4K4FA

Co-crystal structure of tnks1 with compound 18 [4-[(4s)-5,5-dimethyl-2-oxo-4-phenyl-1,3-oxazolidin-3-yl]-n-(quinolin-8-yl)benzamide]
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
210
Chain Sequence
QGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVLAYAEYVIYRGEQAYPEYLITYQIMKPEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of novel, induced-pocket binding oxazolidinones as potent, selective, and orally bioavailable tankyrase inhibitors.
pubmed doi rcsb
molecule keywords Tankyrase-1
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 59
structure length 210
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4k4fA00
4IUEA 4RV6A 4W5IA 4J1ZA 4LI6A 5AEHA 5ADQA 3C49A 4L70A 4GV4A 4TK5A 4UI5A 4UVOA 4L0BA 4X52A 3HKVA 5EBTA 3U9HA 3GEYA 4UFYA 4BUDA 4L0VA 4M7BA 4GV0A 4TVJA 4L0IA 4UVUA 4ZZYA 3U9YA 4PAXA 4HKIA 5ADSA 4BUEA 4BJ9A 4UVYA 4N4TA 4HMHA 5AKWA 2PQFA 4PNTA 4PY4A 4UXBA 4AVWA 5ADRA 4L7LA 5FPFA 3C4HA 4UI8A 4HYFA 4UVNA 4K4FA 1UK1A 4UFUA 4PNNA 4HLMA 5AL3A 4BS4A 2X5YA 4KZQA 4L7OA 4PNLA 4PJVA 4F1QA 4L7RA 3W51A 4UI7A 4ZZZA 4U6AA 4R6EA 4UI6A 3P0QA 5AKUA 5AL1A 4J21A 4DQYC 3GJWA 4N3RA 5ECEA 3UA9A 5C5QA 4F1LA 4UVZA 5AL2A 4BUUA 3SE2A 3GN7A 4L09A 4BU8A 4L0SA 3KR8A 3FHBA 3MHJA 4UI3A 4TJWA 4BU5A 4BUFA 4L10A 4HLGA 4BUSA 1EFYA 4KRSA 4TOSA 4MSKA 2RF5A 4BUYA 4BJCA 4HLFA 5A00A 5DCZA 4HKKA 1PAXA 4KZUA 1WOKA 4BUVA 3KR7A 4BUIA 4W5SA 1GS0A 4UVSA 3CE0A 4L2FA 4UVXA 4HHYA 4HL5A 3GOYA 4BUWA 5C5PA 4PJTA 2PAWA 4J3LA 4KZLA 4OQAC 4PNQA 4L6ZA 3UH2A 4AVUA 3L3MA 4OA7A 4L34A 3L3LA 4L2GA 2RD6A 3MHKA 4L2KA 3UDDA 4UHGA 1UK0A 5ETYA 3KJDA 4F0EA 4UVPA 4BU9A 4BFPA 4BU6A 4J3MA 4PNRA 5AL4A 4LI8A 3BLJA 4TJUA 4BU7A 5ADTA 3P0PA 5LX6A 4HLHA 1A26A 4L7UA 4LI7A 4UX4A 4N4VA 4XHUA 3SMJA 4K4EA 4BUAA 4L32A 4UI4A 4TKGA 4PNSA 5AL5A 4I9IA 5FPGA 4OQBC 4L31A 4GV7A 4TJYA 4UW1A 4DVIA 4L0TA 4UNDA 4UVVA 4UUHA 4L7NA 4BUTA 5LXPA 4HKNA 4R5WA 4GV2A 4J22A 4BJBA 4UVLA 4MSGA 4TKIA 2RCWA 4L7PA 4TORA 4TK0A 4BUXA 4UVWA 4HHZA 4L33A 5LYHA 3PAXA 4W6EA 4OPXC 4ZZXA 4HLKA 4BU3A 4PMLA 3KCZA 3SMIA 2PAXA 4MT9A 4PNMA 5C5RA 4TKFA 3UH4A 3P0NA 4L6SA 4UVTA
chains in the Genus database with same CATH superfamily
4IUEA 4RV6A 4W5IA 3MOFA 4J1ZA 4LI6A 5FH4A 5AEHA 5ADQA 3C49A 1NHXA 4L70A 1YTMA 4GV4A 4TK5A 4UI5A 4UVOA 4L0BA 4X52A 4RCGA 3HKVA 5EBTA 3U9HA 3GEYA 4UFYA 4BUDA 4L0VA 4M7BA 4GV0A 2PC9A 4L0IA 4TVJA 4UVUA 3U9YA 4ZZYA 2FAFA 4PAXA 4HKIA 4YW8A 1K3DA 5ADSA 4BUEA 1AQ2A 4BJ9A 4UVYA 4N4TA 4HMHA 5FH2A 5AKWA 2PQFA 4PNTA 4WPVA 4PY4A 4UXBA 1K3CA 4AVWA 5ADRA 4L7LA 5FPFA 3C4HA 4UI8A 1KHEA 4HYFA 4UVNA 4K4FA 1UK1A 4UFUA 4PNNA 4HLMA 5AL3A 4BS4A 2X5YA 4KZQA 4L7OA 4PNLA 4PJVA 4F1QA 4L7RA 4GNQA 4UI7A 3MOEA 3W51A 4ZZZA 4U6AA 2RK8A 4R6EA 3P0QA 4UI6A 5AKUA 4J21A 5AL1A 3DT7A 3GJWA 4N3RA 5ECEA 5C5QA 3UA9A 2PY7X 2RKAA 4UVZA 5AL2A 4F1LA 4BUUA 3SE2A 2GMVA 3GN7A 4L09A 4BU8A 1YGGA 1AYLA 4L0SA 1KHFA 3KR8A 3FHBA 3MHJA 4UI3A 4TJWA 4BU5A 4BUFA 4L10A 4HLGA 4BUSA 5FH3A 1EFYA 4KRSA 2ZCIA 4GNOA 2OLQA 4MSKA 2RF5A 4TOSA 4BJCA 4HLFA 4BUYA 5A00A 3DTBA 5DCZA 4HKKA 1PAXA 4KZUA 1WOKA 2QEYA 4BUVA 4WIEA 3KR7A 4BUIA 2RKEA 4W5SA 1GS0A 4UVSA 5FH0A 3CE0A 3DT2A 4L2FA 4UVXA 4HHYA 4HL5A 1YLHA 3GOYA 2RKDA 4WL8A 4BUWA 1OS1A 4GNPA 5C5PA 4PJTA 2PAWA 4J3LA 4KZLA 4OQAC 4PNQA 4WPUA 4L6ZA 3UH2A 4AVUA 1II2A 1KHBA 4DQYC 3L3MA 4OA7A 4GNLA 4L34A 3L3LA 4L2GA 5I67A 2RD6A 3MHKA 4WIUA 4L2KA 3UDDA 4UHGA 1UK0A 1YVYA 5ETYA 2QZYA 3KJDA 4F0EA 4UVPA 4BU9A 4BFPA 4BU6A 4J3MA 4PNRA 5AL4A 4LI8A 3BLJA 4TJUA 4BU7A 5ADTA 3P0PA 5LX6A 4HLHA 1OENA 1A26A 4GNMA 4L7UA 4LI7A 4UX4A 4N4VA 2FAHA 4XHUA 4K4EA 3MOHA 3SMJA 3DT4A 4BUAA 4L32A 4UI4A 4GMMA 4TKGA 4PNSA 5AL5A 5FH5A 4I9IA 5FPGA 4OQBC 4GV7A 4L31A 4TJYA 4UW1A 4DVIA 4YW9A 4L0TA 4YWDA 1M51A 4UNDA 4UVVA 4UUHA 4L7NA 4UVLA 4BUTA 5LXPA 2QF1A 4HKNA 4R5WA 1KHGA 5FH1A 4GV2A 4J22A 4GMZA 4WPTA 2QF2A 4BJBA 4R43A 4MSGA 4OX2A 1J3BA 2RCWA 4L7PA 4TKIA 4TORA 4GMUA 4HHZA 4L33A 4UVWA 4BUXA 4TK0A 5LYHA 3PAXA 4W6EA 4OPXC 4ZZXA 2OLRA 1XKVA 4HLKA 4BU3A 4PMLA 3KCZA 3SMIA 4WOUA 2RK7A 2PXZX 2PAXA 4MT9A 4PNMA 5C5RA 4TKFA 3UH4A 3P0NA 4YWBA 4L6SA 4GMWA 4UVTA 2QEWA
chains in the Genus database with same CATH topology
4IUEA 4RV6A 4W5IA 3MOFA 4J1ZA 4LI6A 5FH4A 5AEHA 5ADQA 3C49A 1NHXA 4L70A 1YTMA 4GV4A 4TK5A 4UI5A 4UVOA 4L0BA 4X52A 4RCGA 3HKVA 5EBTA 3U9HA 3GEYA 4UFYA 4BUDA 4L0VA 4M7BA 4GV0A 2PC9A 4L0IA 4TVJA 4UVUA 3U9YA 4ZZYA 2FAFA 4PAXA 4HKIA 4YW8A 1K3DA 5ADSA 4BUEA 1AQ2A 4BJ9A 4UVYA 4N4TA 4HMHA 5FH2A 5AKWA 2PQFA 4PNTA 4WPVA 4PY4A 4UXBA 1K3CA 4AVWA 5ADRA 4L7LA 5FPFA 3C4HA 4UI8A 1KHEA 4HYFA 4UVNA 4K4FA 1UK1A 4UFUA 4PNNA 4HLMA 5AL3A 4BS4A 2X5YA 4KZQA 4L7OA 4PNLA 4PJVA 4F1QA 4L7RA 4GNQA 4UI7A 3MOEA 3W51A 4ZZZA 4U6AA 2RK8A 4R6EA 3P0QA 4UI6A 5AKUA 4J21A 5AL1A 3DT7A 3GJWA 4N3RA 5ECEA 5C5QA 3UA9A 2PY7X 2RKAA 4UVZA 5AL2A 4F1LA 4BUUA 3SE2A 2GMVA 3GN7A 4L09A 4BU8A 1YGGA 1AYLA 4L0SA 1KHFA 3KR8A 3FHBA 3MHJA 4UI3A 4TJWA 4BU5A 4BUFA 4L10A 4HLGA 4BUSA 5FH3A 1EFYA 4KRSA 2ZCIA 4GNOA 2OLQA 4MSKA 2RF5A 4TOSA 4BJCA 4HLFA 4BUYA 5A00A 3DTBA 5DCZA 4HKKA 1PAXA 4KZUA 1WOKA 2QEYA 4BUVA 4WIEA 3KR7A 4BUIA 2RKEA 4W5SA 1GS0A 4UVSA 5FH0A 3CE0A 3DT2A 4L2FA 4UVXA 4HHYA 4HL5A 1YLHA 3GOYA 2RKDA 4WL8A 4BUWA 1OS1A 4GNPA 5C5PA 4PJTA 2PAWA 4J3LA 4KZLA 4OQAC 4PNQA 4WPUA 4L6ZA 3UH2A 4AVUA 1II2A 1KHBA 4DQYC 3L3MA 4OA7A 4GNLA 4L34A 3L3LA 4L2GA 5I67A 2RD6A 3MHKA 4WIUA 4L2KA 3UDDA 4UHGA 1UK0A 1YVYA 5ETYA 2QZYA 3KJDA 4F0EA 4UVPA 4BU9A 4BFPA 4BU6A 4J3MA 4PNRA 5AL4A 4LI8A 3BLJA 4TJUA 4BU7A 5ADTA 3P0PA 5LX6A 4HLHA 1OENA 1A26A 4GNMA 4L7UA 4LI7A 4UX4A 4N4VA 2FAHA 4XHUA 4K4EA 3MOHA 3SMJA 3DT4A 4BUAA 4L32A 4UI4A 4GMMA 4TKGA 4PNSA 5AL5A 5FH5A 4I9IA 5FPGA 4OQBC 4GV7A 4L31A 4TJYA 4UW1A 4DVIA 4YW9A 4L0TA 4YWDA 1M51A 4UNDA 4UVVA 4UUHA 4L7NA 4UVLA 4BUTA 5LXPA 2QF1A 4HKNA 4R5WA 1KHGA 5FH1A 4GV2A 4J22A 4GMZA 4WPTA 2QF2A 4BJBA 4R43A 4MSGA 4OX2A 1J3BA 2RCWA 4L7PA 4TKIA 4TORA 4GMUA 4HHZA 4L33A 4UVWA 4BUXA 4TK0A 5LYHA 3PAXA 4W6EA 4OPXC 4ZZXA 2OLRA 1XKVA 4HLKA 4BU3A 4PMLA 3KCZA 3SMIA 4WOUA 2RK7A 2PXZX 2PAXA 4MT9A 4PNMA 5C5RA 4TKFA 3UH4A 3P0NA 4YWBA 4L6SA 4GMWA 4UVTA 2QEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUE A;  4RV6 A;  4W5I A;  4J1Z A;  4LI6 A;  5AEH A;  5ADQ A;  3C49 A;  4L70 A;  4GV4 A;  4TK5 A;  4UI5 A;  4UVO A;  4L0B A;  4X52 A;  3HKV A;  5EBT A;  3U9H A;  3GEY A;  4UFY A;  4BUD A;  4L0V A;  4M7B A;  4GV0 A;  4TVJ A;  4L0I A;  4UVU A;  4ZZY A;  3U9Y A;  4PAX A;  4HKI A;  5ADS A;  4BUE A;  4BJ9 A;  4UVY A;  4N4T A;  4HMH A;  5AKW A;  2PQF A;  4PNT A;  4PY4 A;  4UXB A;  4AVW A;  5ADR A;  4L7L A;  5FPF A;  3C4H A;  4UI8 A;  4HYF A;  4UVN A;  4K4F A;  1UK1 A;  4UFU A;  4PNN A;  4HLM A;  5AL3 A;  4BS4 A;  2X5Y A;  4KZQ A;  4L7O A;  4PNL A;  4PJV A;  4F1Q A;  4L7R A;  3W51 A;  4UI7 A;  4ZZZ A;  4U6A A;  4R6E A;  4UI6 A;  3P0Q A;  5AKU A;  5AL1 A;  4J21 A;  4DQY C;  3GJW A;  4N3R A;  5ECE A;  3UA9 A;  5C5Q A;  4F1L A;  4UVZ A;  5AL2 A;  4BUU A;  3SE2 A;  3GN7 A;  4L09 A;  4BU8 A;  4L0S A;  3KR8 A;  3FHB A;  3MHJ A;  4UI3 A;  4TJW A;  4BU5 A;  4BUF A;  4L10 A;  4HLG A;  4BUS A;  1EFY A;  4KRS A;  4TOS A;  4MSK A;  2RF5 A;  4BUY A;  4BJC A;  4HLF A;  5A00 A;  5DCZ A;  4HKK A;  1PAX A;  4KZU A;  1WOK A;  4BUV A;  3KR7 A;  4BUI A;  4W5S A;  1GS0 A;  4UVS A;  3CE0 A;  4L2F A;  4UVX A;  4HHY A;  4HL5 A;  3GOY A;  4BUW A;  5C5P A;  4PJT A;  2PAW A;  4J3L A;  4KZL A;  4OQA C;  4PNQ A;  4L6Z A;  3UH2 A;  4AVU A;  3L3M A;  4OA7 A;  4L34 A;  3L3L A;  4L2G A;  2RD6 A;  3MHK A;  4L2K A;  3UDD A;  4UHG A;  1UK0 A;  5ETY A;  3KJD A;  4F0E A;  4UVP A;  4BU9 A;  4BFP A;  4BU6 A;  4J3M A;  4PNR A;  5AL4 A;  4LI8 A;  3BLJ A;  4TJU A;  4BU7 A;  5ADT A;  3P0P A;  5LX6 A;  4HLH A;  1A26 A;  4L7U A;  4LI7 A;  4UX4 A;  4N4V A;  4XHU A;  3SMJ A;  4K4E A;  4BUA A;  4L32 A;  4UI4 A;  4TKG A;  4PNS A;  5AL5 A;  4I9I A;  5FPG A;  4OQB C;  4L31 A;  4GV7 A;  4TJY A;  4UW1 A;  4DVI A;  4L0T A;  4UND A;  4UVV A;  4UUH A;  4L7N A;  4BUT A;  5LXP A;  4HKN A;  4R5W A;  4GV2 A;  4J22 A;  4BJB A;  4UVL A;  4MSG A;  4TKI A;  2RCW A;  4L7P A;  4TOR A;  4TK0 A;  4BUX A;  4UVW A;  4HHZ A;  4L33 A;  5LYH A;  3PAX A;  4W6E A;  4OPX C;  4ZZX A;  4HLK A;  4BU3 A;  4PML A;  3KCZ A;  3SMI A;  2PAX A;  4MT9 A;  4PNM A;  5C5R A;  4TKF A;  3UH4 A;  3P0N A;  4L6S A;  4UVT A; 
#chains in the Genus database with same CATH topology
 4IUE A;  4RV6 A;  4W5I A;  3MOF A;  4J1Z A;  4LI6 A;  5FH4 A;  5AEH A;  5ADQ A;  3C49 A;  1NHX A;  4L70 A;  1YTM A;  4GV4 A;  4TK5 A;  4UI5 A;  4UVO A;  4L0B A;  4X52 A;  4RCG A;  3HKV A;  5EBT A;  3U9H A;  3GEY A;  4UFY A;  4BUD A;  4L0V A;  4M7B A;  4GV0 A;  2PC9 A;  4L0I A;  4TVJ A;  4UVU A;  3U9Y A;  4ZZY A;  2FAF A;  4PAX A;  4HKI A;  4YW8 A;  1K3D A;  5ADS A;  4BUE A;  1AQ2 A;  4BJ9 A;  4UVY A;  4N4T A;  4HMH A;  5FH2 A;  5AKW A;  2PQF A;  4PNT A;  4WPV A;  4PY4 A;  4UXB A;  1K3C A;  4AVW A;  5ADR A;  4L7L A;  5FPF A;  3C4H A;  4UI8 A;  1KHE A;  4HYF A;  4UVN A;  4K4F A;  1UK1 A;  4UFU A;  4PNN A;  4HLM A;  5AL3 A;  4BS4 A;  2X5Y A;  4KZQ A;  4L7O A;  4PNL A;  4PJV A;  4F1Q A;  4L7R A;  4GNQ A;  4UI7 A;  3MOE A;  3W51 A;  4ZZZ A;  4U6A A;  2RK8 A;  4R6E A;  3P0Q A;  4UI6 A;  5AKU A;  4J21 A;  5AL1 A;  3DT7 A;  3GJW A;  4N3R A;  5ECE A;  5C5Q A;  3UA9 A;  2PY7 X;  2RKA A;  4UVZ A;  5AL2 A;  4F1L A;  4BUU A;  3SE2 A;  2GMV A;  3GN7 A;  4L09 A;  4BU8 A;  1YGG A;  1AYL A;  4L0S A;  1KHF A;  3KR8 A;  3FHB A;  3MHJ A;  4UI3 A;  4TJW A;  4BU5 A;  4BUF A;  4L10 A;  4HLG A;  4BUS A;  5FH3 A;  1EFY A;  4KRS A;  2ZCI A;  4GNO A;  2OLQ A;  4MSK A;  2RF5 A;  4TOS A;  4BJC A;  4HLF A;  4BUY A;  5A00 A;  3DTB A;  5DCZ A;  4HKK A;  1PAX A;  4KZU A;  1WOK A;  2QEY A;  4BUV A;  4WIE A;  3KR7 A;  4BUI A;  2RKE A;  4W5S A;  1GS0 A;  4UVS A;  5FH0 A;  3CE0 A;  3DT2 A;  4L2F A;  4UVX A;  4HHY A;  4HL5 A;  1YLH A;  3GOY A;  2RKD A;  4WL8 A;  4BUW A;  1OS1 A;  4GNP A;  5C5P A;  4PJT A;  2PAW A;  4J3L A;  4KZL A;  4OQA C;  4PNQ A;  4WPU A;  4L6Z A;  3UH2 A;  4AVU A;  1II2 A;  1KHB A;  4DQY C;  3L3M A;  4OA7 A;  4GNL A;  4L34 A;  3L3L A;  4L2G A;  5I67 A;  2RD6 A;  3MHK A;  4WIU A;  4L2K A;  3UDD A;  4UHG A;  1UK0 A;  1YVY A;  5ETY A;  2QZY A;  3KJD A;  4F0E A;  4UVP A;  4BU9 A;  4BFP A;  4BU6 A;  4J3M A;  4PNR A;  5AL4 A;  4LI8 A;  3BLJ A;  4TJU A;  4BU7 A;  5ADT A;  3P0P A;  5LX6 A;  4HLH A;  1OEN A;  1A26 A;  4GNM A;  4L7U A;  4LI7 A;  4UX4 A;  4N4V A;  2FAH A;  4XHU A;  4K4E A;  3MOH A;  3SMJ A;  3DT4 A;  4BUA A;  4L32 A;  4UI4 A;  4GMM A;  4TKG A;  4PNS A;  5AL5 A;  5FH5 A;  4I9I A;  5FPG A;  4OQB C;  4GV7 A;  4L31 A;  4TJY A;  4UW1 A;  4DVI A;  4YW9 A;  4L0T A;  4YWD A;  1M51 A;  4UND A;  4UVV A;  4UUH A;  4L7N A;  4UVL A;  4BUT A;  5LXP A;  2QF1 A;  4HKN A;  4R5W A;  1KHG A;  5FH1 A;  4GV2 A;  4J22 A;  4GMZ A;  4WPT A;  2QF2 A;  4BJB A;  4R43 A;  4MSG A;  4OX2 A;  1J3B A;  2RCW A;  4L7P A;  4TKI A;  4TOR A;  4GMU A;  4HHZ A;  4L33 A;  4UVW A;  4BUX A;  4TK0 A;  5LYH A;  3PAX A;  4W6E A;  4OPX C;  4ZZX A;  2OLR A;  1XKV A;  4HLK A;  4BU3 A;  4PML A;  3KCZ A;  3SMI A;  4WOU A;  2RK7 A;  2PXZ X;  2PAX A;  4MT9 A;  4PNM A;  5C5R A;  4TKF A;  3UH4 A;  3P0N A;  4YWB A;  4L6S A;  4GMW A;  4UVT A;  2QEW A; 
#chains in the Genus database with same CATH homology
 4IUE A;  4RV6 A;  4W5I A;  3MOF A;  4J1Z A;  4LI6 A;  5FH4 A;  5AEH A;  5ADQ A;  3C49 A;  1NHX A;  4L70 A;  1YTM A;  4GV4 A;  4TK5 A;  4UI5 A;  4UVO A;  4L0B A;  4X52 A;  4RCG A;  3HKV A;  5EBT A;  3U9H A;  3GEY A;  4UFY A;  4BUD A;  4L0V A;  4M7B A;  4GV0 A;  2PC9 A;  4L0I A;  4TVJ A;  4UVU A;  3U9Y A;  4ZZY A;  2FAF A;  4PAX A;  4HKI A;  4YW8 A;  1K3D A;  5ADS A;  4BUE A;  1AQ2 A;  4BJ9 A;  4UVY A;  4N4T A;  4HMH A;  5FH2 A;  5AKW A;  2PQF A;  4PNT A;  4WPV A;  4PY4 A;  4UXB A;  1K3C A;  4AVW A;  5ADR A;  4L7L A;  5FPF A;  3C4H A;  4UI8 A;  1KHE A;  4HYF A;  4UVN A;  4K4F A;  1UK1 A;  4UFU A;  4PNN A;  4HLM A;  5AL3 A;  4BS4 A;  2X5Y A;  4KZQ A;  4L7O A;  4PNL A;  4PJV A;  4F1Q A;  4L7R A;  4GNQ A;  4UI7 A;  3MOE A;  3W51 A;  4ZZZ A;  4U6A A;  2RK8 A;  4R6E A;  3P0Q A;  4UI6 A;  5AKU A;  4J21 A;  5AL1 A;  3DT7 A;  3GJW A;  4N3R A;  5ECE A;  5C5Q A;  3UA9 A;  2PY7 X;  2RKA A;  4UVZ A;  5AL2 A;  4F1L A;  4BUU A;  3SE2 A;  2GMV A;  3GN7 A;  4L09 A;  4BU8 A;  1YGG A;  1AYL A;  4L0S A;  1KHF A;  3KR8 A;  3FHB A;  3MHJ A;  4UI3 A;  4TJW A;  4BU5 A;  4BUF A;  4L10 A;  4HLG A;  4BUS A;  5FH3 A;  1EFY A;  4KRS A;  2ZCI A;  4GNO A;  2OLQ A;  4MSK A;  2RF5 A;  4TOS A;  4BJC A;  4HLF A;  4BUY A;  5A00 A;  3DTB A;  5DCZ A;  4HKK A;  1PAX A;  4KZU A;  1WOK A;  2QEY A;  4BUV A;  4WIE A;  3KR7 A;  4BUI A;  2RKE A;  4W5S A;  1GS0 A;  4UVS A;  5FH0 A;  3CE0 A;  3DT2 A;  4L2F A;  4UVX A;  4HHY A;  4HL5 A;  1YLH A;  3GOY A;  2RKD A;  4WL8 A;  4BUW A;  1OS1 A;  4GNP A;  5C5P A;  4PJT A;  2PAW A;  4J3L A;  4KZL A;  4OQA C;  4PNQ A;  4WPU A;  4L6Z A;  3UH2 A;  4AVU A;  1II2 A;  1KHB A;  4DQY C;  3L3M A;  4OA7 A;  4GNL A;  4L34 A;  3L3L A;  4L2G A;  5I67 A;  2RD6 A;  3MHK A;  4WIU A;  4L2K A;  3UDD A;  4UHG A;  1UK0 A;  1YVY A;  5ETY A;  2QZY A;  3KJD A;  4F0E A;  4UVP A;  4BU9 A;  4BFP A;  4BU6 A;  4J3M A;  4PNR A;  5AL4 A;  4LI8 A;  3BLJ A;  4TJU A;  4BU7 A;  5ADT A;  3P0P A;  5LX6 A;  4HLH A;  1OEN A;  1A26 A;  4GNM A;  4L7U A;  4LI7 A;  4UX4 A;  4N4V A;  2FAH A;  4XHU A;  4K4E A;  3MOH A;  3SMJ A;  3DT4 A;  4BUA A;  4L32 A;  4UI4 A;  4GMM A;  4TKG A;  4PNS A;  5AL5 A;  5FH5 A;  4I9I A;  5FPG A;  4OQB C;  4GV7 A;  4L31 A;  4TJY A;  4UW1 A;  4DVI A;  4YW9 A;  4L0T A;  4YWD A;  1M51 A;  4UND A;  4UVV A;  4UUH A;  4L7N A;  4UVL A;  4BUT A;  5LXP A;  2QF1 A;  4HKN A;  4R5W A;  1KHG A;  5FH1 A;  4GV2 A;  4J22 A;  4GMZ A;  4WPT A;  2QF2 A;  4BJB A;  4R43 A;  4MSG A;  4OX2 A;  1J3B A;  2RCW A;  4L7P A;  4TKI A;  4TOR A;  4GMU A;  4HHZ A;  4L33 A;  4UVW A;  4BUX A;  4TK0 A;  5LYH A;  3PAX A;  4W6E A;  4OPX C;  4ZZX A;  2OLR A;  1XKV A;  4HLK A;  4BU3 A;  4PML A;  3KCZ A;  3SMI A;  4WOU A;  2RK7 A;  2PXZ X;  2PAX A;  4MT9 A;  4PNM A;  5C5R A;  4TKF A;  3UH4 A;  3P0N A;  4YWB A;  4L6S A;  4GMW A;  4UVT A;  2QEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...