4K4TA

Poliovirus polymerase elongation complex (r4_form)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
462
structure length
462
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of coxsackievirus, rhinovirus, and poliovirus polymerase elongation complexes solved by engineering RNA mediated crystal contacts.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 141
structure length 462
sequence length 462
chains with identical sequence E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4k4tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k4tA02
3PW5A 4KAIA 1HYSB 2HWHA 3D28A 5D3GA 2FLNA 3GV5B 3EPIA 3ITHB 4ED1A 4NLOA 1R0AB 4KE5A 2D7SA 4DG1A 3H5XA 2BQUA 3HVTB 1TL1A 4IFVB 4IFYA 4O3PA 3V81B 3V6DA 1T05A 4ICLB 3MF5A 5KFEA 5J2MA 1UWBA 2UUTA 3FQKA 5CYMA 3KK3A 2J6TA 1MU2B 4F50A 4IDKA 1GX6A 5EWFA 1JLEB 4NLTA 3MFIA 4Q0BA 4B3OA 3C6UB 2IM0A 4PQUA 3DLKB 1S97A 4NCGB 4ZPBA 3MR2A 2IJFA 2ILZA 3E51A 3HVTA 4ZP6A 1KLMB 1RT2B 2RF2A 3BR9A 3I0SA 3MEEB 4WZMA 3DLEB 1RA7A 4I2PB 5DG7A 2AX0A 3H2LA 5KFTA 3FFIB 1C1BB 1FKOA 5I3UB 5C24A 3E01A 3DDKA 1HQEB 1RT7A 4KFBB 4QWBA 5DQHA 2FLPA 3CVKA 5DG8A 3GIKA 4I2QA 2J6SA 1RT5A 3Q8QB 4RW7A 3IGVA 3M9OB 4NLYA 3M8PA 4NCGA 3LP0B 2OPQA 2R8JA 3MFHA 1XR7A 1JLGB 4URSA 2DPJA 4ZVEA 4H54A 3KOAA 2BANB 3GIMA 1XR5A 3TVKA 3ISND 3EPGA 2YKNA 3DRRB 4XO0A 4WE1B 5JXSA 1SH3A 4WFZA 5KG0A 4RUCA 1HYSA 4G1QB 5DGBA 4ED0A 1S6QB 4LQ9A 5KFHA 1YVFA 5KG2A 1LWFB 4RU9A 2YNIA 4RNMA 1N5YB 2FVSA 5J1EA 4X2BA 5HBMA 5F9LA 5KT6A 3BQ1A 1TKXA 3GQCA 5J2MB 4URGA 3NAIA 3BREA 3DRPB 1LWCA 1S4FA 1TL3A 4QW8A 4K4ZA 4U6PA 3KK1A 2VG6B 2W9CB 4IH5A 4J9MA 1C0UA 2YKNB 3M8QA 5KFVA 3CIZA 1S1XB 4RW6B 1VRTB 4G1QA 2CJQA 1S9EA 4H4MB 4YP3A 1T03A 1HNVB 1JKHA 5KT4A 3PJXA 4DL7A 3KMSA 1EETA 1HPZB 5T14A 3Q8PB 5HLFB 3T19A 2VG7A 3LP1B 1RT2A 2C2RA 3KNAA 2ZD1A 4ECQA 5KFFA 2HMIA 4QW9A 4LSLB 3I5CA 5KG4A 2XGQA 2V9WA 3QGGA 3DLGA 3ICLA 5C24B 2OPSB 1S1UB 2VA3A 1MMLA 2ZKUA 2OPPB 4YR2A 3KK2A 2RDIA 3GILA 3KHRA 1ZTWA 1HNIB 1RTIB 3FRZA 4IG3B 1EETB 3OL8A 1HPZA 4ICLA 4RNHA 4KHMA 5C25A 5CYQB 2D3UA 4HYKA 1J5OA 3V6KA 3PW7A 4IR1A 4FBUA 4F4XA 5J2QB 5F9NA 2HNZB 1RTHA 2BRKA 1JLBA 5KFRA 4EYHB 1FK9A 5KFGA 1XR6A 4QWCA 2XI3A 4WE1A 4DL4A 3RAQA 4KBIA 5KFNA 2FVQA 5KFDA 4RW8B 2WRMA 1JLAA 1HMVA 4JV2A 4I2PA 3BGRB 4WXWA 4EO8A 1LWFA 3NKYA 3QIDA 2CKWA 4MIBA 3OL6A 4O44B 4ZMMA 3JSMB 2FJWA 4Q8FA 1C1BA 3DI6B 3NGDA 3FFIA 3LP2B 3CJ3A 4XPCA 1TVRA 2IC3A 3MR6A 2R2TA 5J2NA 1FK9B 4I2QB 1LW2B 1C0UB 4JV0A 3PR5B 3KHHA 4KFBA 3QGHA 5KFCA 3DOKA 2R8GA 1TKTB 3NL0A 2FJXA 4ZP7A 5KFXA 1S9EB 3I0RB 3H59A 1EP4A 4NLPA 3T5HA 1T03B 4O3RA 3T5KA 5EWGA 3JYTA 2W7PA 5L1LA 4DG1B 2YNGB 1KHVA 4QWEA 3BSCA 4PWDB 2IAJB 3G86A 4KHRA 4ZHRA 1UWBB 2V4QA 2ZE2A 4J9PA 5HP1A 1LW0B 1HQUA 2WCXA 5F8MA 3QO9A 5KG5A 4QWDA 1TV6A 4WFXA 2BQRA 1S6PA 4F4WA 4MIAA 2OPPA 1RTDA 2D41A 3OLAA 4K4VA 1EP4B 3DRSB 3LANA 4K4TA 2YNHA 5J2PB 1SV5B 5KG1A 3Q8RB 3JYTB 2HAIA 3T1AA 1IKYB 3UQSA 1C1CB 4MK8A 1RA6A 3V4IB 4ZHRB 4ID5B 1BQNA 4RW4A 3GIIA 2R2RA 4ZP8A 1RDRA 3PHEA 3CDUA 3E01B 1IM4A 3G6VA 2R2UA 3FQLA 3SFGA 1JKHB 3RB4A 4RW6A 4H4MA 4OL8A 3QIPA 5KT2A 2GIRA 3NBPA 4RW8A 1TL1B 4IFYB 3V81A 5KFYA 2HNDB 3BGRA 2B6AB 4ED6A 3RAXA 2OPQB 3BSAA 4ED2A 1JXLA 2VA2A 4MFBB 2R8IA 3KJVB 1JLCA 2B43A 4LSNB 3UDLA 5KFKA 2BANA 3KLVA 4IFVA 4K4YA 3PVXA 3HKWA 5KFIA 4ED7A 2E9RX 1LW2A 3HVWA 3IRXB 1RT6B 2W8KA 4MH8A 3KK3B 3CO9A 1S1VB 1JLEA 2IM2A 2E9ZA 3C6TA 3T5JA 3BSNA 3KLHB 4FBTA 2JEJA 2WOMA 1I6JA 3N6MA 3DRPA 3KK1B 2ZE2B 1HQEA 1RT7B 1T3NA 5EDWA 4RUAA 5C5JA 5KFJA 3QYYA 3IRXA 3MEDB 2WB4A 3RB0A 1JLAB 5KFPA 4IH7A 3KLFB 2C2DA 4O3QA 1JLGA 1N56A 4DL6A 3NMAA 3CJ4A 4Q44A 2WOMB 2R8HA 5J2NB 4ID5A 3LP2A 3HHKA 3IS9A 3BQ2A 3UPFA 1TQLA 1RTJB 3LAMA 4ZVHA 3DLGB 1TKTA 1IKXA 5KT3A 2ASLA 2VG5A 3DOKB 3I0RA 4KKOA 2OPRB 3QZ8A 2AWZA 2RKIB 3MR5A 2XCAA 2ASDA 1NHUA 3OL9A 4RNOA 3KLFA 4R5PB 3KK2B 4Q8EA 5K14B 3DM2A 2YNGA 2YNFB 2JEFA 1C2PA 4RNFA 3V6JA 1LWEA 1LW0A 3BSOA 2JC1A 1C0TA 2V4RA 4DL5A 5HBMB 3DYAA 3BQ0A 3QO9B 3OHBA 2WTFA 4TY9A 1HNVA 2ATLA 2YNHB 3KLGA 1TP7A 3SI8A 2W9AA 1N6QB 2E9TA 5J2PA 4TY8A 1RYSA 2HWIA 2ZD1B 4YMEA 5KFMA 4ECUA 3C6TB 1IKYA 1BQNB 1C1CA 5HROA 5CYMB 3V4IA 1WNEA 2WK4A 4MK9A 4DEZA 4M95A 3I5BA 3CJ0A 4MKBA 5L1IA 1ZTTA 1D1UA 3MEDA 2JEGA 4LQ3A 2AX1A 3KLEA 5C42B 3NBPB 4KV8B 4K4UA 1T94A 2W8LA 1N6QA 4ED8A 3I0SB 4TYAA 4NLSA 2OPSA 5CYQA 1J5OB 4O4RA 1SH0A 3G6XA 4PUOA 1N4LA 1TKZA 2OH2A 5DLGA 1HNIA 1RTIA 2HNZA 5KG7A 4XPEA 1S49A 2YKMA 3Q8SB 1BQMA 4GC7A 2BR0A 5F8GA 5F8NA 4EBCA 3OLBA 1QE1B 1IKXB 5KG3A 4O3SA 4MK7A 2AGPA 2FLLA 1RTHB 1NHVA 4ZP9A 2C22A 4R5PA 1DLOB 1S1TA 4R8UA 3UR0A 4IOBA 4J9SA 3DI6A 5L1JA 4PUOB 5KFUA 2AGQA 3SFUA 3CDWA 3GIJA 2D3ZA 5KFOA 1S0MA 2IMWP 2R2SA 1JLFA 4ZVGA 4NLGA 5FDLA 4H4OA 1VRUB 4YR0A 1JLQA 1DTQA 1OS5A 3RB6A 4TYBA 4RW9B 1RT4B 5J1EB 4YQWA 4PWDA 1REVA 4ECWA 3ISNC 1JIHA 4EBDA 3OSPA 1S9FA 5I42B 4J9OA 3OL7A 1HQUB 3I5AA 1JLCB 3MTKA 4K4SA 2DPIA 4WXOA 3M9MB 3IS9B 4J9KA 2UVVA 4NLVA 1S9GB 4Y2AA 5KFLA 3CJ5A 1IKVA 5K14A 2VG6A 2JC0A 4EBEA 1RT3A 5KFZA 4EO6A 1S1VA 3PW4A 4MKAA 4KB7A 5DGAA 3V6DB 4URQU 4ECYA 2XCPA 2YNFA 2C2EA 2HNYA 1RTDB 3T5LA 2R8KA 3DRSA 4RW4B 4TLRA 1D0EA 3V6HA 1CSJA 3ITHA 2V0NA 3H40A 2YKMB 2GIQA 2W9BA 2JLEA 1C0TB 2IJNA 4J9LA 2AU0A 2ILYA 1S0OA 1S1UA 3N6NA 2IM3A 1FKPA 3IG1A 5KT7A 1S10A 3VQSA 1QE1A 2B5JA 2AGOA 1SUQB 4ZPAA 3PZPA 4QWAA 4IG0A 5KFQA 3RBDA 4WZQA 4U7CA 3MR3A 1KLMA 2RF2B 4M94A 4MFBA 3PW2A 3DOLB 2UVUA 3KJVA 2HNYB 4JUZA 2IBKA 4NRUA 1QAJA 4NLRA 4PQUB 1JLBB 5EWEA 2B6AA 2QE5A 3H5UA 3TAMB 3H4DA 3MECA 1RT6A 4KO0A 2WONA 1K1SA 3H4BA 3G6YA 4F4YA 3CWJA 1KHWA 5C42A 1IKWB 2B5JB 4IRDA 4H4OB 4Y34A 3H5SA 4K4WA 4G3IA 1RT5B 3QIPB 1TKZB 4O4GA 3CDEA 2W7OA 1TVRB 2IC3B 3QZ7A 4EEYA 3M8PB 2C28A 2UVRA 4FS1A 2FVCA 3M9NB 3RB3A 4J9RA 4O44A 3JSMA 1N48A 3KLHA 4NLQA 3LALA 3DYAB 3PR4A 1S48A 2EC0A 3PW0A 2AQ4A 2BE2B 3KLIA 4ECRA 3DMJA 1RT1A 3D5MA 4B3OB 2WHOA 4WYWA 3C6UA 3IN5A 3QGIA 2BQ3A 3MEGB 2IAJA 5KG6A 1RYRA 4J9QA 4O4GB 4NLWA 5HROB 2I1RA 3MEEA 4ZVFA 1S6QA 5D3GB 2IM1A 4QPXA 4NLDA 4GC6A 4ECXA 4IRKA 2XI2A 3OSNA 4DL2A 2VG5B 2OPRA 2BRLA 4ED3A 1FKOB 1DTTB 3LAKA 5FDLB 5DQIA 4Q45A 2BE2A 3KLIB 5I3UA 2ASJA 2HMIB 1K1QA 1RT4A 2GC8A 3HVAA 2XGPA 3MEGA 2J6UA 3NAHA 4DL3A 1VRTA 4HKQA 5DQGA 4NZ0A 3LP0A 4LSLA 1ZETA 3FDSA 3KHLA 2ALZA 1BQMB 3LP1A 1S9GA 1LWEB 5KFSA 3KLGB 4NLUA 1DTTA 1MU2A 1S1WB 1IKWA 3DRRA 5KFAA 2XWYA 2HNDA 1RT3B 4J9NA 2I5JA 3FSIA 4Q0BB 4ECSA 2F8EX 1QUVA 3TQ1A 4LSNA 4ECTA 5DG9A 5DLFA 3RBEA 4TY8B 4IQXA 3DLKA 1FKPB 3IG1B 4IG3A 1TKXB 4NLXA 1Z4UA 2RDJA 4IKAA 1JLFB 3KLEB 1S0NA 3DLEA 1SUQA 4KV8A 5L1KA 4IG0B 3M8QB 2UUWA 2FVPA 1HMVB 4Y3CA 4ZPDA 4K4XA 2I5JB 1DTQB 4ZPCA 3DOLA 4TN2A 4EYIB 2O5DA 2IA6A 2JEIA 4TQRA 4O3NA 4RW7B 5F8JA 5HLFA 1W25A 4R0EA 2VG7B 4RZRA 2WONB 5KFBA 1GX5A 3TAMA 4IR9A 5L9XA 2XC9A 4FS2A 4IDKB 1IKVB 4ECVA 5F8IA 1DLOA 4KSEB 4R8UB 3OHAA 3CJ2A 4IH6A 3N6LA 4ECZA 3KMQA 2FVRA 4TXSA 4F4ZA 3H98A 5C25B 2YNIB 1N5YA 2QV6A 5HP1B 2FJVA 1RAJA 1HARA 1S1TB 4K50A 4Q43A 5KT5A 2W9BB 5J2QA 3QLHA 4I7FB 1TV6B 1LWCB 1TL3B 4KKOB 4JV1A 1VRUA 2RKIA 3BJYA 1SH2A 3DMJB 4WYLA 1S1WA 2W9CA 1NNDA 5EUHA 4TQSA 4O3OA 1RTJA 1RT1B 1REVB 1JX4A 1U09A 1S1XA 5KFWA 1S6PB 5JUMA 4IRCA 4NYZA 4WFYA 1JLQB 3PJWA 4Y2CA 3IGNA 5F8HA 3KHGA 1R0AA 4RW9A 1QAIA 5F8LA 1SV5A 3DM2B 1T05B 3QLHB 3MECB 4I7FA 4KO0B 5I42A 3GV7B 3GYNA 4NRTA 4RNNA 3EZUA 3GV8B 2UVWA 4YR3A 3H5YA
chains in the Genus database with same CATH superfamily
4A8OA 2HRYA 2J0WA 4OJHA 4KAIA 3MZIA 4C8OA 2ACYA 2MTLA 5A8RA 2FLNA 3GV5B 4C0HA 4HH0A 5HAOA 1U1OA 4DG1A 3H5XA 2EFQA 2RS8A 3ZTRA 4CLSA 3SIPB 5M2RA 2E1CA 4WP3A 1RHJB 3G8TA 1NK8A 3MF5A 3MM8A 5KFEA 1UWBA 5J2MA 2UUTA 5A8WB 3FEZA 3OJSA 2WVBA 3J80U 3ZZUA 4Q2MA 2YX1A 4IDKA 4F0KA 2YVSA 1JLEB 4NLTA 2ZJQQ 1WHVA 4LBHA 1H74A 2O01C 3ZZOA 3QJLA 2UXCF 1R0BG 3D66A 1T9VA 5KAKA 4PQUA 2K1RA 4YY3F 3K17A 2QL5B 2AJ0A 3BKFA 4ES2A 1IWGA 2ILZA 3E51A 3I0SA 3MEEB 4JI6F 4RJVA 4I2PB 3J81j 3DLEB 1BWVA 1E6VA 4Y2MA 2RHSB 2VF3A 5KFTA 2VQFJ 3K58A 1C1BB 2LVWA 2D1CA 1FCAA 2QLXA 4CLWA 5C7PA 1FXLA 1F2HA 2XMUA 1PG5B 1HQEB 5F3TA 4QWBA 5L9NA 5DQHA 4HHHA 2BX6A 2NPIA 5BXIA 1WTFA 4B9SA 2NLWA 1FFSB 1V3SA 2HVZA 1L5UA 3ZZZA 3GP9A 2DXEA 5GVQA 4DUZJ 3OJUA 4NLYA 1X31C 3CCMS 2CQ3A 1NCLA 9ATCB 3QWPA 4UZBA 3M6WA 3RU0A 4PXEA 1SIWB 4URSA 2DPJA 2J6TA 4ZVEA 4CO3A 5IM0A 3OV7A 3DGPA 1AFIA 2J9CA 3BYPA 1N5QA 2RSQA 3HF5A 1UVJA 1FD8A 4RUCA 4RPFA 5DGBA 4LT6A 4ED0A 1Q79A 1S6QB 1TMMA 4DSKA 2RQ4A 1YVFA 3UR3C 1X4AA 2NZCA 2V2ZA 3HDSA 4OQJA 1U0HB 2W7AA 5J1EA 2OEMA 2V8PA 1JNZB 3T6BA 2ROPA 5J2MB 5JVHQ 4FYXB 4L75A 1RJJA 1LWCA 1KKHA 1S4FA 2DNGA 4NEZA 1X5OA 2CRLA 2RQKA 4QW8A 4C0BA 3W63A 2CQ0A 4J9MA 1C0UA 3OFFA 1KN6A 1UEKA 5EX3A 3R7SB 5KOXA 3CIZA 1LOUA 2KRBA 1OWXA 3CCUS 4RW6B 1VRTB 4L73A 1S9EA 1OMSA 4YP3A 2YKQA 4DV6F 2LEPA 4BHQA 1S6UA 5GAEI 1GAOA 3G2XA 3PJXA 2O1PA 2EEYA 1HPZB 2DRDA 5KT4A 4DSEA 1RBOB 1WC5A 4FPRA 2ZD1A 4ECQA 1VLOA 4EZ6A 1UVIA 4ED5A 3M2UA 1ZYQA 4DDFA 3TEGA 4NE9C 4QW9A 5KG4A 2AW0A 1RAOA 2V9WA 3QGGA 3KFWX 3ZZPA 2B9EA 3I55S 2AYGA 3N9UC 1F3VA 4OI0A 2ZKUA 3IRWP 4OLOA 3LOUA 5A76A 1HNIB 3O44A 4MYTA 3FRZA 4IG3B 4WTOB 5C25A 1AB8A 2W01A 5CYQB 4OJ1A 1APSA 4DQPA 4M5LA 3P45B 5GMDA 3UN5A 1S79A 1HFEL 2YKPA 4ZLPA 5F9NA 3J7YU 5IT9Y 2HNZB 1RTHA 2VB6A 2CJYB 4NL5A 2MLYA 2QLWA 4M5MA 2YWHA 5KFGA 2MPUA 4QWCA 3HJFA 3GJQB 1H38A 1N34F 2ZH1A 3CCZA 4KBIA 2E7XA 2QG9B 3MD1A 4RW8B 3GTYX 1KQFB 5KFDA 2K06A 2HQFA 1NZAA 2EXUA 2HFSA 3N4WA 4LRDA 4ZPTR 4ZMMA 3OL6A 3KXDA 3EZOA 1RLCL 1V5VA 1TUVA 2W25A 3DI6B 4I68A 4KYZA 4NWBA 3W2WB 2YTCA 4IUFA 2XMMA 1KTVA 2ALYB 2AJQA 2IC3A 2CQHA 4YB7A 2AMCB 2L3MA 1FK9B 4ZVOB 2FLOA 3FKBA 3PYDA 2V4JA 4GVBA 4MT1A 3GZ7A 3CD0A 3LH2S 3DOKA 2HSEB 1HD1A 2KO1A 4ZP7A 4HT5A 4OHZA 1RI7A 2HS4A 3LGMA 3H59A 1N5VA 4NLPA 1ROFA 3T5HA 1T03B 1R8HA 4K0KJ 2YNGB 1SIZA 1RTZA 2RHQB 5B08A 5FD1A 4QWEA 1Q81T 3TEHB 2ZNZA 3G86A 4OIXA 1UWBB 3BKTA 1TL4A 2E5IA 1LW0B 3FBCA 2LLZA 2WCXA 4V19J 5DM6Q 1N0VC 4DLGA 1FRMA 2OSRA 3NNHA 5F8MA 2UXCJ 4QWDA 2MZJA 2VOPA 2Q66A 2Y8YA 2FIUA 2Y8WA 1FD2A 4X4TA 3WX8A 1EP4B 5J2PB 4I6YA 2CQCA 3JYTB 1U8SA 3Q2SC 4DFMA 3TUIC 5GAGU 4ZVSB 3BBFA 1VGYA 1L3VA 1CPZA 4DR3J 3J81U 1RA6A 2C2OB 3K57A 1OQ3A 2GVZB 4RW4A 2R2RA 4QIFA 4ZP8A 3AA8A 1IM4A 3AFGA 3HSZA 1JKHB 1F5AA 2Y9HA 4OI2A 4G1PA 3PJ9A 3NBPA 1TL1B 3V81A 4ED6A 2QFJA 2DNPA 2GQCA 4LIRA 4X4RA 4DR4J 3VZHA 1R8BA 3FBBA 3KJVB 3L7UA 3U1MA 4LSNB 1K0TA 1Q4RA 1NRKA 2DISA 2ZH5A 2NYIA 3K5NA 3PX0A 1FE0A 1KFSA 2CWXA 1RT6B 2OI2A 1WG1A 1FDBA 5GAEU 3CO9A 2GX8A 1KWMA 1DHMA 4DV4F 2BZ2A 3HSJA 1D9FA 1HBUA 2QX0A 3QT5A 2E9ZA 4XDDA 3VALA 3T5JA 2QTWA 2OEKA 4PG8A 1NM2A 4KHPJ 1VQ6S 4IOAQ 2ZE2B 2HW3A 1MLAA 3MM9A 2YWGA 4LIWA 3TRGA 4RUAA 3M6UA 2F8HA 3ZC4A 4DPXA 3GMGA 2CPEA 2PA3A 3TR5A 2PI5A 2NXJA 3BBCA 2EBEA 3HI9A 1QDUB 3PY8A 1P6TA 3KLFB 1TL7B 1QAYA 4C0OC 1V6HA 4RWWA 1VHFA 4M5NA 3NMAA 1Q1KA 3SCKE 4HHUA 2HZCA 5D0EA 2XO6A 3BS9A 1RAGB 3BO2A 3LAMA 1RCOB 1R27B 2C3MA 1IKXA 2BXJA 2HHUA 1NSPA 4TVAB 3MR5A 1RWKB 5H9EK 2CXEA 3OL9A 4Q8EA 4F4KA 3RW6A 4I67A 3DRXA 5GMEA 1C4AA 1U1QA 2VC1A 2YNFB 4PPDA 1GK8A 1UCNA 2QYGA 3HFZB 4LF6F 1RHKB 4W92B 1WORA 2DXDA 2J0SD 1N5SA 2OMLA 1N33J 2JC1A 1KP6A 4DPTA 3VCDA 5HBMB 1WF0A 2XMWA 1NLKL 3AQOA 2WTFA 4JI5F 2W2QP 4TY9A 2Z58B 2G4BA 1SL2A 1FX4A 2YNHB 1WC6A 4ZVRB 1TP7A 1JK9B 3ET6B 1T02A 2E5GA 2OEJA 2MZTA 1O6XA 5CQGA 1FNMA 3CDBA 3SV3A 3UD4P 1XMOJ 1N6QB 1DQ9A 4C8MA 3AWRA 1UW9A 3DFEA 3CXCR 2BUNA 4C11B 2B9XA 3TA0A 1WNEA 4AL6A 3EDRB 1CQMA 4MK9A 4DEZA 3OVBA 3KNGA 3MPWA 3CJ0A 1ZTTA 4X4VA 1I1GA 1PYTA 2FPHX 2IDEA 2ZJPQ 4LQ3A 1WD6A 2K3IA 4O23A 2W2PP 4K4UA 1H7XA 3AXKA 4DOZA 3NXZA 3GSDA 2M7SA 4NLSA 4NI2B 4LFBF 2CPFA 2FUG9 2HK3A 4J90A 4PUOA 4X84A 4TU8A 1M5OC 5DLGA 2CQIA 1RTIA 4PG5A 2HHVA 4DSLA 2YKMA 2OFHX 4Y00A 2VKRA 1R3NA 5MAOA 1IJEB 5HANA 3QJJA 5F8GA 2DHSA 3K59A 4EBCA 1TAQA 4EUVA 3A3PB 1EKRA 5KG3A 3UDVA 2RRNA 4DPOA 4O3SA 1VQNS 4AD6A 2YKAA 3G87A 1SPBP 1RADB 3M8WA 3O3LA 2VODA 4NA2A 1FO1A 4M5DA 4QCLA 1SBRA 3L4BC 1DLOB 2MSTA 3M2RB 2ZZTA 2VPXB 4IOBA 4R8UA 3SCJE 4X66J 1K9MT 2PSZA 3LTOA 4CLYA 2QL9B 1OQ6A 2N3OA 2MGZB 1VHIA 4DXLA 3GIJA 2VOOA 3ZZ0A 2YXLA 1RWUA 4UW2A 4PPZA 5D4LA 5ETKA 1QSYA 1YRTA 1IBCB 4NLGA 2HRUA 3RRHA 2V8DA 2KRRA 2JZ5A 4H4OA 4TNOA 5CH7B 5FDLA 3TUJC 4DR4F 3RB6A 2LA6A 2G0IA 5HVHA 4WFNQ 3LGNA 1WUUA 2KVQE 1X5SA 1REVA 4PWDA 4PXCA 4C6AA 1S7IA 1VQYA 4E8UA 5D15A 1NPKA 3OL7A 4DR6J 4K4SA 2DPIA 5I3PA 1IBLF 1SKUB 4J9KA 2UVVA 3C15A 3W64A 1MN9A 4B02A 2CZ9A 3W7BA 1EIYB 3CJ5A 4QZVB 1IKVA 3MAAA 3MD3A 4USVA 3F56A 3UD5A 3R7NB 2UV8A 1S72S 4ERDA 1U1PA 4F0HA 3PW4A 1WDDA 4Z7YA 2DGQA 3A12A 3THPA 1IQTA 2A6OA 1KSPA 1K47A 3NCPA 4KHPF 4X4NA 2R8KA 4ECYA 5A8KB 3GIRA 3K0JA 3RRGA 1YTYA 1AXQA 1D0EA 2F9DA 3H40A 1OJ4A 2FY8A 5ITHA 3QFHA 2JLEA 2W9BA 1L3KA 4C8YA 2ILYA 2F5GA 1S0OA 1U2CA 3PTWA 4WFAQ 2V2QA 1BD6A 1NAQA 2BKNA 2H5JB 2HS3A 3T6JA 2J9EA 1YKWA 2B4VA 5IQQA 4ATNA 1NJZA 1PCAA 3AX3A 1MSWD 4IG0A 2JJ4D 5KFQA 1VK8A 4LFCJ 4P73A 4C4WA 5HK4A 1KLMA 1OY6A 1UJ5A 2RF2B 3B8HA 4LMZA 2UVUA 2V8GA 4LRBA 4OMFG 4DR2F 1XWLA 4USUA 1X4EA 3JB9k 2V9KA 2G1DA 2ZWOA 5EWEA 1J5EF 2HHTA 4HVZA 4GKKJ 3R5BA 2M52A 3H4BA 4F4YA 2V63A 2WONA 3B6BA 4V19X 5SUHA 3IM9A 3ZZYA 2CYYA 2B5JB 3SDEB 4IRDA 2VONA 2OTJS 2A10A 1ZAWA 5GAHI 4U67Q 2EKYA 1U48A 4FYVB 5A2QY 4LF6J 1KD1T 1UPPA 3W9JA 3TO8A 1NBEB 2IYIA 3B54A 3NOGA 2QSWA 4O4GA 2RUGA 1SC1B 3QATA 1TKDA 2UUBJ 1PBUA 2W7OA 5DZ7A 1A6LA 2IC3B 3M8PB 2C42A 4DV2F 4FS1A 3LUYA 1SB6A 1S48A 3GG0A 4JB8B 4N7TA 3CMES 4FF2A 3CO0P 2ZHOA 1FNXH 4IO1A 1WKKA 5J2QA 2P9EA 3DMJA 5D8HB 4WYWA 3IN5A 2BQ3A 1XMQJ 2IAJA 4LR7A 4J9QA 2MJUA 4NLWA 1LK5A 4ZVFA 3VGVA 5FLXY 2YWFA 4QPTA 2IM1A 4QPXA 3DRYA 3BKUA 4GC6A 4ECXA 2PEBA 2XI2A 4DL2A 2VG5B 2ABYA 2DGUA 2OPRA 1NDKA 3D1HA 4UQGA 1Q0NA 4ED3A 1FKOB 4B9UA 3RR8A 3L7PA 1P1LA 1VMBA 2BE2A 2N4CA 2RH3A 2HLTA 5E33A 1ZM9A 4FZVA 1UJ6A 2VBXA 2PO4A 4Y28C 1ZOTA 2ASYA 2GZOA 4NX9A 3VGUA 1HNWF 3X1LB 2GC8A 3HVAA 4QU7A 1NPPA 2AT1B 2J6UA 3NAHA 4DL3A 1VRTA 3JSRA 3TVYA 5DQGA 4NZ0A 1EJ7L 2P5VA 2QIFA 2U1AA 3LP0A 1ZETA 3AXMA 3FDSA 1VISA 2F65A 3GCWP 3KHLA 1TK5A 1BQMB 3GONA 3IR5B 2R7XA 3V2UC 1S9GA 1ICEB 3EWGA 2H5IB 2IPOB 1S1WB 3N0VA 4J5OA 3DRRA 3SDEA 3TNVA 5HVGA 3MPVA 2UZAA 3OW2R 4J9NA 1RT3B 2ZVSA 4I64A 4OZ1A 2XO7A 2DIUA 3KDOA 3FSIA 2ZHBA 3KTQA 3H90A 4DX8H 3EGZA 4LSNA 4B9TA 2JH3A 4NCBA 2XTDA 2QRRA 2Q43A 3IG1B 1ZZFA 2HAFA 1B7YB 4WKYA 1Z4UA 3AY0A 1JLFB 3UD3P 2DY1A 1H2UX 3BN7A 2BW2A 2FJAB 3ILOA 3Q8VA 3A8IA 2BJ1A 4FXWA 4KV8A 5HQ8A 5A6PA 4ZIVA 3TZWA 4Y3CA 4ZPDA 1DTQB 2L9NA 3DOLA 5E3CA 3HXMA 1FJEB 2IA6A 4TQRA 3FMBA 2ZM6F 1FXDA 4DFKA 4RW7B 3GFXA 3Q22A 3TAQA 2EFNA 4PCQA 2FHJD 3TP2A 2UU9F 1K73T 2Q6BA 5KFBA 3ENVA 1GX5A 1ULRA 2C3UA 4LF5F 5H1SV 2F4VJ 1QUPA 6FD1A 3TUPA 5C2CA 1T7PA 3P3DA 5LSLA 1Q8BA 4IDKB 4YY3J 1IKVB 3I4HX 3MAAB 4FS2A 2DR5A 5F8IA 3NMRA 1S0VA 2F9JA 3PCOB 4K5RA 3GE9A 2OLWA 2FVRA 1J2VA 2E1PA 3QFWA 3BB5A 4CP5A 4F4ZA 1S1TB 3MUMP 3BH7B 2HBZB 4K8RA 1E6VB 1DJ0A 4OHXA 2KDOA 3HHEA 2W9BB 4CI0B 4X4PA 3QLHA 3EGWB 3W5ZA 1LWCB 3D1QA 4JV1A 1VRUA 4J37A 3AX5A 4BWJA 5E7OB 2CPDA 4U9RA 4DLEA 1SL1A 1HW8A 1NNDA 3UNGC 4TQSA 2X1FA 4P9SA 3HK2A 5ETSA 4FN5A 3E2EA 3OFGA 2GJFA 4F3QA 4DR2J 2ZH3A 3HHLA 2DHXA 4LF7J 1T9WA 4IRCA 4WFYA 1Y3KA 3TAPA 1X7VA 5F8HA 3IGNA 2HRTA 3ZXWA 3CJTA 4EGLA 4PG7A 1TK0A 5G0RB 4JP8A 2GVDA 1B7FA 3BM7A 2CZVC 1YJUA 3PFEA 5IM0B 3J7YI 1YZ6A 3GV7B 2ADCA 4J9RA 3SBMA 2DEIA 2WB1D 3OD2A 1RGVA 3P4UB 1IBKJ 3X3UA 2GV1A 3W5YA 3W65A 2BOAA 5GAGI 2HGLA 8ATCB 2X1AA 1GT8A 4DV2J 3D6MB 2VDHA 3HVTB 4IFYA 4IFVB 4F8RA 2POKA 5U47A 3V6DA 1T05A 1UEUA 2Z2ZA 1KOOA 1XBWA 3F44A 4ZKAA 2OO4A 3SXLA 2V5HG 3CNQP 2A3JA 1V5IB 4DR7J 2AEFA 1RLDA 2PDAA 3AAWB 2KT2A 4B3OA 2P2CB 2VL1A 2Y1RI 3C6UB 1WI6A 4R0JA 2IM0A 5F41A 2HHQA 2CPZA 4OX8A 4LF8J 2UUCF 2I6WA 4NCGB 3MR2A 3HFKA 4CTAA 4ZP6A 5DDOC 3BR9A 3NP5A 4N47A 3VAMA 5DG7A 4DV5J 3H2LA 3OTCA 3THTA 3MEKA 1ZBTA 4CLPA 4M1KA 4ZITA 3Q0AA 4M5IA 3CUNA 1YJWS 2COLA 2B4OA 2PMWA 4C97A 5I3UB 2XBPA 3DDKA 3MM9B 4LBIA 3SCLE 4CNZA 2FLPA 1FWPA 4P2MA 1MNEA 1WDTA 4Q7AA 1FESA 4Y6IA 3IGVA 5DO2A 7AT1B 4USTA 1Y3JA 3AA9A 2AJ2A 2H3EB 3RGIA 4KGKA 1QY7A 2GQ2A 3LP0B 4RBVA 2KVIA 3L7OA 1XR7A 2MKIA 1JLGB 4LUBA 2WVEA 5B0DA 1HBOB 1YJVA 4W98A 4DX6A 1OY9A 1U1KA 1M0SA 3HT3A 2JLFA 3KOAA 3E8OA 2KM8B 4B3RF 3TVKA 4F25A 4WE1B 5AT1B 1BC6A 3QMQA 1CS4A 3W3SA 1F9FA 3H8YA 4UF4A 5KFHA 1OPIA 5KG2A 3S6EA 1LWFB 1N88A 1PJ7A 2CUYA 2OP5A 3NWGA 4OZ2A 3W60A 4DZ6A 4X2BA 5HBMA 3SV4A 5KT6A 5KTQA 1TKXA 3GQCA 2OAUA 4OLPA 1RP5A 1TL3A 2W9CB 3R2DJ 4DX5A 3VF0B 2AZ3A 3GB0A 3PDNA 4IH5A 4WKRA 1RISA 2YKNB 5KFVA 4A8XA 3K8VA 4K0KF 4WBFA 8AT1B 1S1XB 1WI8A 2XLJA 2RT3A 1BE4A 1EB0A 2AJ4A 2UU9J 1T03A 2MKSA 2N4DA 3C16B 1HNVB 1AW0A 1PYSB 1VBZA 1RZMA 3FUYA 3MM5A 5T14A 1LQ9A 3KUGA 4ELVA 1RT2A 1I51B 3KNAA 2ZITA 3EGNA 3P8BB 3QAUA 5A8KA 4JI7J 3POTB 2HMIA 2YWWA 4WCEQ 3J7Z5 2HZAA 4IQMA 5RUBA 4CM2A 4M8LA 3C3LA 2FYXA 4EFAC 1R43A 2ZBCA 3BH6B 2BA9A 2KL8A 3N28A 2DNNA 3R7BB 1GMWA 3ZFVA 2OPPB 3UN3A 4YR2A 4WK3A 3Q23A 4MYUA 2RDIA 4WU3A 3DXBA 3ENAA 2BOPA 5F0UA 5IV3A 1RTIB 1CJTB 5DDPC 3WIVA 1EETB 2RJZA 1HNZJ 5E41A 2RRBA 2ERRA 1T11A 2O3DA 4NI2A 2E1MC 2H65B 4LF2A 4IR1A 4P2FA 1P1TA 1RXOB 5J2QB 4X66F 1VQPS 4OX6A 2HQIA 2VZ9A 2BJ7A 4JI8F 2R7WA 2BRKA 1CJVA 2VHGA 1FNOA 3AD7C 3FC9A 1FJGJ 1HHQA 3R5CA 4L74A 2XI3A 3K2YA 4WE1A 4Q5VA 3KJNB 5T7LA 3PACA 5KFNA 1KVKA 2PIIA 1R6YA 2XM3A 1JLAA 4JV2A 1Y00A 4WF9Q 3M4XA 2PEHA 4I2PA 4EO8A 2VJUA 1LWFA 1IQZA 4LR9A 1WKJA 2YWEA 3LA0A 4MIBA 3VAKA 2FJWA 1FEHA 4FXVA 2XSJB 4F0MA 3R2CJ 2YQ1A 1YG0A 2QFIA 3CJ3A 2MJNA 3FFIA 3I56S 2ZH2A 3NWRA 4B9LA 2R2TA 4DV4J 4I2QB 3A3OB 2CQGA 4JV0A 2DHAA 3JTNA 1FX2A 3QGHA 4KFBA 1NK9A 1M1HA 1KC8T 4DR6F 2MQQA 1A9NB 4ZLNA 1UVLA 3HCXA 2VV5A 1BY9A 2XS2A 1UMJA 2W2MP 5EWGA 3T5KA 4X65F 2PMHA 2QSFA 1FTRA 1FE4A 3BBBA 4DG1B 1JMTA 2ZH6A 2DR8A 1KHVA 2Y3YA 2UUAJ 4PWDB 2IAJB 1AUSL 1BQXA 2Z8QA 2ZE2A 2V4QA 4J9PA 5HP1A 1HQUA 4OX7A 4UT4A 1HHTP 5KG5A 2UUCJ 1Y5LB 3QT8A 2OPPA 1RTDA 3EVOA 2D41A 4X64F 3LANA 4QR0A 4K4TA 3Q86A 3KG0A 1PC4A 2AZ1A 5EHHA 2GGPB 2HAIA 3MCNA 1XNQJ 1FF2A 4OYMA 3T1AA 3UQSA 2J8SA 1RWXB 1VLYA 3EJMA 2PE8A 3JSYA 4C9DA 4NXNJ 3GIIA 5IWAJ 3D0HE 4KH0B 3THVA 5BYRA 3CW2C 3MMAA 3PHEA 3M8SA 4DCJB 3DGVA 1RACB 3PKYA 3G6VA 1SJ3P 1TMJA 3VTIA 3FNNA 2R9LA 4GKKF 2C2KB 4H4MA 1CLFA 2JL9A 4OZLA 4AE5A 5B0GA 2AJ1A 3BGRA 3RAXA 2IFXA 2LXUA 3D3BJ 1IR1A 2A2DA 1NSQA 2E1RA 2DNRA 3CC2S 4JI5J 4UOFA 2R8IA 4B9NA 2PGCA 2B3TB 3IXQA 2HIYA 4QOTA 2HQGA 2AIRB 5KFKA 2LQ8A 4C98A 3PVXA 4B3MJ 4HR2A 4JI7F 4LF8F 3T9NA 2NR0A 4ILMA 3DHXA 2D9OA 3BGUA 3H0PA 5KFIA 3OR2B 3IRXB 1TZ0A 3D4JA 3DOMA 2VASA 4A47A 4ITSA 2NQPA 1CS4B 2OUGA 4EI2A 3D0GE 5B0AA 4CO5A 1H2TZ 3D1OA 2IM2A 2EC2A 3A13A 4A46A 2OD6A 4HEA9 2JLGA 3ZTPA 2I38A 2N82B 2CPJA 1NJXA 1PYOB 4Z37A 3J81Y 5ETTA 3QJPA 4YB5A 1T3NA 2P9CA 2G2YA 2B8QA 3IWLA 5J1NA 2LP4A 1Q53A 3WX4A 5C5JA 1TELA 3QYYA 5KFJA 2DH9A 1TUWA 2XZWA 4M5HA 5DDQC 5M2UA 2RS2A 3RB0A 2CJKA 3QT7A 1AZSA 3WHIA 4KGVB 2MXYA 1W2IA 4C8NA 3LWMA 2ROEA 1LFWA 4LSZB 1VYAA 4KC5A 2XZDB 4NYPA 2AEMA 2M9KA 5HO4A 4DL6A 1LV5A 3CJ4A 1IBMJ 1JJ2R 2WOMB 4DI6A 2VKZG 1B0TA 1ZM3A 2PN6A 3AB2B 3M2UB 1GTEA 1VQOS 4QBUA 2OJ3A 3HHKA 3IS9A 1TL5A 1RTJB 1UW4A 4ZVHA 1LNQA 4HDGA 1TFYA 2BE7D 3UWTA 2G9OA 2DH8A 3CJRA 4G65A 4KKOA 2OPRB 3U1NA 3QZ8A 2RKIB 1KVIA 1HBMB 1QD1A 2FC9A 3KLFA 5LOQA 1TTHB 1OYEA 1RAAB 4P52A 1NKEA 1MMNA 2DCUB 4OJGA 2JEFA 2DNQA 2YY3A 3CT9A 4TU7A 4RNFA 5ETNA 3V6JA 4DUYF 3EXCX 1LW0A 2KT5A 4KJIA 2BMBA 2FB0A 1X4CA 3BSOA 5HQLA 1KLNA 1C0TA 2EFGA 2R7QA 1NEEA 2VQEJ 3MMJA 1X60A 3QO9B 3OHBA 1YJRA 3D54A 4ZPWR 5B7WA 2ATLA 2M0GB 1OSDA 2MZQA 5LJ3Y 4LF1A 5LXRA 2E9TA 1W2BR 4F26A 1RU2A 1QVFR 4OI4A 1VQKS 4ECUA 5HROA 3C6TB 1C1CA 1BQNB 3FCWA 5CYMB 3V4IA 1UVKA 4ZVUB 3HMJG 1WEXA 2YPYA 2EKNA 3FBEA 4LF4F 2WK4A 1VFJA 2MLZA 3PNIA 3QT6A 3KUHA 3C19A 4Y0FA 4P10A 3ILIA 3PX6A 2CPYA 3GU0A 3JSBA 2FJDB 1FDAA 1NK0A 1D1UA 3NBPB 4GKJF 2W8LA 1CJUA 4LREA 4X62F 3K5MA 4PUOB 2XTEA 2WVCA 3BGLA 4ED8A 2IVMA 4TYAA 1X9WA 1N6QA 1J5OB 3D68A 4O4RA 3NGUA 1SH0A 3D7SB 1CBKA 3G6XA 1TKZA 1YJNS 2OH2A 1HNXF 3NNAA 2YQ0A 3C2PA 4XPEA 3EUNA 4GC7A 1RWPB 1S49A 1NSKL 4LFCF 3T41A 1FEEA 3QGPA 4X64J 3LGHA 3SQGA 3DXSX 4Z7CA 4MK7A 4TKTA 2KYXA 3CCES 2AGPA 2FLLA 2XLKA 1NHVA 1B4SA 4DX7A 4ZP9A 2K7KA 4R5PA 2C22A 1J5EJ 4LFAF 1QJHA 2FHKA 3CSKA 3N01A 4KTQA 1S1TA 2QN6B 3UR0A 4USIA 4UUXA 4J9SA 2FDNA 1U7LA 2EK1A 2HFNA 4PXDA 4PAAA 5L1JA 2DEJA 2AGQA 5CXTA 3CDWA 1B0VA 1U25A 1ZZNA 3UFCX 4CLFA 2D3ZA 3GFYA 4LF7F 1PILA 4NXMF 2ZHAA 1P9QC 4ZVGA 1N54B 1Y0HA 2F7VA 3HHLD 5BYQA 4CT8A 1FA0A 2CZ4A 4FYWB 4ZN3A 2W24A 2HHXA 1X5TA 2AJFE 1OS5A 1HBNB 2V94A 5D0HA 5IXUA 2NREA 4TYBA 1FJCA 3IWXA 1Q7YT 4YQWA 1NMEB 4YB1P 2R7OA 3ISNC 1CC8A 1JIHA 2CA9A 3ENQA 4LRCA 5E3PA 1YBAA 5FLXU 3GR0A 2PA8D 4RR5A 3UVJA 3I5AA 3MTKA 4CO1A 2HBQB 2J7UA 5DS7A 4NLVA 1S9GB 5HMXA 4Y2AA 2BJDA 1YHQS 3DLLQ 1XMQF 5EX0A 4USHA 5K14A 4EBEA 4DSJA 2GMLA 2P6SA 1RT3A 1XN9A 1DZ5A 5F0WA 3M7VA 3V6DB 2MKYA 2HNYA 1PJ5A 3T5LA 4ES1A 1U24A 2AYEA 3DLJA 2MYFA 3DRSA 1DY3A 1Y5NB 3V6HA 2V0NA 1WSVA 4JI3F 4J9LA 2IJNA 5THWA 2HVIA 1G7CB 1U6BA 1WEZA 2WVDA 5HI7A 4K59A 1WF2A 3K7RA 4WWSA 3MUTP 3PZPA 4QWAA 1N5YB 1IBMF 2IDLA 2I9SA 2J9DE 2XMTA 4DFJA 3EXYA 3SQOP 2DNLA 4MFBA 2R7RA 3PW2A 1RB0A 1RHMB 1M1KT 1VQ8S 2R7UA 4P71A 3CCWA 2Z0GA 4NLRA 2VJVA 1QM9A 4PQUB 1CJVB 3PHTA 3H5UA 2M3DA 3TAMB 3H4DA 3JAMU 2XS7A 1CEZA 2N7CA 1UVMA 1K1SA 4L6V3 3O5TB 1K44A 1UFWA 2RD5C 5T7LB 4HH1A 2LMIA 2K3KA 1IKWB 2MMYA 2EFVA 1MROB 2MLXA 3ILJA 4UQTA 4DSIA 3BV8A 2APOA 4Y34A 4W4MA 3WC2A 4GVBB 4DUYJ 4N56A 4K4WA 4CYUA 2F4FA 2NXUA 1M5PC 2A2CA 1VRQC 3BR8A 1MN7A 1EQ0A 3CDEA 1UAWA 1XMOF 4L3KA 4ZPVR 2HQDA 1JXVA 1YRXA 2DTJA 3QZ7A 2C28A 2DCLA 3VZIA 2FVCA 3M9NB 3VAFA 2F63A 1T9XA 1YWXA 4A8YA 3W2VB 4NLQA 3UO0A 2B7CB 3PW0A 1Y4ZB 4C8KA 2AQ4A 2QMXA 1N5TA 2LEAA 2XULA 4M5DB 3KLIA 1FKAF 3C66A 2HYIB 1E6YB 1RT1A 2J76E 4PABA 1NDCA 3D5MA 3VGTA 1PAEX 2QA4S 3S8SA 3H25A 2LQ9A 3TX0A 3AHPA 5CHCB 3I96A 2I0XA 4KGZB 4O4GB 5HROB 2MB0B 2D3OR 4FYYB 1S6QA 2IRYA 4A8MP 1IN0A 1WHXA 4NLDA 3IC1A 3RRKA 2QA1A 1URNA 4X62J 2R7TA 2L08A 4DPUA 4DWIA 2NXCA 1FDNA 3DHWC 1ZAVA 3MM5B 2C3PA 4AQYJ 1RT4A 3CD5A 4BLGA 1IUJA 4ID8A 2IBOA 3MEGA 1NXIA 1L3UA 5AJ3J 1QAXA 3TUZC 1Y11A 2J7WA 3C16A 2DB1A 3K8WA 4CLZA 1Y5IB 1YLXA 4ZIWA 5HMYA 3K89A 2DRBA 5E3QA 2JVRA 1A7GE 1H0HB 2HFUA 1UA1A 4B3SJ 2MQNA 1IKWA 1UWAA 3IAM9 4MMOA 2ZBQA 2ZKTA 5B0BA 1HL6A 3IP0A 1XMBA 3W5XA 3G8SA 2I5JA 4CQ1A 4DF4A 3HHLB 2KB2A 2X1BA 4JI8J 3QWUA 4ZJQA 3GPAA 3IR7B 3EVWA 1QUVA 1WHWA 5I4MA 3IBCB 5DLFA 2M2BA 2Z57B 4TY8B 4IQXA 1NKCA 1IBKF 1FKPB 4FKYA 4IG3A 7FD1A 3DOMB 3M8RA 2F40A 3KLEB 3GFHA 1SUQA 1VQMS 3KG1A 3M8QB 1R31A 2FVPA 3HKZD 3CE8A 4EMDA 1Q16B 3DDNA 4RO0A 3PIOQ 3O6QA 4ZPCA 2HFZA 1HWUA 1LKZA 2AV5A 3AOBA 2JEIA 2U2FA 4AXJA 1U1LA 4DFPA 3P5TL 4O3NA 2ZZMA 5HLFA 1F5BA 1W25A 1HWJA 1ZM4A 2CIMA 2LQJA 2VG7B 4P75A 5AXNA 4RZRA 2BJ8A 1SJ4P 3GR1A 4PQAA 1VOMA 2X3DA 2QGFB 2ZC4A 4X65J 2XSJA 2HFOA 3VAJA 2IRXA 2Z56B 2UUAF 1WG4A 3I9ZA 1HI1A 4RLEA 4NZ6A 3DGPB 4ANCA 1HI0P 4KSEB 2GO9A 4PZVA 2DY9A 4PYDA 4C2MA 4DV5F 2R42A 1C4CA 1PBAA 1PSDA 3GCXP 1EZZB 3HD1A 3BO4A 3QRRA 3LF0A 2J8AA 2CQ2A 3UW1A 5CAAA 5GMKa 1N5YA 1U0SA 2QV6A 2FJVA 1HARA 2OFGX 3M05A 4ZCMA 1M5SA 3D9BA 2XMJA 5KT5A 4Q43A 1QLNA 3ETMA 4XAKA 1TL3B 4YN3B 4KKOB 3QRPA 3IWNC 2RKIA 5D77A 1XNQF 1SH2A 2QJ3A 3Q8UA 4WYLA 1S76D 1OM2A 3TZXA 4JV5J 4O3OA 1RCXB 1RTJA 1PJ6A 2EFPA 1QTNB 4C3MA 2HGNA 1YJTA 2CDQA 2ZNYA 1P9YA 2MKJA 3MWBA 4KGMA 3MAQA 4NXNF 1HHSA 3BZQA 2G0JA 4W90B 2RB7A 2FJBB 1JLQB 2KJWA 2ZDOA 4Y2CA 3VQTA 4ALZA 3KHGA 1R0AA 2J0XA 4RW9A 2GAGC 3ZNJ1 5F8LA 4IOCQ 3DKDA 2ACMA 3QLHB 2XQCA 3LW5C 5I42A 3CGIA 4GRSA 4NRTA 5CCMA 2UVWA 2UXBJ 3CEDA 2HHHJ 3M1VA 2BW7A 3CCTA 4Y2KA 2KI2A 2HWHA 2HKEA 3CJ8A 1RQ0A 2HURA 1KOHA 2HWTA 2IA0A 3N5BA 2D7SA 4KE5A 1HWIA 1TL1A 2NS1B 3I82A 4O3PA 4AL7A 3V81B 2NZ4A 4ICLB 2BACA 3CCSS 1IVZA 2XYPB 1D8YA 3FQKA 3MXHP 5CYMA 2E5JA 5F3ZA 2LKZA 1MU2B 3FRYA 1GMVA 3ILLA 3CDAA 4M5GA 1EAYC 1UZDA 4CO4A 4KGXB 2K8GA 5KOWA 3DLBA 2Z2LA 3S1TA 5EWFA 2ZJRQ 4Q0BA 2CNLB 4YUDA 3OR1A 4J7CA 2LXFA 4H4KA 3KKFA 3DLKB 3HSDA 4ZPBA 3I4PA 2E5HA 1S0MA 1PC5A 1RT2B 4WZMA 2HQCA 1RA7A 2RILA 4YDXA 2AX0A 2C2MB 2YKOA 3W2WA 4A8KA 2OHDA 3T1HF 1BLUA 2LECA 2O66A 1HR0F 1WSRA 1FKOA 1T8EA 2RQMA 5C24A 3E01A 1HNZF 4UY8T 1GXLA 3BF4A 4NMXA 4OHYA 3ZO7A 3Q8QB 5HL7Q 4RW7A 1BXNA 1WF1A 1YGYA 4F7VA 3M9OB 2C2NA 2GFFA 4OHVA 4NCGA 2QA4G 3UCUP 4O0NA 2OPQA 1FJGF 2AHOB 1NU4A 1GQEA 4L3NA 1D3WA 2V2VA 4H54A 3ISZA 2BANB 2MKHA 3F0NA 1XR5A 5LT5A 1HBMA 3GIMA 3ISND 3DRRB 4XO0A 5JXSA 2ATCB 1SH3A 3M32B 5D0GA 4JI0F 5IQ6A 2AYBA 4WFZA 2DJWA 3U1LA 3BO3A 2RDDA 4G1QB 1U1MA 3PO4A 4K2JA 1HYSA 4I0WA 3OVAA 1R7IA 4LQ9A 4RWXA 2YNIA 2FVSA 1Z2LA 1MG7A 4QIWD 4DBQA 5F9LA 1S6OA 1WC1A 4DR5J 2B56A 2I8EA 3BQ1A 4URGA 3NAIA 3DRPB 3KK1A 4QIVA 4U6PA 5GAHU 4YHHJ 2VG6B 3DU5A 3M8QA 3L95X 4OZ3A 5CD4H 1F2GA 2ZH7A 2ZDPA 3U27A 2PI4A 2HPUA 4LF4J 2F4VF 5DRKA 2DBBA 1HA1A 2PMZD 2CJQA 3HP6A 3OVSA 3MTJA 3MMCB 3TX8A 4ZS6A 1JKHA 2HIQA 2ZOFA 3LO3A 1IWAA 4DL7A 2LA4A 2BJ9A 1RAEB 1R89A 1SJ1A 4TU9A 3PRBA 4HACB 2VG7A 3R5AA 3C14B 3LP1B 3NGRA 2WVFA 3T19A 2GNKA 4JI1F 2VU5A 5KFFA 4FYDA 4HHJA 1RSCA 5DETA 3I5CA 1R8CA 2XGQA 3CCQS 2Q79A 1CQNA 2DNYA 2XHWA 4ANDA 1HNXJ 3ICLA 4ZJOA 5C24B 1FHTA 1RWVB 1MMLA 2BVZA 1XJWB 3QNWB 5EN1A 1HQ2A 5G4DA 3IR6B 3KHRA 3GILA 4G1IA 2VFVA 2BDPA 1W7WA 5SZTA 4U8VA 1B0PA 2Z4PA 2B4PA 3GSIA 1HPZA 3OL8A 2MSSA 4RNHA 3ULHA 4KHMA 3LWLA 1FVQA 5A8WA 4HYKA 1J5OA 1UP1A 2BV3A 1KFDA 4MTPA 3FGVA 1IXKA 4F4XA 1U47A 1SI9A 4GKJJ 7FDRA 3H20A 4CRJA 5D6GA 3MURP 4IO9Q 1B3TA 1JLBA 1JB0C 2EK6A 2PC6A 3PRVA 4NASA 5KFRA 5K8OA 3ONQA 3NOCA 2AP6A 2C3YA 4DL4A 2M5YA 3RAQA 2OD4A 3VVUA 2FVQA 4I1TA 2JFDA 1U2RA 1NK4A 2QA2A 5BJRA 1HMVA 4OYXA 1VCTA 2HGMA 5DJBA 3BGRB 3W9IA 5LMNJ 1N32F 3O1LA 3MCMA 3HFVA 3QIDA 2M8HA 2CNKB 3KJQB 3M8ZA 3OPKA 4WU2A 4IYQA 1YZ7A 3HHDA 3JSMB 1C1BA 1LWXA 4ZLLA 1Y10A 2LU1A 3NGDA 2D74B 2XNRA 3Q83A 3B4MA 4USKA 3VAIA 1TVRA 3MR6A 1UFKA 5J2NA 4PRFA 3BGOP 4BC9A 4HI1A 3MPYA 4RBUA 3H42A 1KBRA 5DZ6A 5KFCA 3PR5B 2K2PA 3MDFA 3TVZA 2R8GA 1TKTB 3EMTA 2JWNA 3HO1A 3I0RB 3NGSA 2P6TA 4DPWA 4O3RA 1E6YA 2DNKA 2NUHA 3MPDA 3R97A 4F02A 2ZC3A 4A4JA 4RKUC 3B78A 5L1LA 4DR7F 4HACA 1GMUA 2HS0A 2EWHA 3BSCA 1KQGB 4KHRA 3DLHA 2YX7A 4ZHRA 2FHOB 2BYCA 3EGVA 2PFDA 4KR0B 5FJ4A 3PFOA 2G0CA 2DNMA 4WFXA 2AEJA 2B0GA 2V8HA 3GJTB 2BQRA 3OQ2A 1VK3A 4LR8A 3HM9A 5JMNA 2XEXA 3OLAA 1RAHB 2IRUA 1DFDA 1RKIA 2YNHA 1SV5B 2MZSA 1S4EA 1FERA 1R8PA 4LJMA 2KFYA 1C1CB 4MK8A 4X4SA 4M5JA 1HR0J 4L76A 2WW4A 2DNOA 4C11A 3MCSA 2KT3A 1O51A 3MHYA 3J7A1 1FRHA 1M5HA 4NYOA 1FRIA 4E2FB 5B0CA 1F60B 1XTZA 2C1EB 2EBGA 3CDUA 4JOUA 4QR2A 5ETLA 3PG9A 1X4BA 3R9LA 4U8YA 4PYAA 4RW6A 4B3RJ 1EQMA 4OL8A 2E5LJ 3H2UB 3QIPA 3OTDA 4MKVA 3G6ES 1TK8A 3BPDA 3QPIA 4ZCIA 2VQEF 5LM7E 4ED4A 1ZH5A 2OPQB 1Q8LA 1NK6A 1JXLA 2V50A 1HI8A 5A8RB 4I56A 3NS6A 1JLCA 2B43A 2O67A 4F3OA 3UDLA 3DNCA 3K5PA 1MROA 1VQ9S 4D3HA 1RHQB 2BANA 2FZGB 4K4YA 2K7JA 3HKWA 3PRDA 4ED7A 2RU3A 4ETZA 1XC9A 3HVWA 1K8AT 1L3TA 1B70B 5K20B 1SQGA 1F6TA 4CT9A 1F1BB 1RBLA 3KK3B 1UEVA 3TARA 1CJTA 3RZAA 2J5AA 1S1VB 1GNKA 1RAFB 3J80Y 1LEOA 3FZ2A 4LRAA 3HULA 2EW9A 3DN9A 4LVNP 5D4PA 1KDNA 3C6TA 1EARA 3W2VA 4DV3J 2K1RB 2JEJA 1I6JA 2ZBRA 3W9HA 1RT7B 2G2ZA 1LFPA 4J9VA 4F3MA 2XZTB 3CJSA 1T3OA 2WW8A 3MEDB 3M30A 1MWZA 4E98A 2JVOA 2GA7A 5E2QA 5EGYA 4UOGA 4YB6A 2YH1A 4O3QA 5ETOA 2VPZB 1ZS6A 3KYLA 2HZVA 1NJYA 5LL6d 1Y7PA 2IMOA 2GMJA 1N56A 2ZH8A 1U6FA 4Q44A 1WHYA 1G1XA 2V1TA 2R8HA 1DBDA 2Y0SD 4CWBA 2V6AA 4QIEA 4ID5A 1WG5A 3LP2A 3U02A 3R5GA 3UPFA 4AT1B 2VDIA 5AJ3F 3W61A 4P7VA 2ASLA 3IAS9 2VG5A 3HZGA 2ADBA 5IFMA 4Z2XA 5LSOA 2AWZA 1NHUA 1AZSB 2VFRA 1S7HA 4R5PB 5JJBA 1F0XA 2GQQA 3SEOA 3WDOA 4NXMJ 1NDLA 4V1Ak 2MKKA 3CPWR 2ZUAA 1C2PA 4CNYA 2W1BA 5B0FA 2B9WA 4DR1F 1B64A 4JI2J 4DU7A 4WPAA 3U7JA 2V4RA 4DL5A 5E3AA 3DYAA 1YIJS 3CCRS 3UDEA 2GHWA 2H9ZA 4N77A 2GIFA 3IM8A 1NZ8A 2N7YA 4KQZA 3M6XA 5J2PA 4TY8A 1RYSA 2KN4A 2ZD1B 2LCWA 4CO0A 1PAUB 4YMEA 4DN0A 3EM1A 3PYFA 1IKYA 5AE3A 1UTAA 2VICA 1F3FA 1SXLA 2DGWA 4EK2A 3LPYA 3MUVP 4M95A 2JRSA 4QJVA 2Q3PA 1XK8A 4ZJLA 2VPYB 4N5SA 2QMWA 1VI7A 2NSBA 4ZK7M 3MEDA 2JEGA 1NHKL 5C42B 4PEOA 4LFAJ 4KV8B 1G3OA 1T94A 5ETQA 2W4DA 5B09A 5IT4A 1ELOA 2OPSA 2OKQA 3UI3A 3TJ8A 1S59A 2B51A 2BM0A 3PIPQ 2CG4A 4B3TF 1ZPWX 1N4LA 1VC5A 3A3NB 2MQ8A 2QZ8A 3Q8SB 5KG7A 2DKOB 3FSXA 4ZVQB 3BEGB 4I6AA 4DV0F 5BYSA 5F8NA 2AYMA 2BR0A 2NCKL 5K8MA 1U45A 3N5FA 1YRUA 1RTHB 4UOCA 3A4TA 2V1SA 2XHCA 3BDEA 3HX9A 3BGFA 5IWAF 3BPSP 3MM7A 1SL0A 1HWLA 4CLKA 1YQHA 4ETXA 4I4BA 2D3O1 3CD7A 3NLCA 3R6GB 5KFUA 2ZEJA 3QBCA 3SFUA 1T9UA 2VBZA 4J9UE 4P72A 2LEBA 4AFFA 2GJ2A 5ETPA 5A6WA 5KFOA 3K5LA 2AKWB 3SYZA 4USMA 3OTEA 1ZM2A 1Q5VA 1M1GA 2FD2A 1V3RA 1FFGB 1MW7A 2HHPA 1O0PA 2L9DA 5GADU 4DV1F 3NCRA 1Q86T 2XG8A 1IR2A 1SJRA 1VQSA 1VRUB 1CG2A 2B8PA 2Y0BB 5MLCV 2KFNA 1YSJA 3FCVA 2NXEA 4FDFA 2CWKA 4NZ7A 1GEHA 4USWA 2QMUB 4A8WA 4EBDA 2EPIA 1S9FA 4A8SA 4J9OA 1JLCB 3ENWA 3QAEA 3SMZA 4DU8A 4WXOA 3M9MB 4ZCKA 2CAJA 1SC4B 1LXJA 1NH7A 3KG4A 4ZN1A 3OR2A 2LXIA 2NYHA 3GFZA 3IMQJ 2VG6A 4MIWA 1GXUA 2JC0A 2V68A 2M88A 4ZVPB 3JXOA 4A48A 4EO6A 4DV3F 2BE9B 4ILRA 3D3CJ 3M1VB 4KB7A 3ZZRA 5DGAA 1U6ZA 3NEKA 1WELA 2WBMA 2YNFA 2C2EA 2AF6A 4NA1A 2DD8S 5D78A 3ZNUA 2GVZA 4RW4B 5LMUJ 4NCAA 1CSJA 3M2VA 2P9GA 2D68A 4AQYF 2ZVIA 4OI3A 3NRBA 3N6NA 3IG1A 4OI6A 5ETRA 5KT7A 1QE1A 2B5JA 2DO0A 2AGOA 4CCHA 5JVGQ 2OELA 4ZPAA 3AX2A 2VFTA 3RBDA 1RHRB 1YBTA 4CM0A 3O8WA 3T1HJ 2A0FB 2QL7B 3MR3A 4AUKA 5HLFB 4M94A 1Q7LB 3AJ1A 3DOLB 2HNYB 9RUBA 3MI7X 3CMAS 3R1HA 3R8YA 1FI4A 1JLBB 2MKCA 2B6AA 4UTGA 3FZBA 2H4WB 3GV8B 3MM6B 1VBXA 1NPRA 1X4GA 3MECA 4KO0A 2Y1JA 1HD0A 1BHNA 3NCQA 1KHWA 1H7WA 3A8KA 4S0MA 3T1YJ 3VV2B 3P96A 3H2VE 1FWLA 2OIHA 3NGKA 1EHWA 2CQDA 3TW0A 4WIQA 2GMHA 1HLWA 1NH8A 3H5SA 2IVFB 1TR0A 2GCFA 2P8IA 3R5DA 4JI2F 2HHSA 1HBOA 3SSRA 5BR8F 1AROP 1PO6A 5HSPA 3AD8C 1TVRB 4P74A 4MAKA 4EEYA 3WBZA 2F8MA 3OUYB 2UVRA 4GMKA 1M5VC 4U7UD 3RB3A 2KTQA 1R6VA 1H3DA 1FTCA 4OFZA 3KLHA 3JSMA 1U1NA 1N48A 3DYAB 4DV7F 2E44A 4DHVA 1P27B 3L9ZA 1PGZA 2H54B 2BE2B 2HK2A 4ECRA 4CLLA 4YHHF 4UOHA 2H5EA 2V8VA 2WHOA 4EZ9A 1JJHA 1RYRA 3K5OA 3M6VA 2I1RA 4JYAF 5D3GB 1CULB 1RWNB 1AYEA 4KH1B 4M5KA 2R3VA 4IRKA 1EX8A 3D6TB 3OSNA 3CIMA 4OYBA 2CQPA 2BRLA 3N79A 2ZUGA 4USJC 2DT9A 3CCVS 3BDPA 1DTTB 2DR9A 4P2XA 4P6QA 5FDLB 5K8NA 5DQIA 2YPZA 5T41A 4B3TJ 2HBRB 1CJUB 1WWHA 5A2QU 4RBTA 1VJWA 2XGPA 1UZHA 4OYAA 2VQFF 2DHGA 2NXNA 3AOAA 2RUSA 3PEJA 3UVJB 1SKSA 4HKQA 2WBRA 4RX6A 4WFBQ 1OYDA 4HL9A 4WK1A 1AFJA 4FF4A 3AQPA 3MM6A 2BEFA 2OMOA 3C14A 3LP1A 1ZAXA 3B82A 3AOCA 1LWEB 2UV8G 4K5SA 5KFSA 3KLGB 4NLUA 1MU2A 5KFAA 3GJRB 2N3LA 3W8PA 2XWYA 2HNDA 4NPOA 1GXTA 4F67A 4ELUA 3ZTQA 3AJ2A 3EE3A 5D0RA 4YS2A 5LXYA 4C8ZA 2LDYA 1VQ5S 2L9WA 2B9YA 4N8NA 5DG9A 3W1YC 2CJ9A 1X4DA 5A0YB 4PR6A 1FDDA 2UXBF 1I5OB 2GJIA 3OUYA 5H9EJ 2QEXS 4NLXA 5LMNF 1N32J 1S0NA 4HTJA 1YJ7A 2RDJA 3DLEA 2FY1A 4OX9J 2KH9A 4IG0B 1MMDA 2KYZA 3RG6A 2UUWA 2CQBA 3HD2A 1HMVB 1N8RT 4TN2A 4K4XA 1HBNA 2XTJP 4EYIB 2O5DA 4BC7A 4A8FA 4C48A 4DCPB 5F8JA 4U7UK 3UNYA 4R0EA 2WONB 2HQ3A 2XMVA 4CH7A 4IR9A 2XYGB 2BJEA 2DIVA 4RL1A 5E0OA 1MWYA 2ZH9A 5GADI 2XNQA 4FF3A 3JQJA 3P49B 4JI3J 4ECVA 3TZZA 4ANEA 2X7IA 1U4BA 2FZCB 4JI4F 5LMUF 3OXFA 3Q2TC 2WZ1A 3C8YA 3CJ2A 4IH6A 3N6LA 3MCOA 4N41A 2DK2A 3H98A 5D4OA 5C25B 2YNIB 5HP1B 3R27A 3L3CA 2JDJA 3EICA 2HHWA 4OV1A 1SKWA 4K50A 1XNRJ 2H48B 2IHR1 5AE2A 4I7FB 1SQEA 3GLJA 4R25A 1G2EA 2MGZA 3BJYA 3DMJB 2A18A 3FMWA 2CQ1A 3US5A 2W9CA 1GTHA 5EUHA 4PG4A 2WAQD 1REVB 2VUGA 1JX4A 3GWCA 1U09A 1J27A 2RU9A 3R3TA 5JUMA 3MR7A 5KFWA 4NYZA 3OXGA 1NJWA 2DGSA 1IR0A 4O0IA 1XQIA 2HEKA 3A8JA 4KRWA 4F2SA 1SV5A 3QRQA 3DM2B 3HHLC 5J1PA 2E5LF 1DURA 4X4OA 4JI0J 3MM8B 1N34J 3MECB 4KO0B 1HWKA 1KRPA 3MAHA 3GYNA 1OPZA 3EZUA 3NG8A 3IA0A 2VFSA 4YR3A 3H5YA 3AD9C 4MJKA 3PW5A 1XERA 4ES3A 3AB4B 1YDLA 3ETOA 2XY7A 3S7RA 4RUHA 1HYSB 1GFWB 3D28A 1QTMA 2YWKA 1NSAA 1ACMB 3A8EA 2EG1A 5H9FK 3EPIA 3ITHB 1VIXA 4NLOA 4ED1A 2CJBA 1R0AB 3NS7B 1FFWB 2BQUA 1RE1B 4CTAB 1OIAA 4OHWA 4DV7J 1S12A 3P5BP 4WJBA 4DQSA 3ZTSA 2R4FA 3Q24A 1UFLA 3KK3A 2DGVA 4FPIA 2QT7A 2IVYA 1SC3B 5IOLA 2B7BB 1CC7A 4F50A 3J7ZT 3DCAA 3IFEA 1GX6A 2I2YA 3QSYB 3MFIA 4JI1J 2XS5A 1MWQA 1UETA 2F1FA 4UZCA 3RJMB 2L41A 1KNZA 2Y1LB 1S97A 4XK8C 2IJFA 1G6BA 2GW8A 3FBFA 1KLMB 2RF2A 3HVTA 4GO7X 4LRFA 5D3GA 3TOQA 4RU2A 3TJ9A 2FZKB 3FCHA 5IT9U 3M30B 3FFIB 1M5KC 2KXFA 2BABA 1N0UA 1KR4A 3R6LB 4DQRA 1RT7A 2X51A 3JS9A 4KFBB 1V9OA 4DJBA 3CVKA 5DG8A 3GIKA 4I2QA 3S01A 1RT5A 4D3GA 2J6SA 1WC0A 3EZ5A 4QYZK 2KG1A 1WOSA 2VFUA 2KZMA 3TA2A 5IC6B 4X4QA 3OFHA 1RWOB 3M8PA 1FWKA 1S99A 2E7WA 3FEXB 2WSFC 2R8JA 3MFHA 3NS5A 5CZVA 3PM9A 3MPUB 2CVEA 1RUSA 4WIIA 3V5RA 1REGX 3G82B 1I3OB 2MHNA 5ETVA 4DS5A 3EPGA 1FT8A 2YKNA 1GH8A 4B08A 3HVRA 4DR1J 2DXFA 3FEYB 5KG0A 3OTOF 1OSCA 4ZDNA 2QYCA 1G4CA 2DNZA 3B4DA 4RU9A 4RNMA 2LU2A 3D0IE 4OX9F 2XMAA 2Y1IA 3I6PA 2MZRA 2XMKA 4PXBA 2DNHA 1AT1B 2NUUG 3BREA 4OZJA 4CO2A 2HMIB 4K4ZA 2RAQA 5ADZA 1D09B 2LQBA 4C3LA 2JHEA 4OZ0A 2V67A 3I32A 2RMLA 1UL3A 5IC4B 1VBKA 4G1QA 4H4MB 4MKYA 2NSCA 4C8LA 2UXDF 2XY5A 2XTCA 4LF9J 1A0OB 3KMSA 1EETA 1KONA 2XWXA 3LQVA 1RK8A 1Q95G 2HVEA 2YH0A 2H1YA 3AH6A 3WC0A 3Q8PB 2C2RA 2W2NP 3JQKA 1X8DA 2HFVA 5L8RC 5HVFA 5M2PA 4LSLB 4ENOA 1QVGR 4UUWA 3SZ2A 1Q8IA 3OBIA 3DLGA 4JI6J 1OY8A 1YX2A 1S1UB 2OPSB 2W4PA 1FRKA 3KUEA 3PXGa 2VA3A 4FF1A 3KK2A 2E66A 3OT9A 4DV0J 1ZTWA 1XNRF 4GVLA 2FTRA 2XYHB 3HZEA 3MOJB 3J7AN 2BKOA 3TANA 4JV5F 4ICLA 2PD1A 4C7QA 3ZTOA 1DQ8A 2D3UA 1RHUB 3V6KA 3PW7A 4FBUA 1WACA 3POTA 2MQPA 1NJIT 2G13A 2DRAA 5K5MA 2DYAA 3PEHA 1SC6A 4EYHB 1WC4A 1NKBA 1I94J 1NUEA 1FK9A 1IJFB 1XR6A 2ZOMA 3KDNA 2EFOA 5HMZA 4U95A 2XZ2A 2E7VA 3ET6A 4OYZA 2WRMA 4XIUA 3R1LA 2R7VA 2VC0A 3TWZA 4WXWA 3VAGA 1DARA 2HHHF 2KHCA 3NKYA 2CKWA 3CMQA 3ZZTA 4CLUA 4O44B 1FRLA 1Z1ZA 4Q8FA 4NMLA 1U8WA 4OV6A 4B9VA 1N52B 3HHNB 4WP9A 4XPCA 3LP2B 2KG0A 1SCJB 1LW2B 1C0UB 2FGCA 3KHHA 1NDPA 2F3JA 3CF5Q 1RBAA 2CPIA 2RVJA 3NL0A 3RBXA 5CABA 5ETMA 5KFXA 2FJXA 1S9EB 4UY85 1EP4A 2IBKA 1VQ7S 3JYTA 3PYGA 2W7PA 3CULA 1DQAA 4QR1A 4QYZJ 3G9CA 4DV6J 3EVMA 2RRAA 2KU7A 1JNRB 2W2OP 3AODA 5IZHA 4PKDB 3M32A 4FNHA 3MMAB 4K7QA 2Z30B 3QO9A 3F73A 1TV6A 3T3FA 1XEZA 2CJXB 3EDQB 1S6PA 4F4WA 4MIAA 3TA1A 2VPWB 4K4VA 3DRSB 4I69A 2IJRA 3KJFB 1T9YA 5KG1A 3OXLA 3Q8RB 1WTBA 3NY0A 2MDAA 1IKYB 2RQCA 3V4IB 4ZHRB 1KTQA 4ID5B 1BQNA 1VQ4S 2GS8A 1U26A 2QLFB 2SXLA 4PWWA 5G0RA 4BCAA 2GVDB 2M4MA 2ZZNA 1RDRA 4HLBA 2MQMA 3E01B 2R2UA 3FQLA 3SFGA 3RB4A 4OYOA 4JBCA 4FP9A 2NPFA 4WP8A 5KT2A 4F04B 2GIRA 4RW8A 4IFYB 2FHJA 1VR6A 5CZXA 2HNDB 2MQLA 2B6AB 1CJKB 3PYEA 4P7TA 5KFYA 1X9MA 3BSAA 5H9FJ 4ED2A 3CB4A 2VA2A 4MFBB 4AYBD 2L48A 2GO8A 2CQ4A 2CPHA 1SJFA 3KLVA 2H4YB 4IFVA 2BBEA 5CD4A 1KS2A 1O8BA 2QLJB 2E9RX 1LW2A 2IIHA 2W8KA 3VAHA 4DR5F 4MH8A 4LBPA 1TUGB 1FRXA 2C2ZB 3SQGB 4CYUB 3CCJS 3NNCA 2XSFA 2JX2A 1WOPA 1JLEA 5L39A 2PT0A 4CH1A 1IBLJ 1WKLA 2XLIA 2WSEC 2HLUA 2V34A 3CJKB 3BSNA 1RWWB 3KLHB 1FRJA 4DN9A 4FBTA 2WOMA 3N6MA 3DRPA 5K9FA 3VGSA 3KK1B 2BJ3A 1HQEA 1O5JA 5EDWA 4DSFA 1FVSA 4JYAJ 3IRXA 3I31A 2V2KA 2WB4A 4LF9F 4U96A 1JLAB 1U49A 5KFPA 2R7SA 4BWMA 4IH7A 1S5ZA 3UN2A 2C2DA 3MMCA 4F4AA 2MQOA 1RKJA 1JLGA 4AL5A 2W4CA 1R8AA 3JQMA 1F5CA 3UCZP 5J2NB 4X4UA 1BMQB 4CH0S 1X9SA 1M90T 3FVYA 3UDCA 1CULA 3BQ2A 3HJVA 3UE2A 1TQLA 4DUZF 3CCLS 2XY6A 3DLGB 1TKTA 3RYLA 5KT3A 5C2GA 1KQSR 2DVIA 3DOKB 3I0RA 2ASDA 1NO8A 1JQGA 2XCAA 4RNOA 1ZA1B 3KK2B 2JSXA 3MM7B 2DR7A 5K14B 4QYRA 1TU0B 3DM2A 2YNGA 4DV1J 4ILLA 2A6MA 1LWEA 1JXEA 1IM6A 3M2VB 1VIOA 4WTYA 3CC4S 1HIYA 2E29A 3BQ0A 2VH7A 1AUDA 2LFVA 4I6WA 3TYTA 3VHQA 5LSRA 1V3ZA 3O2IA 1HNVA 4QIGA 1YBUA 4YDDB 4KPCA 3KLGA 3SI8A 2W9AA 3MGJA 1F9EB 2HWIA 4P2SA 3RW7A 1W26A 2M70A 1HBUB 5KFMA 2KXHA 2FQQB 2QLBB 4NEYA 2KKHA 1QSSA 4DQIA 2Q1LA 4ZOSA 3I5BA 2BM1A 3AJDA 1Q5YA 5B0EA 5A0YA 3GG1A 5L1IA 4MKBA 4BDPA 2AX1A 3KLEA 1S57A 5FIIA 3V4MA 3ELHA 3I0SB 5CYQA 2M8DB 2OSQA 2YQ3A 4DL0C 2UP1A 3R5JB 4LFBJ 3TQEA 4JI4J 3SSQA 1HNIA 2HNZA 1VQLS 1BQMA 3Q89A 6AT1B 1FXRA 4DR3F 2YBVA 5LJ5Y 3RR7A 3Q8YA 3G71S 2GAHC 2A1BA 3OLBA 1QE1B 1IKXB 4QQBA 4KPYA 1BUXA 5HATA 4J91A 2GHVC 3VR1A 3SSSA 2DGXA 3JTPA 1VDHA 3IBFB 4GO5X 1N36J 4OZ5A 3DI6A 5HJXA 1UA0A 1Q8KA 3IO1A 3T1YF 3UCGA 1HKAA 4A8QA 2JFKA 2RE1A 1VJQA 2OTLS 2Z2YB 4KT0C 4PWUA 4OYWA 2IMWP 3CTRA 1YK9A 2R2SA 4E0DA 1JLFA 5D4NA 3DDIA 2VBYA 3TJAA 1UPMB 1SKRA 1NB2A 4DF8A 4DPYA 1N33F 3QSIA 4YR0A 1JLQA 1DTQA 2D69A 3G96A 1X0FA 4RW9B 1RT4B 3H7HB 1U0HA 3FSYA 5J1EB 2AD9A 5DDRC 4ECWA 1CJKA 2J0QD 3OSPA 1VC6A 4HDHA 4K2XA 3W66A 5I42B 2C3OA 4PG6A 1HQUB 3NGTA 1YJ9S 5E3RA 3TI0A 3IS9B 1VS3A 3JAMY 4DZDA 5KFLA 1GMWD 4FKXA 2ZM6J 3MMBA 1K0VA 1EKSA 2JNJA 1X5PA 2Q6CA 1PKUA 5KFZA 2GGPA 2MHEA 1S1VA 2DO4A 4MKAA 2VIHA 4ZA1A 3PX4A 2GHPA 1D8ZA 4Y2IA 5AE1A 4URQU 1X4FA 4OYPA 2XCPA 2ZH4A 1RTDB 3CJKA 4B3SF 3I9V9 2J7KA 4TLRA 2CG8A 2EG2A 4XDCA 3ITHA 4BS2A 2YKMB 5HQMA 2GIQA 1KEKA 1C0TB 2AU0A 1T0TV 1S1UA 1FKPA 2IM3A 5HJYA 1JJ4A 2G2OA 3VQSA 2V69A 3VVTA 3D2WA 3T9ZA 1L3SA 2KXNB 2ROGA 2ZBIA 2ZWPA 1SUQB 4CLTA 2DITA 2MZ1A 1P8GA 2KHDA 4WZQA 1WEYA 4U7CA 5IT0A 3WIUA 5L38A 1WC3A 3KWMA 1DRZA 1PIEA 1JJCB 2X3GA 1ZA2B 4N8OA 5AXLA 3W8GA 2CJAA 2KJVA 4JUZA 2MY8A 4NRUA 3RUBL 3KJVA 3OR1B 1X0PA 5HMWA 4F36A 1QAJA 2MEWA 3M8YA 3CC7S 4ELTA 2PFFB 2QE5A 2DGTA 4F2RA 1RT6A 1TAUA 3G6YA 2VBWA 2ZOGA 3BN4A 3CWJA 5C42A 4HT7A 2LQ5A 3WQPA 3E3XA 2HG4A 4QU6A 3VWSA 3OFEA 4H4OB 2CNOB 5I3QA 1XIQA 2CDRB 3OTBA 4DCOB 2DHHA 4ZCLA 2IY5B 1T9TA 5CYJA 4DQQA 3HLUA 3AT1B 4G3IA 1BWEA 1RT5B 2YX4A 4ER8A 1ITPA 1TKZB 1RWMB 3ADAC 3RAMA 3SCIE 3QQCD 4OJ3A 3C46A 3CD6S 1S77D 4O44A 1X4HA 3LALA 4TLQA 3F41A 4ZVTB 3WZ0A 2EC0A 3PR4A 1B99A 3EYZA 1OO0B 2MY7A 3G82A 3IBWA 2EI5A 4RUBA 1DAXA 2FGOA 2DGOA 3I87A 1D9AA 2IYGA 2ZBPA 3RBZA 2DH7A 3HSGA 4B3OB 3PO5A 3C6UA 6FDRA 3DC2A 3L09A 3QGIA 3MEGB 5KG6A 1RABB 3MEEA 1NK7A 4N76A 1UKUA 1LK7A 1NK5A 1H98A 3A1YG 1T95A 1RAIB 2UXDJ 4KY3A 2G1HA 1U1RA 1BGXT 4FVCA 3G8QA 3LAKA 4Q45A 5I3UA 3KLIB 1R0CB 4KIAA 4OYIA 4DUTA 1K1QA 1U2FA 3CJQA 2ASJA 1H6KX 2HVDA 4CIOA 4EWTA 1ZPVA 2LYVA 4LSLA 2ALZA 4OZNA 4DS4A 5K8PA 3C15B 1TFWA 2BKPA 2DR6A 1DTTA 3LPEA 1VC0A 3PKMA 1Y9OA 1LXNA 3G4SS 4AXIA 2CADA 1N36F 2CNNB 3GYGA 3FJ2A 4CZCA 5L46A 4Q0BB 5AXKA 1I94F 4ECSA 4XTTA 2F8EX 1U02A 4NA3A 3TQ1A 4ZLJA 4ECTA 3D6HB 2HVHA 4H4KC 3RBEA 1YI2S 4G6VB 3DLKA 4B9MA 1TKXB 1KVJA 1H73A 1Q78A 5HN0A 4LF5J 1NB7A 4IKAA 1UVNA 2UUBF 5CCLA 5L1KA 2WSCC 4LVOP 2XB2D 3HPOA 1S10A 2KFZA 2I5JB 1FJ7A 4M63A 1H72C 2KZZA 1SJQA 1SQFA 1WJ9A 3D67A 4YOEA 1CVJA 4OI1A 1F9HA 3FK4A 5DM7Q 2X1GA 4C3KA 3MOZA 1QSLA 2D9PA 4NOHA 2Z2MA 3TAMA 2QO3A 1AA1B 4Y65A 5L9XA 2XC9A 1D9DA 5E5NA 1URRA 3BYRA 4Q2LA 4B3MF 1JWWA 2JOQA 4YFUA 1TL7A 3MMBB 1DLOA 3M2RA 1HW9A 1UJ4A 2CPXA 4DMZA 4R8UB 4YEAA 3OHAA 3RTVA 3W62A 4ECZA 3KMQA 4TXSA 1H2VZ 2EVZA 2LDIA 4HI2A 1HNWJ 1RAJA 2QC3A 5IV4A 3JTOA 4FNIA 1VBYA 4CDIA 3PV8A 4FXDA 4B17A 1KQKA 1TV6B 2RIJA 2CFXA 2E1AA 2FHMA 1RU1A 2ZFHA 1S1WA 3GYXB 8RUCA 2B4UA 5IS2A 4HTIA 1RT1B 1Z2ZA 2H51B 1Q82T 2FC8A 2FJEB 1S1XA 3D6FB 3DU6A 1S6PB 4EU0A 5CA5A 3TZYA 3PJWA 2KM8C 1QAIA 4BBYA 2OGUA 1SVDA 1T05B 4FVMA 2HBYB 3EX7B 4I7FA 2RNEA 5BR8J 3OTOJ 2VD3A 4L72B 2CVIA 2J9DA 3GJSB 1UUJA 3HT0A 5AXMA 1WOOA 2V4JB 4RNNA 1YITS 3QIPB 3P6YC
chains in the Genus database with same CATH topology
4A8OA 2HRYA 2J0WA 4OJHA 4KAIA 3MZIA 4C8OA 2ACYA 5A8RA 2FLNA 3GV5B 4C0HA 4HH0A 1U1OA 4DG1A 3H5XA 2EFQA 2RS8A 2E1CA 5M2RA 3G8TA 1NK8A 3MF5A 3MM8A 5KFEA 1UWBA 5J2MA 2UUTA 5A8WB 3FEZA 3OJSA 3ZZUA 4Q2MA 2YX1A 4IDKA 2YVSA 1JLEB 4NLTA 2ZJQQ 1WHVA 2O01C 3ZZOA 3QJLA 2UXCF 5KAKA 4PQUA 2K1RA 4YY3F 4ES2A 5AE3A 2AJ0A 2ILZA 3E51A 3I0SA 3MEEB 4JI6F 4I2PB 3DLEB 1E6VA 4Y2MA 5KFTA 3K58A 1C1BB 2LVWA 2D1CA 1FCAA 2QLXA 1FXLA 2XMUA 1HQEB 5F3TA 4QWBA 5L9NA 5DQHA 2NPIA 4B9SA 1WTFA 2NLWA 1V3SA 2HVZA 1L5UA 3ZZZA 5GVQA 3OJUA 4NLYA 3CCMS 2CQ3A 3QWPA 3M6WA 3RU0A 4PXEA 1SIWB 4URSA 2DPJA 4ZVEA 4CO3A 5IM0A 3OV7A 3DGPA 1AFIA 2J9CA 1N5QA 2RSQA 3HF5A 1UVJA 1FD8A 4RUCA 5DGBA 4LT6A 4ED0A 1Q79A 1S6QB 4DSKA 2RQ4A 1YVFA 3UR3C 1X4AA 4OQJA 3HDSA 5J1EA 2W7AA 1JNZB 3T6BA 2ROPA 5J2MB 5JVHQ 1RJJA 1LWCA 1S4FA 2DNGA 4QW8A 4C0BA 1X5OA 2CRLA 2RQKA 4EU0A 2CQ0A 4J9MA 1C0UA 3OFFA 1KN6A 5EX3A 5KOXA 3CIZA 1LOUA 2KRBA 1OWXA 3CCUS 4RW6B 1VRTB 4YP3A 1S9EA 4DV6F 2YKQA 2LEPA 4BHQA 1S6UA 5GAEI 1GAOA 3PJXA 5KT4A 2O1PA 1HPZB 4DSEA 4FPRA 2ZD1A 4ECQA 4EZ6A 4ED5A 1UVIA 3M2UA 1ZYQA 4DDFA 4QW9A 5KG4A 2AW0A 2V9WA 3QGGA 3KFWX 3ZZPA 3I55S 2AYGA 3N9UC 4OI0A 2ZKUA 3IRWP 4OLOA 3LOUA 1HNIB 3O44A 4MYTA 3FRZA 4IG3B 5C25A 5CYQB 4OJ1A 1APSA 4DQPA 4ZLPA 1S79A 1HFEL 2YKPA 3J7YU 5F9NA 5IT9Y 2HNZB 1RTHA 2VB6A 4NL5A 2QLWA 5KFGA 4QWCA 2YWHA 3HJFA 2MPUA 1H38A 1N34F 2ZH1A 3CCZA 4KBIA 2E7XA 5KFDA 3MD1A 4RW8B 1KQFB 1NZAA 3N4WA 4ZPTR 4ZMMA 3OL6A 2W25A 1TUVA 3DI6B 4I68A 4NWBA 4IUFA 3W2WB 2YTCA 2XMMA 1KTVA 2AJQA 2IC3A 2CQHA 4YB7A 2L3MA 1FK9B 2FLOA 2V4JA 3GZ7A 3CD0A 3LH2S 3DOKA 1HD1A 2KO1A 4ZP7A 4HT5A 4OHZA 1RI7A 2HS4A 3LGMA 3H59A 1N5VA 4NLPA 1ROFA 3T5HA 1T03B 1R8HA 2YNGB 1SIZA 1Q81T 5B08A 5FD1A 4QWEA 2ZNZA 3G86A 4OIXA 1UWBB 1TL4A 2E5IA 1LW0B 2LLZA 2WCXA 4V19J 5DM6Q 1N0VC 4DLGA 1FRMA 2OSRA 3NNHA 5F8MA 4QWDA