4K4EA

Co-crystal structure of tnks1 with compound 52 [n~2-(5-chloro-2-methoxyphenyl)-n-[trans-4-(2-oxo-2,3-dihydro-1h-benzimidazol-1-yl)cyclohexyl]glycinamide]
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
208
Chain Sequence
QGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSAYAEYVIYRGEQAYPEYLITYQIMKPEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of novel, induced-pocket binding oxazolidinones as potent, selective, and orally bioavailable tankyrase inhibitors.
pubmed doi rcsb
molecule keywords Tankyrase-1
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 59
structure length 208
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4k4eA00
4XHUA 4BUVA 4KZLA 4OA7A 3SMIA 4DVIA 3SMJA 5ADTA 4L7UA 4W5IA 4PJTA 4L0VA 4L6SA 4MSKA 4BUYA 4BU8A 3UA9A 4L0SA 4BU7A 5DCZA 4BS4A 4TKIA 4HLFA 2RF5A 4R6EA 4UVPA 3U9HA 4OQBC 4PNRA 4LI6A 3UDDA 2PQFA 3GJWA 4UI6A 4BU9A 4PNMA 4LI7A 4BUFA 3GN7A 5ECEA 4PNNA 4UVTA 2PAXA 4KZUA 5ETYA 4BUTA 4L6ZA 4BUAA 5A00A 5LXPA 4LI8A 4PNTA 4UI7A 4GV4A 4DQYC 4L0TA 4L2KA 4L2GA 4UW1A 5LYHA 4L34A 4HLKA 1UK1A 3W51A 4L7LA 4HMHA 4W5SA 4K4FA 4TJWA 4F1LA 4L31A 4TKGA 3SE2A 5AEHA 5AL5A 4UX4A 4UXBA 4J3MA 3GEYA 4L33A 4M7BA 4BU5A 4L7RA 4ZZXA 4MT9A 4AVUA 4UVLA 4BU6A 5FPFA 4N4VA 4UNDA 3HKVA 3L3MA 4J21A 3P0QA 4PNQA 4BUUA 4L32A 3FHBA 5C5RA 4L70A 3P0PA 4BJCA 4U6AA 4F1QA 4HLMA 4BJBA 4HLGA 4L0IA 3L3LA 4TKFA 4UI4A 4TK5A 4GV7A 3PAXA 4HKNA 4PAXA 1UK0A 4HKIA 4IUEA 4KZQA 4UVNA 4HL5A 5ADRA 4UVOA 4UVUA 4OQAC 4TVJA 4BFPA 3BLJA 5ADQA 5AL4A 4J22A 4N4TA 4UVWA 4BJ9A 5FPGA 4UVSA 4L7PA 4RV6A 4J3LA 4PJVA 4L7NA 4AVWA 4BUDA 4L0BA 1GS0A 4TJYA 4L09A 4PNLA 3KR8A 5AL1A 4TORA 4BUSA 4J1ZA 4BUWA 4X52A 4BUIA 2RCWA 2RD6A 4F0EA 4L7OA 4UI3A 4MSGA 4PNSA 5ADSA 4UHGA 4HHZA 3MHJA 4N3RA 5AKUA 3UH4A 4HKKA 5AL3A 4W6EA 3UH2A 3CE0A 3KJDA 5C5PA 4PY4A 1A26A 2X5YA 4TK0A 1PAXA 3U9YA 2PAWA 4HYFA 4UFUA 4UVYA 4TJUA 3KCZA 4UVZA 4I9IA 3MHKA 1WOKA 4GV0A 4K4EA 3C4HA 4HLHA 4BUEA 3C49A 5AKWA 4BUXA 4UVXA 4GV2A 5C5QA 4PMLA 4HHYA 4UVVA 4ZZZA 4L10A 5AL2A 4UFYA 1EFYA 4UI8A 5EBTA 3P0NA 4TOSA 5LX6A 4BU3A 4OPXC 4ZZYA 3KR7A 4KRSA 4UI5A 3GOYA 4UUHA 4R5WA 4L2FA
chains in the Genus database with same CATH superfamily
1KHFA 4XHUA 4KZLA 4OA7A 3SMIA 4BUVA 3SMJA 4UVNA 4DVIA 5ADTA 1J3BA 4L7UA 1YGGA 4W5IA 4PJTA 4L0VA 4L6SA 4MSKA 4BUYA 3MOHA 4BU8A 3UA9A 4L0SA 4BU7A 5DCZA 4BS4A 4TKIA 2QEYA 2RF5A 4HLFA 4R6EA 4UVPA 3U9HA 4OQBC 1II2A 4PNRA 4LI6A 1YVYA 3UDDA 3DT7A 2PQFA 3GJWA 4UI6A 5FH3A 4BU9A 2RKDA 4LI7A 4PNMA 3GN7A 4BUFA 5ECEA 4PNNA 2QZYA 2PAXA 2PC9A 4UVTA 4KZUA 5ETYA 4GMWA 4GNMA 4L6ZA 4BUAA 5A00A 5FH2A 2PY7X 2RKEA 4BUTA 5LXPA 4LI8A 4PNTA 4R43A 2RK7A 4UI7A 4GV4A 4DQYC 4L0TA 4L2KA 5I67A 4L2GA 4UW1A 4BUUA 5LYHA 2FAFA 2QF1A 4HLKA 4L34A 1UK1A 3W51A 4GMMA 2FAHA 4L7LA 4HMHA 4WOUA 4WPVA 4W5SA 4K4FA 4TJWA 4GNLA 4F1LA 4L31A 4TKGA 3SE2A 2RK8A 5AEHA 5AL5A 4UX4A 4UXBA 4J3MA 3GEYA 4L33A 4M7BA 4YW8A 4L7RA 4ZZXA 4YW9A 4MT9A 4BU5A 4AVUA 1XKVA 4UVLA 4BU6A 5FPFA 1KHEA 4N4VA 4UNDA 3HKVA 3L3MA 4GNOA 3P0QA 4J21A 3DT4A 4L32A 4PNQA 3FHBA 5C5RA 4L70A 3P0PA 4BJCA 2RKAA 4U6AA 4F1QA 1KHBA 4HLMA 4BJBA 4HLGA 4L0IA 3L3LA 4WPUA 4TKFA 4UI4A 4TK5A 4GV7A 3PAXA 4HKNA 3DTBA 1UK0A 4HKIA 1AYLA 4IUEA 4KZQA 4PAXA 4HL5A 4GNQA 4RCGA 1AQ2A 1K3CA 5ADRA 4UVOA 4UVUA 4OQAC 4TVJA 4BFPA 3BLJA 5ADQA 5AL4A 4J22A 4N4TA 4GMZA 1YLHA 4GNPA 4UVWA 5FPGA 4UVSA 4L7PA 4RV6A 4BJ9A 4J3LA 4PJVA 4L7NA 4AVWA 1YTMA 3DT2A 4BUDA 4L0BA 1GS0A 5FH1A 4TJYA 4WIEA 4L09A 4PNLA 3KR8A 5AL1A 1K3DA 2QEWA 4TORA 2ZCIA 4J1ZA 4BUSA 1KHGA 5FH5A 2GMVA 4BUWA 4X52A 4BUIA 2RCWA 2RD6A 4F0EA 4L7OA 1OENA 4MSGA 3MOFA 4PNSA 4UI3A 5FH4A 4UHGA 4HHZA 3MHJA 4N3RA 4OX2A 4WL8A 4HKKA 5AKUA 3UH4A 2OLRA 5AL3A 1M51A 2OLQA 4W6EA 3CE0A 3KJDA 3UH2A 4PY4A 5C5PA 1NHXA 1A26A 2X5YA 4TK0A 1PAXA 3U9YA 2PAWA 4HYFA 4UFUA 4UVYA 4TJUA 3KCZA 4UVZA 4I9IA 3MHKA 1WOKA 4GV0A 4K4EA 3C4HA 4YWDA 4HLHA 4YWBA 4BUEA 3MOEA 3C49A 5AKWA 4BUXA 2PXZX 4UVXA 4GV2A 5C5QA 4PMLA 4HHYA 4UVVA 4WIUA 4L10A 4ZZZA 1OS1A 5AL2A 4UFYA 1EFYA 4UI8A 5FH0A 5EBTA 3P0NA 4TOSA 5LX6A 4BU3A 4OPXC 4ZZYA 3KR7A 4GMUA 4KRSA 4UI5A 2QF2A 3GOYA 4UUHA 4R5WA 4WPTA 4L2FA 5ADSA
chains in the Genus database with same CATH topology
1KHFA 4XHUA 4KZLA 4OA7A 3SMIA 4BUVA 3SMJA 4UVNA 4DVIA 5ADTA 1J3BA 4L7UA 1YGGA 4W5IA 4PJTA 4L0VA 4L6SA 4MSKA 4BUYA 3MOHA 4BU8A 3UA9A 4L0SA 4BU7A 5DCZA 4BS4A 4TKIA 2QEYA 2RF5A 4HLFA 4R6EA 4UVPA 3U9HA 4OQBC 1II2A 4PNRA 4LI6A 1YVYA 3UDDA 3DT7A 2PQFA 3GJWA 4UI6A 5FH3A 4BU9A 2RKDA 4LI7A 4PNMA 3GN7A 4BUFA 5ECEA 4PNNA 2QZYA 2PAXA 2PC9A 4UVTA 4KZUA 5ETYA 4GMWA 4GNMA 4L6ZA 4BUAA 5A00A 5FH2A 2PY7X 2RKEA 4BUTA 5LXPA 4LI8A 4PNTA 4R43A 2RK7A 4UI7A 4GV4A 4DQYC 4L0TA 4L2KA 5I67A 4L2GA 4UW1A 4BUUA 5LYHA 2FAFA 2QF1A 4HLKA 4L34A 1UK1A 3W51A 4GMMA 2FAHA 4L7LA 4HMHA 4WOUA 4WPVA 4W5SA 4K4FA 4TJWA 4GNLA 4F1LA 4L31A 4TKGA 3SE2A 2RK8A 5AEHA 5AL5A 4UX4A 4UXBA 4J3MA 3GEYA 4L33A 4M7BA 4YW8A 4L7RA 4ZZXA 4YW9A 4MT9A 4BU5A 4AVUA 1XKVA 4UVLA 4BU6A 5FPFA 1KHEA 4N4VA 4UNDA 3HKVA 3L3MA 4GNOA 3P0QA 4J21A 3DT4A 4L32A 4PNQA 3FHBA 5C5RA 4L70A 3P0PA 4BJCA 2RKAA 4U6AA 4F1QA 1KHBA 4HLMA 4BJBA 4HLGA 4L0IA 3L3LA 4WPUA 4TKFA 4UI4A 4TK5A 4GV7A 3PAXA 4HKNA 3DTBA 1UK0A 4HKIA 1AYLA 4IUEA 4KZQA 4PAXA 4HL5A 4GNQA 4RCGA 1AQ2A 1K3CA 5ADRA 4UVOA 4UVUA 4OQAC 4TVJA 4BFPA 3BLJA 5ADQA 5AL4A 4J22A 4N4TA 4GMZA 1YLHA 4GNPA 4UVWA 5FPGA 4UVSA 4L7PA 4RV6A 4BJ9A 4J3LA 4PJVA 4L7NA 4AVWA 1YTMA 3DT2A 4BUDA 4L0BA 1GS0A 5FH1A 4TJYA 4WIEA 4L09A 4PNLA 3KR8A 5AL1A 1K3DA 2QEWA 4TORA 2ZCIA 4J1ZA 4BUSA 1KHGA 5FH5A 2GMVA 4BUWA 4X52A 4BUIA 2RCWA 2RD6A 4F0EA 4L7OA 1OENA 4MSGA 3MOFA 4PNSA 4UI3A 5FH4A 4UHGA 4HHZA 3MHJA 4N3RA 4OX2A 4WL8A 4HKKA 5AKUA 3UH4A 2OLRA 5AL3A 1M51A 2OLQA 4W6EA 3CE0A 3KJDA 3UH2A 4PY4A 5C5PA 1NHXA 1A26A 2X5YA 4TK0A 1PAXA 3U9YA 2PAWA 4HYFA 4UFUA 4UVYA 4TJUA 3KCZA 4UVZA 4I9IA 3MHKA 1WOKA 4GV0A 4K4EA 3C4HA 4YWDA 4HLHA 4YWBA 4BUEA 3MOEA 3C49A 5AKWA 4BUXA 2PXZX 4UVXA 4GV2A 5C5QA 4PMLA 4HHYA 4UVVA 4WIUA 4L10A 4ZZZA 1OS1A 5AL2A 4UFYA 1EFYA 4UI8A 5FH0A 5EBTA 3P0NA 4TOSA 5LX6A 4BU3A 4OPXC 4ZZYA 3KR7A 4GMUA 4KRSA 4UI5A 2QF2A 3GOYA 4UUHA 4R5WA 4WPTA 4L2FA 5ADSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XHU A;  4BUV A;  4KZL A;  4OA7 A;  3SMI A;  4DVI A;  3SMJ A;  5ADT A;  4L7U A;  4W5I A;  4PJT A;  4L0V A;  4L6S A;  4MSK A;  4BUY A;  4BU8 A;  3UA9 A;  4L0S A;  4BU7 A;  5DCZ A;  4BS4 A;  4TKI A;  4HLF A;  2RF5 A;  4R6E A;  4UVP A;  3U9H A;  4OQB C;  4PNR A;  4LI6 A;  3UDD A;  2PQF A;  3GJW A;  4UI6 A;  4BU9 A;  4PNM A;  4LI7 A;  4BUF A;  3GN7 A;  5ECE A;  4PNN A;  4UVT A;  2PAX A;  4KZU A;  5ETY A;  4BUT A;  4L6Z A;  4BUA A;  5A00 A;  5LXP A;  4LI8 A;  4PNT A;  4UI7 A;  4GV4 A;  4DQY C;  4L0T A;  4L2K A;  4L2G A;  4UW1 A;  5LYH A;  4L34 A;  4HLK A;  1UK1 A;  3W51 A;  4L7L A;  4HMH A;  4W5S A;  4K4F A;  4TJW A;  4F1L A;  4L31 A;  4TKG A;  3SE2 A;  5AEH A;  5AL5 A;  4UX4 A;  4UXB A;  4J3M A;  3GEY A;  4L33 A;  4M7B A;  4BU5 A;  4L7R A;  4ZZX A;  4MT9 A;  4AVU A;  4UVL A;  4BU6 A;  5FPF A;  4N4V A;  4UND A;  3HKV A;  3L3M A;  4J21 A;  3P0Q A;  4PNQ A;  4BUU A;  4L32 A;  3FHB A;  5C5R A;  4L70 A;  3P0P A;  4BJC A;  4U6A A;  4F1Q A;  4HLM A;  4BJB A;  4HLG A;  4L0I A;  3L3L A;  4TKF A;  4UI4 A;  4TK5 A;  4GV7 A;  3PAX A;  4HKN A;  4PAX A;  1UK0 A;  4HKI A;  4IUE A;  4KZQ A;  4UVN A;  4HL5 A;  5ADR A;  4UVO A;  4UVU A;  4OQA C;  4TVJ A;  4BFP A;  3BLJ A;  5ADQ A;  5AL4 A;  4J22 A;  4N4T A;  4UVW A;  4BJ9 A;  5FPG A;  4UVS A;  4L7P A;  4RV6 A;  4J3L A;  4PJV A;  4L7N A;  4AVW A;  4BUD A;  4L0B A;  1GS0 A;  4TJY A;  4L09 A;  4PNL A;  3KR8 A;  5AL1 A;  4TOR A;  4BUS A;  4J1Z A;  4BUW A;  4X52 A;  4BUI A;  2RCW A;  2RD6 A;  4F0E A;  4L7O A;  4UI3 A;  4MSG A;  4PNS A;  5ADS A;  4UHG A;  4HHZ A;  3MHJ A;  4N3R A;  5AKU A;  3UH4 A;  4HKK A;  5AL3 A;  4W6E A;  3UH2 A;  3CE0 A;  3KJD A;  5C5P A;  4PY4 A;  1A26 A;  2X5Y A;  4TK0 A;  1PAX A;  3U9Y A;  2PAW A;  4HYF A;  4UFU A;  4UVY A;  4TJU A;  3KCZ A;  4UVZ A;  4I9I A;  3MHK A;  1WOK A;  4GV0 A;  4K4E A;  3C4H A;  4HLH A;  4BUE A;  3C49 A;  5AKW A;  4BUX A;  4UVX A;  4GV2 A;  5C5Q A;  4PML A;  4HHY A;  4UVV A;  4ZZZ A;  4L10 A;  5AL2 A;  4UFY A;  1EFY A;  4UI8 A;  5EBT A;  3P0N A;  4TOS A;  5LX6 A;  4BU3 A;  4OPX C;  4ZZY A;  3KR7 A;  4KRS A;  4UI5 A;  3GOY A;  4UUH A;  4R5W A;  4L2F A; 
#chains in the Genus database with same CATH topology
 1KHF A;  4XHU A;  4KZL A;  4OA7 A;  3SMI A;  4BUV A;  3SMJ A;  4UVN A;  4DVI A;  5ADT A;  1J3B A;  4L7U A;  1YGG A;  4W5I A;  4PJT A;  4L0V A;  4L6S A;  4MSK A;  4BUY A;  3MOH A;  4BU8 A;  3UA9 A;  4L0S A;  4BU7 A;  5DCZ A;  4BS4 A;  4TKI A;  2QEY A;  2RF5 A;  4HLF A;  4R6E A;  4UVP A;  3U9H A;  4OQB C;  1II2 A;  4PNR A;  4LI6 A;  1YVY A;  3UDD A;  3DT7 A;  2PQF A;  3GJW A;  4UI6 A;  5FH3 A;  4BU9 A;  2RKD A;  4LI7 A;  4PNM A;  3GN7 A;  4BUF A;  5ECE A;  4PNN A;  2QZY A;  2PAX A;  2PC9 A;  4UVT A;  4KZU A;  5ETY A;  4GMW A;  4GNM A;  4L6Z A;  4BUA A;  5A00 A;  5FH2 A;  2PY7 X;  2RKE A;  4BUT A;  5LXP A;  4LI8 A;  4PNT A;  4R43 A;  2RK7 A;  4UI7 A;  4GV4 A;  4DQY C;  4L0T A;  4L2K A;  5I67 A;  4L2G A;  4UW1 A;  4BUU A;  5LYH A;  2FAF A;  2QF1 A;  4HLK A;  4L34 A;  1UK1 A;  3W51 A;  4GMM A;  2FAH A;  4L7L A;  4HMH A;  4WOU A;  4WPV A;  4W5S A;  4K4F A;  4TJW A;  4GNL A;  4F1L A;  4L31 A;  4TKG A;  3SE2 A;  2RK8 A;  5AEH A;  5AL5 A;  4UX4 A;  4UXB A;  4J3M A;  3GEY A;  4L33 A;  4M7B A;  4YW8 A;  4L7R A;  4ZZX A;  4YW9 A;  4MT9 A;  4BU5 A;  4AVU A;  1XKV A;  4UVL A;  4BU6 A;  5FPF A;  1KHE A;  4N4V A;  4UND A;  3HKV A;  3L3M A;  4GNO A;  3P0Q A;  4J21 A;  3DT4 A;  4L32 A;  4PNQ A;  3FHB A;  5C5R A;  4L70 A;  3P0P A;  4BJC A;  2RKA A;  4U6A A;  4F1Q A;  1KHB A;  4HLM A;  4BJB A;  4HLG A;  4L0I A;  3L3L A;  4WPU A;  4TKF A;  4UI4 A;  4TK5 A;  4GV7 A;  3PAX A;  4HKN A;  3DTB A;  1UK0 A;  4HKI A;  1AYL A;  4IUE A;  4KZQ A;  4PAX A;  4HL5 A;  4GNQ A;  4RCG A;  1AQ2 A;  1K3C A;  5ADR A;  4UVO A;  4UVU A;  4OQA C;  4TVJ A;  4BFP A;  3BLJ A;  5ADQ A;  5AL4 A;  4J22 A;  4N4T A;  4GMZ A;  1YLH A;  4GNP A;  4UVW A;  5FPG A;  4UVS A;  4L7P A;  4RV6 A;  4BJ9 A;  4J3L A;  4PJV A;  4L7N A;  4AVW A;  1YTM A;  3DT2 A;  4BUD A;  4L0B A;  1GS0 A;  5FH1 A;  4TJY A;  4WIE A;  4L09 A;  4PNL A;  3KR8 A;  5AL1 A;  1K3D A;  2QEW A;  4TOR A;  2ZCI A;  4J1Z A;  4BUS A;  1KHG A;  5FH5 A;  2GMV A;  4BUW A;  4X52 A;  4BUI A;  2RCW A;  2RD6 A;  4F0E A;  4L7O A;  1OEN A;  4MSG A;  3MOF A;  4PNS A;  4UI3 A;  5FH4 A;  4UHG A;  4HHZ A;  3MHJ A;  4N3R A;  4OX2 A;  4WL8 A;  4HKK A;  5AKU A;  3UH4 A;  2OLR A;  5AL3 A;  1M51 A;  2OLQ A;  4W6E A;  3CE0 A;  3KJD A;  3UH2 A;  4PY4 A;  5C5P A;  1NHX A;  1A26 A;  2X5Y A;  4TK0 A;  1PAX A;  3U9Y A;  2PAW A;  4HYF A;  4UFU A;  4UVY A;  4TJU A;  3KCZ A;  4UVZ A;  4I9I A;  3MHK A;  1WOK A;  4GV0 A;  4K4E A;  3C4H A;  4YWD A;  4HLH A;  4YWB A;  4BUE A;  3MOE A;  3C49 A;  5AKW A;  4BUX A;  2PXZ X;  4UVX A;  4GV2 A;  5C5Q A;  4PML A;  4HHY A;  4UVV A;  4WIU A;  4L10 A;  4ZZZ A;  1OS1 A;  5AL2 A;  4UFY A;  1EFY A;  4UI8 A;  5FH0 A;  5EBT A;  3P0N A;  4TOS A;  5LX6 A;  4BU3 A;  4OPX C;  4ZZY A;  3KR7 A;  4GMU A;  4KRS A;  4UI5 A;  2QF2 A;  3GOY A;  4UUH A;  4R5W A;  4WPT A;  4L2F A;  5ADS A; 
#chains in the Genus database with same CATH homology
 1KHF A;  4XHU A;  4KZL A;  4OA7 A;  3SMI A;  4BUV A;  3SMJ A;  4UVN A;  4DVI A;  5ADT A;  1J3B A;  4L7U A;  1YGG A;  4W5I A;  4PJT A;  4L0V A;  4L6S A;  4MSK A;  4BUY A;  3MOH A;  4BU8 A;  3UA9 A;  4L0S A;  4BU7 A;  5DCZ A;  4BS4 A;  4TKI A;  2QEY A;  2RF5 A;  4HLF A;  4R6E A;  4UVP A;  3U9H A;  4OQB C;  1II2 A;  4PNR A;  4LI6 A;  1YVY A;  3UDD A;  3DT7 A;  2PQF A;  3GJW A;  4UI6 A;  5FH3 A;  4BU9 A;  2RKD A;  4LI7 A;  4PNM A;  3GN7 A;  4BUF A;  5ECE A;  4PNN A;  2QZY A;  2PAX A;  2PC9 A;  4UVT A;  4KZU A;  5ETY A;  4GMW A;  4GNM A;  4L6Z A;  4BUA A;  5A00 A;  5FH2 A;  2PY7 X;  2RKE A;  4BUT A;  5LXP A;  4LI8 A;  4PNT A;  4R43 A;  2RK7 A;  4UI7 A;  4GV4 A;  4DQY C;  4L0T A;  4L2K A;  5I67 A;  4L2G A;  4UW1 A;  4BUU A;  5LYH A;  2FAF A;  2QF1 A;  4HLK A;  4L34 A;  1UK1 A;  3W51 A;  4GMM A;  2FAH A;  4L7L A;  4HMH A;  4WOU A;  4WPV A;  4W5S A;  4K4F A;  4TJW A;  4GNL A;  4F1L A;  4L31 A;  4TKG A;  3SE2 A;  2RK8 A;  5AEH A;  5AL5 A;  4UX4 A;  4UXB A;  4J3M A;  3GEY A;  4L33 A;  4M7B A;  4YW8 A;  4L7R A;  4ZZX A;  4YW9 A;  4MT9 A;  4BU5 A;  4AVU A;  1XKV A;  4UVL A;  4BU6 A;  5FPF A;  1KHE A;  4N4V A;  4UND A;  3HKV A;  3L3M A;  4GNO A;  3P0Q A;  4J21 A;  3DT4 A;  4L32 A;  4PNQ A;  3FHB A;  5C5R A;  4L70 A;  3P0P A;  4BJC A;  2RKA A;  4U6A A;  4F1Q A;  1KHB A;  4HLM A;  4BJB A;  4HLG A;  4L0I A;  3L3L A;  4WPU A;  4TKF A;  4UI4 A;  4TK5 A;  4GV7 A;  3PAX A;  4HKN A;  3DTB A;  1UK0 A;  4HKI A;  1AYL A;  4IUE A;  4KZQ A;  4PAX A;  4HL5 A;  4GNQ A;  4RCG A;  1AQ2 A;  1K3C A;  5ADR A;  4UVO A;  4UVU A;  4OQA C;  4TVJ A;  4BFP A;  3BLJ A;  5ADQ A;  5AL4 A;  4J22 A;  4N4T A;  4GMZ A;  1YLH A;  4GNP A;  4UVW A;  5FPG A;  4UVS A;  4L7P A;  4RV6 A;  4BJ9 A;  4J3L A;  4PJV A;  4L7N A;  4AVW A;  1YTM A;  3DT2 A;  4BUD A;  4L0B A;  1GS0 A;  5FH1 A;  4TJY A;  4WIE A;  4L09 A;  4PNL A;  3KR8 A;  5AL1 A;  1K3D A;  2QEW A;  4TOR A;  2ZCI A;  4J1Z A;  4BUS A;  1KHG A;  5FH5 A;  2GMV A;  4BUW A;  4X52 A;  4BUI A;  2RCW A;  2RD6 A;  4F0E A;  4L7O A;  1OEN A;  4MSG A;  3MOF A;  4PNS A;  4UI3 A;  5FH4 A;  4UHG A;  4HHZ A;  3MHJ A;  4N3R A;  4OX2 A;  4WL8 A;  4HKK A;  5AKU A;  3UH4 A;  2OLR A;  5AL3 A;  1M51 A;  2OLQ A;  4W6E A;  3CE0 A;  3KJD A;  3UH2 A;  4PY4 A;  5C5P A;  1NHX A;  1A26 A;  2X5Y A;  4TK0 A;  1PAX A;  3U9Y A;  2PAW A;  4HYF A;  4UFU A;  4UVY A;  4TJU A;  3KCZ A;  4UVZ A;  4I9I A;  3MHK A;  1WOK A;  4GV0 A;  4K4E A;  3C4H A;  4YWD A;  4HLH A;  4YWB A;  4BUE A;  3MOE A;  3C49 A;  5AKW A;  4BUX A;  2PXZ X;  4UVX A;  4GV2 A;  5C5Q A;  4PML A;  4HHY A;  4UVV A;  4WIU A;  4L10 A;  4ZZZ A;  1OS1 A;  5AL2 A;  4UFY A;  1EFY A;  4UI8 A;  5FH0 A;  5EBT A;  3P0N A;  4TOS A;  5LX6 A;  4BU3 A;  4OPX C;  4ZZY A;  3KR7 A;  4GMU A;  4KRS A;  4UI5 A;  2QF2 A;  3GOY A;  4UUH A;  4R5W A;  4WPT A;  4L2F A;  5ADS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...