4K4UA

Poliovirus polymerase elongation complex (r5_form)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
462
structure length
462
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGMSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of coxsackievirus, rhinovirus, and poliovirus polymerase elongation complexes solved by engineering RNA mediated crystal contacts.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 135
structure length 462
sequence length 462
chains with identical sequence E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4k4uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k4uA02
4MKBA 4O3PA 1VRUA 2XCAA 1IKWB 1NHVA 1TKZA 3DM2B 4J9OA 3DDKA 3FQKA 3D5MA 1FK9B 1SH3A 1S1WA 2IAJB 3IRXB 2V4QA 1J5OB 1TKXB 1SH0A 5DGAA 4K4TA 4KSEB 4EEYA 5D3GA 1K1QA 5FDLB 4MFBB 3V6KA 3H4DA 1C1BB 1XR6A 5KFWA 3DYAA 2R8GA 3CIZA 4DL2A 3PR5B 1T05A 3CJ0A 2OPQA 2FJVA 4O4GA 3FRZA 5C42A 1TL1B 1UWBA 1JXLA 4ZPCA 2IM1A 4Q8EA 1RT1A 4I2PB 4RW4A 4IOBA 1TKXA 3MEGB 3RB3A 1LWCB 4I2QB 2JC1A 2WCXA 4R8UA 5DLFA 2C2EA 1JLEA 4KFBB 2VA2A 5HP1B 3M9MB 4ZP7A 1TL3B 4EBEA 3KLEB 4RZRA 3PJXA 3MECA 5KT7A 1EETB 1RT2B 3GILA 3IG1B 3DLEB 4LSNA 2JC0A 5KFDA 4DEZA 3HVWA 1HNVA 3ISNC 2YNHA 4JUZA 2O5DA 3DOLB 4H4MB 4O44B 2ASLA 4MKAA 1HARA 4K4SA 4I7FB 4WXWA 5CYQA 4ECQA 1RYSA 1HPZA 4TYBA 4G1QB 2OPQB 3NBPA 2W7OA 4IR9A 4ECRA 3V6DA 1RT5B 2IM2A 1HMVA 4MH8A 1N6QA 1S1XB 2I5JB 3V4IB 3D28A 3OHAA 3DLKA 1C0UB 4O3QA 4ZVFA 1LWCA 4F4YA 4WZQA 1FKOA 3CDEA 1J5OA 2HMIB 4ED8A 2DPIA 1IKYA 4F4XA 2YNIA 3FQLA 4I7FA 4EYIB 3Q8RB 3GIIA 3NKYA 4ED7A 4Y2CA 2OPSA 3DOKA 5KFZA 4WXOA 3H5SA 3KHGA 4PUOB 4RW7A 4GC6A 3DRSB 3GIJA 4YMEA 2C22A 1S1TA 3NAIA 1RTHB 4R5PA 1LWFB 2W9BB 2W8KA 5L1LA 2VA3A 2OH2A 4ECSA 4H4OB 4IG3B 3I0SB 2B5JA 2D3UA 3DOLA 3LP0A 1C2PA 4LSLA 4QPXA 1RA7A 5KFRA 4PQUA 3UQSA 2WOMA 4M95A 3RB6A 3OLAA 1JLEB 4K4WA 3MEDB 4RW8B 3KK1A 2HNZA 5KFEA 3PW2A 2AQ4A 2BRKA 3KLEA 3BGRA 2IMWP 3DRPB 1S1XA 2I5JA 2ILYA 1JIHA 4PWDB 1N6QB 3RB4A 4O3SA 3DMJA 4EBDA 4G3IA 3E01A 3SI8A 2FVCA 4ICLB 3DI6A 1IKXA 2ZD1B 4EYHB 5F8MA 5KFMA 4NLRA 4NZ0A 2R8IA 3H40A 5HLFA 3GIKA 4MK8A 2YKMA 4Q0BB 1JLQB 5KFPA 4RW9A 3RB0A 5K14B 1LWFA 4NLDA 1RT4A 2AX1A 2XI2A 2DPJA 3DM2A 1HQUA 2CKWA 1JKHA 5KFOA 1KHVA 3OLBA 3QO9B 3H2LA 3LP0B 4WE1B 4ECXA 4MK9A 3MR2A 2WONA 3QGHA 4KV8B 4TYAA 5L1JA 2YNIB 4NRTA 3I5CA 4IH6A 3N6NA 2BANA 4IQXA 2YKNA 5KFCA 3KLFB 5HROA 5F9LA 4R0EA 3NMAA 4WFZA 3DOKB 4URGA 4WFYA 1U09A 3HKWA 3FDSA 1IKVB 5C24B 2E9TA 3OL8A 4K4YA 1RTJB 3RBEA 3QZ7A 3G86A 1QAIA 4ICLA 1XR7A 1FK9A 2IAJA 1JLFA 4KO0B 2WOMB 4RU9A 5KFBA 3LAKA 2BQ3A 1T3NA 4U6PA 4Q45A 5DG9A 3CJ3A 3T5KA 2V9WA 4X2BA 3QLHA 3KLHB 4J9KA 2UUWA 2UVUA 1RT4B 1C0TB 3DLEA 1RTIA 4TY8B 4WE1A 3DMJB 1FKPB 1HNVB 3PHEA 3RAXA 4J9QA 2E9ZA 2RF2A 3H5YA 2YNFA 3EPIA 5F8LA 2W9CA 2GIQA 3ISND 3OHBA 2EC0A 3KMQA 1T03B 1S4FA 5DQIA 2UVWA 4RNNA 2R2TA 1TVRB 2I1RA 4NLPA 3IN5A 2WB4A 4KKOB 4PUOA 1LW2B 2AGOA 1N48A 4GC7A 2OPPA 1HMVB 2C2DA 5KG4A 4ZP9A 1LW0B 1RT5A 3CJ4A 1VRTA 2IC3A 2VG7A 4DG1B 2XC9A 1JLBB 3MR5A 3LP1B 2B6AA 3PJWA 5DQHA 2FVSA 4NLGA 1FKOB 4I2PA 4RW4B 4J9NA 4ED6A 4K4XA 3UR0A 4NLXA 4J9LA 1TQLA 2YNFB 2WONB 1RT7A 2ZKUA 2HWIA 3M9OB 2AWZA 1BQMB 1CSJA 4NLYA 1GX6A 4KBIA 1JLGB 1TVRA 4DL6A 5KT4A 2WRMA 3G6YA 3V6JA 1S6QB 1D1UA 1RT2A 1VRUB 4RUAA 4R5PB 4J9RA 4YR3A 3GV8B 3C6TB 2IM3A 3ITHB 5J2NA 2B5JB 1C0UA 3BJYA 4O3NA 5JUMA 4ECTA 2YNHB 1N56A 4ECUA 2ILZA 1IKXB 2ZD1A 5KFYA 5KFUA 3JSMA 5EDWA 4K4ZA 4EO6A 5KFQA 3PW5A 1TKTB 1S6PB 1LW0A 1HYSA 3PW4A 4QWAA 3IS9B 3QGGA 2ZE2B 2E9RX 4NCGA 1S0NA 1S0OA 5HBMB 1GX5A 3HVTA 4F4WA 3DLKB 4Q8FA 5DG7A 2JEJA 3MFHA 2XCPA 3CJ2A 1RT7B 2W9CB 1S97A 2JEIA 4KE5A 4F50A 2IA6A 3H5UA 5KFGA 3KOAA 3CDWA 2JLEA 1R0AB 1NHUA 4ZPAA 4TY9A 1T05B 3MR3A 5C5JA 1S1TB 2V4RA 3RBDA 3HVAA 2OPRB 1MMLA 5EWEA 5KG5A 3KHRA 5J2NB 3I0SA 4MIBA 4MIAA 5EWFA 3KMSA 3C6UA 4KFBA 1RT6B 3DLGB 1EP4B 3TAMA 2W8LA 4FS1A 3LANA 2AGPA 3I5BA 5F8GA 5KFXA 1BQNB 2YKMB 4Q0BA 4IFYB 4Q44A 1ZTWA 1TKTA 3BGRB 4ZP8A 4TQSA 1W25A 1UWBB 5F8JA 2R2RA 4IFVB 3Q8QB 3E51A 1RT1B 1WNEA 5HBMA 4K50A 3OL6A 4H4MA 3LP2B 1RYRA 4IRDA 4KAIA 2YNGA 4Y3CA 4WZMA 4O4RA 2RKIA 5L9XA 1EP4A 5HROB 4ED3A 2ATLA 3IGNA 4G1QA 4RUCA 2R2SA 4NLOA 1HPZB 3KLGB 5KFKA 1EETA 3FFIA 5KFTA 4DL4A 4LQ3A 4ZHRA 3EZUA 1N4LA 2RDJA 4TY8A 1QUVA 5KT6A 4O3RA 1C1CB 3CJ5A 1HNIB 2J6SA 2W9AA 2IM0A 2FVPA 4YQWA 2F8EX 2JEGA 3FSIA 4RNFA 5J2QB 4IR1A 3Q8PB 2UUTA 4JV1A 4IFYA 2OPPB 1BQNA 3V6DB 4O4GB 4J9MA 1SUQB 2J6TA 3I0RA 1SV5B 2IC3B 2VG7B 5J1EB 2B6AB 3KLIB 2FVQA 1IM4A 1HQEA 5J2PB 2V0NA 5FDLA 2QV6A 5JXSA 1S10A 2JEFA 1S1VA 5KFVA 4H54A 1T03A 2HNZB 1RT6A 3DLGA 4RW8A 1S1UA 2VG5B 5I3UB 3T5JA 2C2RA 1K1SA 3JYTB 3QLHB 3KLHA 3DRPA 1RTHA 5KG6A 1RT3B 2XGQA 4Y34A 3QIDA 1C0TA 5I42B 3G6VA 4H4OA 3QGIA 1FKPA 3IRXA 3M9NB 2ASJA 3V6HA 3H59A 4NLQA 1HNIA 3IGVA 2GC8A 4PQUB 4MK7A 5F8NA 2BE2A 3MEEB 1ZTTA 3LP2A 3MF5A 1KHWA 2FJXA 2IJNA 2RKIB 3QIPA 4ECWA 4DL5A 1RA6A 5KG0A 1S6QA 4OL8A 1OS5A 1SV5A 4ZP6A 3HVTB 1JLBA 5C24A 4RNOA 2FLLA 2AX0A 1SH2A 2ZE2A 4NCGB 3V4IA 2HNDB 1JX4A 1LWEA 4NRUA 3GYNA 4O3OA 2HNYA 1QAJA 3MFIA 3MEEA 3GV5B 1RAJA 4ED2A 5KFFA 1JLAA 5KFHA 4YR0A 3JYTA 5KG7A 1QE1B 2VG6A 2VG5A 4QW9A 5L1IA 2BQUA 4KHMA 4FBUA 3DRSA 4YP3A 3KNAA 4J9PA 5J2MA 4JV2A 4ED1A 1JLCA 5I42A 3GQCA 3ITHA 3NL0A 4RW6A 3QO9A 4U7CA 4TQRA 4LSNB 2WHOA 3M8QB 1XR5A 4NLWA 5J1EA 1DLOB 5KFLA 1TV6A 4ZVHA 2RF2B 3KK3A 4O44A 5T14A 2R8KA 2YNGB 3T1AA 3T5HA 3OSPA 2OPSB 3I5AA 1LW2A 4IG0A 5DQGA 1QE1A 2VG6B 5EWGA 4KKOA 3NBPB 4WFXA 3GV7B 4DL3A 1S49A 2ALZA 4IFVA 3KJVA 3KLVA 2WK4A 1RTJA 3H98A 4ECVA 2AGQA 5KFIA 4FBTA 2XI3A 4B3OA 2HNDA 1S9EB 1C1CA 4ZPDA 5C25A 4J9SA 3UPFA 4KO0A 4MFBA 5KT2A 1Z4UA 2IJFA 3BR9A 3V81A 5D3GB 3TAMB 4ECYA 3MEDA 4RNHA 4K4VA 4ID5A 3KK1B 3TVKA 3T5LA 1I6JA 1TL1A 1IKWA 1TKZB 1JLCB 4RW7B 3NGDA 5C42B 4YR2A 4ZHRB 2R2UA 2OPRA 4XO0A 3BQ0A 4ZVGA 1RTIB 1HQUB 3OL9A 2HAIA 3C6TA 4IG3A 2BRLA 2W9BA 3QYYA 5KFNA 3KHHA 1DLOA 3CWJA 1RDRA 2D7SA 4R8UB 4Q43A 2AU0A 3MEGA 4KV8A 1REVA 4NLUA 3KK2B 4F4ZA 3V81B 4KB7A 2HNYB 5HLFB 3BQ2A 1BQMA 1T94A 4WYLA 2B43A 2D41A 2D3ZA 4IRKA 3PR4A 3I0RB 5K14A 4ZPBA 3KJVB 3RAQA 1VRTB 4HYKA 2ASDA 1HYSB 3LAMA 3LP1A 4RNMA 3ICLA 1S9EA 3M8QA 4JV0A 5J2PA 4RW6B 2XGPA 3KLIA 1TP7A 5L1KA 4IRCA 2QE5A 3NAHA 1DTTA 3CO9A 3M8PA 3QZ8A 4EBCA 4TLRA 3N6MA 3T19A 5KT5A 3H4BA 3KK3B 3BQ1A 2CJQA 4LQ9A 4URQU 5CYQB 3DYAB 1S0MA 2FLNA 2RDIA 4EO8A 1R0AA 1S48A 1S6PA 4NYZA 3MECB 1JLQA 3H5XA 3DRRA 3FFIB 3IG1A 3BSOA 3EPGA 4ED0A 4URSA 4QWCA 1JLFB 4M94A 1S9GA 3G6XA 4I2QA 4LSLB 5DG8A 1RTDB 3M8PB 1S1VB 2FVRA 4K4UA 1DTQB 5CYMA 3BSNA 5KFAA 3VQSA 1TL3A 1KLMA 1JLAB 4ID5B 4IKAA 3CDUA 4ZMMA 3Q8SB 2IBKA 1MU2A 2UVRA 3HHKA 4DG1A 5F9NA 3CVKA 4IDKA 1IKVA 4KHRA 1HQEB 1YVFA 1N5YA 4QWBA 1IKYB 2UVVA 4ECZA 4NLSA 1RTDA 2BE2B 3MR6A 3PVXA 3C6UB 2HMIA 3BSCA 5KG2A 5KFJA 4QWDA 5EUHA 2BQRA 3QIPB 1S1UB 5I3UA 4QW8A 1JLGA 3BREA 2HWHA 5J2MB 3BSAA 3TQ1A 4Y2AA 5F8HA 3LALA 3KHLA 1JKHB 1S1WB 1NNDA 4XPEA 3DI6B 3SFUA 5KG1A 5F8IA 3E01B 4WYWA 3OSNA 1N5YB 1DTQA 5CYMB 2C28A 1S9FA 1LWEB 2GIRA 2R8JA 1DTTB 4IH7A 2J6UA 5HP1A 2W7PA 4FS2A 5J2QA 3UDLA 5KFSA 1MU2B 3KLGA 4NLTA 4RW9B 4IH5A 4DL7A 5DLGA 4XPCA 3PW7A 3SFGA 3PW0A 2XWYA 3N6LA 1SUQA 3DRRB 3IS9A 2FJWA 2R8HA 1D0EA 2FLPA 4HKQA 4PWDA 5C25B 4IDKB 4TXSA 4B3OB 4TN2A 5KG3A 2BR0A 4ZVEA 4NLVA 2WTFA 1S9GB 1REVB 3KK2A 1TV6B 2BANB 2YKNB 3KLFA 3JSMB 5KT3A 1C1BA 3MTKA 3GIMA 1KLMB 4IG0B 3PZPA 5DGBA 1ZETA 3OL7A 4QWEA 1RT3A
chains in the Genus database with same CATH superfamily
3D6HB 3PG9A 4L72B 5AXLA 2ROEA 4MIWA 1U7LA 2ZC3A 2MZ1A 2XCAA 4J9OA 4V19X 4K2JA 3SBMA 4AL6A 3D5MA 4LF7J 1FK9B 2IAJB 4I56A 1R89A 1M5OC 4EZ9A 3V5RA 2RRAA 4K4TA 2DHGA 2GGPB 3EGWB 4KSEB 2DVIA 3HFKA 3J80U 4MFBB 3ZZOA 4E2FB 5M2UA 3H4DA 1LEOA 4YHHJ 1GTEA 3IWLA 1XR6A 5KFWA 4B3SF 1N5QA 4P2SA 5HJXA 5FLXY 2HQCA 1HKAA 2QSFA 3T1YF 3R5DA 4OYAA 2OPQA 4O4GA 1VGYA 2UV8G 2J8AA 3G4SS 1KVJA 2HBZB 3OTOF 4ZPCA 2IM1A 1OSCA 2HHPA 2B7CB 4WBFA 1RT1A 1FT8A 1ZM2A 2UZAA 5A8KA 5F3TA 3EGZA 2BJEA 1PC4A 3FSYA 4A8WA 1VIXA 1VQOS 1CEZA 2RD5C 1JLEA 2AJ2A 3KUHA 2ZH6A 4KFBB 1F3VA 5AJ3F 5HP1B 4I6AA 3ENQA 5SZTA 3W9HA 4ZP7A 1MWQA 5CD4A 3M9MB 3OTCA 3T6BA 3W8PA 3KLEB 3CT9A 3MM8A 3QGPA 3MGJA 1EETB 3TUZC 3ZTQA 4DR3F 5A2QY 1XBWA 2HHTA 3CSKA 5KFDA 1UFKA 3DGPB 4FF4A 1B4SA 1Y5LB 2EBEA 3HVWA 3ISNC 2YNHA 3BBBA 2O5DA 3DOLB 5KOXA 1U4BA 1LNQA 1TMMA 2AIRB 4YHHF 3VCDA 3D2WA 1IR2A 2JJ4D 3PFOA 4OV6A 4ECQA 1VQLS 3QJJA 1HPZA 5IS2A 2CDQA 1HWJA 1RKIA 1VJQA 2CJBA 1VQMS 1VFJA 4DFJA 5JVHQ 4ECRA 1HBOA 2VBZA 4DZDA 3DHWC 4MH8A 2ACMA 3BH7B 1URRA 4WKRA 2QFIA 1PBAA 3P5TL 1FJCA 2C3UA 1C0UB 1RAIB 1LWCA 4GO7X 3FRYA 3EX7B 4A8QA 1VQPS 5A8RB 1J5OA 2XTDA 2DPIA 4ZPTR 3AQOA 4FF3A 1KQGB 5HAOA 1BE4A 3NNCA 1RABB 4PXDA 4LF4J 3MOJB 5IQQA 1B0PA 4ED7A 1Z2ZA 4ERDA 2VKZG 4WXOA 3KHGA 3GTYX 4GC6A 5B0AA 1F5CA 2MGZB 1UEUA 3PRVA 3GIJA 3CPWR 1RISA 1P1LA 2DEIA 4R5PA 3CMES 4LVNP 1LWFB 2W9BB 4LFCJ 1GEHA 1F0XA 3AXMA 2H3EB 4QZVB 3R9LA 4ECSA 2OH2A 3M6XA 4RWXA 4DV6J 5D0HA 2RUGA 2WBRA 3NS5A 1CS4A 1Q78A 3GP9A 3QBCA 1DQAA 3VGTA 1C2PA 4LSLA 2HZVA 4F02A 1PGZA 5KFRA 4JI3J 3UQSA 4M5DA 4RW8B 1XMOF 3HHLD 4Q2MA 2VD3A 2CPEA 1VBYA 5B0BA 2NUHA 3FBFA 2BXJA 2KZZA 3I55S 4CTAA 1FVQA 2GVDA 2I5JA 1XWLA 5B0DA 2YKPA 5H9FJ 4UZBA 1N6QB 4OHWA 2E5LF 2CPYA 2W2NP 2UUBF 4O3SA 5GAGI 1VRQC 3N9UC 3E01A 1PJ5A 2J0XA 2FVCA 2GJ2A 4ICLB 4USWA 4C9DA 4EYHB 5KFMA 4HEA9 3UI3A 5GMKa 2LDIA 3H40A 4OZNA 2YKMA 1U49A 1JLQB 4C97A 2X1AA 5K14B 1R7IA 4JI1J 4NLDA 3AY0A 2AX1A 5HMZA 4DFPA 1ZM4A 3J7Z5 3MM6A 3JS9A 4U9RA 2POKA 3AX2A 3DOMB 2NXUA 5KFOA 4LF7F 1QTNB 3QO9B 4NXMF 4WE1B 2D3O1 2BVZA 1WWHA 4ITSA 3HJVA 1WEZA 3OUYA 4C8LA 4KV8B 1N32J 1TUWA 3FBBA 2Y8YA 2YWGA 4IOAQ 1T95A 4EGLA 1NAQA 2NXEA 4IQXA 4U7UK 1D9DA 5HROA 4R0EA 3NMAA 4NE9C 4A8MP 4OI6A 2Q66A 4WFZA 3B6BA 2L9WA 3DOKB 1MN7A 3HKWA 3W9IA 5C24B 3RBEA 2E9TA 1RTJB 4Y2KA 2FJDB 5ETOA 3W5ZA 5IZHA 3V2UC 2B4PA 3G86A 1A0OB 3QZ7A 4L6V3 3WX8A 2QLWA 2ZJPQ 2XB2D 4C8YA 4NL5A 1VLOA 1N52B 4X64F 4KO0B 2A0FB 1FE4A 1M0SA 4P7TA 4RU9A 2VOOA 2VFRA 5KFBA 1ITPA 2V5HG 1WSRA 3BO2A 2DRBA 1RCOB 4Q45A 2IRYA 1PBUA 4P2MA 4CLLA 4USUA 2HBRB 3IAM9 2PI4A 4YUDA 1YRTA 5E33A 4PWUA 5AE2A 2UVUA 2R7UA 2QJ3A 3DLEA 1RTIA 4TY8B 2J5AA 5LMNJ 3UCZP 2UXCJ 3PHEA 3OJSA 2R7TA 3PKYA 1A9NB 2E9ZA 2DCUB 2O1PA 3H5YA 2CPZA 2GJFA 3EICA 2W9CA 2GIQA 4HTIA 3OHBA 2RS2A 2YQ1A 4ZLLA 4LF6J 1ZH5A 2FHJD 1TVRB 2MZSA 4NLPA 4OX8A 4B3RJ 1U26A 3SDEB 1IBMJ 1ZPVA 2AGOA 2C2DA 1U2CA 1HMVB 2OPPA 2WVCA 4ZP9A 4KGMA 4YN3B 2BJ1A 1UW4A 4KHPF 1JLBB 5DQHA 3VAIA 3QFHA 4Y65A 5E3CA 1DAXA 1FKOB 4BWJA 4ZIWA 2HQIA 4K4XA 1PYTA 4YOEA 3U1MA 3UR0A 2G2OA 4JYAF 2YNFB 2WONB 3DC2A 2I38A 1HNXJ 3UD5A 1CG2A 2HGNA 1B99A 3KWMA 1CSJA 1BY9A 1FESA 4PRFA 2GW8A 1D1UA 3TR5A 1PKUA 1YJRA 1S7IA 1X5SA 2HFOA 2HQ3A 2ZBCA 4RJVA 5GAEI 4R5PB 1GT8A 2IM3A 1OWXA 3C6TB 5JJBA 3GV8B 3T3FA 2DY9A 4O3NA 3R8YA 2EW9A 2YNHB 2MKHA 2XMTA 5HN0A 5JUMA 2HKEA 1CJVB 5E3PA 3G6ES 4GKJJ 2GO9A 1IKXB 2A10A 3R7SB 5KFYA 2DGVA 4NA1A 3FBCA 5KFUA 3UW1A 1YJ9S 4L74A 1FTRA 2KRBA 1DJ0A 1OM2A 2RVJA 4EO6A 1HHTP 3CJRA 2AYEA 2XZ2A 2F65A 3KG1A 1UTAA 2VC1A 2VFUA 4OI4A 2UUBJ 1DZ5A 1HYSA 1S0NA 4W92B 2ZH4A 1KWMA 1S57A 1NJXA 4CH0S 3HVTA 6FD1A 4LIRA 5HBMB 4F4WA 2YH1A 3O2IA 4Q8FA 1U6ZA 3MFHA 4FYVB 2GMHA 2HVDA 4LF2A 2FPHX 3G87A 1RT7B 5ETSA 3VR1A 2JWNA 3TAQA 4KE5A 4F50A 2JEIA 3H5UA 3M2VA 3SIPB 4CLTA 2A2CA 5C7PA 2JLEA 4BC9A 3DXBA 1B64A 3QRRA 1T9XA 2V4RA 1P6TA 2F40A 3ZTRA 1SKSA 1RXOB 3CCWA 5EWEA 2RJZA 3T1HF 1I5OB 1NKCA 3L9ZA 2MQLA 3KHRA 4FF2A 2IFXA 1Y3KA 1ZM9A 1HD0A 2M8HA 2DXDA 1U8SA 4X4PA 4DJBA 3PIPQ 1WC4A 3CE8A 2MZTA 3UN3A 1IBKF 2BZ2A 1EQMA 4KGZB 4F3MA 2RMLA 3W2VA 3TWZA 4Q44A 4KTQA 3CDAA 3BO3A 4ZP8A 1B3TA 1HNWF 1WKKA 2FZKB 2OMLA 2UXBJ 2MY7A 4IFVB 2NPFA 2W24A 1JJHA 1K9MT 4DV3F 2KVIA 3E51A 5HBMA 1OPIA 4DDFA 4K50A 4B9NA 1NCLA 3BYPA 3UE2A 1TL7A 3BDEA 3NLCA 4H4MA 4F25A 3G2XA 1RAFB 4KAIA 3MM5B 2RKIA 3US5A 4TKTA 5K8OA 1M5KC 4FP9A 1GXUA 4RUCA 3A8EA 1X7VA 4BS2A 4RUBA 3U1NA 5KFTA 2ADBA 4ZHRA 3EZUA 5E2QA 3DGVA 4TY8A 1HNIB 2J6SA 3MMAA 3KTQA 2P9EA 2W9AA 4B3RF 3VAJA 3HJFA 2VQEJ 5IFMA 2IHR1 4KPYA 4V19J 1N54B 2KI2A 4LRDA 3FSIA 3BDPA 2CQ1A 4F7VA 4IFYA 1Y5IB 1EB0A 3QQCD 1U6BA 4DUTA 1R27B 3V6DB 3HFZB 2E1MC 1N0UA 1I51B 2GQ2A 3AOBA 2DJWA 1SV5B 2IC3B 2UXBF 2DR6A 1G7CB 2VPXB 1LQ9A 1X4EA 3RBXA 4WK3A 2FVQA 2W4DA 2RQ4A 1HQEA 2K1RB 3MHYA 3ADAC 5FDLA 4ZJQA 4M63A 2R7XA 2R7OA 1S1VA 2KG0A 3J81Y 1T03A 4UUXA 4RW8A 1S1UA 3AH6A 3CO0P 5LXYA 2HLUA 4RUHA 3G9CA 2AZ1A 5U47A 3PCOB 3G82B 4DQSA 4Y34A 1YLXA 1BC6A 2CA9A 2G2YA 5ETKA 3BEGB 4MYTA 3M9NB 1CQMA 4LRFA 4YY3F 3F44A 4PKDB 3V6HA 2ASJA 3KJQB 1HNIA 2DNHA 3IGVA 2GC8A 4GRSA 3IWXA 1N36F 1EX8A 1FD2A 1P9YA 3BF4A 1OYDA 1MWYA 2XHWA 4HH1A 1VQKS 3HZEA 3LP2A 3GJRB 4PG5A 3MF5A 4OZLA 1ZTTA 1NK8A 3PJ9A 3QATA 3QFWA 3BZQA 5KG0A 1AA1B 2LA4A 4HHUA 1N5TA 4CP5A 3H20A 3C46A 2FJAB 4ZP6A 2VZ9A 3OTBA 1U1MA 3DLHA 4IO9Q 1PO6A 4ES3A 2FLLA 2UUAF 1M1KT 2ZBQA 3DKDA 4OFZA 1B0TA 2AJFE 2OLWA 5DZ7A 1S6UA 2HNDB 4OX6A 1LWEA 2K1RA 2ERRA 3R97A 3CCQS 3HHNB 1URNA 2DNQA 1YITS 3GV5B 1RAJA 1R8CA 4XAKA 5M2RA 4QIFA 3JYTA 1F6TA 4QW9A 5MLCV 4FBUA 1RWWB 3DRSA 3N79A 3KNAA 1XTZA 3QAEA 1UKUA 3HI9A 2RIJA 4A8KA 3M2RB 5K9FA 2A6OA 1QTMA 3G82A 2VKRA 4EWTA 4RW6A 4M5JA 3QO9A 4U7CA 2ZHAA 3MCSA 2WHOA 3EWGA 3PIOQ 4NLWA 3QRPA 4G6VB 2P8IA 2DR7A 2YX7A 2RF2B 5ETVA 4Y28C 4CT8A 3KK3A 1Q82T 2JOQA 1FNXH 3MR2A 4ELUA 3T5HA 1F5BA 2EBGA 4IO1A 1JJ2R 1LW2A 3AB4B 2DGSA 1QE1A 2LMIA 5DQGA 4KKOA 3NBPB 3GV7B 1RLDA 4AUKA 4NCBA 1S49A 2Z4PA 2XMAA 4M5GA 5I3PA 3CCZA 3DU5A 3CDBA 4DF8A 3ENAA 4EFAC 2Y0SD 5LL6d 2FIUA 2M3DA 4B3OA 1FWLA 1UA0A 4ZPDA 3ZZZA 1TK5A 3VAMA 4TU7A 3ZZYA 3OV7A 5D78A 1FF2A 2QG9B 3MEDA 2Y1IA 3SQGB 2HRUA 2BKNA 5ETRA 2AEJA 1I6JA 2R7QA 3I4HX 4KJIA 1X8DA 3M2UB 3AD7C 4AXJA 3NCRA 3K17A 5C42B 4X84A 4X66J 2HAIA 3FGVA 3FMBA 4IG3A 2BRLA 1C4AA 5LOQA 3OT9A 1DLOA 1FKAF 2D7SA 2HBQB 2DO4A 4LF1A 2ZH2A 2R7SA 4N77A 5H9EJ 3KK2B 2AEFA 4FXVA 2LU1A 2HNYB 1NXIA 6AT1B 2KO1A 1TR0A 2L48A 4WYLA 2X7IA 4OHXA 5HVHA 2QA2A 5A8WA 4IRKA 3PR4A 4OYXA 2DD8S 2E7XA 3P4UB 4ZN3A 2J0WA 1Y10A 2M8DB 1VQ9S 3J7A1 3LAMA 4CLWA 3LP1A 4ANCA 2DHXA 3M8QA 4C11A 5J2PA 1HWKA 1N0VC 2Y0BB 3D9BA 4IRCA 2QE5A 4EUVA 4RBVA 3CO9A 4F36A 2JNJA 2NUUG 4HTJA 3RG6A 3GG1A 3IR6B 4TLRA 2MXYA 3H4BA 2CJQA 3M05A 3QSIA 4OI2A 4URQU 4DV4J 3P49B 1RHQB 4EO8A 3TA0A 2F8MA 1S6PA 3OR1B 3MECB 5CCMA 3W61A 5GADI 3NNHA 2CPDA 3BSOA 4N56A 1FRMA 3DGPA 4DR1F 4M94A 1S79A 1S9GA 1V9OA 1CJVA 2CG8A 2CQPA 2CQGA 2L41A 1X0FA 1SJFA 5J1PA 2MKSA 3ZO7A 2NSBA 1NKBA 2J9CA 2V6AA 4ZVUB 4AE5A 4B08A 1VDHA 3LO3A 1TL3A 1JLAB 4PPDA 2GNKA 1IN0A 3MI7X 3Q8SB 1XERA 1NO8A 4JI6F 3W1YC 1J5OB 4C48A 2E5LJ 3WC2A 4OZJA 2BW2A 5CZVA 3RRGA 4IDKA 3RRHA 1IKVA 1HFEL 2JFDA 1QSLA 5IT4A 3H8YA 4OIXA 2GS8A 3K8VA 4C11B 1OJ4A 2LEPA 2ZUGA 4QWBA 1IKYB 3SYZA 2NXNA 4NLSA 3L4BC 1RK8A 1T9TA 2MHNA 1T7PA 3BSCA 3H42A 4OHYA 5I3UA 2MQ8A 1JLGA 3POTB 3ZNUA 4U8VA 2XMMA 1KQKA 3VAFA 3TQ1A 2RUSA 4P10A 1R31A 2U2FA 3CIMA 5F8HA 5D0EA 3VGSA 2VFVA 2EC2A 3K58A 3A8KA 1S77D 1N33F 3K5PA 1JKHB 1XK8A 1NNDA 1BLUA 3IO1A 3DI6B 3Q8YA 3SFUA 1DQ9A 4DUYF 1KONA 2HRYA 1DTQA 3UNGC 2IVMA 2FC9A 1Q53A 4P2FA 2R8JA 1DTTB 1U2RA 3K5NA 2B4VA 1GMWA 2EFGA 3Q2SC 1VK3A 4R25A 3CULA 1YBAA 1LXNA 4YY3J 1MU2B 1RE1B 4NLTA 1WOPA 2FYXA 2J9DA 3MCOA 3P3DA 3MZIA 4RW9B 5DJBA 2EPIA 2XY7A 4F3OA 4NCAA 1N32F 3CC4S 5IM0A 3IS9A 2R8HA 1UA1A 1D0EA 3N4WA 4ER8A 4X4SA 2FLPA 4PWDA 4CNZA 4B3OB 4TN2A 5KG3A 2XZDB 1P27B 1REVB 1TV6B 2DIVA 2E1AA 3GIMA 1C1BA 3MTKA 1YJWS 1KLMB 4MYUA 3UD4P 4JV5J 4OX9F 5DDPC 1WF1A 3PZPA 1FJGF 5DM6Q 4LRCA 2ZOMA 1RA6A 4OJHA 1AYEA 1VRUA 3M2UA 1U0SA 3C3LA 3SV4A 1N33J 5GAHI 1YZ6A 3IRXB 4NEYA 1SH0A 2JLFA 4FVMA 4CQ1A 5DGAA 1K1QA 5FDLB 2BA9A 2E66A 2OTLS 4FYXB 3V6KA 4RWWA 3VVTA 1UVLA 1OO0B 1C1BB 2FZCB 1FRJA 1CJTA 1HA1A 2XSFA 2RQKA 4PZVA 3CIZA 3THPA 5HJYA 3RTVA 5C2CA 4DL2A 3RYLA 2PFFB 4P9SA 5I4MA 2FJVA 7FDRA 1R0CB 1TL1B 3N28A 1Y9OA 1N88A 4DV5F 2ASYA 1JXLA 1TFYA 4LR8A 4WWSA 5IM0B 2F8HA 3GFZA 2GIFA 1LK7A 2LP4A 1Q81T 4I2PB 1MW7A 4RW4A 2ZH5A 3MEGB 1V3RA 2MKCA 1GH8A 3J7ZT 2JC1A 4R8UA 9ATCB 5DLFA 2BX6A 3SV3A 3OXFA 3JQKA 3N5FA 4QJVA 3CEDA 3TUIC 1H6KX 2K3KA 3HPOA 3MPWA 4RZRA 2CNOB 3C19A 2B9YA 3M2RA 2DISA 3MPYA 3IXQA 4ZJOA 5KT7A 1RT2B 3BM7A 4BCAA 3DN9A 4LSNA 3J7YU 2JC0A 3HSJA 1HWIA 2W2MP 2XLKA 3T41A 3MDFA 4H4MB 3Q24A 4O44B 3M6WA 2ASLA 1BUXA 3R6GB 1HARA 3UN5A 2V34A 1X5PA 1YJUA 2LU2A 2PMHA 3IFEA 4PYDA 2VBWA 1VQYA 2BJ8A 4TNOA 1KKHA 2DXEA 3MM8B 4ZA1A 5IT9Y 5SUHA 2H5IB 1CJUA 3FCWA 4IR9A 2H51B 1RT5B 1FEEA 3HKZD 1N6QA 2PEBA 1HI8A 1S1XB 3V4IB 3B4DA 1SL1A 5G0RB 1S76D 2ADCA 4O3QA 1ZBTA 3CDEA 2NYIA 4I1TA 4CO2A 1IKYA 2V94A 3CB4A 4CLPA 4F4XA 2PIIA 2YNIA 1K8AT 4C4WA 3Q83A 4EYIB 4O0NA 1CJTB 4USMA 4DR4F 2VHGA 1NBEB 2E7WA 3POTA 3ET6B 2OEKA 2Y1LB 5T7LA 1NDPA 1RTHB 4A8FA 3GYXB 3J7YI 2Y8WA 2W8KA 5L1LA 3OBIA 1KR4A 2IJRA 5KTQA 2PE8A 2JLGA 1JXVA 3DOLA 3LP0A 3M1VA 3FNNA 3MM7A 3JAMY 2HFVA 3ZZ0A 1WC3A 4K5RA 4PQUA 1VQNS 2WOMA 3RB6A 2GHWA 3OLAA 1JLEB 4K4WA 1NPRA 2Q79A 3MEDB 3KK1A 2HNZA 2LCWA 1F9FA 1HIYA 2JX2A 4FNIA 4WP9A 3PW2A 1T9YA 1H3DA 3IBCB 3W60A 3WC0A 3KLEA 1L3VA 3H7HB 3R5AA 3DRPB 2IMWP 4L75A 1YJ7A 2YWEA 1HBNA 4YFUA 4HACB 2LQ9A 2XY5A 3RB4A 2F4VJ 1X60A 2O3DA 1CC7A 5T41A 1WI6A 2XULA 4EBDA 1CJKB 1M5HA 2N3OA 3HM9A 2ZD1B 3GJQB 3HXMA 1BWVA 1KD1T 4MMOA 2JSXA 1VCTA 3PRBA 2J0QD 3O5TB 3HSGA 4MK8A 4OQJA 3PYFA 1PYSB 3K5OA 1XNRJ 1WKJA 2XWXA 2UU9F 4DR7J 2CJAA 2RH3A 1OSDA 1SCJB 1YWXA 2V2QA 1WJ9A 2WBMA 4DCPB 1JKHA 3AX5A 3P45B 2XSJA 2CFXA 2DT9A 2G9OA 2XMJA 4OZ1A 2R9LA 4ELVA 3O44A 4W90B 4MTPA 3Q89A 2YNIB 4ES2A 2FY8A 1NJIT 3BBFA 2YKNA 2Z2YB 3KLFB 1QSYA 2L3MA 1YQHA 3R7BB 1XMBA 4X65J 2N4CA 3QPIA 4UOHA 3PXGa 2ZM6F 2I2YA 2ZZNA 2K3IA 2CQ3A 2AT1B 1IKVB 1SJQA 5JVGQ 3OL8A 4K4YA 3OR2A 3MMCB 1CULA 1WKLA 4DX5A 4DQIA 1YBUA 1XR7A 2LEAA 2KDOA 3LA0A 3OXLA 5E3RA 1UVJA 4WP8A 3PO4A 3TW0A 2WOMB 2JRSA 2HVIA 5FD1A 1GMVA 2HVZA 4UF4A 2BQ3A 1DRZA 4U6PA 1LFPA 4JBCA 2BOAA 3OR1A 5DG9A 3CJ3A 3C66A 2V9WA 3QLHA 1KEKA 4HT5A 3PYEA 4QIEA 2C2ZB 4J9KA 2KZMA 2YPZA 4LIWA 2YWKA 3C15A 4P6QA 3BBCA 5GAEU 2VB6A 1GFWB 4WE1A 1FKPB 2Y1JA 1Q86T 5A6PA 1RWNB 2HFNA 2EFPA 4W98A 4AQYF 2QLFB 2K8GA 2B4UA 2HS0A 1U2FA 2WVEA 4CWBA 1JWWA 2MMYA 3ZZPA 2EC0A 1RWOB 4KT0C 1GK8A 3P8BB 4Q7AA 3K5LA 2D74B 2OD4A 2PD1A 4M5MA 4Y2MA 1LW2B 2PMZD 4PUOA 3JSRA 5KG4A 1WUUA 4XDDA 1RT5A 3CJ4A 2XC9A 2VG7A 3MR5A 3IBWA 3PJWA 2FVSA 4NLGA 4I2PA 4RW4B 3O8WA 2KT3A 2ZKTA 4WTYA 5ETLA 4J9NA 3RR8A 4J9LA 2XMVA 2NXCA 4N7TA 3HFVA 3OUYB 4J5OA 4WCEQ 3HULA 3ONQA 2HWIA 2G0IA 5L38A 5K20B 2AWZA 1GX6A 2HQDA 4NLYA 3FEYB 4KBIA 3M9OB 1TL5A 1TVRA 3F73A 4A8SA 5IWAF 3V6JA 2AF6A 3NWGA 2WSCC 1S6QB 4CZCA 3EE3A 1RT2A 4RL1A 4CLZA 2CQIA 4J9RA 4YR3A 2BV3A 1BQXA 2GJIA 3NEKA 3K5MA 2PT0A 3ULHA 4CLFA 3ILIA 2B0GA 3FZBA 3WHIA 2ZWOA 4ECTA 3BKFA 3HK2A 3JSMA 2CXEA 5DDOC 1FDBA 2GMLA 4JI3F 4K4ZA 3Q22A 2F1FA 4WTOB 1F2HA 3ZZRA 4DN9A 5KFQA 4LF6F 3PW5A 1SXLA 1TKTB 3TZXA 2VPZB 4DSIA 1CQNA 1RSCA 2E5JA 3SSRA 4EZ6A 3PW4A 4QWAA 3QGGA 2ZE2B 4NCGA 2KYZA 4EK2A 3FEXB 4B02A 5DG7A 2C1EB 1XQIA 2MSTA 2XCPA 3OJUA 5FLXU 2G1HA 1UFLA 2W9CB 2ZH9A 1J27A 3PM9A 2IA6A 5AXKA 3DHXA 4X64J 4C7QA 4ETXA 3KOAA 4DFMA 4USJC 1R0AB 1EIYB 3CNQP 1U6FA 4ZPAA 4TY9A 4DX7A 2OHDA 5C5JA 3MR3A 1U1QA 1WD6A 2ZHOA 3HVAA 2OPRB 3HDSA 3LPYA 2VF3A 3D6MB 4L3NA 5D4NA 5F0UA 2SXLA 3Q0AA 3QT7A 3EZ5A 1OQ3A 3KMSA 3IAS9 2RU3A 4DV5J 3DLGB 1EP4B 4FS1A 2W8LA 4M5HA 2BMBA 2PN6A 4DQQA 2ACYA 1UVMA 1HI0P 1TKTA 4DI6A 4B3MF 1W25A 3MCNA 3HHDA 4EI2A 3TUPA 2PGCA 1PYOB 4NASA 1RT1B 2F4VF 4OJGA 1Y3JA 3M8YA 3RRKA 3M32A 2ZH3A 4J9VA 3BH6B 1RYRA 4IRDA 2YQ0A 4PABA 2YNGA 4CI0B 3AODA 4ED3A 1VQ4S 5L9XA 4K8RA 2ATLA 1BWEA 2HIQA 2DNMA 2R2SA 4NLOA 3EUNA 5KFKA 3LGMA 3A4TA 2DNLA 3GWCA 2FHJA 1EETA 4HI1A 4YDXA 4WF9Q 1KC8T 2LQJA 2YBVA 1X5TA 3N01A 2ZUAA 4WXWA 1VC0A 2XSJB 1N4LA 4PAAA 1AROP 4C3KA 1M5VC 1CVJA 4RKUC 3UDCA 4GO5X 1Y0HA 3T1YJ 1XC9A 2UP1A 3AT1B 2RB7A 1UCNA 4LFAJ 1WTBA 4C8OA 1HWLA 1RZMA 2IM0A 2V1TA 4CH1A 1S6OA 2F8EX 1EHWA 4LSZB 2AV5A 2FGCA 4KQZA 3WIUA 4RNFA 5J2QB 3C2PA 3Q8PB 1FXLA 2UUTA 4JI1F 1N5SA 2DHAA 3KKFA 1BQNA 1F9EB 3GSDA 4BWMA 1HBOB 1VYAA 2HBYB 3GFXA 1SUQB 4CTAB 1ZPWX 3AB2B 2CG4A 4N8NA 5A0YA 3TX0A 4OZ3A 5J1EB 2UUAJ 3R3TA 4PQAA 1NSPA 3KLIB 3TUJC 4FYDA 5J2PB 1D8YA 1T02A 2V0NA 1M1GA 2QV6A 1I94F 1KVKA 1U25A 2GGPA 3LGHA 1S99A 4I4BA 5KFVA 3MUTP 2AD9A 3THVA 2KXFA 1VIOA 5E7OB 5I3UB 2VG5B 2BDPA 1IBCB 3SCKE 1D9FA 1EZZB 3QLHB 2GA7A 1UJ6A 1RT3B 3W65A 1T9UA 2JVOA 1C0TA 3G6VA 2G1DA 5I42B 3ZNJ1 1FKPA 2HHHF 1T0TV 2W2QP 3HF5A 2D9OA 3A1YG 4H4KA 5ETTA 3R5JB 4DS4A 4PQUB 3BGUA 2Z58B 2QO3A 4P72A 5F8NA 5E0OA 2V4JA 3EM1A 3OXGA 2IJNA 2RKIB 5B09A 4ZLNA 3QIPA 2ZH8A 1UMJA 1LKZA 2P9GA 1BXNA 3LF0A 4C98A 4DX6A 2ZEJA 4DN0A 1R8AA 5HVGA 1NSAA 4X62F 2NQPA 2DGQA 5C24A 4CO1A 2ATCB 2QL7B 4N8OA 2XO7A 3CCRS 2UU9J 2Z30B 1FCAA 1FVSA 3FEZA 3MD3A 1SJ3P 5A6WA 3SEOA 1X9WA 3GJTB 4DPXA 3HMJG 4ILRA 4PXCA 1SI9A 3BB5A 3EVOA 3JQMA 1H38A 5AJ3J 1OYEA 2VG6A 3QT8A 2VG5A 3I56S 2BQUA 4KHMA 4F4AA 4USTA 2HHWA 4L76A 1Y00A 4F26A 4XIUA 2KJVA 1JLCA 4ED1A 2Q3PA 2MKJA 4FKYA 3GQCA 1TMJA 4TQRA 5H9EK 1KVIA 4LSNB 2KT5A 3K57A 2ZJRQ 4EMDA 3KG4A 2OI2A 3Q8UA 5B7WA 3O6QA 2KHCA 4G1IA 4O44A 1NK7A 2R8KA 3T1AA 1DFDA 2DNRA 3A8JA 4J91A 2GX8A 3I5AA 3FMWA 1RQ0A 1U8WA 1UL3A 4IG0A 2OEJA 1RAAB 3PFEA 4FXWA 2F4FA 2K7KA 5EWGA 1WG5A 3CCSS 4DL3A 3NNAA 4LJMA 2C2OB 1NRKA 4DL0C 1M5PC 1PILA 4QIWD 4C2MA 2QT7A 3M30B 3KJVA 4FBTA 1RTJA 2QEXS 5KFIA 4JI0J 3D6FB 1RU1A 2JVRA 3OPKA 2ZZMA 4AYBD 2HNDA 1C1CA 3C8YA 4H4KC 3ISZA 4J9SA 4HHJA 1BGXT 4KO0A 4MFBA 1SKWA 2IJFA 3V81A 1I1GA 5IOLA 1VISA 1RUSA 2V4JB 4RNHA 3TAMB 1NDKA 2CPHA 3HX9A 3CJKB 1AFJA 3A13A 3KK1B 3T5LA 2GV1A 1TL1A 1TKZB 4YB6A 3BQ0A 2OPRA 2CJXB 1RTIB 3OL9A 4LFCF 3C6TA 4N76A 2JZ5A 2AU0A 4Q43A 4R8UB 4RU2A 4LF8F 4L3KA 1JK9B 1P1TA 2IRXA 2VL1A 4PR6A 2V2KA 2ZWPA 2DK2A 1O8BA 5HLFB 1BQMA 2XMWA 4QYRA 1EKSA 1T94A 1OIAA 1Q7LB 4K0KF 1FX2A 1FNMA 2CVEA 2RE1A 3FSXA 1HI1A 5K14A 4DSFA 4ZPBA 2ZVIA 1IBLF 2ALYB 1F1BB 4LF9J 4UTGA 4JI4J 4ZPVR 4RNMA 1S9EA 2BJ3A 2CJ9A 5G0RA 4JV0A 3U27A 4RW6B 3BV8A 3UCGA 4DPTA 2Y9HA 3Q2TC 5F3ZA 1Z1ZA 3DXSX 2BE9B 3BGOP 1GNKA 2M0GB 3MMBA 4DV1F 1X4DA 2FC8A 4FN5A 5IXUA 3KK3B 4LQ9A 1S0MA 3AFGA 3DYAB 1AFIA 1WTFA 2B9WA 4DS5A 4ZVOB 1S48A 3T1HJ 1WOSA 5IT9U 1QM9A 1WF2A 4B9SA 4DBQA 1SC6A 3DDIA 1SQGA 2CZVC 2MKKA 3S01A 4Y6IA 3LGNA 1P9QC 4UW2A 3CF5Q 5K8NA 4DR3J 1H2TZ 3AD9C 3BGFA 1VK8A 1XJWB 4URSA 2UXDJ 2QX0A 1BD6A 1RWPB 4GMKA 4I2QA 1X9MA 5IV4A 3MMBB 1S1VB 2FVRA 5CYMA 3G96A 2VODA 5E3QA 2HIYA 3VQSA 5CHCB 3CXCR 1YK9A 2MJNA 4CH7A 4ID5B 1D8ZA 3ILLA 1UJ5A 3BGLA 4DLEA 1SC1B 4RX6A 4ALZA 4QBUA 2R7VA 4CO4A 5K8PA 4DG1A 4YS2A 1JNZB 3JSBA 2E5IA 3EGNA 1Q0NA 2JH3A 5BYRA 1U24A 2CPXA 2XLIA 4YB7A 1N5YA 1NK6A 3M6UA 4C8ZA 4DPUA 3AJ2A 3C6UB 1VLYA 3QRQA 4QWDA 4J37A 5D4LA 6FDRA 3HD2A 3NRBA 4QW8A 3VAHA 1WHYA 3BREA 2Y1RI 3NOCA 5D15A 2H54B 5EX0A 5J2MB 3C14B 3D1QA 2KJWA 4FVCA 3JTNA 4Y2AA 5E3AA 4DPWA 3I32A 2C2MB 2CNKB 3SXLA 5LMNF 1WSVA 1MLAA 3WQPA 4XPEA 3DLJA 5DM7Q 5EGYA 3E01B 2ZJQQ 2GIRA 3BS9A 3I4PA 4ED5A 1L3TA 2MKYA 4IH7A 4NWBA 1ZM3A 1KSPA 4FS2A 2A3JA 2YVSA 3UDLA 2DNOA 1DHMA 1X4AA 4USVA 5IC6B 4JI2F 2VASA 4P2XA 3KLGA 4IH5A 3VVUA 1WEYA 1UEVA 5DLGA 5DDRC 2DKOB 3PX6A 3SFGA 2WVDA 3DCAA 3WBZA 2C42A 2FJWA 1IBMF 1FRLA 1H74A 1RBAA 2C2KB 2DNKA 2O01C 5C25B 3UDEA 1VQ6S 2BR0A 4ZVEA 4NLVA 1FRHA 1BHNA 1CJKA 2Z2LA 2WTFA 1S9GB 2BJ9A 2LKZA 3KNGA 4LF4F 2YKNB 3KLFA 2P9CA 3GE9A 1RWUA 1SL2A 3GG0A 2BYCA 4HVZA 3KFWX 1X4HA 2V8VA 3GB0A 3IC1A 5DGBA 2QGFB 4QYZK 1HWUA 4QWEA 1RTZA 1RT3A 2ZC4A 3TJ9A 4C6AA 2N4DA 4O3PA 4NXNF 1GXTA 1TKZA 3DM2B 4GVBA 3DDKA 1V6HA 3FQKA 3IR5B 5DO2A 2X1BA 1V5VA 2J7KA 1SJ1A 1QY7A 9RUBA 4AD6A 4DR2F 5LMUJ 4CT9A 1Q7YT 1ROFA 1TKXB 3MWBA 4K7QA 2FHOB 2GHVC 2ZH1A 1N8RT 2HHSA 4IYQA 5D3GA 1T11A 2QL5B 3NGTA 2PDAA 2IIHA 4P73A 4BBYA 3SQGA 2ZOGA 3KDOA 5BYSA 2RILA 2R8GA 4LFAF 1T05A 4DWIA 3UD3P 3FRZA 4Y00A 1YRUA 5C42A 5CAAA 5HQ8A 3PHTA 5AXMA 2KH9A 1TZ0A 3KG0A 5I3QA 2OD6A 4Z37A 2VJVA 4IOBA 1TKXA 3HVRA 4DUZJ 2IPOB 2WCXA 3BYRA 5CXTA 1YX2A 2L9DA 2RNEA 3VGVA 3J80Y 2VA2A 1TL3B 4EBEA 1RAGB 2M88A 4OJ1A 3VWSA 1DARA 1N36J 3MECA 2OGUA 1AT1B 1SIWB 3IA0A 1Q79A 3IG1B 1KNZA 1FXDA 4DEZA 2P6SA 1HNVA 4JUZA 3VAKA 2U1AA 2L9NA 1X5OA 1Q8KA 4I6YA 5DZ6A 2IVYA 4I7FB 2CNNB 1NZAA 2HHXA 1RYSA 4TYBA 3KYLA 4E98A 4NMLA 2R7RA 2OPQB 2YKAA 1V5IB 3GLJA 4P71A 3QMQA 3NBPA 1WG4A 2VV5A 4P7VA 2W7OA 1KBRA 2E1CA 2Q1LA 3F56A 1HMVA 2AP6A 1U02A 4FKXA 5A76A 4OI0A 5GVQA 1V3ZA 2J76E 1VBXA 1HNWJ 1IQZA 1KQSR 3VQTA 3JQJA 1EAYC 4ZVFA 3UVJA 4X65F 3OFGA 2IBOA 3CD5A 4WZQA 1FKOA 4F4YA 2HMIB 1QAYA 1RWKB 3FQLA 4BHQA 1TKDA 2M7SA 4HH0A 3GIIA 2E5HA 5EX3A 5LJ5Y 4DV6F 2OPSA 2MTLA 3DOKA 1UAWA 1HR0J 3H5SA 3SDEA 3PKMA 1F2GA 1GMWD 2C22A 1ZOTA 3DRSB 3TX8A 8RUCA 3FKBA 1EQ0A 3TI0A 3TAPA 2AKWB 2OMOA 4OHZA 2MQPA 2XM3A 1X0PA 1RWMB 2CWKA 3GR0A 3I6PA 3I9ZA 2VA3A 4AXIA 4IG3B 4QCLA 4B9TA 2VPWB 4I68A 2D3UA 4YB1P 1QUPA 1KS2A 1UWAA 5ADZA 1IR0A 4FDFA 4M95A 1U0HA 1IM6A 3NG8A 2KG1A 1E6VB 3RU0A 1U47A 5KFEA 1K0TA 1MROB 1YSJA 2BE7D 4QYZJ 2BRKA 1FFSB 2B8PA 3E8OA 3AOAA 2V2ZA 1RWXB 3MM9B 5IT0A 1S1XA 2ILYA 1JIHA 3J7AN 1LOUA 4QOTA 3D0GE 1VC5A 1E6YA 3OTOJ 2QMUB 5IWAJ 4ZCLA 1QLNA 1L5UA 2LQ8A 4A8XA 1WI8A 1OY9A 2EEYA 4C0BA 4HL9A 3FCHA 5F8MA 4U95A 1U1KA 4F0HA 2R8IA 1X31C 4JV5F 3W5YA 5HLFA 4ILMA 4ZIVA 3K89A 4RW9A 3PNIA 1WELA 3D1OA 2G0JA 1LWFA 1Q16B 1RT4A 2Z8QA 4XDCA 2MLZA 2XI2A 3SSSA 5L9NA 1YIJS 3AOCA 4DR2J 3NGRA 2M2BA 3OLBA 2HVEA 4Z2XA 4ECXA 4MK9A 3QGHA 1ZAWA 4B9UA 2XEXA 3R7NB 5L1JA 2PFDA 4NRTA 1N34J 4UY85 3N6NA 1WHXA 1YHQS 2AW0A 2HFSA 1W2IA 5KFCA 3BKTA 4AQYJ 2VQFF 3TRGA 5F9LA 5B0GA 1A7GE 4DV0F 3ENVA 4DR5F 2MDAA 1O51A 2WSEC 4WFYA 3FDSA 2NSCA 4HDGA 1RU2A 1WORA 4FYYB 4B9MA 1QAIA 3BPDA 4OYWA 4ICLA 2ZDOA 2GHPA 2EVZA 4WFAQ 1QDUB 1DBDA 1EJ7L 3L7PA 2CQ2A 4Y2IA 3UR3C 2OIHA 2V8PA 1ULRA 2AJ4A 2AEMA 2GZOA 3W9JA 2G4BA 4DV1J 3LAKA 2P6TA 1T3NA 4X4NA 4USKA 3LWLA 5C2GA 3SZ2A 4OYBA 3W64A 3RW6A 3D67A 3Q86A 3EXCX 1G6BA 4X2BA 2B51A 3KLHB 3M8RA 1RHMB 1RT4B 4E0DA 1C0TB 1YBTA 4UQTA 4CLSA 4HHHA 3TVZA 2HS3A 5LSOA 1IBKJ 1HNVB 3RAXA 1AXQA 2NZCA 4JI6J 3EPIA 1JMTA 5F8LA 2XTEA 1AB8A 3IBFB 4CO5A 3AA8A 3TEHB 2W25A 1S4FA 2UVWA 2OELA 4RNNA 5FIIA 5HQMA 1SPBP 2I1RA 4M1KA 2WB4A 4P52A 3IN5A 2R2TA 2ZH7A 4JYAJ 1TAQA 1DY3A 3E3XA 5JMNA 1LW0B 4ZCKA 3VF0B 2CQHA 1VRTA 3DLBA 7AT1B 2Q6CA 1Y11A 8ATCB 1NB2A 3TARA 4AFFA 2Q6BA 2MQOA 4ED6A 3RR7A 3EMTA 1VHFA 3MAAA 4RO0A 4B3TF 4F4KA 4NLXA 4JOUA 1TQLA 1H98A 2D69A 3ZC4A 1R8PA 2DGOA 2E44A 1RT7A 2B3TB 4AL7A 1LXJA 1FJEB 1WOOA 5HQLA 3MMJA 1UFWA 1BQMB 1VHIA 4I6WA 1JLGB 4DUZF 4DL6A 2LXUA 2CRLA 1NDLA 2NYHA 2R42A 2WRMA 5KT4A 3G6YA 2V68A 3CMAS 3VALA 2XZTB 2I0XA 3FC9A 4Q2LA 4C8NA 5CABA 4ZPWR 3RGIA 5J2NA 2B5JB 1C0UA 2MLXA 3B78A 3OD2A 3PRDA 4YEAA 2MZRA 3BJYA 2MQMA 1HL6A 3CC7S 1IXKA 2RSQA 3AA9A 2ZD1A 2LA6A 4TU9A 2C2NA 1G3OA 2EFQA 4B3SJ 1XN9A 1K44A 3ELHA 2CAJA 3N0VA 1YTYA 2XMUA 5D77A 4RR5A 4CYUA 2VIHA 2PA8D 3MUMP 1S6PB 2A2DA 2XHCA 3F41A 4FPIA 2CWXA 4G65A 4HLBA 1S0OA 3IS9B 1AW0A 4AL5A 2E9RX 3OFEA 4I67A 1GX5A 1WC0A 4DV7J 2DH7A 3DLKB 1NH7A 4NXNJ 2VBXA 3CJ2A 1NPPA 5HVFA 4CIOA 1U1NA 2MPUA 2E1PA 4ZDNA 1NHUA 2QC3A 4DUYJ 1T05B 1S1TB 3IRWP 2MZJA 4OHVA 3RBDA 4AT1B 4NZ6A 3RW7A 5RUBA 2I8EA 5KG5A 5J2NB 3I0SA 2WSFC 4FZVA 2HFUA 1HR0F 4MIAA 2D68A 1HBMB 3QT6A 4FPRA 1FO1A 5EWFA 1NM2A 3C6UA 5J1NA 3MAHA 4KFBA 7FD1A 2VDIA 2ZNZA 5MAOA 3VZHA 5LT5A 1RT6B 1QJHA 3ILJA 1N5VA 4MT1A 2QZ8A 3HHLC 3LANA 2HHUA 3I5BA 2P2CB 3A3PB 5F8GA 1BQNB 2DHHA 2DH9A 5LSLA 4Q0BA 3Q23A 1ZTWA 4A48A 2C3MA 4JI8J 4LF9F 3BGRB 3HHLB 1SIZA 3SCLE 4LT6A 4F3QA 4TQSA 2R2RA 3QSYB 2VH7A 1W2BR 1NJYA 5LM7E 3TA2A 4CO3A 1KTQA 1UZHA 2M9KA 3D68A 2FHKA 4BLGA 3Q8QB 4NEZA 4ZVSB 1FXRA 3OL6A 2BBEA 2JFKA 2BACA 2EI5A 3GJSB 2F7VA 4QR2A 2KXNB 3LP2B 2CQ4A 4KGKA 5HANA 4Y3CA 5B08A 4O4RA 1T9VA 3OVSA 1EP4A 2J7WA 1I3OB 5HROB 1HNXF 4WP3A 1UVKA 4G1QA 2PEHA 3KLGB 5BR8J 2XTJP 2O67A 2LFVA 4I64A 5T7LB 3CJ8A 2ROPA 3HCXA 4DL4A 3VGUA 4ENOA 1A6LA 3GCXP 4F0MA 4OYIA 3PACA 2RRBA 1QUVA 2CVIA 5KT6A 2RDJA 3CJ5A 3E2EA 1R6YA 2V9KA 4NA3A 4DXLA 1ZA2B 2HAFA 2FVPA 3I82A 1VQ5S 4QPTA 1T3OA 1J5EF 1ZAXA 2YKQA 5CA5A 4JI0F 2QL9B 1SC3B 2OPPB 2NZ4A 3IR7B 2UXDF 1RACB 2E7VA 4J9MA 3S7RA 2J6TA 2DNGA 3A3NB 2AHOB 3ILOA 3MTJA 1E6YB 2FQQB 2VG7B 3G8SA 1H0HB 3CC2S 3TP2A 3ZTOA 3HSZA 1IM4A 5AT1B 4X62J 4ANEA 4DCOB 1HW9A 3TANA 4UOCA 5JXSA 4LBHA 2JEFA 2EKNA 4ZLPA 3C16B 4ZVRB 4H54A 4QQBA 2GAHC 4DX8H 3DLGA 3T5JA 2QTWA 2A6MA 2NS1B 3JYTB 2MEWA 4LF5F 3KLHA 1WDDA 2CUYA 1RTHA 1NSQA 5KG6A 3TZWA 1HHQA 3I31A 5IC4B 1RAHB 3CW2C 3IRXA 1PG5B 1KN6A 3CTRA 3H59A 1NJZA 4MKYA 1WC6A 3M7VA 2GQCA 3NS6A 1ZS6A 2BE2A 1PAEX 4KPCA 1KHWA 2Z2MA 1FFWB 4CLYA 2VICA 1J5EJ 2OSQA 1U45A 1H7WA 1KDNA 3R1LA 4CRJA 3G8TA 4DV7F 4JI7F 1S6QA 1HHSA 1MMNA 2FZGB 1OS5A 1SV5A 1YG0A 3D54A 4CLKA 2UV8A 4DLGA 1HW8A 2LYVA 2N7YA 2W4CA 2ZE2A 1SH2A 4LR7A 4NCGB 3H25A 2V8DA 1IWGA 2GCFA 4O3OA 4NRUA 2DXFA 3GYNA 3O1LA 3MURP 1RWVB 4NX9A 4OI3A 3WDOA 1QAJA 3GSIA 2H1YA 3FBEA 4PYAA 5F41A 3MXHP 4U67Q 1JLAA 4QR0A 5L46A 1R8BA 1UPPA 5KFHA 4YR0A 2CPIA 2IBKA 3P96A 5CD4H 2MGZA 2BKPA 2XLJA 2BJDA 4UY8T 1Y5NB 1U1PA 2KXHA 2RQMA 3ITHA 4K2XA 2UXCF 4JI5J 1H73A 1ZYQA 3K8WA 3BPSP 2F63A 1TV6A 4ZVHA 2J9EA 2VC0A 1RHKB 3MPUB 3EXYA 4O0IA 1XMOJ 2XS5A 2OPSB 3AD8C 2HWTA 4M5NA 5G4DA 2VG6B 4DR1J 1HLWA 2EG1A 2KU7A 4F8RA 4ZVTB 3R2CJ 3NGSA 5EHHA 4PG4A 2DRAA 4KHPJ 5FJ4A 4IFVA 2RDDA 4Q5VA 4OV1A 2KYXA 3OR2B 2CYYA 3TO8A 4UT4A 2OUGA 1JJCB 2DNPA 1PJ7A 2OP5A 2WW4A 3CD0A 3UPFA 3MD1A 1Q8BA 5KT2A 1Z4UA 2RT3A 3BR9A 1YRXA 3GFYA 4OX9J 1FJGJ 4K4VA 1E6VA 4OYPA 3TVKA 2WZ1A 4NPOA 2VUGA 3BKUA 3W2VB 1IKWA 1JLCB 4DPOA 3P5BP 4YR2A 1IJEB 2LLZA 4ZHRB 3W7BA 1HQUB 5DS7A 1YDLA 4OI1A 2X1FA 3TVYA 3KHHA 1RDRA 4E8UA 5GADU 4LF5J 1ZZNA 4UOFA 1REVA 4NLUA 4PG7A 4LBPA 3V81B 3BQ2A 1V3SA 2QIFA 2XO6A 4IOCQ 1FEHA 2YTCA 1F5AA 1JJ4A 5IQ6A 1NPKA 1REGX 4UOGA 2CQCA 3I0RB 4OYMA 5B0EA 3M30A 3KJVB 4C0OC 1VRTB 3UNYA 4HYKA 1HYSB 2YWFA 2CJKA 1FDNA 3H2UB 3ICLA 3AAWB 5L39A 2OFHX 3QWPA 1LK5A 1UETA 3KLIA 1KFDA 2XGPA 4TU8A 2CQBA 1DTTA 1Q5VA 1ZAVA 3SMZA 3QZ8A 1SJ4P 2DR9A 3N6MA 2HS4A 2ZBIA 3K7RA 1UVNA 1B0VA 3BQ1A 5CYQB 1PSDA 2FLNA 2W4PA 5HMWA 2KHDA 4ELTA 3FVYA 4M5KA 3R2DJ 3K59A 4NYZA 4PPZA 5B0CA 4CYUB 3DRRA 4GKKF 3MAQA 3FFIB 3MR7A 2YQ3A 3PTWA 2R7WA 1WACA 4F0KA 2AYBA 1FDDA 4QIVA 3MPDA 2HGMA 4QWCA 1JLFB 3B4MA 2RQCA 1NK9A 2GVZB 3HLUA 5M2PA 3DLLQ 3M2VB 3BSNA 3EVWA 3QWUA 5KFAA 2KFYA 2BUNA 2MQNA 4OYOA 2DNYA 4U96A 3B8HA 4ZMMA 3CDUA 4IUFA 4CM2A 3UFCX 3ET6A 3TA1A 2UVRA 4DV3J 1EARA 3DRYA 3HHKA 5F9NA 2DO0A 4KC5A 3CVKA 3MMCA 1U1OA 1O5JA 4JI4F 4A4JA 2EFVA 1YVFA 4ZCMA 2XBPA 5K8MA 4CLUA 2UVVA 4ECZA 3AX3A 2V2VA 4S0MA 3PVXA 1WHWA 1FERA 3AHPA 3JSYA 5BXIA 1AUDA 4DV4F 2BQRA 1OPZA 4KRWA 4DF4A 2HWHA 3W8GA 2W7AA 2F9DA 1U1LA 1CJUB 3BSAA 4V1Ak 4DV2J 2FB0A 2VONA 2F3JA 1PCAA 1FTCA 3MAAB 4USHA 5KG1A 2XZWA 3JAMU 3AXKA 1N5YB 5HMXA 5CYMB 2OAUA 2C28A 1LWEB 1GQEA 4KY3A 3R27A 2VQFJ 2HZCA 2XYHB 2PC6A 2IA0A 2XYGB 4KH1B 4LRAA 5IV3A 2W7PA 5HATA 5J2QA 2V8GA 4B9VA 1MSWD 4DL7A 2R3VA 2IMOA 3QNWB 1K47A 3PW0A 3N6LA 1SUQA 3M4XA 2KRRA 3MM9A 3D7SB 4B9LA 2BW7A 3U1LA 4HACA 2C3PA 4HT7A 1JB0C 1VMBA 2BKOA 3L7UA 5B0FA 1K0VA 3GFHA 3TJ8A 3EVMA 3KK2A 4QU7A 2C3YA 3JSMB 4M5DB 4ZK7M 1B70B 5KT3A 2ZHBA 5F0WA 3HP6A 4NI2B 3DNCA 2ZITA 3CJQA 3U7JA 5DDQC 2XQCA 2FD2A 4DCJB 4NMXA 2HHHJ 4MKBA 5D4OA 2AMCB 1IKWB 1NHVA 5GMEA 3MM6B 2MKIA 2OO4A 4DPYA 3GPAA 2QLBB 5HMYA 1SH3A 1S1WA 2OSRA 2V4QA 3D0HE 2D3OR 1NKEA 2HPUA 2FDNA 4PG8A 5LXRA 3CGIA 4EEYA 2AJ0A 1QAXA 2B7BB 2NCKL 1JNRB 2W01A 3H90A 3VHQA 4LF8J 1XNQJ 4ATNA 3DYAA 2EK1A 3I96A 3TOQA 4DMZA 1LV5A 3PR5B 3S1TA 2XS7A 3CD6S 4Z7CA 3IM8A 3CJ0A 2HVHA 1T8EA 1R43A 2CPJA 4QIGA 1UWBA 2H5JB 1RHJB 4Q8EA 2X51A 1XIQA 1CC8A 3OTEA 3RB3A 2B9EA 2YXLA 1LWCB 4I2QB 1RGVA 1YGYA 3W2WB 2C2EA 4ZS6A 3OFHA 1XMQF 2BOPA 1OY6A 4LMZA 1R8HA 1FFGB 2V63A 3IMQJ 3TZYA 4F2SA 4A46A 2YPYA 2FGOA 2VBYA 1SKRA 3CCVS 1WF0A 3PJXA 4GVLA 3U02A 1KTVA 2RU9A 4QU6A 3GILA 1IQTA 1G2EA 3DLEB 3FJ2A 2X1GA 4DSEA 1VI7A 3D1HA 1IUJA 2HGLA 1HBUA 3GYGA 1CS4B 2CNLB 4ZJLA 3HO1A 4KYZA 2HRTA 1H7XA 4MKAA 4K4SA 1FE0A 1TU0B 2AJ1A 4NI2A 3PX4A 1RP5A 1XNQF 1KFSA 2MSSA 2VU5A 1MROA 1TUVA 4G1QB 3AQPA 1UUJA 2KB2A 2AJQA 4YDDB 1O6XA 2ABYA 3V6DA 2EKYA 2HEKA 3R5BA 2IM2A 3LQVA 4DQPA 5EN1A 3M8ZA 2I5JB 2XNQA 5GMDA 3BN4A 3D28A 2XNRA 3OHAA 3W3SA 4UZCA 3DLKA 4OLPA 2FY1A 4P75A 2EWHA 2PO4A 5A8KB 2MLYA 4DR5J 4ED8A 4JP8A 2M5YA 1SKUB 1U48A 3KDNA 4I7FA 2QA4S 1D9AA 3Q8RB 3EJMA 3NKYA 4Y2CA 5KFZA 3KJNB 4PUOB 1NK5A 4RW7A 2CZ9A 4YMEA 3R6LB 2M4MA 1S1TA 4LUBA 3NAIA 5D6GA 1RKJA 1MWZA 4DQRA 4X66F 4H4OB 2LECA 3I0SB 4OYZA 2B5JA 3UVJB 4PG6A 1F60B 1DQ8A 3OVBA 4QPXA 1RA7A 1M90T 4ANDA 3ENWA 1L3UA 5K5MA 4RBTA 2EXUA 1O0PA 2NREA 2XMKA 1YJNS 1NMEB 2VQEF 2AQ4A 1RADB 4A47A 4EU0A 2XTCA 3BGRA 3FZ2A 3HHLA 1VQ7S 1MG7A 1YZ7A 3S8SA 1R6VA 2V8HA 1QSSA 4PWDB 2QFJA 1D3WA 2YWHA 3DMJA 1FJ7A 3CUNA 3BO4A 3W66A 2OKQA 3SI8A 4G3IA 3DI6A 2DH8A 1IKXA 2PA3A 1I94J 1RHUB 4R0JA 4NLRA 4NZ0A 1U0HB 1X4BA 3PYDA 4LR9A 4RPFA 5AE3A 3GIKA 3NOGA 4Q0BB 4J90A 2WVFA 1NEEA 1Q8LA 2HSEB 3SCIE 4CDIA 5KFPA 2APOA 3RB0A 3TNVA 2DIUA 1IWAA 3N5BA 5GAHU 4JI5F 2DPJA 1W7WA 2Y3YA 3DM2A 1HQUA 2CKWA 3IP0A 3OFFA 4GVBB 3ZZUA 3PO5A 1KHVA 1AZSA 3H2LA 3LP0B 3JTOA 3M1VB 2ZVSA 3MM7B 2GMJA 4C8MA 5E41A 5HO4A 1X4GA 2WONA 1B7YB 1RAEB 3KXDA 3LOUA 2WW8A 1JXEA 2H4WB 1TL7B 3I5CA 4IH6A 5ETNA 3PX0A 2BANA 3T9ZA 2Z57B 5CCLA 1LFWA 2DGXA 1ICEB 3MEKA 4URGA 4UQGA 3OVAA 1U09A 3H0PA 4HR2A 3EYZA 1SBRA 1IBLJ 4PXBA 1FDAA 1M5SA 3EDQB 1KP6A 2OEMA 4JB8B 4OJ3A 2K7JA 4WKYA 1FK9A 1ZA1B 2IAJA 1JLFA 1FHTA 2BABA 3J81j 1ZZFA 5ITHA 3KJFB 3EDRB 5D8HB 3D3CJ 3B54A 1WG1A 1WHVA 4OMFG 2CQDA 1RJJA 3DFEA 3GR1A 4DHVA 5LSRA 3T5KA 2W1BA 5ETMA 2UUWA 1S59A 1H2VZ 3DRXA 3EGVA 3W63A 1HD1A 1B7FA 4WIIA 3HT0A 2VOPA 1T9WA 3Q8VA 3DMJB 1BMQB 2PI5A 4CCHA 3LUYA 2G0CA 2RHQB 3UDVA 2HLTA 3M32B 4J9QA 2RF2A 2KFNA 2HG4A 2YNFA 3ISND 2UUCF 3KMQA 1R0BG 2BM0A 4X4OA 4KR0B 1T03B 1N34F 5DQIA 1RLCL 2VDHA 4LBIA 2W2OP 4KKOB 2GFFA 1RB0A 4U7UD 3D66A 3W5XA 1DURA 4MKVA 1VBZA 4GC7A 1N48A 2G13A 1CLFA 1G1XA 4DG1B 1Y7PA 2IC3A 2IY5B 4KH0B 3P6YC 3LP1B 1Q5YA 2B6AA 4K59A 4LVOP 3L3CA 4ZVQB 5CYJA 3G71S 1X9SA 1F9HA 2V50A 4CO0A 5ETPA 5BJRA 4X4RA 2V69A 5HI7A 2ZKUA 4X4VA 1XMQJ 4DR4J 2YWWA 4ZKAA 4U8YA 2HHQA 5LMUF 2BEFA 4ZN1A 2LQ5A 1VRUB 2M52A 3CD7A 4RUAA 2N7CA 2NLWA 4DR7F 1Q95G 3ITHB 4WJBA 3I87A 2MB0B 4OZ2A 1XNRF 2JHEA 4DSKA 1HBUB 3M8SA 2YH0A 3T9NA 1N56A 4ECUA 2RAQA 4PWWA 3VTIA 2H9ZA 2ILZA 2FUG9 1KOHA 2NPIA 5BR8F 3CMQA 1RBLA 5EDWA 4K0KJ 2LDYA 3MM5A 2F9JA 4M5IA 1K73T 3K0JA 1GMUA 1PAUB 3BR8A 3LW5C 1LW0A 3R5CA 3CJSA 3HZGA 4ZITA 4C3LA 5GAGU 2KN4A 1CBKA 1VC6A 3O3LA 4LFBF 2K2PA 1NU4A 2WAQD 5KOWA 2Q43A 2XYPB 2JEJA 2HQFA 2GQQA 2HQGA 3LWMA 3FK4A 1S97A 1MN9A 2JL9A 2ROGA 1SC4B 3OQ2A 1AUSL 4HI2A 4QR1A 5KFGA 1ACMB 3JTPA 3CDWA 1VS3A 4I0WA 4Z7YA 3TYTA 2KM8B 1PC5A 3D4JA 1TELA 2Z2ZA 4OZ0A 2KVQE 2DGUA 3KUGA 3RBZA 2YX4A 3TJAA 2GAGC 2M70A 3SCJE 2MJUA 1RCXB 2QYGA 1MMLA 2B4OA 2HK2A 2R4FA 2ZFHA 2MY8A 4MIBA 1Q4RA 4DSJA 2ZZTA 2GO8A 3FUYA 1UEKA 2VFTA 3CCJS 4D3GA 4HDHA 3TAMA 2MZQA 5AE1A 3HSDA 2DNZA 4FNHA 2EG2A 2H5EA 5KFXA 2AGPA 1SL0A 2YKMB 2PMWA 4IFYB 3VZIA 3ZXWA 3MCMA 1UWBB 4UUWA 5F8JA 2EFOA 1SVDA 2G2ZA 3GMGA 3PEHA 4ETZA 1S0VA 3H2VE 2DHSA 1WNEA 2H48B 2LXFA 1X4FA 2QLXA 3THTA 4ZCIA 2VJUA 1NK0A 4WFNQ 4DU8A 3W62A 4C8KA 4B3MJ 4NYOA 5LJ3Y 3TQEA 4CM0A 4WZMA 2CPFA 3IGNA 4M8LA 4WU3A 1HPZB 3CCMS 5CZXA 3CJTA 1FRKA 2IDEA 3ZZTA 4GKJF 3GONA 3NXZA 1GAOA 1PJ6A 2LVWA 3F0NA 2WB1D 2DYAA 3FFIA 4LRBA 2J9DE 4LQ3A 4ILLA 1FWPA 4M5LA 2XS2A 1FX4A 1C1CB 3GZ7A 3KUEA 2J8SA 3FCVA 1KQFB 4O3RA 3WIVA 2MHEA 2FLOA 3WX4A 2QRRA 5A8RA 3RUBL 4YQWA 1X4CA 4YB5A 4Y0FA 2JEGA 3D6TB 1Z2LA 5HK4A 4IR1A 2QYCA 3NGKA 4NZ7A 2MQQA 4JV1A 1NJWA 1TK8A 3EZOA 2GVDB 4B3TJ 4O4GB 4A8OA 8AT1B 3I0RA 3WZ0A 2QA1A 1IR1A 1FA0A 3MPVA 2HHVA 2V1SA 2B6AB 2J7UA 4DR6F 1HBMA 1TTHB 2CADA 5THWA 1OMSA 3X3UA 4WFBQ 1S10A 1RI7A 2HZAA 3LPEA 2X3DA 3RAMA 3V4MA 2AYMA 2ZDPA 2HNZB 1TFWA 1MMDA 1RT6A 5D0GA 2RRNA 4CNYA 4F04B 2C2RA 4DZ6A 5A8WB 4LREA 1K1SA 1CPZA 2DGTA 2B8QA 3D3BJ 3DRPA 3RJMB 2XGQA 1VOMA 3LH2S 2X3GA 4XK8C 3QIDA 4NOHA 3VV2B 1S72S 1AZSB 2E5GA 4H4OA 5A2QU 3QGIA 1NUEA 3ETMA 3G8QA 3K2YA 4NLQA 2I9SA 5D0RA 2LXIA 3OTDA 4OX7A 1FRIA 1FWKA 4USIA 3PV8A 4MK7A 3L7OA 3HT3A 3CJKA 3MEEB 1LWXA 3SSQA 3J81U 1S7HA 3T6JA 2FJXA 1UPMB 2K06A 5E5NA 4ECWA 2ZNYA 1IJFB 2LEBA 4DL5A 5ETQA 4WK1A 4F67A 4OL8A 4KIAA 1NSKL 3QAUA 3IM9A 3HVTB 1JLBA 2EFNA 4RNOA 2N82B 2AX0A 4IQMA 4NA2A 3V4IA 1VQ8S 1CULB 2COLA 2QMXA 1G4CA 1JX4A 5CYQA 4MJKA 3A8IA 2IVFB 1Q8IA 2HNYA 4DV0J 3QT5A 4GKKJ 1QVGR 3MFIA 3MEEA 4ED2A 1WC1A 5KFFA 3D0IE 3M8WA 4ZVPB 5KG7A 1QE1B 5L1IA 1TAUA 1S5ZA 1NK4A 5HSPA 3NWRA 1ELOA 1FI4A 4YP3A 4J9PA 1HQ2A 5J2MA 4TVAB 2N3LA 4JV2A 5I42A 4J7CA 4O23A 3NL0A 3MUVP 3M8QB 2FHMA 3NY0A 1XR5A 3NCQA 3AWRA 5J1EA 1DLOB 5KFLA 1FNOA 1OY8A 1EKRA 4RBUA 2L08A 5T14A 1P8GA 1RBOB 2YNGB 3OSPA 4C0HA 1RHRB 5BYQA 3ZTPA 2NR0A 4BDPA 3GCWP 1HNZF 2OFGX 3I9V9 3AJ1A 4C3MA 4WFXA 2H65B 3ZTSA 3SQOP 2ALZA 1NLKL 1WC5A 4ECVA 3KLVA 2WK4A 1NZ8A 3H98A 4TLQA 1R3NA 2AGQA 2H4YB 2XI3A 2A1BA 3M6VA 4DOZA 2W2PP 4ED4A 1L3SA 1F3FA 1S9EB 2YY3A 5C25A 3R1HA 4PCQA 4PXEA 2DITA 4L73A 3W2WA 5D3GB 1JQGA 1UW9A 2HK3A 4ECYA 1H2UX 1TL4A 1UP1A 1VJWA 2B56A 3DU6A 3NGUA 5D4PA 3OW2R 4ID5A 2ZBPA 5L8RC 2HFZA 2DR5A 4OLOA 2DCLA 3ETOA 2XY6A 4WPAA 1C4CA 2PSZA 2DGWA 4ZOSA 2R2UA 4RW7B 3NGDA 4J9UE 4D3HA 4XO0A 4W4MA 4ZVGA 4NXMJ 2W9BA 3AJDA 3QYYA 3LTOA 5DRKA 3CWJA 5KFNA 3IWNC 3HHEA 4I69A 3QJLA 3R5GA 4DV2F 2KTQA 3MEGA 3DDNA 4KV8A 2I6WA 4F4ZA 3A12A 1XEZA 4WIQA 4KB7A 2DR8A 3PYGA 2D1CA 1QD1A 2VPYB 1GXLA 2UUCJ 2B43A 1D09B 2D41A 2D3ZA 3CCTA 3L95X 3GU0A 4G1PA 4DR6J 1Q1KA 1NHKL 3RAQA 1H72C 5A0YB 3GIRA 4BC7A 2QMWA 5H1SV 3VAGA 2ASDA 3JXOA 3RZAA 2HYIB 1TP7A 2CIMA 2VFSA 3NAHA 2QSWA 3M8PA 3MOZA 2IDLA 3T19A 4EBCA 1SB6A 5KT5A 2C3OA 3L09A 2FJBB 3UO0A 2F5GA 1TUGB 2FTRA 1L3KA 2NXJA 2RDIA 1R0AA 2CZ4A 4N41A 1JLQA 4XTTA 3H5XA 2YX1A 1U1RA 4TYAA 3C14A 2DBBA 1SJRA 4KGXB 3C15B 2DTJA 3IG1A 1FD8A 1S12A 2CJYB 3NS7B 3EPGA 4ED0A 2MYFA 1HNZJ 4FXDA 3G6XA 4K5SA 2HURA 3PDNA 2WVBA 4LSLB 5DG8A 1W26A 2IYGA 3C16A 3M8PB 4K4UA 1DTQB 1RTDB 2KFZA 2KKHA 4PEOA 3CCLS 4JI7J 2E29A 2QN6B 5CQGA 1KLMA 2IYIA 1FRXA 1PIEA 4X4TA 1M1HA 2AZ3A 4IKAA 3NCPA 2E1RA 1YJVA 1OQ6A 1MU2A 2EK6A 2KL8A 2P5VA 3BN7A 4NYPA 4ZLJA 5AXNA 1NH8A 4A8YA 4OZ5A 2OTJS 4X4UA 4KHRA 1Y4ZB 1APSA 1HQEB 4ID8A 4DSLA 1KRPA 2ZBRA 4B17A 1IVZA 2Z0GA 2HMIA 3JB9k 2BE2B 3MR6A 3TEGA 1TK0A 1RTDA 1UVIA 4WU2A 1KOOA 5KG2A 5KFJA 1VQSA 2KT2A 5EUHA 5DETA 3QIPB 1S1UB 3NMRA 4ES1A 1VBKA 3UN2A 2QLJB 5KAKA 2CDRB 1VR6A 5HL7Q 3A3OB 2DEJA 1YI2S 2ZOFA 4MAKA 2A18A 4X4QA 3TZZA 2DNNA 4RLEA 2HW3A 3LALA 3KHLA 2RS8A 2Z56B 5CH7B 3DOMA 1S1WB 2DY1A 1NDCA 2JDJA 3HD1A 3QJPA 3MMAB 4N5SA 2BM1A 4JI8F 3CCES 1KLNA 1S4EA 5F8IA 3OSNA 4WYWA 2ZM6J 2AYGA 2V67A 1S9FA 1GTHA 1UZDA 4FYWB 2XG8A 5HP1A 4DU7A 3UCUP 2J6UA 1SQFA 5L1KA 1MNEA 5KFSA 1NB7A 3PW7A 2J0SD 4XPCA 2DB1A 3NP5A 2KM8C 4LFBJ 1HBNB 1YJTA 1J2VA 2XWYA 3DRRB 4FF1A 3X1LB 3UWTA 2OJ3A 4N47A 4HKQA 2RHSB 2IRUA 2B9XA 2LQBA 4IDKB 4TXSA 4DFKA 3PY8A 2O66A 2CQ0A 4P74A 1YKWA 2GVZA 4JI2J 1WDTA 3PEJA 1SQEA 1QVFR 2BANB 2BJ7A 2DRDA 5H9FK 2QA4G 1RAOA 4F2RA 3S6EA 4KGVB 3CCUS 2D9PA 4IG0B 1ZETA 1UJ4A 3B82A 2FJEB 3OL7A 2YKOA 1WEXA 3ZFVA
chains in the Genus database with same CATH topology
4L72B 5AXLA 4J9OA 2ROEA 4MIWA 1U7LA 2ZC3A 2MZ1A 2XCAA 4V19X 4AL6A 3D5MA 1FK9B 2IAJB 4I56A 1R89A 1M5OC 4EZ9A 3V5RA 2RRAA 4K4TA 2DHGA 2GGPB 3EGWB 4KSEB 2DVIA 3HFKA 4MFBB 3ZZOA 5M2UA 3H4DA 1GTEA 3IWLA 1XR6A 5KFWA 4B3SF 1N5QA 4P2SA 5FLXY 2QSFA 3T1YF 3R5DA 2OPQA 4O4GA 1VGYA 2UV8G 2J8AA 3G4SS 1KVJA 3OTOF 4ZPCA 2IM1A 1OSCA 2HHPA 2B7CB 1RT1A 1FT8A 1ZM2A 2UZAA 5A8KA 5F3TA 3EGZA 2BJEA 1PC4A 3FSYA 4A8WA 1VIXA 1VQOS 1CEZA 2RD5C 1JLEA 2ZH6A 4KFBB 5AJ3F 5HP1B 4I6AA 3ENQA 5SZTA 3M9MB 4ZP7A 3OTCA 3T6BA 3KLEB 3CT9A 3MM8A 3QGPA 3MGJA 1EETB 3TUZC 4DR3F 5A2QY 1XBWA 2HHTA 3CSKA 5KFDA 4FF4A 2EBEA 1Y5LB 3HVWA 3ISNC 2YNHA 2O5DA 3DOLB 5KOXA 1U4BA 4YHHF 3VCDA 3D2WA 2JJ4D 3PFOA 4ECQA 1VQLS 3QJJA 1HPZA 5IS2A 2CDQA 1HWJA 1RKIA 2CJBA 1VQMS 1VFJA 4DFJA 5JVHQ 4ECRA 1HBOA 2VBZA 3DHWC 4MH8A 1URRA 4WKRA 3P5TL 1FJCA 2C3UA 1C0UB 1LWCA 4GO7X 3FRYA 3EX7B 4A8QA 1VQPS 5A8RB 1J5OA 2XTDA 2DPIA 4ZPTR 3AQOA 4FF3A 1KQGB 3NNCA 4PXDA 3MOJB 5IQQA 1B0PA 4ED7A 1Z2ZA 4ERDA 2VKZG 4WXOA 3KHGA 4GC6A 5B0AA 1F5CA 2MGZB 1UEUA 3GIJA 3CPWR 3CMES 1RISA 1P1LA 4R5PA 4LVNP 1LWFB 2W9BB 1F0XA 4QZVB 2OH2A 4ECSA 3M6XA 4RWXA 2RUGA 2WBRA 3NS5A 1Q78A 1DQAA 1C2PA 4LSLA 4F02A 1PGZA 5KFRA 3UQSA 4M5DA 4RW8B 1XMOF 3HHLD 4Q2MA 2VD3A 2CPEA 1VBYA 5B0BA 2NUHA 2BXJA 2KZZA 3I55S 4CTAA 1FVQA 2I5JA 1XWLA 5B0DA 2YKPA 5H9FJ 2E5LF 1N6QB 4OHWA 2UUBF 2CPYA 4O3SA 5GAGI 3N9UC 3E01A 4C9DA 2J0XA 2FVCA 2GJ2A 4ICLB 4EYHB 5KFMA 4HEA9 3UI3A 5GMKa 2LDIA 3H40A 4OZNA 2YKMA 1U49A 1JLQB 4C97A 2X1AA 5K14B 1R7IA 4NLDA 3AY0A 2AX1A 5HMZA 4DFPA 1ZM4A 3J7Z5 3MM6A 4U9RA 1L3VA 2POKA 4LF7F 5KFOA 2NXUA 3QO9B 4WE1B 2BVZA 1WWHA 4ITSA 1WEZA 3OUYA 4C8LA 4KV8B 2YWGA 4IOAQ 1T95A 4EGLA 1NAQA 4IQXA 4U7UK 1D9DA 5HROA 4R0EA 3NMAA 4A8MP 4OI6A 2Q66A 4WFZA 3DOKB 2L9WA 3HKWA 5C24B 3RBEA 2E9TA 1RTJB 4Y2KA 2FJDB 5IZHA 3OVAA 2ZJPQ 3V2UC 2B4PA