4K4UA

Poliovirus polymerase elongation complex (r5_form)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
462
structure length
462
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGMSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Structures of coxsackievirus, rhinovirus, and poliovirus polymerase elongation complexes solved by engineering RNA mediated crystal contacts.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 135
structure length 462
sequence length 462
chains with identical sequence E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4k4uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k4uA02
3PJXA 4Y2CA 2WONA 4MK7A 4EEYA 5F9NA 5J2QB 4G3IA 1S0NA 4FBUA 3KLHA 2IC3A 3KLGA 1N5YA 3NL0A 1S1TA 3CJ2A 4LSNB 1TKZA 3JYTB 2IAJA 4PQUA 4I7FA 1RT6B 1S48A 2BRLA 5J1EB 2HMIB 3H40A 3M8PA 4MKAA 4Q45A 4ZMMA 4F4YA 1FKPA 3BQ1A 4PWDA 2ZE2A 1VRUB 1TQLA 4Y34A 1JLGB 5D3GA 1VRTB 1BQNA 4R8UA 2B5JB 3I5AA 5KG1A 4KHRA 3RBDA 2OH2A 4ZP8A 1TVRA 4WE1A 3DOLB 4NYZA 4ECVA 1FKOB 1LWCB 4RW6A 3DI6A 3GV7B 4J9SA 3G86A 5EWEA 4ID5A 1KHWA 5J2PB 4ZP7A 5DGBA 4IRKA 4JV1A 3DRSA 3E01A 4RW8B 5KFVA 4M95A 1SUQB 3V6HA 2ASJA 5HBMA 4J9QA 4IFVA 2HNYB 1XR6A 2AU0A 3V6DA 4ED3A 3GV8B 4IQXA 3DLGB 1S9GB 4WYWA 5KFNA 4IKAA 2W9AA 4DL5A 2R2UA 4ED6A 5DLFA 1JLFA 3SI8A 4ZHRA 3KJVA 4H4MA 1TL3A 1S10A 5F8JA 2RDJA 4TY9A 1JKHA 2BE2B 4YR3A 3NAIA 1RTJB 1RT5B 3FQKA 3DLKA 4LSLA 2IBKA 3SFUA 2GIRA 2YKNB 5CYQA 4ECUA 4KE5A 1DTQB 3QIPB 4ED0A 3ITHB 1IKYA 1OS5A 5DQIA 5C24A 4ZP6A 1RTIA 2J6TA 4IDKA 4IH5A 5KT6A 3LALA 2IM0A 3IGNA 4J9PA 1RT1B 3M9NB 5C42B 1K1SA 4URQU 3G6YA 1JLEB 4O4GB 3DM2A 3ISNC 2RF2A 1GX5A 4MKBA 3GYNA 1C0UB 1EETB 3PW0A 3KLIB 1C1CA 3PW7A 4RU9A 1QE1B 3T5KA 3C6TA 2FJVA 2YNFA 2C22A 3NBPB 3GIMA 2ATLA 1HNIA 2WONB 2XI2A 4RNOA 3GQCA 4URGA 5KT7A 1LW0A 4DEZA 3KLHB 2IC3B 3KLGB 3RB0A 1N5YB 1TKZB 4WXWA 2IAJB 1MMLA 3PW4A 3SFGA 4K4XA 4PQUB 3QIDA 1DLOA 2W9CA 5DG9A 4FS1A 1IKWB 4Q44A 3M8PB 5EUHA 5KFTA 3I0RA 1S1UB 4NLWA 5KFQA 5D3GB 2ALZA 3MEEB 4ZPCA 5JXSA 1S1VB 2HNZB 4WFXA 1TVRB 2HAIA 4WE1B 3BQ2A 5T14A 4RW6B 4Y3CA 3DI6B 2R8HA 2E9TA 4IRDA 5KG4A 1I6JA 3BSCA 4ZVEA 5KFBA 1RTDB 3KMQA 4J9LA 1TKTB 3FQLA 3E01B 5KFHA 3TVKA 4ED8A 4QWBA 4ECTA 5HBMB 3E51A 3KHRA 4JV0A 4I2QA 3GILA 2OPRB 3V6DB 2W8KA 2D7SA 3T19A 1QAIA 3Q8PB 2VG7A 2D3UA 1JLFB 3IG1A 1TL3B 4O44A 5KFXA 2YNHA 5KFPA 4TLRA 3GV5B 1QAJA 1JKHB 3MTKA 1K1QA 3NMAA 1RAJA 2ILZA 3DLKB 4LSLB 2UUTA 2BRKA 5CYQB 5DLGA 3DOKA 3CJ0A 3EZUA 3IS9A 5KFZA 1LWEA 5CYMA 1SV5A 1RT7A 3BR9A 4RNMA 4Q8FA 1RTIB 2UVUA 5F8IA 3LP2A 1HYSA 3FFIA 4IDKB 5KFGA 1N56A 4KKOA 3LANA 3BSAA 4NZ0A 3DM2B 2C2EA 3LP1B 2VG6A 3BQ0A 3MR3A 4EBEA 1C1CB 5KFFA 2WOMA 1RA6A 2XI3A 2VA3A 2YNFB 4NLSA 4MIAA 2FJXA 3DYAA 1KLMA 3T5HA 3TQ1A 1HNIB 1REVA 1HNVA 1S1XA 5KFLA 1TV6B 3QZ8A 2XGQA 3H5XA 3OSNA 3RB4A 5KG5A 1HMVA 3I5BA 5C25B 3PW5A 5EDWA 3V4IA 3OL8A 4O3RA 1DLOB 4I2PA 5KFDA 2W9CB 1T05A 3CJ5A 3CDEA 3HVTB 2R8JA 2UVWA 1S9EA 4QW8A 2ILYA 2WCXA 1IKVA 1EP4B 1JXLA 1SH2A 3H5YA 3OL9A 3MEDB 4TYBA 3LP0A 5KT5A 2YKMB 4YMEA 3T5LA 4IH6A 5HROA 3MECA 2RKIA 2OPQA 4H4OA 3MR5A 3CVKA 4ECWA 5F8GA 1RYSA 3CDUA 3N6MA 3QYYA 2HWHA 4RW7A 2FVQA 2B6AA 3FRZA 3DMJA 2JC1A 4K4ZA 1S49A 3KLEA 1RT4A 1LWFA 1T3NA 4PUOA 2ZKUA 1SH0A 4IFYA 1S4FA 3BREA 4WXOA 3JSMA 2FVPA 2HNDB 4URSA 1LW2B 5DG7A 1D0EA 4K4VA 1MU2A 5L1KA 4ECYA 1HARA 5HLFA 3H5SA 1YVFA 1Z4UA 2R8KA 4Q0BA 5KFOA 1RYRA 3I0SA 4DG1A 4O44B 3MR6A 4NLOA 4LQ3A 1HQUA 2YNHB 4XPCA 2AX0A 4F4WA 2R8IA 1IKXA 3KHLA 5KFMA 2E9RX 4YR0A 4M94A 1T03B 1JLAB 4LQ9A 3DOKB 3M9OB 1TKXA 2IM3A 1TL1A 3IS9B 5I42B 1BQMA 4YP3A 4NLRA 3V81A 1LWEB 5CYMB 1SV5B 4WYLA 4F50A 3DDKA 5KFIA 3EPIA 3H98A 3LP2B 3RAQA 1HYSB 3FFIB 3IGVA 5FDLA 5KT4A 3RAXA 3Q8QB 3GIKA 4IH7A 3OSPA 3PVXA 3MEGB 4RNHA 2FVRA 2QE5A 2ASLA 4MH8A 3D5MA 1NNDA 2WRMA 4IG3A 2DPJA 2I5JB 4IR9A 2JEFA 2VG6B 3CWJA 4ED1A 5JUMA 4H54A 3OHBA 1N4LA 3IN5A 2GC8A 3PHEA 2WOMB 4G1QA 4IRCA 3ICLA 4RW9A 2ZD1A 1KLMB 3DYAB 2BQ3A 1J5OA 4QPXA 1REVB 1S1XB 2RDIA 2D3ZA 2I1RA 4WZMA 1S1TB 3FSIA 4Y2AA 1W25A 4NRUA 1SH3A 1HMVB 4I7FB 4KHMA 3KHGA 4JV2A 4R0EA 2CKWA 3KK3A 2YNGA 4NCGA 3V4IB 3OHAA 1T05B 1XR5A 1C0TA 1FKPB 4PWDB 1FK9A 2ZE2B 1S9EB 2EC0A 1RT2A 4K50A 1BQNB 4R8UB 4KFBA 2XC9A 2FVSA 2AQ4A 1IKVB 3MFIA 2FJWA 4K4SA 2IM1A 1S6PA 3DRRA 3LP0B 4ZP9A 1HPZA 2C2RA 3D28A 3M9MB 3V6KA 3NAHA 4TQRA 5KFKA 4ID5B 3QGIA 3MECB 2RKIB 2OPQB 4QW9A 3OL7A 2JEGA 4GC6A 3DRSB 5KFAA 3CO9A 4MFBA 4LSNA 4U7CA 4RW7B 4IR1A 2B6AB 3DMJB 4O3OA 1C1BA 2OPPA 3H5UA 2OPSA 4IFVB 1XR7A 1RT4B 3CJ3A 3JSMB 4ZVHA 1VRUA 1JLGA 3VQSA 3OLBA 4QWAA 4Q0BB 3DOLA 4ZHRB 3KJVB 4H4MB 1LWCA 3I0SB 3UDLA 4DG1B 5DQHA 4DL7A 1ZTWA 3LAKA 2AX1A 2FLNA 5EWGA 2R2SA 4JUZA 2WK4A 1TKXB 3HVWA 2C28A 1IKYB 1BQMB 5C24B 5DQGA 5KFWA 2HNYA 1C2PA 3H4BA 2AGPA 1S0OA 4NRTA 3KHHA 4K4TA 5L1LA 3DLGA 1R0AA 1S9GA 4KSEB 4IG3B 2FLLA 4KV8A 3BSOA 4J9RA 2RF2B 3NKYA 4NLUA 2FVCA 2YNIA 2BE2A 3MFHA 5KFUA 2VG5A 2UUWA 3C6TB 1RTJA 1RT5A 1UWBA 4EBCA 2IM2A 4U6PA 4O3SA 4G1QB 2BQRA 5I3UA 4RW9B 1DTQA 1RTHA 3QIPA 1J5OB 3ITHA 1LW0B 1JLQA 3QGGA 5KFEA 4TQSA 3RB3A 1S6QA 3Q8RB 3HKWA 5F8MA 2W9BA 3NGDA 1RT1A 2AGQA 4RW4A 4NCGB 3KK3B 2IA6A 5KFRA 1ZTTA 2IMWP 2UVRA 1CSJA 4GC7A 4O4GA 1C0TB 3C6UA 3KK2A 4ZPDA 1C0UA 1FK9B 3I0RB 2WTFA 3GIIA 3KLIA 1RT2B 4O3NA 4HKQA 4ECQA 5KG0A 1N6QA 1QE1A 1TP7A 1WNEA 1DTTA 1NHUA 1S6PB 2BANA 2V0NA 3DRRB 3T1AA 1JLCA 5EWFA 1HPZB 2FLPA 4XPEA 1S0MA 5K14A 4YR2A 5L9XA 5F9LA 1QUVA 4MFBB 4MK8A 2V9WA 5J2NA 4IOBA 1C1BB 2OPPB 2BR0A 2OPSB 4J9NA 2J6SA 3DRPA 3RBEA 2W7OA 4I2QB 1IKWA 3N6NA 1S1WA 4OL8A 1T94A 1S1UA 2AWZA 4ED7A 4FS2A 5J2MA 3MEEA 2HNZA 1S1VA 4MIBA 2VG7B 5F8LA 3M8QA 2F8EX 3IG1B 4IG0A 3QO9A 3PZPA 2VA2A 4DL4A 1JLBA 5HP1A 4B3OA 3TAMA 3KK1A 3MF5A 1RTDA 1TKTA 4NLTA 3KLFA 1RT3A 2D41A 4ZPAA 3BGRA 2WB4A 1RT7B 3OL6A 4Q43A 2W7PA 4K4WA 4TY8A 2OPRA 5DG8A 4MK9A 2XWYA 4ICLA 4KKOB 4RNFA 4TXSA 3EPGA 3T5JA 3V6JA 1R0AB 3IRXA 4YQWA 2R2TA 3UR0A 2J6UA 1GX6A 4KV8B 4QWEA 4DL6A 4KO0A 4TYAA 4K4YA 2E9ZA 3ISND 2YNIB 2W8LA 2VG5B 1UWBB 1NHVA 3I5CA 2BQUA 4NLQA 5C5JA 5I3UB 1RDRA 2JEIA 1RTHB 4ZVFA 1KHVA 4WFZA 1HNVB 1JLQB 1HQEA 4NLXA 3KOAA 4NLYA 5KT3A 1S6QB 5KFJA 3H4DA 2O5DA 4RZRA 3BSNA 1IM4A 2XGPA 2W9BB 2JLEA 2R2RA 1N48A 2JEJA 4I2PB 4RW4B 4FBTA 2JC0A 3DLEA 3RB6A 3LP1A 3QLHA 4KBIA 3C6UB 4R5PA 3KK2B 4F4ZA 4HYKA 4RUCA 4ED2A 2AGOA 4EYHB 5F8NA 1N6QB 1DTTB 2BANB 4RUAA 3KLVA 4ZVGA 1JLCB 4KAIA 5F8HA 5HROB 4H4OB 5J2QA 4ECRA 2WHOA 1TV6A 3CDWA 4XO0A 3FDSA 5K14B 3PJWA 2V4QA 5KT2A 3HVAA 3JYTA 1RT6A 1RA7A 4O3PA 5J2NB 5C25A 5J1EA 2HMIA 3KLEB 4EO6A 3Q8SB 1LWFB 1JX4A 3DRPB 4PUOB 4IFYB 3HVTA 2IJNA 1S1WB 4ECZA 2IJFA 1VRTA 2B5JA 1MU2B 5J2MB 2CJQA 4J9KA 5HLFB 3PR4A 1EP4A 3CJ4A 3KMSA 4F4XA 3MEDA 4KB7A 2R8GA 3M8QB 1FKOA 4X2BA 2YKMA 4TN2A 4RNNA 4IG0B 2UVVA 1HQUB 1S97A 5J2PA 3QO9B 4EYIB 4B3OB 1IKXB 1JLBB 3UPFA 3TAMB 4QWDA 3KK1B 5HP1B 3N6LA 3KNAA 4RW8A 1D1UA 3KLFB 1RT3B 1SUQA 1TL1B 3V81B 3BGRB 3QZ7A 5KG2A 1JIHA 3MR2A 4DL3A 3OLAA 4J9MA 4TY8B 4EBDA 5FDLB 3QGHA 2HNDA 4ICLB 1LW2A 3H2LA 2GIQA 3IRXB 1ZETA 1S9FA 3H59A 2ASDA 2C2DA 3CIZA 1U09A 5L1IA 3G6XA 4KO0B 5KG3A 4DL2A 5DGAA 3BJYA 2YKNA 4O4RA 5L1JA 2B43A 1JLAA 1T03A 2ZD1B 4NLDA 3UQSA 4K4UA 4O3QA 2XCPA 5I42A 3PR5B 4NLVA 4WFYA 1HQEB 3G6VA 3LAMA 2HWIA 4ECXA 4J9OA 5C42A 2YNGB 3MEGA 2DPIA 4Q8EA 1JLEA 5KFCA 4NLPA 5KG6A 3PW2A 4ZPBA 2I5JA 3DLEB 3GIJA 2V4RA 3QLHB 1EETA 3HHKA 5KFYA 2QV6A 4EO8A 4R5PB 5KG7A 4QWCA 4KFBB 4ECSA 4NLGA 4WZQA 5KFSA 2XCAA 3NBPA
chains in the Genus database with same CATH superfamily
3VAHA 5CH7B 2A18A 2FYXA 3NS5A 2M3DA 1VRUB 1BQNA 2CJKA 1CC7A 3DOLB 1WG4A 1KHWA 4X4NA 1WWHA 3E01A 5DRKA 2AU0A 1AB8A 4ED3A 5D6GA 4IKAA 2FHMA 2DTJA 2F1FA 3BH6B 2R2UA 1FXLA 5HJXA 4ZVSB 1BY9A 1VJWA 4TU7A 1TTHB 4LSLA 1OS5A 5C24A 1VIOA 4NA3A 1VQKS 2R7SA 1SJ1A 3ETMA 1VBKA 4DXLA 3I82A 3HSDA 3EGZA 2D3O1 2OGUA 2XMAA 2JVOA 3N01A 3I0RA 2HAIA 2E7VA 3QJLA 4ZJQA 4DR5F 3FQLA 5HBMB 3E51A 1RWPB 1W26A 4X64F 2XYHB 2KDOA 5A2QY 2HHXA 2LQ5A 1BD6A 3GV5B 4DDFA 3R1HA 3ENWA 3H0PA 3BR9A 2CQ0A 2VZ9A 2MDAA 4FF2A 4NCAA 4OI3A 4JI3J 1T8EA 4JI5F 4WP3A 3GYXB 1KLMA 1S1XA 2XGQA 1RE1B 3A3PB 2G2OA 2DR5A 1FDNA 3O2IA 3EGWB 1HMVA 1QD1A 2Y0SD 4I2PA 1WHVA 2RILA 3D3CJ 5K8PA 4P73A 1EP4B 2C1EB 3H5YA 2Z0GA 3TA0A 4YMEA 2RKIA 2OPQA 3OD2A 4OYPA 2RHSB 3JAMU 5HQMA 4AL5A 4OX6A 3SCKE 3KLEA 2HK3A 4ECYA 1FNXH 4LIWA 5T41A 2IDEA 1HR0J 4Y2KA 5KFMA 1EB0A 1TL1A 1LNQA 2ATCB 2KT3A 4DZDA 4DV6F 4YY3F 1G3OA 4UZCA 4IG3A 3BGFA 2VG6B 3CWJA 2DXDA 3Q8YA 4YDXA 4HH0A 2GIFA 2ZD1A 4ED4A 4K5RA 4NA2A 1H74A 2RUGA 2HSEB 4Y2AA 4M5DA 3V4IB 4F25A 2CDQA 1XTZA 3W8GA 1NH8A 5G0RB 2IJRA 2IM1A 2E44A 4YHHF 4DLEA 3DRSB 4JYAF 3JQMA 1X60A 1XR7A 3D6MB 3HXMA 3NEKA 2F4VF 3P8BB 4OZ2A 2A10A 2OTJS 2DH8A 4ZHRB 4H4MB 3RRGA 3TI0A 4DL7A 2ZH7A 4DOZA 5B0FA 2CNKB 2FPHX 4KV8A 1U7LA 3R27A 4X4RA 5CYJA 4EBCA 2IM2A 2NYIA 3CCMS 4HT7A 1XNQJ 1RI7A 2M0GB 1SQEA 2AGQA 4PPDA 4GC7A 1WOPA 4QJVA 3SQGB 1K73T 1W2BR 2AEMA 3T1AA 2V0NA 5L9XA 1EQMA 1OMSA 2W7OA 4DS4A 1S1UA 2XEXA 3R5GA 4EU0A 3MEEA 4FYVB 2F8EX 2VKZG 1RTDA 1RT3A 3TNVA 2D41A 3KTQA 3D67A 3PKYA 1FXRA 2WAQD 4Q43A 3MUVP 4K4WA 2D74B 5BYQA 1X31C 4IUFA 4YQWA 5K8MA 3CGIA 1LFPA 5D4OA 2H48B 2HHPA 2HGLA 4ZVFA 4ANCA 4YUDA 4QR0A 1SKSA 1DHMA 2GO9A 3LF0A 2R2RA 3M6UA 2QIFA 1IWAA 3PV8A 3LW5C 2DRAA 2BANB 4RUAA 2CYYA 4DFPA 3PYEA 3N79A 3OTOF 5J2NB 3Q24A 1VQ4S 4ECZA 3T1YJ 5EX3A 3MEDA 2HRTA 4G6VB 1H7XA 4EYIB 4C8ZA 4QWDA 4USMA 4U7UD 4LF6F 2DISA 3CMAS 3BGRB 4PRFA 2QA4S 3QRQA 4OHYA 1Y5LB 3GTYX 4OYMA 5I42A 3HD2A 4QIFA 4DX8H 4I4BA 4Y0FA 3OUYA 3HHKA 2QEXS 4WIQA 4ECSA 2N82B 4WZQA 4B02A 1O8BA 1SC6A 1S57A 3LUYA 1X9WA 5J2QB 1N5YA 2Z2YB 3BDEA 4C98A 3EGVA 1S48A 1L3UA 1RU1A 4F4YA 4R8UA 3L95X 4LFCJ 3AD8C 4WE1A 1UJ5A 3DI6A 3FK4A 1RKJA 4LFAJ 2BKOA 1KONA 1WKKA 1SUQB 4CYUB 4C0OC 1TL3A 5F8JA 3TZYA 1RT5B 5EHHA 3D4JA 4FN5A 1NK7A 3A3OB 3G4SS 2QG9B 1FEEA 3OFFA 4QR1A 3KDOA 2KH9A 5GAEU 2FY8A 4RUHA 2HYIB 3QATA 2DRBA 2AD9A 1ACMB 3WC0A 1VFJA 2BV3A 4UF4A 2KT5A 1UVMA 5H9FJ 4IRDA 1U4BA 5KFHA 4WK3A 4HVZA 4CO1A 1QAIA 4BBYA 2F9JA 1DJ0A 2MKIA 5IT9U 1RAJA 1LWEA 5CYMA 1HR0F 2BA9A 5KFGA 1ZAWA 5KFFA 2MQNA 1G1XA 4NLSA 3IWNC 4PYDA 2RQ4A 1HNVA 3OVSA 4DSLA 3OSNA 2BM0A 1WF0A 5JVGQ 1FRJA 3MUMP 5ETOA 1S9EA 2VH7A 1GTHA 3BV8A 3MECA 4LFBF 1CJVB 1RYSA 1RQ0A 1N34J 2ZOMA 4QIVA 3T6JA 3JSMA 3IP0A 2EPIA 3HHEA 1UMJA 4DG1A 4XPCA 2OP5A 2FZCB 1GTEA 1JLAB 1IJFB 5A8WB 3CCQS 5KFIA 3RTVA 2LECA 2Y8WA 3J7YI 5AJ3F 3H20A 2CQ1A 3IWLA 1NDLA 4ED1A 2E5LJ 2DHGA 3IN5A 3E8OA 4EMDA 2R4FA 2W24A 3FSIA 1U48A 2JL9A 1FK9A 3K89A 4OYOA 1FO1A 4P2SA 2C2RA 1HWKA 5D4PA 1N36J 2OPPA 3P49B 4LF9F 3GB0A 1VRUA 2E5IA 3DOLA 1LK5A 4CH0S 3I9ZA 2NZCA 5FJ4A 2R7OA 2BM1A 1H73A 4K4TA 3NGUA 2VJUA 3BSOA 2XHCA 2RF2B 2GQQA 2A1BA 2FVCA 2BQRA 2HQIA 5B08A 4DF4A 2HW3A 2E1MC 3Q8RB 5F8MA 2XB2D 4NCGB 1TKDA 3ENVA 2X1GA 4W98A 3W7BA 2DH7A 3GIIA 2R7QA 3GR0A 1B7YB 1DTTA 4DUYF 3HT0A 5CQGA 4B9LA 2OPSB 1OWXA 3N6NA 3HX9A 3KG4A 4P7VA 3T1YF 4CO2A 4BDPA 1PC5A 3SZ2A 5LXRA 1N5TA 1YGYA 3CJRA 4HH1A 5RUBA 1CEZA 2W4CA 2EFGA 4RNFA 2LP4A 2R2TA 1GX6A 5HAOA 1KVIA 4TYAA 1FJEB 4M5GA 5CXTA 4L3KA 4ZVRB 2C3OA 5I3UB 1RDRA 1P6TA 1FJGJ 3SV3A 1S6QB 2DO4A 2O66A 3KK2B 4A46A 5F8HA 4C6AA 3CDWA 4M5NA 2VQEF 2CJ9A 2CQ2A 1RA7A 4O3PA 4C4WA 3DRPB 1U2CA 2B5JA 5HLFB 1EP4A 2LA6A 1S97A 1JLBB 3M1VA 2VPWB 2YKAA 4C11A 4X62J 1L5UA 5BR8J 3F44A 2PMHA 3HKZD 4K5SA 5ETQA 3MUTP 4DV0F 1WOSA 2C2DA 4LR7A 4CI0B 3W64A 3EYZA 2YNGB 4Q8EA 2QV6A 3K2YA 1TFWA 3H2VE 1S0NA 3EWGA 2IAJA 2HMIB 3DXSX 4Q45A 4OJ1A 3O8WA 2OH2A 5G0RA 3RBXA 2VJVA 1RABB 1H2UX 2JVRA 3DRSA 4F4KA 3L7PA 4OZNA 3CW2C 2COLA 1WEYA 2YTCA 3TUZC 1J27A 2GV1A 3HMJG 1HBOB 2IVMA 4DL5A 3KUEA 3TANA 4ZHRA 4H4MA 2EW9A 4USJC 2GIRA 3TP2A 1X7VA 4NMXA 4IH5A 4ZDNA 2UXBJ 3FNNA 4MKBA 1C0UB 4LF1A 2C22A 3W61A 3VGVA 1MMLA 2M5YA 3HT3A 2UUCJ 2W9CA 4J9UE 3MI7X 3AJ2A 3H7HB 4WFXA 3ZZYA 5F0WA 3UDEA 4CT8A 1TMMA 1X5OA 4AD6A 3H25A 5EX0A 3EMTA 4RU2A 2ZHAA 1UWAA 2D3UA 1JLFB 2L9WA 3SSQA 1M5KC 2UUTA 1B70B 4MT1A 4JI2J 2ZZTA 3MHYA 2YPYA 3BSAA 3FEXB 4OHVA 1Q16B 5CZVA 2VA3A 4MIAA 1Q1KA 2E5LF 3DYAA 3ZTSA 1XBWA 2MZ1A 5KG5A 4L76A 2Z56B 3MAHA 3RJMB 4GVBA 2HRYA 3IR6B 3G8SA 2V8DA 1L3VA 1FTCA 1VK3A 1RP5A 4K2XA 3VAIA 4ZCKA 1T11A 3BO4A 4F3MA 2R9LA 3QPIA 1T3NA 1N36F 4Q2LA 1LW2B 3R6GB 2VV5A 1Z4UA 4WU2A 1N0VC 1YJWS 4OYIA 1SV5B 2Q6CA 3BKFA 4YS2A 2IDLA 3SDEB 4OI0A 3MEGB 2OAUA 2QE5A 2B3TB 2DB1A 3D5MA 2WRMA 3NY0A 3FRYA 3PHEA 4C7QA 4RW9A 2MHNA 3HHLB 1NZAA 1S6UA 1T05B 4P6QA 2FVSA 2V5HG 3MFIA 4QYZJ 1RAHB 1AUDA 5LMUJ 5AE3A 3ILIA 5H9EK 1V3ZA 2B6AB 3IAS9 1OPIA 4WJBA 3NG8A 1R8BA 4QWAA 4ZLJA 3KJVB 1OQ3A 2C2OB 5A8RB 4AQYF 2WK4A 2ZUGA 4CYUA 2V63A 2KRRA 2LCWA 3ZZTA 1VRQC 2XM3A 2E5HA 1YRXA 4ALZA 1A0OB 2YNIA 1NSPA 1RT5A 1RB0A 4PWUA 3G82B 2CA9A 2H9ZA 3RB3A 2GJIA 3UW1A 1FJGF 2UUBJ 3KK3B 4PG4A 1ZTTA 1VQOS 1Z2LA 2QGFB 2I2YA 2DBBA 1N6QA 3PX0A 5EWFA 4LREA 3KJNB 1S1WA 5ETLA 3CCES 2FJBB 5A8KA 3GJQB 2DR9A 1XC9A 1KS2A 1WJ9A 3J7A1 1RWXB 2M2BA 4JI7F 4X62F 4MK9A 2MMYA 3CC2S 5IV4A 1IBKF 3RR8A 1XN9A 4NLXA 4NZ6A 4ZLLA 4X4UA 4B3MJ 4OZ0A 4DQPA 3HHLC 4KAIA 2PI4A 4P2XA 4ECRA 1VQ6S 3X3UA 2CFXA 2ZH4A 2YQ0A 1LWFB 2J0XA 3CXCR 2CPDA 4C8KA 4CLZA 1HBMB 3US5A 3KMSA 1EARA 4HR2A 4ANEA 3DC2A 3V81B 1KOHA 4N8NA 1FRIA 3FZBA 3QGHA 2GFFA 3MPDA 5CCMA 3OXGA 4Y6IA 3R6LB 3D1QA 3BDPA 4HACB 3FZ2A 1JLAA 4PG6A 1CG2A 2UXCF 3G6VA 5M2PA 1Q5VA 1YRUA 4PABA 5KFCA 2B7BB 4R5PB 5A76A 5KFSA 2Q79A 4G1PA 3CJ2A 3Q22A 2Y1RI 2JWNA 2PEHA 2OEJA 3ZC4A 5D4LA 5E0OA 2Q6BA 4NYZA 2KZZA 2IRYA 3HD1A 3V6HA 2J0QD 1X5PA 2PEBA 2G2YA 1RISA 2YVSA 2N4CA 1YTYA 4R0JA 1YZ7A 3BN4A 2K2PA 3AX2A 1F9EB 4N76A 3DKDA 1H7WA 4YN3B 1RT1B 2BE9B 3QT5A 2PD1A 1MLAA 2K1RA 5HI7A 2RF2A 3PW7A 2B4OA 2GVDB 2RAQA 3MM9B 3SEOA 1TKZB 2DXEA 1FERA 3MMAB 3HSGA 1GK8A 3M4XA 3AFGA 1YBUA 1I6JA 2CPEA 3BB5A 1TKTB 4CWBA 3RRKA 4M5IA 2OPRB 4DU8A 4ZIVA 2H5IB 2IYIA 1KTVA 4TLRA 1QAJA 1A6LA 3EVMA 1V5IB 2ZM6J 3BO2A 4U95A 5HVHA 4E8UA 3DM2B 1RBOB 3D66A 1OJ4A 3D0GE 2VASA 1C1CB 1UFLA 2DGSA 5AE1A 1PO6A 3MPUB 2ZJRQ 2MQQA 3HVTB 1HWLA 3DN9A 1Q5YA 1JXLA 1I94J 3OL9A 4FKXA 4TYBA 2H51B 4CO0A 3T5LA 2H65B 2DY9A 2ZNYA 2KO1A 3MR5A 3FRZA 1S49A 1RT4A 4NYOA 4BCAA 2DNOA 4CO3A 1WF1A 5HLFA 5IV3A 3CNQP 2HHHJ 3I0SA 4O44B 3MR6A 2YNHB 4JI4J 2XSJB 4LR8A 8RUCA 1TKXA 3Q89A 1BQMA 2HPUA 2LYVA 2FVRA 1S0VA 2P6SA 1C4CA 2RQCA 1RAFB 2IVYA 2NXJA 4DX6A 1M5HA 4P74A 3U1LA 4BS2A 2RU3A 4KHMA 5K5MA 2YNGA 3IC1A 4OFZA 1JNRB 1SKUB 1IKVB 1L3KA 3DRRA 3LP0B 2CWKA 2UXDJ 3OL7A 3ZTQA 3H5UA 3C2PA 1KVKA 5E3AA 4RJVA 4JI1F 2B51A 4GKJF 4CDIA 2W01A 2WSCC 3M8RA 3B6BA 2C2ZB 4GO7X 1Q82T 3I96A 4J91A 5L46A 4O3SA 2XS2A 3PYDA 5KFEA 1FVSA 3V2UC 2WZ1A 5GMKa 1CSJA 2PFFB 3C6UA 1C0UA 2CPZA 1FF2A 1RHQB 4ZITA 1SVDA 2C2KB 1QUVA 4MK8A 2V9WA 3GZ7A 3WDOA 2CG4A 1DQ8A 3QSYB 2MPUA 4P75A 2BKPA 1TUWA 4LRCA 2L08A 4NLTA 1RT7B 2W7PA 1EKSA 4C0HA 5LJ3Y 2XWYA 3V6JA 2J6UA 3VVUA 4QWEA 3BBBA 4Y65A 3THVA 2XS5A 2VG5B 4OZLA 2LQ9A 4NLQA 2K3KA 4C8MA 1VQ9S 2XGPA 2W9BB 4RW4B 2B4VA 3DLEA 1S12A 3QLHA 3BKUA 3C15A 3EGNA 1U1OA 1U1NA 4BC7A 2AYGA 5K20B 1FD8A 3NNHA 1HHQA 4OLOA 2CQHA 1KTQA 2V4QA 4J5OA 4PG7A 2JFKA 3A8KA 2DGXA 1WHWA 2WW8A 4J9KA 3P5BP 2L9NA 3CDAA 4X2BA 4IG0B 3M8SA 3TAMB 3KK1B 3KNAA 1VQLS 2VIHA 4L74A 4ZVPB 4NEZA 1JIHA 4OJGA 2LEPA 3M6XA 1LW2A 3IRXB 5E33A 3CIZA 2D69A 3CCWA 4DQIA 2PA8D 5DGAA 2UU9F 2EFQA 4NLDA 2W1BA 4WFYA 5KOWA 3PIPQ 4FYWB 3NLCA 2BE7D 3MEGA 2DPIA 2MHEA 3THPA 3GIJA 5KFYA 4DV7J 4NLGA 3D68A 2W7AA 5LSLA 1XNRF 2C3MA 1RLCL 3H40A 1SPBP 1F0XA 3M8PA 4Z2XA 5D3GA 4Y34A 1VRTB 4KIAA 4KHRA 1TVRA 3GP9A 3RW7A 1H3DA 5EGYA 2DIVA 3QFWA 2OD4A 4U9RA 3Q83A 2M52A 5KFNA 1YJUA 3A13A 3KJVA 2RDJA 4F2SA 5A8RA 5HJYA 4YEAA 2PMWA 2XMVA 2EKNA 4KQZA 3AXMA 2HBZB 2ZM6F 3IGNA 3IMQJ 1C4AA 3VF0B 4ES2A 2GQ2A 4ELVA 1MN9A 4AL7A 2DNQA 1UTAA 2F63A 2FDNA 4LIRA 3G82A 3NBPB 2ACMA 1HNIA 3GQCA 4MAKA 3Q8UA 2XY7A 4PQUB 3BF4A 2F65A 2CZ4A 3CB4A 2Q3PA 1RXOB 1S1VB 2DNZA 3TW0A 2CPYA 5T14A 2B56A 4ZVEA 3GILA 3B78A 5IT9Y 1TFYA 4OI1A 2ILZA 2HHHF 5DLGA 3UN3A 2VC1A 1RTIB 1HYSA 2O3DA 4FXVA 3GSDA 2XG8A 4YB5A 1NRKA 3NNCA 2FJXA 3CJ8A 3DGPA 4B9NA 3CCUS 4OYAA 4ES3A 1UFWA 4ILMA 3Q23A 1SIZA 5T7LA 1DZ5A 1TR0A 4JI6J 1YJRA 4RW7A 3TEHB 2XMWA 1LWFA 1GMUA 1HWJA 1QSYA 1GQEA 2HNDB 1HBMA 5L1KA 3KWMA 1RYRA 4NLOA 3CCLS 4F4WA 2W2PP 4A8KA 1HI8A 3VALA 1VI7A 1VCTA 3V81A 4WP9A 2NYHA 3PVXA 2AW0A 2VPXB 2GJFA 2OEKA 4QPXA 2RDIA 2ZWPA 3H8YA 4C3LA 3ISZA 1W25A 3HZEA 2PIIA 3MPYA 2CADA 4PWDB 3W62A 3W2WA 3CMES 1SXLA 3PHTA 4QQBA 3TEGA 1FX2A 1IBCB 3CO9A 4O3OA 2K06A 1JXVA 3CJ3A 3S7RA 2PFDA 2Q43A 2OSQA 2F9DA 3OFHA 4CRJA 1U1KA 3RUBL 2V94A 4NRTA 5LM7E 4C2MA 1V3RA 2XYGB 3AOCA 1TU0B 4P10A 2CQIA 4K0KJ 3EXYA 3VZHA 3PNIA 3W8PA 5HO4A 1RT1A 5DDQC 5GMDA 2IA6A 3TO8A 3TYTA 3VTIA 3CTRA 2OUGA 2HLUA 2J0WA 5I4MA 1NHUA 4ZJLA 3S6EA 1NU4A 1URNA 4L73A 3MDFA 4CLPA 3MM9A 3GR1A 1D9AA 2BR0A 4J9NA 2A6OA 1KWMA 4FS2A 3IBFB 3MAAA 2VG7B 1VR6A 1F5AA 4KGVB 1QLNA 4ZCLA 1TKTA 1IR2A 2VFUA 2KJWA 3K59A 2OPRA 4ZCIA 2G1DA 1MMDA 2PMZD 3T5JA 1X5SA 1Q8KA 1KDNA 1LXNA 1UWBB 3F41A 2Z4PA 3QNWB 2JEIA 2D9OA 3K5OA 2QO3A 5KT3A 4RZRA 4DI6A 1N48A 4FBTA 3R5BA 4DV5F 4HL9A 4ZOSA 4IYQA 2RU9A 3CPWR 4V1Ak 4DV1F 2V67A 3A12A 2CJAA 2XMJA 3PJWA 4JV5J 3HVAA 2OI2A 3Q8SB 3HVTA 2HHWA 1VQ8S 2KXNB 2QRRA 1MW7A 2XZTB 4O0IA 1HNWJ 1FKOA 4NX9A 2VFVA 1XEZA 4AFFA 3PRDA 1LWXA 3I55S 2DGQA 2RRBA 3ZTPA 5IS2A 2GIQA 2Z2ZA 3SSRA 4FYDA 1Q8BA 1Y5NB 2VUGA 3UQSA 1MWQA 1MROA 1R89A 1X0FA 5C2CA 3LAMA 3QQCD 2XSFA 3VGTA 5ITHA 4NLPA 3L7UA 1WC6A 3MPVA 2KHDA 2EBEA 4CLLA 3UN2A 1HNZF 4OZ1A 2HQCA 1KN6A 4LSNB 4IOAQ 3MM6B 1G7CB 1HBNA 1KVJA 1YITS 1HBUB 4OI2A 3CCSS 1P8GA 5SUHA 4DV2J 4ZP8A 1GXTA 5CA5A 3MOJB 5J2PB 1K47A 3PJ9A 2IRXA 1NKBA 1WELA 2RNEA 4A8MP 3BPSP 4WYWA 2ZC3A 1RAAB 3VWSA 3GIRA 1WI6A 4KHPF 2HHQA 1U6FA 3SFUA 2WBMA 1PYSB 2YKNB 1DTQB 2BJ9A 2PA3A 4IDKA 4OX8A 2XLKA 4M5MA 3PX4A 2V9KA 1FRLA 3KLIB 2WVBA 3TJAA 3EX7B 1QE1B 3SCLE 5ETNA 2XI2A 5AXMA 2I6WA 1TUGB 2CQBA 2UZAA 4EI2A 5GAGU 3KDNA 4ZPCA 2HRUA 3BQ2A 1M1HA 3LGHA 3L4BC 4X4VA 4S0MA 3BSCA 3E01B 2XYPB 1X4DA 4JV0A 3T19A 4DUZJ 1FE0A 2I9SA 4UQGA 4LSLB 5A0YB 4USWA 3IS9A 4U8YA 4OX9F 1T9WA 1RT7A 3HULA 5F8IA 3LP2A 3LANA 1X8DA 1FD2A 1SI9A 3TA1A 4MKYA 2EC2A 6AT1B 3N5FA 1Q79A 2C2MB 2AV5A 1SC3B 4KTQA 2FB0A 3FMBA 4XK8C 2CJBA 2H4WB 1H6KX 1BXNA 3IWXA 2OTLS 2LVWA 3AQPA 1RWMB 3UN5A 3DU6A 4DPWA 2MY8A 2FQQB 3K58A 3DMJA 4Y2MA 1FFSB 1NJWA 4B17A 1BE4A 1WOOA 3JSRA 3JS9A 2J9CA 5F3ZA 2R8IA 1PCAA 3DDKA 4LF8F 2ZVIA 3PXGa 1WC3A 4RNHA 1HNXJ 5K8OA 2JFDA 4WF9Q 1RWNB 1VBYA 4LVOP 4G1QA 2Y9HA 4FF3A 1KLMB 1S1XB 2PE8A 1RAOA 1HMVB 3KKFA 2GQCA 1R0BG 2M8HA 1RT2A 1S6PA 4TLQA 3V6KA 5KFKA 4ID5B 2RKIB 2OPQB 4ELTA 2NPFA 3J80U 2XMTA 3FJ2A 2KVQE 3VAKA 2BXJA 1WKJA 3GFXA 1U2RA 1BMQB 2AX1A 2ALYB 3CJSA 3AOAA 1KOOA 2Q1LA 3L3CA 3OPKA 5GAHU 1ZZNA 1FRKA 3OTDA 3LGMA 4IG3B 2FLLA 5IWAF 3HFVA 4KPYA 1JJHA 2YWKA 4ER8A 1H98A 1UCNA 2EI5A 4AYBD 4N47A 3IO1A 2WTFA 4O3NA 1FCAA 1UVIA 3OJSA 2J0SD 2POKA 5L38A 4ZVOB 1UETA 1UVNA 1T94A 3I4PA 2PDAA 3M2UB 1S1VA 5F8LA 3M8QA 1VS3A 2MJUA 2AP6A 3UVJA 2CQCA 2A2DA 2IMOA 3KLFA 4ZPAA 4DSIA 3AH6A 1WTBA 2B4PA 2AJ0A 4KV8B 4LSZB 2NREA 1P1TA 2UV8G 2J9DA 4HT5A 3FBBA 3GMGA 2CIMA 3KOAA 4NASA 4HHJA 1SIWB 4NEYA 2DEJA 4RUCA 4EYHB 1UUJA 3RZAA 3KLVA 1MG7A 3NWGA 4DV4F 2WHOA 3NS7B 5B0BA 2NXCA 1IBMJ 1F2HA 4F36A 4DMZA 4EO6A 3PR4A 4HHUA 4DR2F 3I87A 2KM8B 2BX6A 2FZKB 4TN2A 1N32F 4K2JA 2XZ2A 4DV2F 1ZM2A 4RW8A 3JB9k 4JI0J 1RT3B 2H54B 1UA1A 5MAOA 4DL3A 2J76E 4CLSA 1V9OA 2HNDA 2EBGA 4N5SA 5D0RA 4DLGA 2QFIA 2JHEA 4NE9C 2VICA 4X4QA 4J9OA 1JLEA 5CD4A 2HFZA 1EETA 2XZWA 3VCDA 4DF8A 2E5JA 7AT1B 4Q2MA 4PZVA 2FC8A 1PAEX 2BRLA 2HWTA 2YKPA 4PWDA 2XMMA 4NXNF 4RW6A 1LWCB 4DR4J 2DY1A 4J7CA 2EXUA 2VQFF 1M5SA 1L3SA 2RB7A 5CD4H 4WP8A 5DS7A 2W9AA 1AZSA 1XK8A 3BKTA 2E66A 4OYWA 2UUAJ 4TY9A 1JKHA 4ILLA 1NXIA 2BDPA 5CYQA 3HJFA 2NUHA 3ITHB 1LEOA 1N33F 1B99A 2IM0A 1GT8A 4AXJA 3SYZA 4ZK7M 2LXFA 4URQU 3OUYB 2MTLA 1NH7A 3MXHP 4GMKA 1N5YB 5K8NA 4Q44A 2MSTA 5KFTA 1OO0B 1SJRA 1Z1ZA 4WE1B 4UOHA 3DI6B 3HLUA 5KFBA 3FKBA 4ECTA 5IT0A 4BHQA 2KM8C 2X1AA 2VG7A 1NPRA 1TL3B 3VR1A 4MYUA 3SSSA 4Q8FA 2UVUA 3TZXA 3FFIA 1HQ2A 3DLLQ 3K5NA 2FJEB 1ZOTA 1PILA 2QLBB 3H5XA 4LF4J 2E1AA 3DLJA 3PW5A 3I5BA 3KUHA 4O3RA 3BGOP 1VQSA 2WCXA 2BOAA 5KT5A 1IXKA 1CQNA 1LKZA 4YDDB 3WC2A 3CDUA 3N6MA 3P96A 2YX4A 4K4VA 4PXDA 4C3MA 5DDPC 1RGVA 4NLRA 1LWEB 5CYMB 2ZH1A 2V1TA 2NXUA 3D9BA 3GCWP 2PSZA 3OSPA 2MGZA 3CMQA 2I5JB 4DR3J 2HZCA 6FDRA 2HS3A 1YG0A 4FXWA 4CLTA 3V5RA 5HQLA 1NSAA 1SC4B 5AT1B 2ZE2B 1S9EB 4P9SA 1TL5A 2Y3YA 2B0GA 2Z2MA 3MECB 3RYLA 4FVCA 2JEGA 2ZNZA 4LSNA 1VC6A 3UNGC 2KL8A 3JSMB 3LH2S 2KT2A 2XO7A 2MZJA 3KFWX 5A6WA 4DG1B 2ZWOA 1PYTA 2MEWA 2C28A 5DQGA 1MMNA 3DDNA 1BWVA 3NXZA 5KFUA 2UUWA 2BJ8A 3C6TB 3UCUP 2HQFA 2IHR1 1DTQA 1RTHA 1UL3A 5HVGA 1JLQA 1MWYA 1Q53A 4KY3A 2ABYA 3AODA 1HA1A 4C9DA 1FK9B 3BGUA 1FA0A 3KLIA 2RJZA 4HKQA 1QE1A 3U02A 4P52A 1JLCA 1VLOA 4XPEA 5M2UA 1M0SA 3O1LA 2OPPB 2AF6A 2HK2A 2CUYA 2DYAA 3QJPA 3JSBA 4WCEQ 3GFHA 1F5BA 3JTPA 2BKNA 4DL4A 3LPEA 1FDDA 3HHNB 1NJZA 4TY8A 4ICLA 3OFGA 3TVZA 3UR0A 4KO0A 4OZJA 5A0YA 3GJSB 4KRWA 4WFZA 2P2CB 1YI2S 1F3VA 3H4DA 3QBCA 1CC8A 3TZZA 1DTTB 1U47A 4WFNQ 1TUVA 2MJNA 1RT6A 4C8YA 2HVIA 5J1EA 1J5EF 2BJEA 2IJNA 3GFZA 2NUUG 1U0SA 4ZVUB 3CF5Q 4DSJA 3CJTA 4DR4F 2HS0A 4DX5A 4DWIA 5FDLB 3CULA 1NJXA 3H2LA 1ZETA 1BQXA 1ZBTA 1EQ0A 2JDJA 5CZXA 1IBLJ 5ETMA 4NXMJ 2XLIA 4EZ9A 4N56A 1YBAA 1X9MA 5C42A 5DDOC 1IQTA 3ZZRA 1PJ7A 2C3YA 2DVIA 3Q2SC 2WONA 3HSJA 3KLHA 3W9IA 5J1NA 3HZGA 3BQ1A 5DM7Q 2B5JB 2HFVA 5EWEA 4ID5A 5B0DA 1EHWA 1T0TV 2XBPA 3M1VB 2V4JB 4C11B 2D9PA 4DX7A 2L48A 3GV8B 1I51B 2H5EA 3IFEA 3TAQA 3SI8A 3AT1B 2AJFE 3DLKA 5D0GA 4DR6F 4KE5A 5DQIA 2P9GA 4PKDB 4TU9A 4W92B 4QYRA 2VODA 1NDKA 3BYPA 5IC4B 1PBUA 1T9VA 1AUSL 2W25A 1B7FA 2DEIA 4DEZA 3CD0A 4JI8J 2Y8YA 2IAJB 3SFGA 4LF7J 1FX4A 4FS1A 2J8SA 1UZDA 5KFQA 3LPYA 4AXIA 4DQRA 4ITSA 2DT9A 3ILOA 4N8OA 4Q5VA 2HFUA 3BBFA 1YLXA 3JXOA 3M05A 4HTIA 3B8HA 4DR7F 1ZM4A 4ZN1A 3M2UA 3EJMA 2R3VA 4FXDA 2AJQA 1GEHA 3UNYA 2EG2A 3VGSA 2FIUA 3TWZA 2ZH5A 3DOKA 2GMLA 3CJ0A 5KFZA 2U2FA 3L7OA 1JB0C 3N28A 1U6BA 1SJ3P 2V2VA 5LMNJ 1QJHA 4FDFA 3T5HA 1G6BA 1VQYA 2QTWA 2IY5B 3PEHA 4YB7A 4IOCQ 5KFDA 2W9CB 2KXFA 2UVWA 2Y1LB 1WEZA 3HPOA 1SH2A 2R42A 4RWWA 3HO1A 1RBAA 1SH0A 4DZ6A 4Q0BA 2R8KA 1T03B 3D6TB 4PXCA 1XERA 5HMWA 3EPIA 3H98A 3RAXA 2QSFA 5GADU 4UOGA 2DPJA 4HEA9 4A8OA 3G96A 2GHPA 3CD6S 2GCFA 3DYAB 1J5OA 1F9HA 1QY7A 4WZMA 2WW4A 1S5ZA 1LFWA 1TELA 1F2GA 4GVBB 2I38A 2JLGA 4B3SJ 1K9MT 3LO3A 1XMQJ 3C46A 4DU7A 2PT0A 4XDDA 3VQSA 1LWCA 2X7IA 4XDCA 2FUG9 1NSQA 2R7RA 1S0OA 4CP5A 1R0AA 1SL1A 4WKYA 4FZVA 2V6AA 4J9RA 1KC8T 3PY8A 2M70A 2AEJA 4RW9B 2VOOA 3ITHA 1M1KT 3HKWA 3D0IE 5KAKA 1TP7A 1JWWA 2ZFHA 2FLPA 2IIHA 1X4FA 1UPPA 5F9LA 2KG0A 3PX6A 3CIMA 3C19A 4I2QB 1ZM9A 2MKKA 3DHWC 4C8OA 4NI2A 3O6QA 2KFYA 3S1TA 2VA2A 2FTRA 4B9TA 2L3MA 4CM0A 4FKYA 4HHHA 2QJ3A 3P5TL 2YNIB 2LEBA 2M88A 1LK7A 2A0FB 1KHVA 4NXMF 4N41A 2MB0B 1N5QA 2N3OA 5FD1A 1V6HA 2RS2A 1M5VC 1B0VA 1CULB 3MZIA 5B09A 1VQ7S 1N6QB 4JI3F 1WD6A 4RPFA 4ZCMA 1RK8A 7FDRA 2GS8A 1S1WB 2QFJA 1GFWB 1UA0A 5A8KB 1Q7LB 1MSWD 2GX8A 3M32A 1YJNS 1Q0NA 1D1UA 2V2KA 5KG2A 2BZ2A 1VC0A 4LBIA 1SJ4P 3Q86A 3THTA 1NK8A 3VAFA 4UOFA 4LRFA 1XMOJ 5KG3A 1P27B 2KXHA 3NMRA 3T9ZA 2XCPA 3LA0A 3NOCA 2RRAA 3DDIA 3A3NB 2I5JA 2AYEA 3OVBA 2CPIA 3EM1A 4EEYA 1RWOB 3ZNJ1 5F9NA 2DNKA 1RAGB 4G3IA 3KLGA 4LF5J 2O67A 3WIVA 1RHKB 3I31A 3A4TA 1Z2ZA 3IXQA 4ZMMA 2ZE2A 3ZTOA 3D54A 3SXLA 3C8YA 3G86A 4NCBA 3D0HE 4IRKA 4JV1A 5I3QA 4B3TJ 1JNZB 1X4HA 1BC6A 4O23A 2RDDA 3MEKA 1GH8A 1HW9A 1X4CA 4Z7CA 5FLXU 1I3OB 4ZP6A 2NCKL 2C42A 5B0GA 1VDHA 2VHGA 4OHWA 1Y7PA 2YQ3A 3PW0A 2NQPA 5LL6d 1YBTA 3C6TA 4DR1J 1FTRA 1REGX 2OEMA 5F0UA 1VQPS 1XNQF 4K4XA 1W2IA 5L39A 1E6YA 3ZZPA 4B3RJ 3ZFVA 3ET6B 4PG5A 4TKTA 2J7UA 5B7WA 3KHRA 1FI4A 3R5AA 2W8KA 2F8HA 3Q8PB 3SMZA 1R6VA 3H2UB 3U1NA 2IPOB 2CPXA 4UY85 1WORA 4LR9A 1GMWA 1NKEA 1UW4A 4DV3J 2CPHA 2K1RB 3TAPA 4C3KA 3IA0A 4USIA 1TV6B 4M1KA 2ZEJA 2ZVSA 4WFAQ 3FC9A 4FYYB 2B9EA 1UEKA 2Y1IA 2B9WA 4DFMA 1UEUA 2MKCA 2FVQA 3LTOA 4E0DA 2JC1A 1U24A 4HLBA 9RUBA 2ZKUA 3P3DA 3BREA 4G1IA 4WXOA 3FCHA 5HK4A 1HWIA 2FJDB 1HHTP 4ZS6A 1YSJA 3KHLA 2ZOGA 4LQ9A 1VC5A 4F50A 1PJ5A 3NGTA 1Y4ZB 5FDLA 2ZH6A 2QMXA 1VYAA 2JEFA 2ZBRA 2MKJA 1VQ5S 2AHOB 2OHDA 2QX0A 1Y00A 3R2DJ 1Q4RA 4P2MA 3NGSA 1C0TA 2VF3A 4UW2A 2XC9A 2AQ4A 4KH1B 3J80Y 1HPZA 1LQ9A 1NZ8A 3QGIA 4U7CA 4MFBA 1R31A 3RBZA 1PKUA 3D1HA 2EFNA 1RT4B 5B0CA 1JK9B 1T9UA 1NKCA 2LQJA 2XULA 3I0SB 4D3GA 2GHWA 4LFCF 3QSIA 2H5JB 1TKXB 2V4JA 2Y0BB 1BQMB 1DQ9A 3IRWP 4LFAF 2VBZA 4MKVA 1UPMB 1QAXA 1Q8IA 3DOMB 3MMCA 4DPYA 1BLUA 1K8AT 2N4DA 4F8RA 1FEHA 4HDHA 2OFHX 2IMWP 3ZZOA 4DR5J 3DRRB 4F26A 4ZVQB 2OO4A 1S77D 4X64J 3FBFA 2J6SA 3RBEA 1RU2A 3EDRB 1T95A 2P6TA 5J2MA 2Z30B 4LMZA 2XY5A 3BGLA 1WUUA 4QPTA 3PEJA 4Q7AA 2FJAB 4JI5J 3MCSA 2KU7A 2DO0A 3U27A 4B9UA 3ISND 4HI1A 4F0MA 2CNLB 1YJVA 2V8HA 3GONA 2V68A 2WVFA 1IM4A 3BO3A 3C6UB 2LQBA 4F4ZA 1UW9A 1NK5A 1U1PA 1XQIA 3ZXWA 2JOQA 1AW0A 5IQQA 4XO0A 2MXYA 1NHKL 1FKAF 2ROEA 1FFGB 1RWKB 3RRHA 4I1TA 3W5XA 1KSPA 1HQUB 4A8SA 1IKXB 3N6LA 4YY3J 2XTDA 2EVZA 4P72A 5HMYA 4J9MA 1N34F 2JLFA 5I3PA 3OR2A 4DPXA 2F7VA 2ASDA 2W2QP 2C3UA 1X4EA 1T03A 2P9CA 2BBEA 3VQTA 3K57A 3HCXA 1H72C 2Z8QA 3DLEB 2V4RA 3QLHB 3C15B 2DJWA 4YHHJ 4ZPWR 5E3QA 3LWLA 4JYAJ 2DHSA 2IC3A 2F4VJ 2BJ1A 2XZDB 3POTA 1JLGB 2E1PA 1GXLA 4CZCA 4ECVA 3QAEA 2W4DA 2B4UA 1D9DA 3M2VA 1EX8A 3M2RB 5KFVA 3GG1A 3EVWA 3HP6A 1HD0A 3NS6A 3W9JA 1H38A 4TNOA 4J37A 3IR7B 4CLWA 2K7KA 3TJ9A 1TAUA 2FD2A 3FQKA 3QIPB 3M6VA 1WC4A 5E3CA 1SJFA 2XTCA 2MQ8A 3MMBA 3ISNC 5M2RA 2DH9A 2KN4A 2VD3A 2GAGC 3HHLD 3D6FB 1OM2A 3QIDA 1DLOA 3M8PB 5D3GB 1TVRB 1DURA 1RBLA 3KMQA 2LFVA 3TVKA 1VIXA 4PXEA 4I2QA 2HQ3A 4USKA 4I6AA 1ZS6A 3NOGA 4EFAC 1OQ6A 2L9DA 4BWJA 2ADCA 3J7YU 2LDYA 3CT9A 3FSYA 4KGXB 4Y28C 2WOMA 1RA6A 2XI3A 3OTOJ 1HNIB 1REVA 5GAEI 4PR6A 1CULA 4GVLA 3CD5A 2LEAA 2BABA 1NAQA 4LF6J 3LQVA 2KVIA 1IVZA 5F8GA 3QYYA 1KLNA 4CH7A 4M5JA 2GVZA 2DHHA 4URSA 5DG7A 4F7VA 3R8YA 3G8QA 5KFOA 2ZH3A 3TARA 4QIWD 2NS1B 2DNYA 4M94A 4YR0A 1DRZA 4YP3A 1BWEA 1HYSB 3MM7B 1D9FA 5BR8F 2ASLA 4IR9A 2VU5A 1EIYB 5JUMA 4IRCA 2B7CB 3MWBA 3DGPB 2BUNA 3OXLA 1UJ4A 4I7FB 2CKWA 1CS4B 1WI8A 1T3OA 1XR5A 5H9EJ 2WSFC 2WBRA 4ZP9A 5T7LB 1TAQA 2C3PA 3PFEA 2N7YA 2XLJA 1E6VA 3QT8A 2B9XA 4IR1A 4RW7B 4IFVB 4WWSA 4DPTA 2FY1A 2LU1A 2RT3A 1FNOA 1OYDA 3A8IA 1ZTWA 1P9YA 3G6ES 1X9SA 2AJ2A 1FHTA 1IKYB 2ZHOA 5KFWA 1C2PA 2GAHC 5L1LA 3D1OA 4AUKA 3UR3C 1QTMA 2BJDA 3I4HX 2MSSA 4FPRA 1KQFB 3OR1A 1O6XA 3L9ZA 1RAIB 4I64A 1RACB 1QM9A 2HHSA 1QSLA 2KZMA 4CNZA 2UVRA 4I0WA 4QIGA 4ECQA 3AQOA 5KG0A 3W2WB 2UXBF 1WNEA 4OX7A 2XQCA 1HI1A 3MGJA 4RBTA 3TA2A 1FWKA 4OV6A 3ELHA 3AA9A 1ICEB 4DUTA 4E2FB 2XTEA 1Y10A 2UUCF 2HFNA 3ET6A 3W63A 2KI2A 4MMOA 3QO9A 2OMOA 2J8AA 4B3OA 5HP1A 2HFOA 4FF4A 3PYFA 2CQDA 2E1RA 5DG8A 2YWWA 1I5OB 1SB6A 4ELUA 4CLFA 2W8LA 3SV4A 2H3EB 1SL0A 2Z57B 4I67A 4JI2F 2JEJA 2JLEA 2V2QA 5HQ8A 3RB6A 1BUXA 4LFBJ 3PYGA 1AFJA 1TV6A 2RE1A 5KT2A 3JYTA 4H4KA 2ZH2A 3OQ2A 1VJQA 5ETSA 2CJQA 3MAAB 4KB7A 4R25A 2R8GA 4K59A 2HIYA 2NSCA 1N8RT 2KB2A 1EZZB 2GW8A 3NGKA 5AJ3J 3C3LA 4FVMA 3V4MA 1U09A 4F0HA 4O4RA 3G87A 1NUEA 4RKUC 3MMJA 3DU5A 2V69A 5AXLA 3PW2A 1LOUA 2JX2A 4EO8A 5KG7A 1NK9A 1V3SA 3PJXA 4XAKA 2KFZA 4LF9J 4IO9Q 3ILJA 4NA1A 3OV7A 2YWGA 4ANDA 4L3NA 1FKOB 1U8SA 5DGBA 5LMUF 2AT1B 2D1CA 2ASJA 4EWTA 6FD1A 3V6DA 3T3FA 1RTZA 1Y3JA 1APSA 2CPJA 3K5LA 1FXDA 2VBXA 2IBKA 2G0CA 1MROB 2J6TA 3LALA 1ZAXA 4ZVTB 4O4GB 3DOMA 3N0VA 4DUYJ 2YNFA 3OTBA 2CQ3A 3PW4A 1ZM3A 1HBNB 3ADAC 5EUHA 1KEKA 3R2CJ 2UUBF 3FUYA 3SIPB 3U1MA 1WC5A 3NCQA 4LJMA 4DHVA 4Y3CA 1YRTA 4KGKA 5HSPA 1ZA2B 2IFXA 1NMEB 4ZA1A 5HMZA 5H9FK 4V19X 2D7SA 2WSEC 2V50A 2BJ3A 3FVYA 3IBCB 3FCWA 1KQGB 1RZMA 3R9LA 4CLYA 2W4PA 3EZUA 2LXUA 2VDIA 1B4SA 1JQGA 4IDKB 1SL2A 3GE9A 1RHUB 5F3TA 3LP1B 1OIAA 2DCUB 3UCGA 1R8HA 3BBCA 1Q78A 4OV1A 2VQEJ 3Q0AA 4BWMA 1S76D 4MYTA 4ERDA 1CBKA 3CDEA 4U96A 3C14A 4ED5A 3JQKA 2GGPA 2HGNA 4B3MF 2YKMB 3MM8A 4ECWA 4K8RA 5DZ7A 3DXBA 4DV0J 4OHXA 1S4FA 1FJ7A 9ATCB 1M90T 2KRBA 2HVHA 1HQUA 2AX0A 2QA4G 1IKXA 1RWWB 3T1HJ 3IS9B 1Y5IB 4PG8A 5CAAA 3QRRA 2P9EA 3LP2B 2E1CA 2RS8A 3GIKA 4MH8A 4WPAA 4OLPA 2BMBA 3D2WA 4W90B 4U67Q 2GC8A 5ETRA 2QC3A 2BQ3A 3CDBA 1Y3KA 3X1LB 3L09A 5CABA 4DS5A 4UY8T 1B0PA 3N4WA 3BM7A 3HJVA 2AJ4A 3W1YC 4B9SA 3NCPA 3M9MB 3NAHA 4CTAA 2EK1A 3DMJB 1C1BA 3CSKA 4RBVA 5ETTA 2XHWA 1MN7A 1TK5A 2LXIA 1JLGA 1O0PA 2HBYB 3OLBA 2WVCA 4U7UK 2DXFA 2MQOA 3UDLA 4UT4A 2KFNA 2CJXB 1RSCA 5BYSA 2QT7A 3M2RA 3NP5A 4WK1A 1RWVB 2DGTA 3DNCA 2F8MA 3GFYA 3AX5A 1WEXA 3T9NA 2SXLA 4OZ3A 1M5PC 4M5LA 4G1QB 1CJKA 4QR2A 3QIPA 4OMFG 2CZVC 4AE5A 2DR8A 2J9EA 4WU3A 4ZPDA 5E41A 1RT2B 3CC4S 3HSZA 4ED7A 1S6PB 3CC7S 1CQMA 3EVOA 4X84A 5K14A 1YK9A 3KJQB 1AFIA 3M8YA 2MQLA 2AZ1A 3MM5B 2VPYB 4DQQA 4Z7YA 1G2EA 3UWTA 2M4MA 2RH3A 1FRXA 3VHQA 3W2VB 3M30B 1H0HB 4TXSA 3QWPA 3JQJA 4DL6A 2QLXA 2QMUB 1PBAA 1OY6A 3QFHA 1WSVA 3MPWA 2DNNA 1HQEA 2QYGA 4NLYA 4QOTA 3W66A 4CM2A 1O5JA 1HD1A 3PTWA 2XO6A 3TUPA 2CNNB 2YWFA 2OLWA 4JOUA 4IFYB 4ENOA 1GXUA 2LA4A 2CG8A 2IJFA 1MU2B 5E2QA 2HVEA 3M8QB 1EKRA 1XIQA 2V8GA 2GNKA 2DHXA 3LGNA 3UVJB 1I94F 4KGZB 3EUNA 5LSOA 3O44A 3KLFB 1TK0A 3F0NA 4C8NA 4UTGA 4Y00A 2B43A 4JI4F 2RHQB 1VHIA 3MM7A 4ECXA 3HVRA 4RLEA 1V5VA 5MLCV 5DETA 3UD5A 3TRGA 4KFBB 2WVDA 2OSRA 2XCAA 1DQAA 1YJTA 3Q2TC 1PIEA 3GG0A 4I7FA 1CS4A 4TU8A 4OIXA 4FYXB 2G1HA 5K9FA 4AQYJ 3GJTB 1CVJA 4ETXA 2X51A 4CLKA 4RW8B 5HBMA 2UXDF 2RD5C 4IFVA 3AB4B 1XR6A 5KOXA 4X65J 2AYBA 2R7WA 1S9GB 4B08A 1Q86T 5C7PA 2ZJQQ 2K7JA 4TVAB 4YR3A 2BE2B 5FLXY 2ZUAA 2HHTA 2ZBPA 5CCLA 4J90A 1B3TA 1IKYA 3LWMA 1A9NB 5KT6A 3M9NB 1JLEB 2N3LA 1S59A 1EETB 3T5KA 4UZBA 2B8QA 2MLZA 5ETVA 5KT7A 3T41A 1U45A 1QVGR 4DSFA 5DG9A 2IBOA 1IM6A 4RW6B 5J1PA 4JI7J 2IRUA 1RADB 3R5JB 2UP1A 1HL6A 1R7IA 1ZZFA 4DCPB 3PFOA 1NK0A 1IN0A 4ILRA 4DQSA 1IBKJ 2VL1A 1AZSB 1N88A 1QDUB 3OXFA 2RSQA 1JKHB 1K1QA 5AXKA 5CYQB 1WSRA 4WFBQ 3R7NB 4RNMA 5SZTA 4CCHA 3T1HF 1R8AA 1OSDA 4NZ0A 2FLOA 3J7AN 2C2EA 2VG6A 2I0XA 4LRBA 3MR3A 1NB7A 5IFMA 2BOPA 3VAMA 4W4MA 5IZHA 1Q95G 3FGVA 1VHFA 3D6HB 3VVTA 3CCVS 3PRBA 1EAYC 3R1LA 1U6ZA 3V4IA 2DNRA 3CJ5A 1VBZA 2JNJA 4GKKJ 4LBHA 4YOEA 4QW8A 5H1SV 1N52B 2DNPA 1K0VA 3KUGA 2ZBCA 5CHCB 4F67A 3H42A 3TQEA 2UXCJ 4NWBA 4DN0A 3FFIB 2HG4A 2QL5B 4OJ3A 1BHNA 2R7VA 4RUBA 3EZOA 3QAUA 1T02A 2CQGA 4NMLA 2I1RA 1S1TB 4IQMA 4NRUA 2YXLA 4UQTA 1T9YA 1FKPB 2EC0A 3SQGA 2AEFA 3ONQA 4DV7F 3BH7B 4DL0C 3ZNUA 4QYZK 1Y11A 1FDAA 1FT8A 2AIRB 4OQJA 1LV5A 2R2SA 3GPAA 1HKAA 1RKIA 4NYPA 2FHJD 1R27B 2KTQA 2MGZB 2OIHA 1R43A 3PIOQ 1TK8A 5GVQA 4BC9A 1WDDA 4UOCA 4O4GA 4RBUA 1JJ4A 2BANA 1UVLA 1S99A 5J2NA 2O1PA 1FNMA 1B0TA 3T6BA 2HVZA 3TX0A 1QAYA 4ZLPA 4L6V3 1SQFA 4LT6A 2L41A 3BGRA 1VLYA 3ENQA 3R3TA 1YWXA 4NOHA 5HATA 2LDIA 4K4YA 2E9ZA 3W60A 1SC1B 4OJHA 2BQUA 5C5JA 1HLWA 1RTHB 4QBUA 5D8HB 4DBQA 1JLQB 4N77A 5KFJA 2O5DA 3ULHA 3BSNA 2F3JA 4JB8B 3LP1A 4LVNP 4ED2A 2VBYA 3DRXA 2OD6A 1R0CB 3HM9A 2DGVA 2DR7A 2ZOFA 1JLCB 4KH0B 5HROB 5J2QA 3FDSA 2KYZA 1VOMA 1S7IA 2Z58B 4ID8A 4PUOB 2WB1D 2VFSA 2HBRB 2YKMA 4C97A 2HZAA 1P1LA 1D8YA 3UI3A 3BPDA 1SUQA 2ZBIA 4JI6F 4A4JA 4TY8B 4EBDA 3WBZA 3K7RA 2CNOB 1NPPA 2HAFA 4ICLB 4X65F 1S9FA 4DJBA 1H2TZ 5DZ6A 4KO0B 2FGCA 2DNMA 1RHJB 5E7OB 2LU2A 2ZITA 4NLVA 1EJ7L 7FD1A 2HWIA 4YFUA 2HKEA 4CO4A 2VB6A 4ZN3A 1S6OA 1WTFA 2XNQA 4ZPVR 4Y2CA 1NLKL 3AHPA 3NL0A 2MQMA 2DKOB 1PG5B 1RT6B 2MLYA 3U7JA 5J1EB 3R97A 4PAAA 4JI1J 4GKJJ 1TQLA 5KG1A 3RBDA 3ZO7A 4F3OA 5KTQA 2VFTA 1ROFA 3UD4P 2R7XA 2J9DE 1U26A 4USVA 3WX8A 1CLFA 1N5VA 2U1AA 1CJTB 2DCLA 2HQDA 5C42B 1U1RA 5GMEA 3MAQA 4USHA 2HQGA 3HFZB 2WONB 4CNYA 4K0KF 3KLHB 3RB0A 2Y1JA 4WXWA 2F40A 3KJFB 3ETOA 1KNZA 1S4EA 4GKKF 5JXSA 2HNZB 3FCVA 1FFWB 1CJVA 1YJ7A 2O01C 1YIJS 4F3QA 4QWBA 1KD1T 1U1QA 4B9MA 2YQ1A 4ZJOA 1IJEB 3MM5A 5KFXA 5KFPA 3DLKB 2LLZA 2BRKA 2FZGB 5B0AA 1RJJA 5A8WA 1H2VZ 4U8VA 5U47A 3W2VA 3SQOP 3M30A 1FWPA 1CJUB 1UFKA 4EBEA 2QYCA 3R5DA 2BACA 3TQ1A 1NDPA 4KR0B 5KFLA 4OYBA 3QZ8A 2PGCA 1M1GA 2HGMA 3OL8A 4QZVB 4C0BA 3ZTRA 3VAJA 2ZKTA 2HWHA 4OZ5A 1IUJA 5FIIA 3FEZA 4IFYA 4JV5F 2GZOA 1MU2A 2RRNA 2FHKA 1HARA 3H5SA 4CQ1A 2UU9J 1OY9A 2E9RX 1HNWF 3DOKB 2IM3A 1HWUA 2ZH9A 3IGVA 1NM2A 5DM6Q 1SKWA 3LOUA 3KYLA 3DRYA 2IA0A 5AXNA 1XNRJ 4M63A 4N7TA 2K3IA 3KXDA 2DGWA 4ZKAA 1WC0A 1KKHA 1IQZA 3B4MA 3R5CA 4NCGA 2YKQA 4KFBA 1PJ6A 4UUXA 4K4SA 2DGOA 2BYCA 4QW9A 4GC6A 1WC1A 3J81j 1OSCA 4I56A 2OPSA 2E7XA 4ZPTR 3UDVA 4Q0BB 4DCJB 5BJRA 2EFVA 1U0HB 3IAM9 1QUPA 2FLNA 5EWGA 4ZLNA 1BGXT 2AYMA 3H4BA 4RL1A 1S9GA 1DARA 4KSEB 4DSEA 4GRSA 2BE2A 1KRPA 4U6PA 2V8PA 1PAUB 5I3UA 1J5OB 3QT6A 3QGGA 1S6QA 1U49A 1M5OC 2PI5A 3KK2A 1UJ6A 4C48A 3JAMY 3O5TB 4YR2A 5E3RA 2YH0A 3DRPA 2AWZA 2YPZA 3IG1B 2ZBQA 3UD3P 2QMWA 3PZPA 1JLBA 5D78A 1WG5A 4WTOB 3J7Z5 4KKOB 1R0AB 3N9UC 3B4DA 2VC0A 4DUZF 2VPZB 3CJKB 2X3DA 2JZ5A 3CJQA 2DITA 1GMVA 4WIIA 4KPCA 3G2XA 4LUBA 3DCAA 4A48A 2MY7A 4ZVGA 4L72B 4H4OB 5ETKA 3IM8A 1TL7B 2HMIA 2MZRA 4KGMA 1RWUA 2QLJB 3AWRA 1UVJA 3WHIA 1AA1B 4CH1A 2NXNA 4NI2B 4RNNA 3TJ8A 1UKUA 4ATNA 1VQNS 3SCIE 3J81U 3P4UB 3OLAA 1HBOA 1Q81T 3H59A 4QU7A 2GA7A 4DSKA 4DL2A 2HVDA 1VISA 4P2FA 2NSBA 3K17A 3OTCA 5A6PA 4K7QA 5ADZA 2DRDA 1KR4A 1S79A 4USUA 1HNXF 3A8EA 2HS4A 5IQ6A 1S1TA 3BEGB 2C2NA 2ZC4A 3RW6A 2G4BA 1FKPA 1QVFR 3OVAA 2FGOA 2NPIA 3EE3A 3JSYA 4J9SA 1YDLA 2YBVA 3M32B 2QL9B 3HK2A 1VGYA 1T9TA 3FEYB 5HL7Q 1GAOA 4QU6A 3W65A 3QMQA 3DLGB 3ZZUA 3MR7A 3GWCA 3K8WA 4ED6A 1JLFA 4MTPA 1S10A 1FESA 2J7WA 1UEVA 1RTJB 2CXEA 4F4AA 2R7UA 2QL7B 4D3HA 4ECUA 3RU0A 1FRMA 3MURP 3PO4A 2HEKA 2PC6A 4FF1A 1K44A 4RNOA 4URGA 2QA2A 3KLGB 2W2MP 3HI9A 1IKWB 2KKHA 2YX1A 1RHRB 2ALZA 1ZA1B 2PN6A 3PRVA 3MCOA 5IT4A 2NXEA 2HURA 1ZPVA 3SBMA 1MNEA 3PACA 3ILLA 4DN9A 5A2QU 3NMAA 5D77A 4A8QA 1SV5A 2DR6A 3M7VA 3SDEA 4DV5J 1YHQS 1SJQA 3BQ0A 4DV1J 3HHLA 3P45B 3E2EA 2GHVC 1FE4A 3C66A 5EDWA 2EEYA 1E6YB 4FP9A 1T05A 1RHMB 4PWWA 5GAGI 3AD7C 5HROA 2RIJA 3OFEA 3I6PA 1JJCB 3K5PA 5IOLA 2B6AA 4WKRA 4PUOA 5IC6B 1U1MA 1IBMF 2NR0A 5D0EA 1YVFA 1AYEA 3OTEA 2ZZNA 3BN7A 3IR5B 4LQ3A 3Q8VA 3QRPA 1P9QC 2PO4A 4KYZA 4EGLA 3M9OB 3FBCA 2YY3A 4JI0F 1GMWD 1NBEB 3C16B 3Q8QB 4EZ6A 1T9XA 1RCXB 2KYXA 5BYRA 3OHBA 1HNZJ 3R7BB 1MWZA 2CAJA 4J9VA 1YX2A 2VOPA 1SH3A 4JV2A 3KHGA 4R0EA 3KK3A 4PYAA 4LRAA 1OYEA 3EZ5A 4USTA 2CZ9A 2AJ1A 4K50A 2BW2A 5JJBA 2FJWA 5LOQA 1FVQA 4F0KA 4Y2IA 3K8VA 1S72S 4KHPJ 1U1LA 3NGRA 4YB1P 2CVEA 3AJ1A 5DQHA 3K0JA 2X1BA 3JTOA 4A47A 2EWHA 3KHHA 2HFSA 1X4BA 4F02A 3IBWA 3P6YC 2UUAF 1B64A 1CJTA 1KFDA 3AA8A 2YX7A 1LW0B 1D3WA 1S7HA 5KFRA 1C0TB 5THWA 1HHSA 1X4AA 3AJDA 4O0NA 2M7SA 2J7KA 1HPZB 4E98A 5C2GA 1CPZA 4MFBB 4IOBA 2JH3A 1IWGA 2AZ3A 3K5MA 5B0EA 1ZYQA 2HNZA 4MIBA 3OBIA 4OX9J 2HBQB 4CT9A 3EXCX 3W9HA 1U25A 3AOBA 2CQPA 2RQMA 1OPZA 3F56A 5GAHI 1L3TA 3FBEA 3MMCB 1U02A 4KJIA 4HACA 3DHXA 2G13A 1NHVA 4EK2A 1KQSR 2CWXA 1UAWA 3MD1A 4A8WA 3CE8A 2MZQA 4ZIWA 3RR7A 3R7SB 3PDNA 4KBIA 4R5PA 1CJUA 2VDHA 1UP1A 2XMUA 4AL6A 1VQMS 1URRA 1HW8A 5E3PA 2DNHA 2B9YA 1JX4A 4LF4F 5ETPA 4P71A 5J2MB 3CCTA 2UVVA 4LF8J 2QLWA 2E5GA 3KG0A 3MD3A 3AB2B 5L1IA 1ZH5A 3GSIA 1I1GA 5L1JA 1D09B 4MJKA 4PEOA 3I56S 2W2NP 3GCXP 4FPIA 4PQAA 4ZPBA 1PC4A 2UV8A 3F73A 4DR3F 2GVDA 4FBUA 4XIUA 1TKZA 2HHUA 3MMAA 1AROP 2MYFA 3S8SA 3NWRA 4DPOA 5LT5A 2MLXA 1SBRA 3GV7B 3AX3A 1VBXA 4M95A 1KQKA 3QJJA 2HNYB 4IO1A 3OJUA 3OR2B 5IWAJ 5DLFA 3VAGA 1T7PA 1WG1A 3CCZA 1U0HA 3W5ZA 1WKLA 2NZ4A 2QSWA 4J9PA 4LF2A 3I32A 3DM2A 1GX5A 2FC9A 3GYNA 1C1CA 4RU9A 2ZH8A 2ATLA 2R7TA 1TMJA 2IC3B 1SKRA 5JMNA 2DIUA 3PKMA 2G0IA 2JJ4D 3ZZ0A 2OMLA 2GMHA 3POTB 4I6YA 2KHCA 5EN1A 3NCRA 2VBWA 1IR1A 4L75A 3M2VB 2RMLA 5HMXA 4KT0C 4RX6A 2OELA 2Q66A 1ZAVA 1JJ2R 4I68A 3IG1A 4O44A 2YNHA 3AAWB 3MTKA 2XSJA 3A1YG 2BVZA 3WZ0A 1N56A 4LRDA 3SCJE 4KKOA 3AY0A 1RUSA 2G9OA 1TL4A 3MMBB 5HVFA 3B82A 2BJ7A 2H1YA 4DV4J 2J5AA 1R8CA 3CJKA 5C25B 1DLOB 4DR2J 3UO0A 3D7SB 3TZWA 2R8JA 1N32J 1TZ0A 1NSKL 3MOZA 1IKVA 3LP0A 2V2ZA 4QIEA 5IM0B 4H4OA 4XTTA 4NL5A 2CJYB 1TL7A 5LSRA 2FVPA 5LJ5Y 4NZ7A 1D0EA 3KNGA 1YZ6A 3IM9A 4M8LA 2BEFA 1WHXA 4WYLA 2F4FA 3RAQA 1NNDA 4OI4A 4DCOB 1JXEA 3S01A 4H54A 3HDSA 2WOMB 4M5HA 4FNHA 3ICLA 4QCLA 1REVB 1IBLF 2D3ZA 3O3LA 4BLGA 3OHAA 4NXNJ 2CPFA 1BQNB 2VQFJ 2HZVA 2OJ3A 5HANA 3D28A 1O51A 4TQRA 2P5VA 3WX4A 3MCNA 3JTNA 2KJVA 1U2FA 3EDQB 1YQHA 4ZVHA 1YKWA 4FNIA 2GVZB 5LXYA 4DPUA 4A8XA 5AE2A 1XJWB 8ATCB 1N33J 4JUZA 4C8LA 1U8WA 1WDTA 3HVWA 1WHYA 5C24B 4EUVA 3H90A 2XMKA 2JRSA 3RGIA 2AGPA 4DFKA 3DLGA 2M9KA 3TUJC 3M6WA 8AT1B 3CCJS 1FRHA 1SCJB 2EFPA 3MFHA 2VG5A 1RTJA 2B8PA 4HI2A 3WIUA 1F60B 4TQSA 1HIYA 2W9BA 2ZHBA 3NGDA 4RW4A 2QZ8A 3I0RB 1F5CA 1SQGA 2ERRA 2OKQA 1E6VB 2LQ8A 2CRLA 3PCOB 3DGVA 1IKWA 4JI8F 4OL8A 4LF7F 1QSSA 3GJRB 1G4CA 1KP6A 4IG0A 3TAMA 4PPZA 3MF5A 3KK1A 3D3BJ 3CD7A 1D8ZA 3PM9A 4LBPA 3HF5A 4OI6A 2ZDOA 3EPGA 2CDRB 3IRXA 3TX8A 3FSXA 3DLBA 3I5CA 3AXKA 3OR1B 1QTNB 1WF2A 3TUIC 2G0JA 2QN6B 1OY8A 2IVFB 4I2PB 4OYZA 2JC0A 1R6YA 4HYKA 1XMBA 4X4SA 1X5TA 3HFKA 4B9VA 5LMNF 4A8FA 2VFRA 4X4OA 3KLEB 4HDGA 1VRTA 1X0PA 3M8WA 1W7WA 3CJ4A 4F4XA 3KG1A 1J2VA 3QO9B 3NRBA 2AKWB 4B3OB 5HP1B 1TL1B 3QZ7A 3MR2A 2ASYA 4X66J 3B54A 1GNKA 2A6MA 5E5NA 1RLDA 3G6XA 3HHDA 3BJYA 2ZD1B 1IR0A 3MTJA 4M5DB 3C16A 2NLWA 3J7ZT 5KG6A 1LXJA 1KFSA 5G4DA 2ROGA 4QWCA 1ULRA 3TVYA 1XWLA 3NBPA 4PXBA 4MK7A 1JMTA 4NPOA 5IXUA 2GO8A 3JYTB 1N54B 4PQUA 1DAXA 1X4GA 3VGUA 2ZZMA 2DHAA 4MKAA 3I5AA 5DJBA 3CUNA 1K0TA 3WQPA 4ZP7A 4B3SF 4J9QA 1RCOB 4IQXA 5L8RC 2DK2A 1XMQF 3RG6A 2OFGX 2HIQA 2ROPA 2H4YB 3NAIA 1KBRA 4RWXA 4ED0A 3AD9C 2GMJA 1RTIA 3A8JA 1K1SA 3G6YA 2LKZA 2VKRA 2MKHA 2EG1A 2FJVA 2A3JA 2KG1A 1RAEB 3GIMA 2EK6A 1PSDA 1PYOB 4WBFA 1LW0A 2GJ2A 4OHZA 2Z2LA 4I6WA 4YB6A 3UDCA 1S1UB 4NLWA 1F9FA 3MEEB 4OYXA 1NK4A 2HLTA 2R8HA 2E9TA 5KG4A 4F2RA 1NCLA 1RTDB 5D0HA 4J9LA 4ED8A 2MZSA 2ZJPQ 2G2ZA 3V6DB 4Z37A 2X3GA 1NEEA 1NJIT 1ITPA 1F1BB 3BS9A 1NO8A 4JP8A 2DD8S 2XS7A 4DFJA 2DGUA 1Q8LA 3G8TA 2APOA 2X1FA 4M5KA 2RUSA 5HN0A 4UUWA 2V34A 1ZPWX 3W3SA 3TOQA 3RAMA 1R3NA 2YNFB 2YWEA 3BYRA 2ACYA 1J5EJ 3I9V9 1HFEL 3RB4A 4RR5A 1A7GE 2CQ4A 3QGPA 1Q7YT 4CIOA 2ILYA 3MEDB 4A8YA 2FHOB 2QA1A 4IH6A 3G9CA 3EICA 3CVKA 4H4KC 2IYGA 2XY6A 1VK8A 3UFCX 4K4ZA 3FMWA 2XWXA 4WTYA 1FJCA 3VV2B 3NNAA 2DNGA 4AT1B 2I8EA 5I42B 5DDRC 4GO5X 5KT4A 4I69A 4IH7A 1Y9OA 2BW7A 2K8GA 1N4LA 4G65A 2VONA 1HI0P 1XMOF 2MKYA 2RVJA 1R8PA 2HHVA 3CCRS 3C14B 2YH1A 2GGPB 4R8UB 4KC5A 3MM8B 5BXIA 4ES1A 5KFAA 4MIWA 4P7TA 3DFEA 4LF5F 2ADBA 2YKOA 2F5GA 4DR6J 2RQKA 1Y0HA 4X4TA 3LAKA 4DV6J 3OW2R 2A2CA 3CO0P 1NB2A 2N7CA 2HNYA 3E3XA 2V1SA 4B3TF 4PCQA 5GADI 3NKYA 2D68A 4NLUA 2EKYA 1UWBA 4CO5A 2W2OP 1FDBA 2MQPA 3UCZP 4CLUA 3W5YA 1DY3A 1NJYA 1F6TA 2V8VA 2WVEA 3BZQA 4CTAB 1S0MA 1DFDA 4DR1F 3PG9A 1WACA 1C1BB 4DR7J 3OT9A 5D15A 4B3RF 2ZDPA 1UZHA 3UE2A 3BR8A 4RO0A 2D3OR 2FHJA 2WB4A 3OL6A 1N5SA 3N5BA 4X66F 2P8IA 1AT1B 2QLFB 1CJKB 2JSXA 3VZIA 1HNVB 1PGZA 5DO2A 2M8DB 2AGOA 4HTJA 4DV3F 1NK6A 5F8NA 3G71S 3MCMA 1YJ9S 1FWLA 2XTJP 2LMIA 5D4NA 5K14B 3MM6A 5C25A 2YWHA 1F3FA 3DLHA 1NPKA 3ENAA 1HBUA 3QT7A 3PO5A 5IM0A 2MKSA 2E29A 2E7WA 5J2PA 3GU0A 4X4PA 3UPFA 4F04B 3J81Y 2MZTA 3ZZZA 1UVKA 3TR5A 2CVIA 4ETZA 5JVHQ 3GLJA 1ELOA 3GYGA 2DNLA 2EFOA 2XNRA 1N0UA 4V19J 2YKNA 1VMBA 3QWUA 4K4UA 2AMCB 4O3QA 1DBDA 3PR5B 1HQEB 1AXQA 5F41A 3CEDA 3M8ZA 5L9NA 1NDCA 4JBCA
chains in the Genus database with same CATH topology
4Y2CA 3VAHA 2W7AA 4EEYA 5F9NA 2DNKA 4G3IA 5CH7B 5LSLA 3KLGA 3AHPA 2C3MA 3NL0A 1XNRF 2MQMA 2O67A 1RT6B 3U7JA 5J1EB 2A18A 3I31A 3H40A 3NS5A 1F0XA 1Z2ZA 3M8PA 3IXQA 4ZMMA 2M3DA 4Z2XA 2ZE2A 1VRUB 1TQLA 4Y34A 5D3GA 3D54A 3SXLA 1VRTB 1BQNA 4KIAA 5KG1A 4KHRA 2CJKA 3C8YA 3RBDA 1CC7A 1TVRA 3DOLB 3RW7A 3G86A 1WG4A 1H3DA 1KHWA 4F3OA 4NCBA 3D0HE 4IRKA 4X4NA 4JV1A 1WWHA 5EGYA 3E01A 2DIVA 5KTQA 2VFTA 5I3QA 2OD4A 4U9RA 5DRKA 2AU0A 2M52A 1ROFA 3UD4P 4ED3A 2R7XA 1JNZB 1X4HA 2J9DE 5D6GA 1BC6A 1U26A 4IKAA 5KFNA 2FHMA 2DTJA 2F1FA 2R2UA 1FXLA 1YJUA 3KJVA 1CLFA 1BY9A 1N5VA 1VJWA 2RDJA 4TU7A 4O23A 4F2SA 3MEKA 1GH8A 4LSLA 1HW9A 1X4CA 2U1AA 5A8RA 4YEAA 2XMVA 2DCLA 1OS5A 5C24A 4ZP6A 1VIOA 4KQZA 4NA3A 2ZM6F 3IGNA 1C4AA 3VF0B 2C42A 5C42B 1VQKS 2R7SA 5B0GA 1U1RA 1SJ1A 4OHWA 4ES2A 1Y7PA 2GQ2A 2YQ3A 3PW0A 2NQPA 3I82A 5LL6d 4ELVA 4AL7A 2DNQA 3C6TA 2FDNA 3MAQA 4LIRA 3NBPB 4USHA 1FTRA 1HNIA 2WONB 3GQCA 3EGZA 4CNYA 4K0KF 4MAKA 5F0UA 3KLHB 3RB0A 2Y1JA 1VQPS 4WXWA 2XY7A 2F40A 1XNQF 4PQUB 4K4XA 1W2IA 5L39A 1E6YA 3ZZPA 3ETOA 3BF4A 2JVOA 1KNZA 3N01A 2CZ4A 3CB4A 2Q3PA 3I0RA 3ZFVA 4GKKF 5JXSA 2HNZB 1S1VB 2DNZA 2HAIA 4PG5A 2CPYA 3TW0A 5T14A 2B56A 4TKTA 3QJLA 2O01C 4ZVEA 4DR5F 1YIJS 2J7UA 3FQLA 4F3QA 5B7WA 4QWBA 1KD1T 5HBMB 3E51A 3KHRA 1U1QA 3GILA 4B9MA 4X64F 3R5AA 3B78A 1IJEB 2W8KA 2KDOA 3MM5A 2F8HA 3Q8PB 5A2QY 3SMZA 5IT9Y 2HHXA 2LQ5A 4OI1A 1TFYA 1BD6A 5KFXA 5KFPA 3GV5B 3H2UB 2ILZA 3DLKB 2LLZA 4DDFA 2HHHF 2BRKA 3U1NA 5DLGA 3R1HA 5B0AA 1RJJA 2CPXA 3ENWA 5A8WA 4UY85 1H2VZ 5U47A 2VC1A 3BR9A 2CQ0A 2VZ9A 1RTIB 2MDAA 3W2VA 1HYSA 2O3DA 1NKEA 4FF2A 4FXVA 3M30A 1UW4A 2CPHA 4NCAA 4OI3A 3GSDA 2K1RB 1T8EA 2XG8A 4EBEA 2QYCA 4YB5A 4JI5F 3TAPA 3GYXB 4C3KA 1NRKA 3IA0A 4USIA 3NNCA 3R5DA 2FJXA 2BACA 1KLMA 3TQ1A 4KR0B 5KFLA 1S1XA 1TV6B 3QZ8A 3DGPA 2XGQA 2PGCA 4B9NA 2DR5A 4M1KA