4K5YA

Crystal structure of human corticotropin-releasing factor receptor 1 (crf1r) in complex with the antagonist cp-376395
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
411
structure length
407
Chain Sequence
HYHVAAIINYLGHCISLVALLVAFVLFLRARSIRCLRNIIHANLIAAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLSVAKSELDKAIGRNSNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRSALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVIATFRTGTWDAYDRLRAWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWAGKRPGVYTDYIYQGPMALVLLINFIFLFNIVRILMTKLRASTTSETIQARKAVKATLVLLPLLGITYMLAFVNEVSRVVFIYFNAFLESFQGFFVSVFACFLNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of class B GPCR corticotropin-releasing factor receptor 1.
pubmed doi rcsb
molecule keywords Corticotropin-releasing factor receptor 1, T4-Lysozyme chime
molecule tags Membrane protein, receptor
source organism Homo sapiens
total genus 148
structure length 407
sequence length 411
chains with identical sequence B, C
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4k5yA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4k5yA01
168LA 1P37A 3ODUA 2L78A 1C62A 218LA 3UTYA 2Q9DA 3HH6A 128LA 4G71B 4W51A 166LA 1L97A 238LA 1L14A 3GUJA 1GUEA 2Y02A 1CUQA 1L94A 3DQBA 3NSBA 3PWHA 1L9HA 1L40A 1L22A 3ZPRA 1P8IA 3CODA 1L23A 1QM8A 3C9MA 5G2DA 2ZIYA 3F8VA 4L6RA 4FPDA 2WJKA 1L79A 236LA 3HU8A 4EKRA 3T45A 255LA 1L49A 3K2RA 2ZZLA 4EA3A 1SX2A 3LZMA 1ZYTA 3DN6A 2A4TA 219LA 1L73A 5A45A 1OWYA 2Y04A 1EHKB 4WAVA 5AHYA 144LA 1P2LA 1L47A 139LA 1D3MA 151LA 1L44A 227LA 2B73A 4ARPA 1IXFA 1DYCA 3QAPA 2NTHA 4IAQA 5AZDA 4OV0A 146LA 1MGYA 217LA 3HT6A 4MBSA 1QT4A 221LA 1L69A 233LA 211LA 234LA 1D3NA 1GZMA 253LA 1KY1A 3QBLA 147LA 5KKHA 1L57A 1X0K1 3HTGA 2Q9EA 2QPEB 102LA 1C6JA 2YCZA 5H2IA 1L72A 169LA 5AHZA 1IW6A 1L66A 1QTZA 3HUQA 1C60A 5H2JA 1C64A 4GP8B 2HUKA 205LA 150LA 2OU8A 256LA 1L05A 3HU9A 3EH3B 1L52A 1ZURA 1C6QA 1QKOA 2YCYA 5JJNA 2O4WA 4IARA 1P56A 4EPIA 2O7AA 3OE8A 1QTHA 196LA 3C8QA 1E12A 1QUHA 123LA 1OWZA 3C8RA 1CWQA 3QJQB 161LA 186LA 4X31A 141LA 118LA 1L98A 3DNAA 212LA 1XIOA 1G1VA 1C6EA 3DMVA 4W58A 1F88A 4L35A 4XXJA 1CV0A 1VGOA 1QT5A 3GUNA 1L91A 1K28A 1KW7A 3DKEX 1QT8A 3A7KA 3CAPA 247LA 213LA 1PQMA 1L84A 3NS0A 251LA 1BRDA 138LA 174LA 3QBIA 5LWEA 1L21A 226LA 2QB0B 1C63A 2RBSA 3RZEA 1XEPA 3SB6A 4J4QA 4I7QA 1L64A 2F95A 1TN0A 3HANA 176LA 3VGAA 1T97A 1C8SA 1LN6A 2Y00A 1L29A 2OTYX 2IGCA 249LA 240LA 4HYJA 2B7XA 1L27A 3SB9A 1C6CA 1QTVA 191LA 1C61A 3HAPA 1L0KA 4DJHA 188LA 2OU9A 1L32A 2KSYA 1L25A 5B6VA 3QJRB 1D2WA 1L75A 2JAFA 3ZPQA 2LCBA 2OE7X 4W57A 2Z73A 3VVKA 5B6XA 4ARJA 1C6PA 149LA 1L07A 107LA 2B72A 2B74A 2R4RA 243LA 3V2WA 4EKSA 195LA 3DN4A 1PQDA 216LA 2B6ZA 4W55A 4S0WA 1DYEA 1L33A 1U19A 3CDOA 1L13A 2RB0X 2NTWA 3S3BB 2RAZX 4K5YA 1WTHA 1KGBA 1LI6A 1XJTA 1C6BA 3G3WA 3OE0A 1G06A 1GU8A 3X3CA 1L24A 1DYFA 3OE9A 4I7JA 222LA 229LA 1X0SA 2RB2X 1H2SA 162LA 2RH1A 4IB4A 1L62A 1L89A 2Z55A 157LA 1C6AA 3PBLA 1O0AA 1TLAA 1L83A 3REYA 1L31A 4XTOA 244LA 5G2CA 4I7NA 2OEAX 2KSAA 5ITEA 1C6IA 4XTNA 235LA 4GRVA 4EPFA 1LW9A 1G0KA 3ZEVA 1OVJA 4JQ6A 125LA 3C7WA 3S3CB 5ITCA 1L01A 2RBQA 2QPDB 1L85A 1LYEA 5AWZA 1L34A 4GBRA 187LA 3UONA 1F50A 1PQIA 5A44A 3CDQA 3QJSB 3RFMA 5AX1A 1L37A 167LA 1L11A 1P46A 4JR8A 3QBGA 3UZCA 1CV6A 1TN5A 1T8FA 1C6NA 1LLHA 4HWLA 1L04A 224LA 156LA 3HUAA 1JGJA 1L90A 245LA 5C1MA 137LA 3DMZA 1L92A 2QARC 1X0I1 2L6XA 1L17A 1LWKA 257LA 5H2LA 4I7PA 2HPYA 109LA 4N6HA 171LA 3GUIA 1S54A 1L50A 1SSWA 2O79A 1T8GA 4EJ4A 5G28A 1P6YA 1S8LA 3C83A 4W56A 4LDOA 1L65A 4UG2A 1C6FA 4PXFA 1QUGA 1LYJA 112LA 103LA 2B75A 1BM1A 3GUMA 4MQTA 1C3WA 1KY0A 3C7ZA 1C68A 1L77A 3VHZA 1L35A 1L68A 3QBKA 3UTWA 1DYGA 2I35A 1P2RA 3FA0A 248LA 4W52A 2YCXA 1G1WA 158LA 1SWZA 155LA 3HAQA 1L46A 4TL3A 1SWYA 215LA 5AX0A 1M0KA 1I6SA 104LA 2Z6BA 110LA 108LA 4PK0A 3AM6A 1L08A 2YDVA 1L12A 127LA 230LA 3HASA 2I20A 1QUDA 4G7RB 1L45A 4G7SB 198LA 1C6GA 119LA 1S8JA 4JKVA 1L71A 3G3XA 5FJGA 5B0WA 241LA 2B6XA 1CV5A 1ZWNA 1PQJA 2VT4A 1G0GA 1C66A 4GP4B 1L03A 3VI0A 131LA 1SSYA 7LZMA 1L20A 3CDVA 4DAJA 262LA 1QS9A 4HYXA 5H2HA 2OTZX 3VG9A 1P5CA 1XMEB 1CVKA 3ABWA 1L09A 225LA 4BEZA 3S8FB 2LZMA 242LA 114LA 258LA 5B34A 239LA 3NYAA 5B2NA 5H2PA 1LYIA 1L18A 3DN3A 4BUOA 1PQKA 4EXMA 4ARMA 1BRXA 3HDEA 1CTWA 4I7MA 1QHJA 4QI1A 5BR2A 4A4MA 3PDSA 3WQJA 1E0PA 1QTBA 3OAXA 5G2AA 1KG8A 1L59A 1R84A 113LA 228LA 4YXAC 1AP9A 2RBPA 5G36A 1KS3A 2WJLA 3HARA 4GPOA 1LPYA 1L80A 1LYDA 1LGXA 4QRYA 3C8SA 1CX6A 3DN2A 3SB5A 5H2MA 4FAAB 220LA 1LGWA 1M0LA 3P0GA 4G72B 5B6WA 3L2XA 1CU2A 252LA 1L19A 2G87A 2Y01A 2PEDA 173LA 1SX7A 1FBKA 4I7LA 5DHHA 1F4ZA 1CUPA 3S3DB 5DYSA 1L95A 1C6TA 4FA7B 3DN0A 3GUOA 2AT9A 1Q5IA 4N4YB 4XT3A 3UG9A 1LYHA 3UTVA 1G0LA 3DDLA 246LA 3AYNA 2B6TA 3HT8A 1L16A 2J4YA 2KSBA 1G0MA 1G07A 190LA 1L54A 1L0JA 1L43A 4G70B 1L60A 3HAOA 6LZMA 5H2OA 3HTDA 163LA 237LA 1PY6A 1QKPA 2BRDA 2RBNA 3F9LA 3S8GB 1C6MA 3GUPA 1H68A 3EMLA 209LA 4LDEA 4UHRA 1CV1A 5EN0A 1S53A 1L42A 3COCA 3QJTB 4X1HA 2ANVA 3HWLA 170LA 261LA 1QUOA 1LI2A 4PJZA 3C81A 2RB1X 4BWBA 1D2YA 3NY8A 197LA 3SBBC 2I21A 4GBRB 1CU3A 1OV5A 4YX7C 1JFPA 1JQUA 1T8AA 1T6HA 3FI5A 1EPYA 1KW5A 1QT6A 4ARQA 1DYDA 1S51A 1QSQA 4ARLA 5I14A 5F8UA 1D9WA 3DN8A 1DYAA 159LA 4MD1A 4BV0A 1CX7A 1LGUA 3MBVA 4XTLA 140LA 1L76A 1L67A 3JR6A 1KG9A 3QJUB 2M3GA 3QDCA 1JV7A 5JJEA 1G0JA 3OE6A 4EKQA 1LWGA 3HTBA 4I7KA 232LA 192LA 4OO9A 3VW7A 2LC9A 3BVDB 199LA 3C9LA 1L02A 2KS9A 4GP5B 2ANXA 1L41A 4I7SA 3HT9A 214LA 3V2YA 1CU0A 1P8HA 184LA 181LA 1L48A 2OU0X 3HT7A 1L06A 4I7OA 1PXRA 250LA 2F2QA 1PXSA 2YDOA 2JAGA 2F47A 1L88A 3AYMA 3UZAA 1QSBA 3QAKA 1CV4A 3PQRA 3D4SA 1L28A 4KNFA 3X3BA 3DN1A 2B6YA 3G3VA 3GULA 3HTFA 1L51A 1DZEA 1IW9A 2RBRA 5DHGA 4IAPA 1L00A 210LA 5ETZA 4EIYA 1CU6A 4NC3A 115LA 1QT7A 2OE9X 2CUUA 4G7QB 1L39A 1M0MA 1C69A 3L64A 1KNIA 129LA 2HULA 4PXKA 1PQOA 3KJ6A 1L82A 1L81A 4DKLA 206LA 1L58A 2X72A 4KLYA 1B6IA 3C80A 4W59A 143LA 3SBAA 1L0MA 260LA 2LNLA 1XJIA 3DMXA 111LA 4ZPUA 4W53A 2R4SA 182LA 4LZMA 2OE4X 1P64A 1S52A 145LA 126LA 1L70A 3HDFA 1LYGA 3HH3A 1C6DA 1L10A 4QIDA 4XT1A 1NHBA 4YXCA 1G0QA 1XJUA 5TGZA 1LI3A 1R2NA 4AMJA 3EH5B 2RBOA 1UCQA 4GYCA 4ARMB 3HH5A 1C67A 2Y03A 1LYFA 1C8RA 1L30A 3SN6R 2EI4A 177LA 175LA 1JTNA 3C7YA 2I1XA 189LA 3RUNA 2YCWA 1L87A 1C6KA 5A8EA 1OVHA 1BRRA 1L63A 1Q5JA 164LA 4MD2A 2NTUA 178LA 1L55A 1P3NA 5BR5A 1D3FA 5H2NA 1C6LA 1C6HA 1CU5A 1L74A 259LA 122LA 3QJVB 1AT9A 1JTMA 5B6YA 254LA 1G0PA 1QTCA 3SB7A 3PXOA 1FBBA 1OV7A 3HH4A 4LDLA 223LA 2F93A 165LA 2HUMA 5B6ZA 3C82A 3HUKA 172LA 201LA 4N4WA 1L38A 3SB8A 1P8UA 160LA 5G53A 4AQNA 2F32A 142LA 2ZFEA 1HZXA 5J7AA 2NTGA 5G54A 1P36A 1L15A 4BEYA 4MQSA 1L61A 1L26A 1L56A 1L53A 1L93A 5H2KA 4W54A 4FBZA 4X32A 1JV6A 1C65A 1QT3A 1VJMA 4AMIA 130LA 180LA 1CV3A 1DYBA 1OYUA 1P7SA 5LZMA 1L99A 4EKPA 3UTXA 152LA 3EH4B 1D3JA 4E97A 200LA 2B6WA 185LA 4I7RA 2B70A 4Y9HA 1OVKA 231LA 1L36A 5B35A 1L96A 4I7TA 4BVNA 1L86A 2RAYX 148LE 4ARQB 120LA 1QTDA 5JJJA 183LA 3GUKA 3NY9A 3FADA 3CDRA 1UAZA 3CDTA 1KMEA 1QS5A 4WW3A
chains in the Genus database with same CATH superfamily
4Z46A 2EKSC 2Q9DA 4G71B 3GUJA 3NSBA 1AT5A 1L94A 1L40A 1HSWA 1P8IA 1GE1A 1LOZA 1L23A 1QM8A 3C9MA 5G2DA 154LA 2WJKA 3HU8A 4EKRA 1OUFA 255LA 1L49A 3K2RA 4EA3A 1ZYTA 1MELL 1YKYX 1HFZA 2A4TA 1L73A 1OWYA 4WAVA 1P2LA 227LA 4H9CA 1IXFA 2ZQ3A 1MGYA 217LA 1I56A 1E8LA 1L69A 233LA 3CT1A 3RW8A 1GE3A 1VDSA 3CQLA 4NHIA 2MEAA 4WLYA 2QPEB 1C6JA 1IX0A 1B0DA 5H2IA 4WO9A 5AHZA 4DT3A 1QTZA 2ZNWY 5H2JA 1C64A 3A92A 3WPLA 4R0FA 1QKOA 1JJ0A 1P56A 4EPIA 2BQBA 3C8RA 5APDA 4OWHA 3RT5X 4PGJB 4TSBA 118LA 1JISA 1BVKC 1G1VA 3D9AC 4L35A 4XXJA 1EQEA 3GUNA 4OOTA 1L91A 1KXYA 5KKJA 138LA 1LSEA 1VDPA 1XEPA 3HANA 176LA 3TMWA 1LN6A 3RU5A 2OTYX 2IGCA 1HERA 2DBTA 1GEVA 1F6SA 3SB9A 1QTVA 4H8YA 1L0KA 4DJHA 1XSFA 1GFAA 1B7MA 1LSYA 2F4AA 2Z73A 1XGTC 5B6XA 4ARJA 2R4RA 4EKSA 1GFEA 3DN4A 4XADA 1DYEA 1U19A 1PS5A 2RB0X 1QTEA 2NTWA 1LI6A 1XJTA 5L3IA 1GU8A 3X3CA 4I7JA 1D0MA 1HFYA 4H9BA 1H2SA 1L89A 2BLXA 3W6AA 1L83A 4YEOA 3REYA 2G4QA 207LA 1IP1A 4I7NA 2OEAX 2KSAA 4XJIA 4HTQA 4G4BA 4GCCA 4NEBA 3S3CB 3C7WA 3CT5A 2RBQA 2QPDB 4ZFPA 3QJSB 4HP0A 3SP3A 1L11A 1YL0X 1JTTL 3UZCA 1TN5A 1LLHA 4NFVA 1HMKA 156LA 1L90A 1YAOA 137LA 1L92A 2L6XA 257LA 5HNLA 1S54A 3GUIA 2O79A 4WL7A 1S8LA 2BQEA 4LDOA 1L65A 4N1EI 3WUNA 4UG2A 3IJVA 1LYJA 4O34A 1C3WA 1C68A 3VHZA 3UTWA 4A7DA 1GB2A 3FA0A 3ZEKA 5IDDA 4WG7A 2YCXA 1SWZA 1LZRA 1C45A 2BQFA 4TL3A 215LA 5AX0A 3AW7A 110LA 3AM6A 1L08A 1RCMA 1L12A 127LA 1NBYC 2I20A 2HECA 2HU1A 1G7MC 198LA 2B6XA 1OUIA 4RW1A 2BQNA 4QEQA 1ZWNA 5M1YA 1C66A 3VI0A 1L03A 1T6VL 1J1XY 1SSYA 1CJ8A 1FLUA 1UIGA 3CDVA 3WUMA 2OTZX 1P5CA 4EMNA 3K3TA 2LZMA 242LA 258LA 4CFPA 2CGIA 5H2PA 1B5WA 1JKDA 5LVHA 1L18A 1PQKA 1WQQA 4EXMA 4MCKA 1B7QA 1BRXA 3HDEA 1QDRA 1UICA 1QHJA 4RDSA 3AZ5A 4WM5A 3PDSA 3WQJA 1QTBA 3OAXA 4OW1A 5L3HA 5J7CA 5KKIA 3AZ4A 1OUAA 4WM2A 1LYDA 1V7SA 1LGXA 1LHMA 3KAMA 1IP2A 1CU2A 252LA 2G87A 2PEDA 173LA 4TX7A 3S3DB 5DYSA 1VFBC 5LVIA 4XJDA 1PZYA 2Z19A 3GUOA 2BPUA 3UG9A 1LYHA 3A94A 2J4YA 1L16A 1G07A 1IOTA 1L54A 5H2OA 163LA 237LA 1QKPA 1XGRC 2RBNA 3GUPA 4WM3A 3AZ6A 2F2NA 1S53A 3QJTB 4X1HA 3WH1A 1D2YA 3TXJA 3TMXA 2DQAA 3OK0A 1JEFA 1Z55A 4KXIA 3FI5A 4ARQA 4LYMA 2CDSA 1NKHA 5FHWA 1QSQA 5I14A 3D3DA 5LAFA 2ZNXY 4XTLA 140LA 1L76A 2M3GA 1G0JA 3OE6A 4H93A 1UIFA 1IORA 1LMCA 3VW7A 5KXTA 5LXWA 2HEAA 2DQGY 4LGKA 1L02A 5I53A 2KS9A 1LSGA 4I7SA 3HT9A 1F0WA 3T36A 2OU0X 2F2QA 1LZEA 1YKXX 4H92A 3AYMA 1BWHA 3ULRA 5APEA 2G4NA 3D4SA 4KNFA 2B6YA 3WW6A 1CNSA 1GDXA 1P2CC 1LSZA 1VDQA 1CU6A 4NC3A 115LA 4MR1A 1BB3A 1YQVY 1IP6A 5KXZA 206LA 3ATNA 4AXTA 1L58A 3C80A 4J1AA 3WUAA 1GFRA 111LA 1JUGA 1JKAA 2R4SA 1HEOA 4M4OA 2OE4X 1P64A 5B1GA 1HC0A 1S52A 1IWTA 1DI5A 1L70A 4QIDA 1NHBA 1F10A 1BB7A 1G0QA 1R2NA 4AMJA 5D5FA 4PJ2C 3EH5B 1LZ8A 2Y03A 4NGIA 1JTNA 5B05A 189LA 4Z41A 1KIRC 1AM7A 1OVHA 1L63A 1Q5JA 9LYZA 2BQGA 3AW6A 1LZDA 1D3FA 4LZTA 1CU5A 1L74A 1JTMA 5B6YA 254LA 1F6RA 1G0PA 1FDLY 3SB7A 1OV7A 2F93A 4NWHA 201LA 4DD2A 2YBNA 160LA 3HFMY 4AQNA 2F32A 2ZFEA 1L56A 4PHIA 1FLWA 4PRUA 2BQJA 5H2KA 4KL7A 4W54A 3E3DA 5KY1A 1IIZA 1VJMA 1C08C 1HMLA 180LA 1DYBA 1OUCA 1OYUA 1P7SA 4EKPA 1LZNA 4Y9HA 3P64A 1L96A 5B59A 2Z12A 1REMA 1GFUA 5JJJA 3GUKA 3NY9A 3AGGG 1UAZA 3CDTA 1QS5A 1GBWA 168LA 2EIZC 3ODUA 1C62A 4DD1A 4J7VA 4W51A 166LA 238LA 1L14A 1GUEA 2Y02A 1QSAA 2ZIYA 3GXKA 4HJVA 4NSIA 3T45A 3LYMA 1IOQA 3A6CY 3G3BB 2ZZLA 5APCA 3LZMA 2ZWBA 3DN6A 3A93A 4XJBA 1W6ZA 3M18B 139LA 1D3MA 1L44A 4ARPA 146LA 1GB5A 1FLYA 1QT4A 234LA 1HHLA 5KXPA 5II3A 147LA 1X0K1 2Q9EA 1LMOA 1I1ZA 1XEKA 1BWJA 1JITA 1L72A 5LVGA 1L66A 4N5RA 3HUQA 1IWYA 4GP8B 1GPQC 1L52A 1ZURA 2YCYA 1GBSA 1QTHA 196LA 2YSSC 1E12A 2Z18A 4LFXA 5LA8A 1JTPL 186LA 4X31A 141LA 1T3PA 3OJPA 1C46A 4W58A 1GE0A 1CV0A 4LT0A 1VGOA 1QT5A 2IHLA 3CAPA 1KW7A 1QT8A 3NS0A 2ZYPA 1B5XA 251LA 3LYZA 1B7LA 174LA 1KXXA 2QB0B 2RBSA 3RZEA 1LAAA 4J4QA 1J1OY 1LJJA 4TUNA 2XBRA 1LTMA 4I7QA 2F95A 1TN0A 3VWOA 1LZYA 2Y00A 5DM9A 1GE4A 4H1PA 2H9KA 4HYJA 2B7XA 1GWDA 1L27A 3T6UA 1C6CA 3HAPA 191LA 1C61A 188LA 1L32A 2KSYA 1L25A 5B6VA 1BHZA 1GE2A 1D2WA 2EPEA 5E9RA 1D9UA 1DKJA 1G7JC 5KXNA 1DZBX 2B74A 5LVJA 4B4IA 3ZVQA 1FBIX 1L33A 2Q0MX 1YANA 2YBJA 1KIQC 4NY5A 2RAZX 4K5YA 4PRQA 1IWUA 1LJEA 3B6LA 1KGBA 6LYZA 4IJ4A 3OE0A 1G06A 1ZMYL 1IWXA 2MEHA 222LA 208LA 3W6FA 2YBIA 1L62A 4BADA 1C6AA 1TBYA 2G4PA 4AGAA 1C6IA 4XTNA 4EPFA 4LYBA 1CKFA 2RSCA 3G3AB 1HELA 5F9UA 1BQLY 1GF3A 5AWZA 4YF2A 4GBRA 187LA 3UONA 3RFMA 5AX1A 1L37A 167LA 1B5UA 3A96A 2LYZA 5E4PA 5I4WA 3QBGA 4DQ7A 1C6NA 1L04A 2HTXA 3DMZA 1B5YA 1L17A 1LWKA 5H2LA 4I7PA 171LA 4EJ4A 1T8GA 1YKZX 1P6YA 3C83A 1LZ6A 1C6FA 1GFVA 112LA 103LA 2B75A 3WXTA 3GUMA 1BM1A 1KY0A 3QBKA 4LT2A 1DYGA 1BB4A 248LA 4N1CC 3WVXA 4W52A 155LA 1IR8A 2W1YA 4RLMA 1DKKA 3AZ7A 1I6SA 4HSFA 104LA 1H6MA 1UACY 4PK0A 1LZ9A 4YEMA 5FDJA 1LJIA 2XQOA 2YBLA 4LYZA 230LA 3HASA 1QUDA 1L45A 3A67Y 1IWWA 4NGJA 5HMJA 4JKVA 3G3XA 5FJGA 4FJRA 1GBOA 1PQJA 2VT4A 1G0GA 4NGZA 7LZMA 1L20A 5LA5A 1QS9A 3VG9A 3TXFA 1UC0A 4NG8A 3ABWA 225LA 4BEZA 4WLDA 4H9EA 1NHEA 4H91A 114LA 3EO5A 5B34A 239LA 1QSWA 3NYAA 1WVVA 3DN3A 1FLQA 4GCEA 4ARMA 4QI1A 1GXV2 4FDYA 5B06A 3LYOA 228LA 2MEDA 4YXAC 2Z2FA 5G36A 1KS3A 2WJLA 3HARA 1OUBA 4QRYA 3DN2A 1FKVA 1D6PA 1GAYA 220LA 3P4ZA 1DI4A 2DQFC 194LA 1IEEA 1F4ZA 4FA7B 2BQOA 3DN0A 3HBDA 2AT9A 1Q5IA 3RZ4A 3UTVA 1G0LA 4G49A 3AYNA 4QDNA 2KSBA 4H8ZA 190LA 4G70B 6LZMA 3HTDA 1RE2A 1PY6A 3F9LA 2F30A 4LT3A 1H68A 3EMLA 4N8ZA 1YL1X 1L42A 170LA 1DXJA 4G9SA 2DQJY 1AKIA 1YILA 197LA 2I21A 1OV5A 3MGWA 4P2EA 5F8UA 3DN8A 1L67A 1KG9A 3P68A 1NDGC 3N9EA 4I7KA 3WPKA 232LA 192LA 1XEJA 4GN4A 5A3EA 1QDTA 1LYZA 4DYGA 6LYTA 1N4FA 2XBSA 4GP5B 1B5VA 2D4KA 3V2YA 1CU0A 2I26L 4NHQA 1L48A 2LZTA 1INUA 1LSCA 3UZAA 2MEIA 1CV4A 4NGKA 3F6ZA 1HEQA 2ZIJA 1YIKA 3G3VA 3GULA 5DHGA 210LA 5ETZA 4EIYA 2DKVA 3W6CA 4PPOA 4G7QB 1L39A 4D9ZA 3L64A 4OWAA 4PXKA 3KJ6A 1L81A 4NSHA 4DKLA 4NG1A 5DN5A 260LA 4WOAA 3DMXA 1B7OA 1IP7A 4LZMA 3WXUA 133LA 1GBXA 1YAPA 126LA 3HH3A 1LYGA 4G4CA 4XT1A 4YXCA 2C8PA 1GB9A 1LMQA 1LI3A 2RBOA 1C67A 1EQ4A 1LYFA 1BWIA 1L30A 2XJWA 3WULA 4B4EA 4CFOA 4DD3A 177LA 3RUNA 2YCWA 1C6KA 164LA 1GF0A 1P3NA 2HEFA 4H9AA 1C6LA 1WQOA 2D4JA 4GLVA 4DDCA 3PXOA 4UWVA 3HH4A 2MEGA 4LDLA 3C82A 3HUKA 172LA 3B0IA 4N4WA 1LZ5A 2EQLA 4ET8A 5I54A 1HZXA 1O23A 1VDTA 5J7AA 2BQDA 5G54A 4NHSA 1L61A 1L53A 2YBMA 4AMIA 4Z98A 1GF7A 3UTXA 1L99A 1OUHA 185LA 4I7RA 1LYYA 1LSNA 4ARQB 120LA 4HV1A 2ZIKA 3HBEX 4II8A 4H9HA 1KMEA 1LSAA 218LA 4XYYA 3UTYA 4TWSA 3HH6A 128LA 3EXDA 1LSMA 1J1PY 3WVYA 1CUQA 3PWHA 1L22A 1BGIA 3CODA 5LYTA 4CGEA 3F8VA 3M3UA 1L79A 4WMGA 4XJFA 2F4GA 3WU7A 1IWVA 1OUEA 1NBZC 4HTKA 2Y04A 2B73A 1UIAA 4H94A 151LA 5AZDA 3QAPA 4IAQA 2GV0A 2ZQ4A 3N9CA 211LA 1GZMA 1KY1A 1IR7A 3HTGA 4B49A 102LA 2YCZA 5KXWA 169LA 1IW6A 4OWBA 2FYDA 1C60A 2HUKA 150LA 3HU9A 1L05A 2XTHA 1C6QA 4IARA 4Z3MA 1LKSA 3C8QA 1KXWA 5DL9A 2X0AA 5KXMA 3AYQA 1QUHA 1IVMA 123LA 1OWZA 2Y8PA 161LA 2MECA 3DNAA 1LJ4A 1VAUA 3DMVA 1F88A 1OP9B 4NGYA 1K28A 4ETAA 3A7KA 247LA 4L41A 3QBIA 5LWEA 1L21A 1NMMA 3A34A 1C63A 1LYSA 3VGAA 1XEIA 1T97A 1LSBA 1QUSA 4NSJA 249LA 5IHGA 193LA 4B4JA 2OU9A 1LZSA 3QJRB 1L75A 3ZPQA 1OUDA 1SLYA 2LCBA 4ZEEA 2I6ZA 1IOSA 4W57A 1LCNA 1L07A 2FBDA 2B72A 3QE8A 5I4XA 243LA 195LA 1PQDA 1HNLA 4S0WA 1XGPC 1B7NA 4N9RA 2BQKA 1OQMA 1L13A 3CDOA 3S3BB 2FBBA 4J1BA 1C6BA 3G3WA 4B1AA 4YENA 1L24A 3OE9A 229LA 1X0SA 1LJGA 3TXKA 2RH1A 2I25L 2Z55A 5DN4A 3WPJA 1GFKA 2DQIY 1I20A 235LA 1IY4A 1G0KA 1OVJA 2MEFA 125LA 1HEWA 4NGVA 4W94A 5ITCA 1IWZA 1TAYA 5LIOA 1L85A 1LYEA 3WYHA 1PQIA 5A44A 1BVXA 3A95A 1T8FA 3HUAA 5A3ZA 245LA 5C1MA 1NDMC 1X0I1 4HPEA 1GB0A 4N6HA 1AZFA 1YAMA 1SSWA 3EBAB 4YOPA 1IC4Y 2HU3A 1NWGA 4W56A 4U3XB 1LZ4A 3LYTA 1WQRA 2LYOA 1GDWA 4WL6A 3LZ2A 1LHIA 3P66A 1L68A 1JJ3A 1P2RA 1LZGA 1GF4A 5T3FA 8LYZA 2PC2A 4ANRA 1G1WA 158LA 5KXRA 1HENA 1L46A 3HBHA 1ZV5L 2Z6BA 108LA 2HUBA 3CB7A 1H87A 1GF8A 4BAFA 119LA 1REZA 3WU8A 1L71A 5B0WA 4DD7A 4GP4B 3B0OA 5JENB 3N9AA 1UCOA 4DAJA 3ATOA 4LFPA 3S8FB 1JIYA 1B2KA 1NQIA 5B2NA 4ETEA 1LMAA 4BUOA 3CSRA 5HNCA 1IY3A 4GCFA 4I7MA 5BR2A 4GN3A 1E0PA 1BB6A 1KG8A 4NGOA 113LA 1HF4A 3QNGA 1UA6Y 4GCDA 1LSPA 4GPOA 1LPYA 1TDYA 4GN5C 1CX6A 4CJ2A 3ZVQB 3SB5A 5H2MA 4FAAB 3P0GA 1LGWA 4TTDA 2Y01A 5EBHA 4I7LA 4DD9A 4ZIXA 1CUPA 3AB6A 1L95A 1C6TA 2IFFY 4XT3A 153LA 246LA 2B6TA 1L0JA 1L43A 1L60A 1A4VA 3A6BY 2BRDA 1C6MA 1B9OA 4LDEA 1CV1A 5LINA 1LZTA 2ANVA 3HWLA 134LA 261LA 2RB1X 4BWBA 3NY8A 2YDGA 4XN6A 3SBBC 4GBRB 1CU3A 4OWCA 4BS7A 1T8AA 1T6HA 1EPYA 1KW5A 1QT6A 2HEEA 4KPMA 4M6DA 1GFGA 1DYDA 5HMVA 4C5FA 4WO6A 1TCYA 159LA 1G7LC 2BAAA 4WLTA 1CX7A 3JR6A 3A3QA 3QJUB 1JV7A 5JJEA 4EKQA 1D6QA 5F81A 4OO9A 4XENA 3EMSA 2LC9A 3BVDB 199LA 3C9LA 1ZVYB 3CSQA 2ANXA 4UWNA 214LA 4RLNA 184LA 3HT7A 4I7OA 1PXRA 1V7TA 2JAGA 1L88A 1BB5A 4NGWA 2H5ZA 3QAKA 4ETBA 4ML7A 2D4IA 3X3BA 3DN1A 3HTFA 1DZEA 1L51A 1GFTA 1IW9A 2RBRA 1L00A 1FKQA 3AJNA 1JSEA 3W6BA 1M0MA 1C69A 1KNIA 5FSTA 3J4GA 4OOOA 2B5ZA 4B0DA 4H9FA 4J0LA 4QGZA 3W6DA 5KXYA 5F16A 1B6IA 143LA 3SBAA 2VB1A 1C43A 1GBYA 5KXOA 4W53A 145LA 3HDFA 3TMUA 1L10A 2BQIA 5TGZA 4ET9A 4E3UA 1UCQA 4HJYA 4ARMB 3HH5A 4DS7E 4WLXA 1JPOA 4TSCA 3SN6R 1VEDA 3C7YA 2I1XA 1QTKA 5A8EA 5FEKA 1BRRA 1D0LA 1L55A 1CKCA 5H2NA 1C6HA 259LA 3QJVB 1REYA 1AT9A 1QTCA 4MSTA 1NF5A 2MEBA 3A3RX 223LA 1KIPC 3BKHA 5F9XA 4NHPA 1WQNA 2HUMA 3SB8A 5APFA 142LA 5ILCA 2NTGA 4BEYA 1JKCA 4OWEA 1UUZC 2BQAA 1L93A 2ZYCA 5KXKA 1LSDA 4FBZA 1C65A 1QT3A 2NWDX 130LA 1CV3A 1LMPA 3B72A 4E97A 2CWIA 1EL1A 1C7PA 1ALCA 4I7TA 132LA 1L86A 2RAYX 4NHTA 1LJKA 3TXIA 1LKRA 1XFPL 4G7RB 1P37A 2L78A 1LZAA 1L97A 1RFPA 5B07A 3DQBA 2MEEA 1L9HA 4NWEA 3ZPRA 4QY9A 1GXXA 4L6RA 4IASA 4FPDA 236LA 4W96A 1CJ6A 2YBHA 1DQJC 4N0JA 1GB6A 1SX2A 1IO5A 1IC7Y 4NIJA 219LA 5A45A 2LZ2A 1EHKB 5AHYA 144LA 1L47A 3LZTA 2A7FA 1LZCA 1DYCA 2NTHA 4OV0A 2N5ZA 5KXXA 3HT6A 4MBSA 221LA 1JTOL 4LYOA 1D3NA 253LA 3QBLA 5KKHA 1MLCE 1L57A 4DC4A 1GHLA 2W1XA 4R6CA 2OU8A 205LA 4CHXA 256LA 3EH3B 1JSFA 5JJNA 2O4WA 1IP5A 2O7AA 3OE8A 5LYMA 1G7IC 5HLLA 2D6BA 4WG1A 1CWQA 3QJQB 1GB3A 1L98A 3LN2A 3A8ZA 212LA 1XIOA 2DQHY 1C6EA 3TXBA 1LHKA 1EQ5A 2C8OA 3DKEX 213LA 1PQMA 1L84A 2WARA 1BRDA 5LYZA 226LA 4DDBA 3SB6A 1L64A 1LJFA 1WQPA 1C8SA 1L29A 240LA 1UIBA 1LHJA 1CKHA 1OUGA 2JAFA 4H90A 2OE7X 3VVKA 1XGQC 4X3BA 1C6PA 149LA 107LA 3CSZA 4XJGA 4BAPA 1B5ZA 4UWUA 1B7SA 3V2WA 216LA 1W08A 2B6ZA 3AGIA 4W55A 1UIEA 3B0KA 4LYCA 1JJ1A 1WTHA 1D0KA 2BQLA 2Z38A 2ZILA 1WQMA 1DYFA 2RB2X 1SQ2L 1CJ9A 2CJLA 162LA 1GEZA 1TEWA 4IB4A 157LA 3PBLA 1O0AA 1TLAA 1L31A 3TMVA 244LA 4XTOA 1QUTA 5G2CA 1HSXA 1LHLA 1XGUC 5ITEA 2DQEY 4GRVA 4LT1A 1LW9A 3ZEVA 1GBZA 4JQ6A 5L9JA 1L01A 1L34A 4I0CA 1F50A 1IP3A 3CDQA 4EOFA 1DPWA 5HQ1A 4ETDA 1P46A 4JR8A 5KXSA 1CV6A 5C6LA 4HWLA 224LA 3J6KA 4GCBA 1JGJA 5KJ9A 1UIDA 2QARC 3FE0A 3TXEA 5LVKA 7LYZA 2HPYA 109LA 5G28A 1L50A 1GFHA 5LAGA 4PXFA 1QUGA 4I8SA 1GF6A 1UIHA 4MQTA 3C7ZA 1L77A 1L35A 2I35A 4IATA 1YROA 1IC5Y 3HAQA 5KXLA 1GFJA 1SWYA 1M0KA 5K7OA 2YDVA 5C6JA 3W6EA 1LMTA 5DLAA 4G7SB 4DWXA 1C6GA 1HEPA 1S8JA 1LSFA 3WU9A 4H8XA 1A2YC 241LA 1CV5A 5F14A 3LHMA 131LA 1JKBA 262LA 4HYXA 5H2HA 1GD6A 1CKGA 2DQCY 1XMEB 1CVKA 1L09A 2FYCA 5FCPA 4NSGA 3AGHA 3WMKA 1G7HC 3TXDA 1RJCB 1LYIA 1FN5A 3A91A 1CTWA 4HJZA 4A4MA 5I4YA 5G2AA 2W1MA 1L59A 4HV2A 1R84A 4LYTA 1AP9A 1LJNA 2RBPA 1GAZA 1L80A 3WW5A 5IELA 3C8SA 1LJHA 2H9JA 1ZVHL 1M0LA 2YVBA 4G72B 5B6WA 3L2XA 1L19A 1SX7A 1FBKA 5DHHA 4XJHA 4KT3A 4WM6A 5D5CA 4N4YB 3DDLA 3HT8A 1G0MA 4DQ5A 1B7PA 1LJ3A 3HAOA 3S8GB 1JWRA 209LA 4UHRA 1WTNA 4GLAA 5EN0A 3COCA 1QUOA 1LI2A 4PJZA 3C81A 2LHMA 5FELA 1IR9A 4YX7C 1UBZA 3IWRA 1JQUA 1JFPA 1HEMA 2HEBA 1REXA 2LYMA 1S51A 4ARLA 1CJ7A 2BQMA 2W1LA 2Z37A 1D9WA 5C6IA 1DYAA 4MD1A 4BV0A 3MBVA 1LGUA 1LHHA 1LZ1A 1RI8B 1AT6A 1QIOA 3QDCA 1LWGA 3HTBA 2DQDY 1GB8A 4ETCA 5I5QA 1L41A 1P8HA 181LA 1L06A 1PXSA 250LA 3IJUA 5AMYA 2YDOA 2F47A 1QSBA 1JHLA 3PQRA 1L28A 4YM8A 1HFXA 4IAPA 1OUJA 2BQCA 1LYOA 1IOCA 1B7RA 1QT7A 2OE9X 2CUUA 135LA 129LA 2HULA 1PQOA 1L82A 4DDAA 2X72A 4KLYA 4W59A 1L0MA 2LNLA 1XJIA 3A90A 3WL2A 4ZPUA 4C3WA 182LA 5B1FA 2AUBA 3BKVA 1QQYA 1C6DA 3RNXA 4HTNA 1GB7A 1XJUA 2BQHA 4GYCA 4G4HA 1C8RA 2EI4A 1WTMA 4WM1A 175LA 2Z2EA 4H9IA 1L87A 3QY4A 1LZBA 3GXRA 1VATA 2NTUA 4MD2A 178LA 5BR5A 3P65A 5ILFA 1IP4A 122LA 3W3EA 4DQJA 1LMNA 1FBBA 1CKDA 165LA 5B6ZA 4WM4A 2HEDA 1L38A 1P8UA 1YAQA 5G53A 1GF5A 4NGLA 1P36A 1L15A 4MQSA 1L26A 1GF9A 1DPXA 2D91A 1LPIA 4HPIA 4RW2A 4X32A 1DI3A 1JV6A 3FI7A 3TXGA 1C10A 5LZMA 152LA 3EH4B 1D3JA 200LA 2B6WA 3CT0A 2B70A 1OVKA 231LA 1L36A 5B35A 2A7DA 4BVNA 148LE 1QTDA 183LA 3FADA 2Z39A 2BLYA 3CDRA 4DD0A 3TXHA 4WW3A 1WVUA
chains in the Genus database with same CATH topology
4Z46A 2EKSC 2Q9DA 4G71B 3GUJA 3NSBA 1AT5A 1L94A 1L40A 1HSWA 1P8IA 1GE1A 1LOZA 1L23A 1QM8A 3C9MA 5G2DA 154LA 2WJKA 3HU8A 4EKRA 1OUFA 255LA 1L49A 3K2RA 4EA3A 1ZYTA 1MELL 1YKYX 1HFZA 2A4TA 1L73A 1OWYA 4WAVA 1P2LA 227LA 4H9CA 1IXFA 2ZQ3A 1MGYA 217LA 1I56A 1E8LA 1L69A 233LA 3CT1A 3RW8A 1GE3A 1VDSA 3CQLA 4NHIA 2MEAA 4WLYA 2QPEB 1C6JA 1IX0A 1B0DA 5H2IA 4WO9A 5AHZA 4DT3A 1QTZA 2ZNWY 5H2JA 1C64A 3A92A 3WPLA 4R0FA 1QKOA 1JJ0A 1P56A 4EPIA 2BQBA 3C8RA 5APDA 4OWHA 3RT5X 4PGJB 4TSBA 118LA 1JISA 1BVKC 1G1VA 3D9AC 4L35A 4XXJA 1EQEA 3GUNA 4OOTA 1L91A 1KXYA 5KKJA 138LA 1LSEA 1VDPA 1XEPA 3HANA 176LA 3TMWA 1LN6A 3RU5A 2OTYX 2IGCA 1HERA 2DBTA 1GEVA 1F6SA 3SB9A 1QTVA 4H8YA 1L0KA 4DJHA 1XSFA 1GFAA 1B7MA 1LSYA 2F4AA 2Z73A 1XGTC 5B6XA 4ARJA 2R4RA 4EKSA 1GFEA 3DN4A 4XADA 1DYEA 1U19A 1PS5A 2RB0X 1QTEA 2NTWA 1LI6A 1XJTA 5L3IA 1GU8A 3X3CA 4I7JA 1D0MA 1HFYA 4H9BA 1H2SA 1L89A 2BLXA 3W6AA 1L83A 4YEOA 3REYA 2G4QA 207LA 1IP1A 4I7NA 2OEAX 2KSAA 4XJIA 4HTQA 4G4BA 4GCCA 4NEBA 3S3CB 3C7WA 3CT5A 2RBQA 2QPDB 4ZFPA 3QJSB 4HP0A 3SP3A 1L11A 1YL0X 1JTTL 3UZCA 1TN5A 1LLHA 4NFVA 1HMKA 156LA 1L90A 1YAOA 137LA 1L92A 2L6XA 257LA 5HNLA 1S54A 3GUIA 2O79A 4WL7A 1S8LA 2BQEA 4LDOA 1L65A 4N1EI 3WUNA 4UG2A 3IJVA 1LYJA 4O34A 1C3WA 1C68A 3VHZA 3UTWA 4A7DA 1GB2A 3FA0A 3ZEKA 5IDDA 4WG7A 2YCXA 1SWZA 1LZRA 1C45A 2BQFA 4TL3A 215LA 5AX0A 3AW7A 110LA 3AM6A 1L08A 1RCMA 1L12A 127LA 1NBYC 2I20A 2HECA 2HU1A 1G7MC 198LA 2B6XA 1OUIA 4RW1A 2BQNA 4QEQA 1ZWNA 5M1YA 1C66A 3VI0A 1L03A 1T6VL 1J1XY 1SSYA 1CJ8A 1FLUA 1UIGA 3CDVA 3WUMA 2OTZX 1P5CA 4EMNA 3K3TA 2LZMA 242LA 258LA 4CFPA 2CGIA 5H2PA 1B5WA 1JKDA 5LVHA 1L18A 1PQKA 1WQQA 4EXMA 4MCKA 1B7QA 1BRXA 3HDEA 1QDRA 1UICA 1QHJA 4RDSA 3AZ5A 4WM5A 3PDSA 3WQJA 1QTBA 3OAXA 4OW1A 5L3HA 5J7CA 5KKIA 3AZ4A 1OUAA 4WM2A 1LYDA 1V7SA 1LGXA 1LHMA 3KAMA 1IP2A 1CU2A 252LA 2G87A 2PEDA 173LA 4TX7A 3S3DB 5DYSA 1VFBC 5LVIA 4XJDA 1PZYA 2Z19A 3GUOA 2BPUA 3UG9A 1LYHA 3A94A 2J4YA 1L16A 1G07A 1IOTA 1L54A 5H2OA 163LA 237LA 1QKPA 1XGRC 2RBNA 3GUPA 4WM3A 3AZ6A 2F2NA 1S53A 3QJTB 4X1HA 3WH1A 1D2YA 3TXJA 3TMXA 2DQAA 3OK0A 1JEFA 1Z55A 4KXIA 3FI5A 4ARQA 4LYMA 2CDSA 1NKHA 5FHWA 1QSQA 5I14A 3D3DA 5LAFA 2ZNXY 4XTLA 140LA 1L76A 2M3GA 1G0JA 3OE6A 4H93A 1UIFA 1IORA 1LMCA 3VW7A 5KXTA 5LXWA 2HEAA 2DQGY 4LGKA 1L02A 5I53A 2KS9A 1LSGA 4I7SA 3HT9A 1F0WA 3T36A 2OU0X 2F2QA 1LZEA 1YKXX 4H92A 3AYMA 1BWHA 3ULRA 5APEA 2G4NA 3D4SA 4KNFA 2B6YA 3WW6A 1CNSA 1GDXA 1P2CC 1LSZA 1VDQA 1CU6A 4NC3A 115LA 4MR1A 1BB3A 1YQVY 1IP6A 5KXZA 206LA 3ATNA 4AXTA 1L58A 3C80A 4J1AA 3WUAA 1GFRA 111LA 1JUGA 1JKAA 2R4SA 1HEOA 4M4OA 2OE4X 1P64A 5B1GA 1HC0A 1S52A 1IWTA 1DI5A 1L70A 4QIDA 1NHBA 1F10A 1BB7A 1G0QA 1R2NA 4AMJA 5D5FA 4PJ2C 3EH5B 1LZ8A 2Y03A 4NGIA 1JTNA 5B05A 189LA 4Z41A 1KIRC 1AM7A 1OVHA 1L63A 1Q5JA 9LYZA 2BQGA 3AW6A 1LZDA 1D3FA 4LZTA 1CU5A 1L74A 1JTMA 5B6YA 254LA 1F6RA 1G0PA 1FDLY 3SB7A 1OV7A 2F93A 4NWHA 201LA 4DD2A 2YBNA 160LA 3HFMY 4AQNA 2F32A 2ZFEA 1L56A 4PHIA 1FLWA 4PRUA 2BQJA 5H2KA 4KL7A 4W54A 3E3DA 5KY1A 1IIZA 1VJMA 1C08C 1HMLA 180LA 1DYBA 1OUCA 1OYUA 1P7SA 4EKPA 1LZNA 4Y9HA 3P64A 1L96A 5B59A 2Z12A 1REMA 1GFUA 5JJJA 3GUKA 3NY9A 3AGGG 1UAZA 3CDTA 1QS5A 1GBWA 168LA 2EIZC 3ODUA 1C62A 4DD1A 4J7VA 4W51A 166LA 238LA 1L14A 1GUEA 2Y02A 1QSAA 2ZIYA 3GXKA 4HJVA 4NSIA 3T45A 3LYMA 1IOQA 3A6CY 3G3BB 2ZZLA 5APCA 3LZMA 2ZWBA 3DN6A 3A93A 4XJBA 1W6ZA 3M18B 139LA 1D3MA 1L44A 4ARPA 146LA 1GB5A 1FLYA 1QT4A 234LA 1HHLA 5KXPA 5II3A 147LA 1X0K1 2Q9EA 1LMOA 1I1ZA 1XEKA 1BWJA 1JITA 1L72A 5LVGA 1L66A 4N5RA 3HUQA 1IWYA 4GP8B 1GPQC 1L52A 1ZURA 2YCYA 1GBSA 1QTHA 196LA 2YSSC 1E12A 2Z18A 4LFXA 5LA8A 1JTPL 186LA 4X31A 141LA 1T3PA 3OJPA 1C46A 4W58A 1GE0A 1CV0A 4LT0A 1VGOA 1QT5A 2IHLA 3CAPA 1KW7A 1QT8A 3NS0A 2ZYPA 1B5XA 251LA 3LYZA 1B7LA 174LA 1KXXA 2QB0B 2RBSA 3RZEA 1LAAA 4J4QA 1J1OY 1LJJA 4TUNA 2XBRA 1LTMA 4I7QA 2F95A 1TN0A 3VWOA 1LZYA 2Y00A 5DM9A 1GE4A 4H1PA 2H9KA 4HYJA 2B7XA 1GWDA 1L27A 3T6UA 1C6CA 3HAPA 191LA 1C61A 188LA 1L32A 2KSYA 1L25A 5B6VA 1BHZA 1GE2A 1D2WA 2EPEA 5E9RA 1D9UA 1DKJA 1G7JC 5KXNA 1DZBX 2B74A 5LVJA 4B4IA 3ZVQA 1FBIX 1L33A 2Q0MX 1YANA 2YBJA 1KIQC 4NY5A 2RAZX 4K5YA 4PRQA 1IWUA 1LJEA 3B6LA 1KGBA 6LYZA 4IJ4A 3OE0A 1G06A 1ZMYL 1IWXA 2MEHA 222LA 208LA 3W6FA 2YBIA 1L62A 4BADA 1C6AA 1TBYA 2G4PA 4AGAA 1C6IA 4XTNA 4EPFA 4LYBA 1CKFA 2RSCA 3G3AB 1HELA 5F9UA 1BQLY 1GF3A 5AWZA 4YF2A 4GBRA 187LA 3UONA 3RFMA 5AX1A 1L37A 167LA 1B5UA 3A96A 2LYZA 5E4PA 5I4WA 3QBGA 4DQ7A 1C6NA 1L04A 2HTXA 3DMZA 1B5YA 1L17A 1LWKA 5H2LA 4I7PA 171LA 4EJ4A 1T8GA 1YKZX 1P6YA 3C83A 1LZ6A 1C6FA 1GFVA 112LA 103LA 2B75A 3WXTA 3GUMA 1BM1A 1KY0A 3QBKA 4LT2A 1DYGA 1BB4A 248LA 4N1CC 3WVXA 4W52A 155LA 1IR8A 2W1YA 4RLMA 1DKKA 3AZ7A 1I6SA 4HSFA 104LA 1H6MA 1UACY 4PK0A 1LZ9A 4YEMA 5FDJA 1LJIA 2XQOA 2YBLA 4LYZA 230LA 3HASA 1QUDA 1L45A 3A67Y 1IWWA 4NGJA 5HMJA 4JKVA 3G3XA 5FJGA 4FJRA 1GBOA 1PQJA 2VT4A 1G0GA 4NGZA 7LZMA 1L20A 5LA5A 1QS9A 3VG9A 3TXFA 1UC0A 4NG8A 3ABWA 225LA 4BEZA 4WLDA 4H9EA 1NHEA 4H91A 114LA 3EO5A 5B34A 239LA 1QSWA 3NYAA 1WVVA 3DN3A 1FLQA 4GCEA 4ARMA 4QI1A 1GXV2 4FDYA 5B06A 3LYOA 228LA 2MEDA 4YXAC 2Z2FA 5G36A 1KS3A 2WJLA 3HARA 1OUBA 4QRYA 3DN2A 1FKVA 1D6PA 1GAYA 220LA 3P4ZA 1DI4A 2DQFC 194LA 1IEEA 1F4ZA 4FA7B 2BQOA 3DN0A 3HBDA 2AT9A 1Q5IA 3RZ4A 3UTVA 1G0LA 4G49A 3AYNA 4QDNA 2KSBA 4H8ZA 190LA 4G70B 6LZMA 3HTDA 1RE2A 1PY6A 3F9LA 2F30A 4LT3A 1H68A 3EMLA 4N8ZA 1YL1X 1L42A 170LA 1DXJA 4G9SA 2DQJY 1AKIA 1YILA 197LA 2I21A 1OV5A 3MGWA 4P2EA 5F8UA 3DN8A 1L67A 1KG9A 3P68A 1NDGC 3N9EA 4I7KA 3WPKA 232LA 192LA 1XEJA 4GN4A 5A3EA 1QDTA 1LYZA 4DYGA 6LYTA 1N4FA 2XBSA 4GP5B 1B5VA 2D4KA 3V2YA 1CU0A 2I26L 4NHQA 1L48A 2LZTA 1INUA 1LSCA 3UZAA 2MEIA 1CV4A 4NGKA 3F6ZA 1HEQA 2ZIJA 1YIKA 3G3VA 3GULA 5DHGA 210LA 5ETZA 4EIYA 2DKVA 3W6CA 4PPOA 4G7QB 1L39A 4D9ZA 3L64A 4OWAA 4PXKA 3KJ6A 1L81A 4NSHA 4DKLA 4NG1A 5DN5A 260LA 4WOAA 3DMXA 1B7OA 1IP7A 4LZMA 3WXUA 133LA 1GBXA 1YAPA 126LA 3HH3A 1LYGA 4G4CA 4XT1A 4YXCA 2C8PA 1GB9A 1LMQA 1LI3A 2RBOA 1C67A 1EQ4A 1LYFA 1BWIA 1L30A 2XJWA 3WULA 4B4EA 4CFOA 4DD3A 177LA 3RUNA 2YCWA 1C6KA 164LA 1GF0A 1P3NA 2HEFA 4H9AA 1C6LA 1WQOA 2D4JA 4GLVA 4DDCA 3PXOA 4UWVA 3HH4A 2MEGA 4LDLA 3C82A 3HUKA 172LA 3B0IA 4N4WA 1LZ5A 2EQLA 4ET8A 5I54A 1HZXA 1O23A 1VDTA 5J7AA 2BQDA 5G54A 4NHSA 1L61A 1L53A 2YBMA 4AMIA 4Z98A 1GF7A 3UTXA 1L99A 1OUHA 185LA 4I7RA 1LYYA 1LSNA 4ARQB 120LA 4HV1A 2ZIKA 3HBEX 4II8A 4H9HA 1KMEA 1LSAA 218LA 4XYYA 3UTYA 4TWSA 3HH6A 128LA 3EXDA 1LSMA 1J1PY 3WVYA 1CUQA 3PWHA 1L22A 1BGIA 3CODA 5LYTA 4CGEA 3F8VA 3M3UA 1L79A 4WMGA 4XJFA 2F4GA 3WU7A 1IWVA 1OUEA 1NBZC 4HTKA 2Y04A 2B73A 1UIAA 4H94A 151LA 5AZDA 3QAPA 4IAQA 2GV0A 2ZQ4A 3N9CA 211LA 1GZMA 1KY1A 1IR7A 3HTGA 4B49A 102LA 2YCZA 5KXWA 169LA 1IW6A 4OWBA 2FYDA 1C60A 2HUKA 150LA 3HU9A 1L05A 2XTHA 1C6QA 4IARA 4Z3MA 1LKSA 3C8QA 1KXWA 5DL9A 2X0AA 5KXMA 3AYQA 1QUHA 1IVMA 123LA 1OWZA 2Y8PA 161LA 2MECA 3DNAA 1LJ4A 1VAUA 3DMVA 1F88A 1OP9B 4NGYA 1K28A 4ETAA 3A7KA 247LA 4L41A 3QBIA 5LWEA 1L21A 1NMMA 3A34A 1C63A 1LYSA 3VGAA 1XEIA 1T97A 1LSBA 1QUSA 4NSJA 249LA 5IHGA 193LA 4B4JA 2OU9A 1LZSA 3QJRB 1L75A 3ZPQA 1OUDA 1SLYA 2LCBA 4ZEEA 2I6ZA 1IOSA 4W57A 1LCNA 1L07A 2FBDA 2B72A 3QE8A 5I4XA 243LA 195LA 1PQDA 1HNLA 4S0WA 1XGPC 1B7NA 4N9RA 2BQKA 1OQMA 1L13A 3CDOA 3S3BB 2FBBA 4J1BA 1C6BA 3G3WA 4B1AA 4YENA 1L24A 3OE9A 229LA 1X0SA 1LJGA 3TXKA 2RH1A 2I25L 2Z55A 5DN4A 3WPJA 1GFKA 2DQIY 1I20A 235LA 1IY4A 1G0KA 1OVJA 2MEFA 125LA 1HEWA 4NGVA 4W94A 5ITCA 1IWZA 1TAYA 5LIOA 1L85A 1LYEA 3WYHA 1PQIA 5A44A 1BVXA 3A95A 1T8FA 3HUAA 5A3ZA 245LA 5C1MA 1NDMC 1X0I1 4HPEA 1GB0A 4N6HA 1AZFA 1YAMA 1SSWA 3EBAB 4YOPA 1IC4Y 2HU3A 1NWGA 4W56A 4U3XB 1LZ4A 3LYTA 1WQRA 2LYOA 1GDWA 4WL6A 3LZ2A 1LHIA 3P66A 1L68A 1JJ3A 1P2RA 1LZGA 1GF4A 5T3FA 8LYZA 2PC2A 4ANRA 1G1WA 158LA 5KXRA 1HENA 1L46A 3HBHA 1ZV5L 2Z6BA 108LA 2HUBA 3CB7A 1H87A 1GF8A 4BAFA 119LA 1REZA 3WU8A 1L71A 5B0WA 4DD7A 4GP4B 3B0OA 5JENB 3N9AA 1UCOA 4DAJA 3ATOA 4LFPA 3S8FB 1JIYA 1B2KA 1NQIA 5B2NA 4ETEA 1LMAA 4BUOA 3CSRA 5HNCA 1IY3A 4GCFA 4I7MA 5BR2A 4GN3A 1E0PA 1BB6A 1KG8A 4NGOA 113LA 1HF4A 3QNGA 1UA6Y 4GCDA 1LSPA 4GPOA 1LPYA 1TDYA 4GN5C 1CX6A 4CJ2A 3ZVQB 3SB5A 5H2MA 4FAAB 3P0GA 1LGWA 4TTDA 2Y01A 5EBHA 4I7LA 4DD9A 4ZIXA 1CUPA 3AB6A 1L95A 1C6TA 2IFFY 4XT3A 153LA 246LA 2B6TA 1L0JA 1L43A 1L60A 1A4VA 3A6BY 2BRDA 1C6MA 1B9OA 4LDEA 1CV1A 5LINA 1LZTA 2ANVA 3HWLA 134LA 261LA 2RB1X 4BWBA 3NY8A 2YDGA 4XN6A 3SBBC 4GBRB 1CU3A 4OWCA 4BS7A 1T8AA 1T6HA 1EPYA 1KW5A 1QT6A 2HEEA 4KPMA 4M6DA 1GFGA 1DYDA 5HMVA 4C5FA 4WO6A 1TCYA 159LA 1G7LC 2BAAA 4WLTA 1CX7A 3JR6A 3A3QA 3QJUB 1JV7A 5JJEA 4EKQA 1D6QA 5F81A 4OO9A 4XENA 3EMSA 2LC9A 3BVDB 199LA 3C9LA 1ZVYB 3CSQA 2ANXA 4UWNA 214LA 4RLNA 184LA 3HT7A 4I7OA 1PXRA 1V7TA 2JAGA 1L88A 1BB5A 4NGWA 2H5ZA 3QAKA 4ETBA 4ML7A 2D4IA 3X3BA 3DN1A 3HTFA 1DZEA 1L51A 1GFTA 1IW9A 2RBRA 1L00A 1FKQA 3AJNA 1JSEA 3W6BA 1M0MA 1C69A 1KNIA 5FSTA 3J4GA 4OOOA 2B5ZA 4B0DA 4H9FA 4J0LA 4QGZA 3W6DA 5KXYA 5F16A 1B6IA 143LA 3SBAA 2VB1A 1C43A 1GBYA 5KXOA 4W53A 145LA 3HDFA 3TMUA 1L10A 2BQIA 5TGZA 4ET9A 4E3UA 1UCQA 4HJYA 4ARMB 3HH5A 4DS7E 4WLXA 1JPOA 4TSCA 3SN6R 1VEDA 3C7YA 2I1XA 1QTKA 5A8EA 5FEKA 1BRRA 1D0LA 1L55A 1CKCA 5H2NA 1C6HA 259LA 3QJVB 1REYA 1AT9A 1QTCA 4MSTA 1NF5A 2MEBA 3A3RX 223LA 1KIPC 3BKHA 5F9XA 4NHPA 1WQNA 2HUMA 3SB8A 5APFA 142LA 5ILCA 2NTGA 4BEYA 1JKCA 4OWEA 1UUZC 2BQAA 1L93A 2ZYCA 5KXKA 1LSDA 4FBZA 1C65A 1QT3A 2NWDX 130LA 1CV3A 1LMPA 3B72A 4E97A 2CWIA 1EL1A 1C7PA 1ALCA 4I7TA 132LA 1L86A 2RAYX 4NHTA 1LJKA 3TXIA 1LKRA 1XFPL 4G7RB 1P37A 2L78A 1LZAA 1L97A 1RFPA 5B07A 3DQBA 2MEEA 1L9HA 4NWEA 3ZPRA 4QY9A 1GXXA 4L6RA 4IASA 4FPDA 236LA 4W96A 1CJ6A 2YBHA 1DQJC 4N0JA 1GB6A 1SX2A 1IO5A 1IC7Y 4NIJA 219LA 5A45A 2LZ2A 1EHKB 5AHYA 144LA 1L47A 3LZTA 2A7FA 1LZCA 1DYCA 2NTHA 4OV0A 2N5ZA 5KXXA 3HT6A 4MBSA 221LA 1JTOL 4LYOA 1D3NA 253LA 3QBLA 5KKHA 1MLCE 1L57A 4DC4A 1GHLA 2W1XA 4R6CA 2OU8A 205LA 4CHXA 256LA 3EH3B 1JSFA 5JJNA 2O4WA 1IP5A 2O7AA 3OE8A 5LYMA 1G7IC 5HLLA 2D6BA 4WG1A 1CWQA 3QJQB 1GB3A 1L98A 3LN2A 3A8ZA 212LA 1XIOA 2DQHY 1C6EA 3TXBA 1LHKA 1EQ5A 2C8OA 3DKEX 213LA 1PQMA 1L84A 2WARA 1BRDA 5LYZA 226LA 4DDBA 3SB6A 1L64A 1LJFA 1WQPA 1C8SA 1L29A 240LA 1UIBA 1LHJA 1CKHA 1OUGA 2JAFA 4H90A 2OE7X 3VVKA 1XGQC 4X3BA 1C6PA 149LA 107LA 3CSZA 4XJGA 4BAPA 1B5ZA 4UWUA 1B7SA 3V2WA 216LA 1W08A 2B6ZA 3AGIA 4W55A 1UIEA 3B0KA 4LYCA 1JJ1A 1WTHA 1D0KA 2BQLA 2Z38A 2ZILA 1WQMA 1DYFA 2RB2X 1SQ2L 1CJ9A 2CJLA 162LA 1GEZA 1TEWA 4IB4A 157LA 3PBLA 1O0AA 1TLAA 1L31A 3TMVA 244LA 4XTOA 1QUTA 5G2CA 1HSXA 1LHLA 1XGUC 5ITEA 2DQEY 4GRVA 4LT1A 1LW9A 3ZEVA 1GBZA 4JQ6A 5L9JA 1L01A 1L34A 4I0CA 1F50A 1IP3A 3CDQA 4EOFA 1DPWA 5HQ1A 4ETDA 1P46A 4JR8A 5KXSA 1CV6A 5C6LA 4HWLA 224LA 3J6KA 4GCBA 1JGJA 5KJ9A 1UIDA 2QARC 3FE0A 3TXEA 5LVKA 7LYZA 2HPYA 109LA 5G28A 1L50A 1GFHA 5LAGA 4PXFA 1QUGA 4I8SA 1GF6A 1UIHA 4MQTA 3C7ZA 1L77A 1L35A 2I35A 4IATA 1YROA 1IC5Y 3HAQA 5KXLA 1GFJA 1SWYA 1M0KA 5K7OA 2YDVA 5C6JA 3W6EA 1LMTA 5DLAA 4G7SB 4DWXA 1C6GA 1HEPA 1S8JA 1LSFA 3WU9A 4H8XA 1A2YC 241LA 1CV5A 5F14A 3LHMA 131LA 1JKBA 262LA 4HYXA 5H2HA 1GD6A 1CKGA 2DQCY 1XMEB 1CVKA 1L09A 2FYCA 5FCPA 4NSGA 3AGHA 3WMKA 1G7HC 3TXDA 1RJCB 1LYIA 1FN5A 3A91A 1CTWA 4HJZA 4A4MA 5I4YA 5G2AA 2W1MA 1L59A 4HV2A 1R84A 4LYTA 1AP9A 1LJNA 2RBPA 1GAZA 1L80A 3WW5A 5IELA 3C8SA 1LJHA 2H9JA 1ZVHL 1M0LA 2YVBA 4G72B 5B6WA 3L2XA 1L19A 1SX7A 1FBKA 5DHHA 4XJHA 4KT3A 4WM6A 5D5CA 4N4YB 3DDLA 3HT8A 1G0MA 4DQ5A 1B7PA 1LJ3A 3HAOA 3S8GB 1JWRA 209LA 4UHRA 1WTNA 4GLAA 5EN0A 3COCA 1QUOA 1LI2A 4PJZA 3C81A 2LHMA 5FELA 1IR9A 4YX7C 1UBZA 3IWRA 1JQUA 1JFPA 1HEMA 2HEBA 1REXA 2LYMA 1S51A 4ARLA 1CJ7A 2BQMA 2W1LA 2Z37A 1D9WA 5C6IA 1DYAA 4MD1A 4BV0A 3MBVA 1LGUA 1LHHA 1LZ1A 1RI8B 1AT6A 1QIOA 3QDCA 1LWGA 3HTBA 2DQDY 1GB8A 4ETCA 5I5QA 1L41A 1P8HA 181LA 1L06A 1PXSA 250LA 3IJUA 5AMYA 2YDOA 2F47A 1QSBA 1JHLA 3PQRA 1L28A 4YM8A 1HFXA 4IAPA 1OUJA 2BQCA 1LYOA 1IOCA 1B7RA 1QT7A 2OE9X 2CUUA 135LA 129LA 2HULA 1PQOA 1L82A 4DDAA 2X72A 4KLYA 4W59A 1L0MA 2LNLA 1XJIA 3A90A 3WL2A 4ZPUA 4C3WA 182LA 5B1FA 2AUBA 3BKVA 1QQYA 1C6DA 3RNXA 4HTNA 1GB7A 1XJUA 2BQHA 4GYCA 4G4HA 1C8RA 2EI4A 1WTMA 4WM1A 175LA 2Z2EA 4H9IA 1L87A 3QY4A 1LZBA 3GXRA 1VATA 2NTUA 4MD2A 178LA 5BR5A 3P65A 5ILFA 1IP4A 122LA 3W3EA 4DQJA 1LMNA 1FBBA 1CKDA 165LA 5B6ZA 4WM4A 2HEDA 1L38A 1P8UA 1YAQA 5G53A 1GF5A 4NGLA 1P36A 1L15A 4MQSA 1L26A 1GF9A 1DPXA 2D91A 1LPIA 4HPIA 4RW2A 4X32A 1DI3A 1JV6A 3FI7A 3TXGA 1C10A 5LZMA 152LA 3EH4B 1D3JA 200LA 2B6WA 3CT0A 2B70A 1OVKA 231LA 1L36A 5B35A 2A7DA 4BVNA 148LE 1QTDA 183LA 3FADA 2Z39A 2BLYA 3CDRA 4DD0A 3TXHA 4WW3A 1WVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 168L A;  1P37 A;  3ODU A;  2L78 A;  1C62 A;  218L A;  3UTY A;  2Q9D A;  3HH6 A;  128L A;  4G71 B;  4W51 A;  166L A;  1L97 A;  238L A;  1L14 A;  3GUJ A;  1GUE A;  2Y02 A;  1CUQ A;  1L94 A;  3DQB A;  3NSB A;  3PWH A;  1L9H A;  1L40 A;  1L22 A;  3ZPR A;  1P8I A;  3COD A;  1L23 A;  1QM8 A;  3C9M A;  5G2D A;  2ZIY A;  3F8V A;  4L6R A;  4FPD A;  2WJK A;  1L79 A;  236L A;  3HU8 A;  4EKR A;  3T45 A;  255L A;  1L49 A;  3K2R A;  2ZZL A;  4EA3 A;  1SX2 A;  3LZM A;  1ZYT A;  3DN6 A;  2A4T A;  219L A;  1L73 A;  5A45 A;  1OWY A;  2Y04 A;  1EHK B;  4WAV A;  5AHY A;  144L A;  1P2L A;  1L47 A;  139L A;  1D3M A;  151L A;  1L44 A;  227L A;  2B73 A;  4ARP A;  1IXF A;  1DYC A;  3QAP A;  2NTH A;  4IAQ A;  5AZD A;  4OV0 A;  146L A;  1MGY A;  217L A;  3HT6 A;  4MBS A;  1QT4 A;  221L A;  1L69 A;  233L A;  211L A;  234L A;  1D3N A;  1GZM A;  253L A;  1KY1 A;  3QBL A;  147L A;  5KKH A;  1L57 A;  1X0K 1;  3HTG A;  2Q9E A;  2QPE B;  102L A;  1C6J A;  2YCZ A;  5H2I A;  1L72 A;  169L A;  5AHZ A;  1IW6 A;  1L66 A;  1QTZ A;  3HUQ A;  1C60 A;  5H2J A;  1C64 A;  4GP8 B;  2HUK A;  205L A;  150L A;  2OU8 A;  256L A;  1L05 A;  3HU9 A;  3EH3 B;  1L52 A;  1ZUR A;  1C6Q A;  1QKO A;  2YCY A;  5JJN A;  2O4W A;  4IAR A;  1P56 A;  4EPI A;  2O7A A;  3OE8 A;  1QTH A;  196L A;  3C8Q A;  1E12 A;  1QUH A;  123L A;  1OWZ A;  3C8R A;  1CWQ A;  3QJQ B;  161L A;  186L A;  4X31 A;  141L A;  118L A;  1L98 A;  3DNA A;  212L A;  1XIO A;  1G1V A;  1C6E A;  3DMV A;  4W58 A;  1F88 A;  4L35 A;  4XXJ A;  1CV0 A;  1VGO A;  1QT5 A;  3GUN A;  1L91 A;  1K28 A;  1KW7 A;  3DKE X;  1QT8 A;  3A7K A;  3CAP A;  247L A;  213L A;  1PQM A;  1L84 A;  3NS0 A;  251L A;  1BRD A;  138L A;  174L A;  3QBI A;  5LWE A;  1L21 A;  226L A;  2QB0 B;  1C63 A;  2RBS A;  3RZE A;  1XEP A;  3SB6 A;  4J4Q A;  4I7Q A;  1L64 A;  2F95 A;  1TN0 A;  3HAN A;  176L A;  3VGA A;  1T97 A;  1C8S A;  1LN6 A;  2Y00 A;  1L29 A;  2OTY X;  2IGC A;  249L A;  240L A;  4HYJ A;  2B7X A;  1L27 A;  3SB9 A;  1C6C A;  1QTV A;  191L A;  1C61 A;  3HAP A;  1L0K A;  4DJH A;  188L A;  2OU9 A;  1L32 A;  2KSY A;  1L25 A;  5B6V A;  3QJR B;  1D2W A;  1L75 A;  2JAF A;  3ZPQ A;  2LCB A;  2OE7 X;  4W57 A;  2Z73 A;  3VVK A;  5B6X A;  4ARJ A;  1C6P A;  149L A;  1L07 A;  107L A;  2B72 A;  2B74 A;  2R4R A;  243L A;  3V2W A;  4EKS A;  195L A;  3DN4 A;  1PQD A;  216L A;  2B6Z A;  4W55 A;  4S0W A;  1DYE A;  1L33 A;  1U19 A;  3CDO A;  1L13 A;  2RB0 X;  2NTW A;  3S3B B;  2RAZ X;  4K5Y A;  1WTH A;  1KGB A;  1LI6 A;  1XJT A;  1C6B A;  3G3W A;  3OE0 A;  1G06 A;  1GU8 A;  3X3C A;  1L24 A;  1DYF A;  3OE9 A;  4I7J A;  222L A;  229L A;  1X0S A;  2RB2 X;  1H2S A;  162L A;  2RH1 A;  4IB4 A;  1L62 A;  1L89 A;  2Z55 A;  157L A;  1C6A A;  3PBL A;  1O0A A;  1TLA A;  1L83 A;  3REY A;  1L31 A;  4XTO A;  244L A;  5G2C A;  4I7N A;  2OEA X;  2KSA A;  5ITE A;  1C6I A;  4XTN A;  235L A;  4GRV A;  4EPF A;  1LW9 A;  1G0K A;  3ZEV A;  1OVJ A;  4JQ6 A;  125L A;  3C7W A;  3S3C B;  5ITC A;  1L01 A;  2RBQ A;  2QPD B;  1L85 A;  1LYE A;  5AWZ A;  1L34 A;  4GBR A;  187L A;  3UON A;  1F50 A;  1PQI A;  5A44 A;  3CDQ A;  3QJS B;  3RFM A;  5AX1 A;  1L37 A;  167L A;  1L11 A;  1P46 A;  4JR8 A;  3QBG A;  3UZC A;  1CV6 A;  1TN5 A;  1T8F A;  1C6N A;  1LLH A;  4HWL A;  1L04 A;  224L A;  156L A;  3HUA A;  1JGJ A;  1L90 A;  245L A;  5C1M A;  137L A;  3DMZ A;  1L92 A;  2QAR C;  1X0I 1;  2L6X A;  1L17 A;  1LWK A;  257L A;  5H2L A;  4I7P A;  2HPY A;  109L A;  4N6H A;  171L A;  3GUI A;  1S54 A;  1L50 A;  1SSW A;  2O79 A;  1T8G A;  4EJ4 A;  5G28 A;  1P6Y A;  1S8L A;  3C83 A;  4W56 A;  4LDO A;  1L65 A;  4UG2 A;  1C6F A;  4PXF A;  1QUG A;  1LYJ A;  112L A;  103L A;  2B75 A;  1BM1 A;  3GUM A;  4MQT A;  1C3W A;  1KY0 A;  3C7Z A;  1C68 A;  1L77 A;  3VHZ A;  1L35 A;  1L68 A;  3QBK A;  3UTW A;  1DYG A;  2I35 A;  1P2R A;  3FA0 A;  248L A;  4W52 A;  2YCX A;  1G1W A;  158L A;  1SWZ A;  155L A;  3HAQ A;  1L46 A;  4TL3 A;  1SWY A;  215L A;  5AX0 A;  1M0K A;  1I6S A;  104L A;  2Z6B A;  110L A;  108L A;  4PK0 A;  3AM6 A;  1L08 A;  2YDV A;  1L12 A;  127L A;  230L A;  3HAS A;  2I20 A;  1QUD A;  4G7R B;  1L45 A;  4G7S B;  198L A;  1C6G A;  119L A;  1S8J A;  4JKV A;  1L71 A;  3G3X A;  5FJG A;  5B0W A;  241L A;  2B6X A;  1CV5 A;  1ZWN A;  1PQJ A;  2VT4 A;  1G0G A;  1C66 A;  4GP4 B;  1L03 A;  3VI0 A;  131L A;  1SSY A;  7LZM A;  1L20 A;  3CDV A;  4DAJ A;  262L A;  1QS9 A;  4HYX A;  5H2H A;  2OTZ X;  3VG9 A;  1P5C A;  1XME B;  1CVK A;  3ABW A;  1L09 A;  225L A;  4BEZ A;  3S8F B;  2LZM A;  242L A;  114L A;  258L A;  5B34 A;  239L A;  3NYA A;  5B2N A;  5H2P A;  1LYI A;  1L18 A;  3DN3 A;  4BUO A;  1PQK A;  4EXM A;  4ARM A;  1BRX A;  3HDE A;  1CTW A;  4I7M A;  1QHJ A;  4QI1 A;  5BR2 A;  4A4M A;  3PDS A;  3WQJ A;  1E0P A;  1QTB A;  3OAX A;  5G2A A;  1KG8 A;  1L59 A;  1R84 A;  113L A;  228L A;  4YXA C;  1AP9 A;  2RBP A;  5G36 A;  1KS3 A;  2WJL A;  3HAR A;  4GPO A;  1LPY A;  1L80 A;  1LYD A;  1LGX A;  4QRY A;  3C8S A;  1CX6 A;  3DN2 A;  3SB5 A;  5H2M A;  4FAA B;  220L A;  1LGW A;  1M0L A;  3P0G A;  4G72 B;  5B6W A;  3L2X A;  1CU2 A;  252L A;  1L19 A;  2G87 A;  2Y01 A;  2PED A;  173L A;  1SX7 A;  1FBK A;  4I7L A;  5DHH A;  1F4Z A;  1CUP A;  3S3D B;  5DYS A;  1L95 A;  1C6T A;  4FA7 B;  3DN0 A;  3GUO A;  2AT9 A;  1Q5I A;  4N4Y B;  4XT3 A;  3UG9 A;  1LYH A;  3UTV A;  1G0L A;  3DDL A;  246L A;  3AYN A;  2B6T A;  3HT8 A;  1L16 A;  2J4Y A;  2KSB A;  1G0M A;  1G07 A;  190L A;  1L54 A;  1L0J A;  1L43 A;  4G70 B;  1L60 A;  3HAO A;  6LZM A;  5H2O A;  3HTD A;  163L A;  237L A;  1PY6 A;  1QKP A;  2BRD A;  2RBN A;  3F9L A;  3S8G B;  1C6M A;  3GUP A;  1H68 A;  3EML A;  209L A;  4LDE A;  4UHR A;  1CV1 A;  5EN0 A;  1S53 A;  1L42 A;  3COC A;  3QJT B;  4X1H A;  2ANV A;  3HWL A;  170L A;  261L A;  1QUO A;  1LI2 A;  4PJZ A;  3C81 A;  2RB1 X;  4BWB A;  1D2Y A;  3NY8 A;  197L A;  3SBB C;  2I21 A;  4GBR B;  1CU3 A;  1OV5 A;  4YX7 C;  1JFP A;  1JQU A;  1T8A A;  1T6H A;  3FI5 A;  1EPY A;  1KW5 A;  1QT6 A;  4ARQ A;  1DYD A;  1S51 A;  1QSQ A;  4ARL A;  5I14 A;  5F8U A;  1D9W A;  3DN8 A;  1DYA A;  159L A;  4MD1 A;  4BV0 A;  1CX7 A;  1LGU A;  3MBV A;  4XTL A;  140L A;  1L76 A;  1L67 A;  3JR6 A;  1KG9 A;  3QJU B;  2M3G A;  3QDC A;  1JV7 A;  5JJE A;  1G0J A;  3OE6 A;  4EKQ A;  1LWG A;  3HTB A;  4I7K A;  232L A;  192L A;  4OO9 A;  3VW7 A;  2LC9 A;  3BVD B;  199L A;  3C9L A;  1L02 A;  2KS9 A;  4GP5 B;  2ANX A;  1L41 A;  4I7S A;  3HT9 A;  214L A;  3V2Y A;  1CU0 A;  1P8H A;  184L A;  181L A;  1L48 A;  2OU0 X;  3HT7 A;  1L06 A;  4I7O A;  1PXR A;  250L A;  2F2Q A;  1PXS A;  2YDO A;  2JAG A;  2F47 A;  1L88 A;  3AYM A;  3UZA A;  1QSB A;  3QAK A;  1CV4 A;  3PQR A;  3D4S A;  1L28 A;  4KNF A;  3X3B A;  3DN1 A;  2B6Y A;  3G3V A;  3GUL A;  3HTF A;  1L51 A;  1DZE A;  1IW9 A;  2RBR A;  5DHG A;  4IAP A;  1L00 A;  210L A;  5ETZ A;  4EIY A;  1CU6 A;  4NC3 A;  115L A;  1QT7 A;  2OE9 X;  2CUU A;  4G7Q B;  1L39 A;  1M0M A;  1C69 A;  3L64 A;  1KNI A;  129L A;  2HUL A;  4PXK A;  1PQO A;  3KJ6 A;  1L82 A;  1L81 A;  4DKL A;  206L A;  1L58 A;  2X72 A;  4KLY A;  1B6I A;  3C80 A;  4W59 A;  143L A;  3SBA A;  1L0M A;  260L A;  2LNL A;  1XJI A;  3DMX A;  111L A;  4ZPU A;  4W53 A;  2R4S A;  182L A;  4LZM A;  2OE4 X;  1P64 A;  1S52 A;  145L A;  126L A;  1L70 A;  3HDF A;  1LYG A;  3HH3 A;  1C6D A;  1L10 A;  4QID A;  4XT1 A;  1NHB A;  4YXC A;  1G0Q A;  1XJU A;  5TGZ A;  1LI3 A;  1R2N A;  4AMJ A;  3EH5 B;  2RBO A;  1UCQ A;  4GYC A;  4ARM B;  3HH5 A;  1C67 A;  2Y03 A;  1LYF A;  1C8R A;  1L30 A;  3SN6 R;  2EI4 A;  177L A;  175L A;  1JTN A;  3C7Y A;  2I1X A;  189L A;  3RUN A;  2YCW A;  1L87 A;  1C6K A;  5A8E A;  1OVH A;  1BRR A;  1L63 A;  1Q5J A;  164L A;  4MD2 A;  2NTU A;  178L A;  1L55 A;  1P3N A;  5BR5 A;  1D3F A;  5H2N A;  1C6L A;  1C6H A;  1CU5 A;  1L74 A;  259L A;  122L A;  3QJV B;  1AT9 A;  1JTM A;  5B6Y A;  254L A;  1G0P A;  1QTC A;  3SB7 A;  3PXO A;  1FBB A;  1OV7 A;  3HH4 A;  4LDL A;  223L A;  2F93 A;  165L A;  2HUM A;  5B6Z A;  3C82 A;  3HUK A;  172L A;  201L A;  4N4W A;  1L38 A;  3SB8 A;  1P8U A;  160L A;  5G53 A;  4AQN A;  2F32 A;  142L A;  2ZFE A;  1HZX A;  5J7A A;  2NTG A;  5G54 A;  1P36 A;  1L15 A;  4BEY A;  4MQS A;  1L61 A;  1L26 A;  1L56 A;  1L53 A;  1L93 A;  5H2K A;  4W54 A;  4FBZ A;  4X32 A;  1JV6 A;  1C65 A;  1QT3 A;  1VJM A;  4AMI A;  130L A;  180L A;  1CV3 A;  1DYB A;  1OYU A;  1P7S A;  5LZM A;  1L99 A;  4EKP A;  3UTX A;  152L A;  3EH4 B;  1D3J A;  4E97 A;  200L A;  2B6W A;  185L A;  4I7R A;  2B70 A;  4Y9H A;  1OVK A;  231L A;  1L36 A;  5B35 A;  1L96 A;  4I7T A;  4BVN A;  1L86 A;  2RAY X;  148L E;  4ARQ B;  120L A;  1QTD A;  5JJJ A;  183L A;  3GUK A;  3NY9 A;  3FAD A;  3CDR A;  1UAZ A;  3CDT A;  1KME A;  1QS5 A;  4WW3 A; 
#chains in the Genus database with same CATH topology
 4Z46 A;  2EKS C;  2Q9D A;  4G71 B;  3GUJ A;  3NSB A;  1AT5 A;  1L94 A;  1L40 A;  1HSW A;  1P8I A;  1GE1 A;  1LOZ A;  1L23 A;  1QM8 A;  3C9M A;  5G2D A;  154L A;  2WJK A;  3HU8 A;  4EKR A;  1OUF A;  255L A;  1L49 A;  3K2R A;  4EA3 A;  1ZYT A;  1MEL L;  1YKY X;  1HFZ A;  2A4T A;  1L73 A;  1OWY A;  4WAV A;  1P2L A;  227L A;  4H9C A;  1IXF A;  2ZQ3 A;  1MGY A;  217L A;  1I56 A;  1E8L A;  1L69 A;  233L A;  3CT1 A;  3RW8 A;  1GE3 A;  1VDS A;  3CQL A;  4NHI A;  2MEA A;  4WLY A;  2QPE B;  1C6J A;  1IX0 A;  1B0D A;  5H2I A;  4WO9 A;  5AHZ A;  4DT3 A;  1QTZ A;  2ZNW Y;  5H2J A;  1C64 A;  3A92 A;  3WPL A;  4R0F A;  1QKO A;  1JJ0 A;  1P56 A;  4EPI A;  2BQB A;  3C8R A;  5APD A;  4OWH A;  3RT5 X;  4PGJ B;  4TSB A;  118L A;  1JIS A;  1BVK C;  1G1V A;  3D9A C;  4L35 A;  4XXJ A;  1EQE A;  3GUN A;  4OOT A;  1L91 A;  1KXY A;  5KKJ A;  138L A;  1LSE A;  1VDP A;  1XEP A;  3HAN A;  176L A;  3TMW A;  1LN6 A;  3RU5 A;  2OTY X;  2IGC A;  1HER A;  2DBT A;  1GEV A;  1F6S A;  3SB9 A;  1QTV A;  4H8Y A;  1L0K A;  4DJH A;  1XSF A;  1GFA A;  1B7M A;  1LSY A;  2F4A A;  2Z73 A;  1XGT C;  5B6X A;  4ARJ A;  2R4R A;  4EKS A;  1GFE A;  3DN4 A;  4XAD A;  1DYE A;  1U19 A;  1PS5 A;  2RB0 X;  1QTE A;  2NTW A;  1LI6 A;  1XJT A;  5L3I A;  1GU8 A;  3X3C A;  4I7J A;  1D0M A;  1HFY A;  4H9B A;  1H2S A;  1L89 A;  2BLX A;  3W6A A;  1L83 A;  4YEO A;  3REY A;  2G4Q A;  207L A;  1IP1 A;  4I7N A;  2OEA X;  2KSA A;  4XJI A;  4HTQ A;  4G4B A;  4GCC A;  4NEB A;  3S3C B;  3C7W A;  3CT5 A;  2RBQ A;  2QPD B;  4ZFP A;  3QJS B;  4HP0 A;  3SP3 A;  1L11 A;  1YL0 X;  1JTT L;  3UZC A;  1TN5 A;  1LLH A;  4NFV A;  1HMK A;  156L A;  1L90 A;  1YAO A;  137L A;  1L92 A;  2L6X A;  257L A;  5HNL A;  1S54 A;  3GUI A;  2O79 A;  4WL7 A;  1S8L A;  2BQE A;  4LDO A;  1L65 A;  4N1E I;  3WUN A;  4UG2 A;  3IJV A;  1LYJ A;  4O34 A;  1C3W A;  1C68 A;  3VHZ A;  3UTW A;  4A7D A;  1GB2 A;  3FA0 A;  3ZEK A;  5IDD A;  4WG7 A;  2YCX A;  1SWZ A;  1LZR A;  1C45 A;  2BQF A;  4TL3 A;  215L A;  5AX0 A;  3AW7 A;  110L A;  3AM6 A;  1L08 A;  1RCM A;  1L12 A;  127L A;  1NBY C;  2I20 A;  2HEC A;  2HU1 A;  1G7M C;  198L A;  2B6X A;  1OUI A;  4RW1 A;  2BQN A;  4QEQ A;  1ZWN A;  5M1Y A;  1C66 A;  3VI0 A;  1L03 A;  1T6V L;  1J1X Y;  1SSY A;  1CJ8 A;  1FLU A;  1UIG A;  3CDV A;  3WUM A;  2OTZ X;  1P5C A;  4EMN A;  3K3T A;  2LZM A;  242L A;  258L A;  4CFP A;  2CGI A;  5H2P A;  1B5W A;  1JKD A;  5LVH A;  1L18 A;  1PQK A;  1WQQ A;  4EXM A;  4MCK A;  1B7Q A;  1BRX A;  3HDE A;  1QDR A;  1UIC A;  1QHJ A;  4RDS A;  3AZ5 A;  4WM5 A;  3PDS A;  3WQJ A;  1QTB A;  3OAX A;  4OW1 A;  5L3H A;  5J7C A;  5KKI A;  3AZ4 A;  1OUA A;  4WM2 A;  1LYD A;  1V7S A;  1LGX A;  1LHM A;  3KAM A;  1IP2 A;  1CU2 A;  252L A;  2G87 A;  2PED A;  173L A;  4TX7 A;  3S3D B;  5DYS A;  1VFB C;  5LVI A;  4XJD A;  1PZY A;  2Z19 A;  3GUO A;  2BPU A;  3UG9 A;  1LYH A;  3A94 A;  2J4Y A;  1L16 A;  1G07 A;  1IOT A;  1L54 A;  5H2O A;  163L A;  237L A;  1QKP A;  1XGR C;  2RBN A;  3GUP A;  4WM3 A;  3AZ6 A;  2F2N A;  1S53 A;  3QJT B;  4X1H A;  3WH1 A;  1D2Y A;  3TXJ A;  3TMX A;  2DQA A;  3OK0 A;  1JEF A;  1Z55 A;  4KXI A;  3FI5 A;  4ARQ A;  4LYM A;  2CDS A;  1NKH A;  5FHW A;  1QSQ A;  5I14 A;  3D3D A;  5LAF A;  2ZNX Y;  4XTL A;  140L A;  1L76 A;  2M3G A;  1G0J A;  3OE6 A;  4H93 A;  1UIF A;  1IOR A;  1LMC A;  3VW7 A;  5KXT A;  5LXW A;  2HEA A;  2DQG Y;  4LGK A;  1L02 A;  5I53 A;  2KS9 A;  1LSG A;  4I7S A;  3HT9 A;  1F0W A;  3T36 A;  2OU0 X;  2F2Q A;  1LZE A;  1YKX X;  4H92 A;  3AYM A;  1BWH A;  3ULR A;  5APE A;  2G4N A;  3D4S A;  4KNF A;  2B6Y A;  3WW6 A;  1CNS A;  1GDX A;  1P2C C;  1LSZ A;  1VDQ A;  1CU6 A;  4NC3 A;  115L A;  4MR1 A;  1BB3 A;  1YQV Y;  1IP6 A;  5KXZ A;  206L A;  3ATN A;  4AXT A;  1L58 A;  3C80 A;  4J1A A;  3WUA A;  1GFR A;  111L A;  1JUG A;  1JKA A;  2R4S A;  1HEO A;  4M4O A;  2OE4 X;  1P64 A;  5B1G A;  1HC0 A;  1S52 A;  1IWT A;  1DI5 A;  1L70 A;  4QID A;  1NHB A;  1F10 A;  1BB7 A;  1G0Q A;  1R2N A;  4AMJ A;  5D5F A;  4PJ2 C;  3EH5 B;  1LZ8 A;  2Y03 A;  4NGI A;  1JTN A;  5B05 A;  189L A;  4Z41 A;  1KIR C;  1AM7 A;  1OVH A;  1L63 A;  1Q5J A;  9LYZ A;  2BQG A;  3AW6 A;  1LZD A;  1D3F A;  4LZT A;  1CU5 A;  1L74 A;  1JTM A;  5B6Y A;  254L A;  1F6R A;  1G0P A;  1FDL Y;  3SB7 A;  1OV7 A;  2F93 A;  4NWH A;  201L A;  4DD2 A;  2YBN A;  160L A;  3HFM Y;  4AQN A;  2F32 A;  2ZFE A;  1L56 A;  4PHI A;  1FLW A;  4PRU A;  2BQJ A;  5H2K A;  4KL7 A;  4W54 A;  3E3D A;  5KY1 A;  1IIZ A;  1VJM A;  1C08 C;  1HML A;  180L A;  1DYB A;  1OUC A;  1OYU A;  1P7S A;  4EKP A;  1LZN A;  4Y9H A;  3P64 A;  1L96 A;  5B59 A;  2Z12 A;  1REM A;  1GFU A;  5JJJ A;  3GUK A;  3NY9 A;  3AGG G;  1UAZ A;  3CDT A;  1QS5 A;  1GBW A;  168L A;  2EIZ C;  3ODU A;  1C62 A;  4DD1 A;  4J7V A;  4W51 A;  166L A;  238L A;  1L14 A;  1GUE A;  2Y02 A;  1QSA A;  2ZIY A;  3GXK A;  4HJV A;  4NSI A;  3T45 A;  3LYM A;  1IOQ A;  3A6C Y;  3G3B B;  2ZZL A;  5APC A;  3LZM A;  2ZWB A;  3DN6 A;  3A93 A;  4XJB A;  1W6Z A;  3M18 B;  139L A;  1D3M A;  1L44 A;  4ARP A;  146L A;  1GB5 A;  1FLY A;  1QT4 A;  234L A;  1HHL A;  5KXP A;  5II3 A;  147L A;  1X0K 1;  2Q9E A;  1LMO A;  1I1Z A;  1XEK A;  1BWJ A;  1JIT A;  1L72 A;  5LVG A;  1L66 A;  4N5R A;  3HUQ A;  1IWY A;  4GP8 B;  1GPQ C;  1L52 A;  1ZUR A;  2YCY A;  1GBS A;  1QTH A;  196L A;  2YSS C;  1E12 A;  2Z18 A;  4LFX A;  5LA8 A;  1JTP L;  186L A;  4X31 A;  141L A;  1T3P A;  3OJP A;  1C46 A;  4W58 A;  1GE0 A;  1CV0 A;  4LT0 A;  1VGO A;  1QT5 A;  2IHL A;  3CAP A;  1KW7 A;  1QT8 A;  3NS0 A;  2ZYP A;  1B5X A;  251L A;  3LYZ A;  1B7L A;  174L A;  1KXX A;  2QB0 B;  2RBS A;  3RZE A;  1LAA A;  4J4Q A;  1J1O Y;  1LJJ A;  4TUN A;  2XBR A;  1LTM A;  4I7Q A;  2F95 A;  1TN0 A;  3VWO A;  1LZY A;  2Y00 A;  5DM9 A;  1GE4 A;  4H1P A;  2H9K A;  4HYJ A;  2B7X A;  1GWD A;  1L27 A;  3T6U A;  1C6C A;  3HAP A;  191L A;  1C61 A;  188L A;  1L32 A;  2KSY A;  1L25 A;  5B6V A;  1BHZ A;  1GE2 A;  1D2W A;  2EPE A;  5E9R A;  1D9U A;  1DKJ A;  1G7J C;  5KXN A;  1DZB X;  2B74 A;  5LVJ A;  4B4I A;  3ZVQ A;  1FBI X;  1L33 A;  2Q0M X;  1YAN A;  2YBJ A;  1KIQ C;  4NY5 A;  2RAZ X;  4K5Y A;  4PRQ A;  1IWU A;  1LJE A;  3B6L A;  1KGB A;  6LYZ A;  4IJ4 A;  3OE0 A;  1G06 A;  1ZMY L;  1IWX A;  2MEH A;  222L A;  208L A;  3W6F A;  2YBI A;  1L62 A;  4BAD A;  1C6A A;  1TBY A;  2G4P A;  4AGA A;  1C6I A;  4XTN A;  4EPF A;  4LYB A;  1CKF A;  2RSC A;  3G3A B;  1HEL A;  5F9U A;  1BQL Y;  1GF3 A;  5AWZ A;  4YF2 A;  4GBR A;  187L A;  3UON A;  3RFM A;  5AX1 A;  1L37 A;  167L A;  1B5U A;  3A96 A;  2LYZ A;  5E4P A;  5I4W A;  3QBG A;  4DQ7 A;  1C6N A;  1L04 A;  2HTX A;  3DMZ A;  1B5Y A;  1L17 A;  1LWK A;  5H2L A;  4I7P A;  171L A;  4EJ4 A;  1T8G A;  1YKZ X;  1P6Y A;  3C83 A;  1LZ6 A;  1C6F A;  1GFV A;  112L A;  103L A;  2B75 A;  3WXT A;  3GUM A;  1BM1 A;  1KY0 A;  3QBK A;  4LT2 A;  1DYG A;  1BB4 A;  248L A;  4N1C C;  3WVX A;  4W52 A;  155L A;  1IR8 A;  2W1Y A;  4RLM A;  1DKK A;  3AZ7 A;  1I6S A;  4HSF A;  104L A;  1H6M A;  1UAC Y;  4PK0 A;  1LZ9 A;  4YEM A;  5FDJ A;  1LJI A;  2XQO A;  2YBL A;  4LYZ A;  230L A;  3HAS A;  1QUD A;  1L45 A;  3A67 Y;  1IWW A;  4NGJ A;  5HMJ A;  4JKV A;  3G3X A;  5FJG A;  4FJR A;  1GBO A;  1PQJ A;  2VT4 A;  1G0G A;  4NGZ A;  7LZM A;  1L20 A;  5LA5 A;  1QS9 A;  3VG9 A;  3TXF A;  1UC0 A;  4NG8 A;  3ABW A;  225L A;  4BEZ A;  4WLD A;  4H9E A;  1NHE A;  4H91 A;  114L A;  3EO5 A;  5B34 A;  239L A;  1QSW A;  3NYA A;  1WVV A;  3DN3 A;  1FLQ A;  4GCE A;  4ARM A;  4QI1 A;  1GXV 2;  4FDY A;  5B06 A;  3LYO A;  228L A;  2MED A;  4YXA C;  2Z2F A;  5G36 A;  1KS3 A;  2WJL A;  3HAR A;  1OUB A;  4QRY A;  3DN2 A;  1FKV A;  1D6P A;  1GAY A;  220L A;  3P4Z A;  1DI4 A;  2DQF C;  194L A;  1IEE A;  1F4Z A;  4FA7 B;  2BQO A;  3DN0 A;  3HBD A;  2AT9 A;  1Q5I A;  3RZ4 A;  3UTV A;  1G0L A;  4G49 A;  3AYN A;  4QDN A;  2KSB A;  4H8Z A;  190L A;  4G70 B;  6LZM A;  3HTD A;  1RE2 A;  1PY6 A;  3F9L A;  2F30 A;  4LT3 A;  1H68 A;  3EML A;  4N8Z A;  1YL1 X;  1L42 A;  170L A;  1DXJ A;  4G9S A;  2DQJ Y;  1AKI A;  1YIL A;  197L A;  2I21 A;  1OV5 A;  3MGW A;  4P2E A;  5F8U A;  3DN8 A;  1L67 A;  1KG9 A;  3P68 A;  1NDG C;  3N9E A;  4I7K A;  3WPK A;  232L A;  192L A;  1XEJ A;  4GN4 A;  5A3E A;  1QDT A;  1LYZ A;  4DYG A;  6LYT A;  1N4F A;  2XBS A;  4GP5 B;  1B5V A;  2D4K A;  3V2Y A;  1CU0 A;  2I26 L;  4NHQ A;  1L48 A;  2LZT A;  1INU A;  1LSC A;  3UZA A;  2MEI A;  1CV4 A;  4NGK A;  3F6Z A;  1HEQ A;  2ZIJ A;  1YIK A;  3G3V A;  3GUL A;  5DHG A;  210L A;  5ETZ A;  4EIY A;  2DKV A;  3W6C A;  4PPO A;  4G7Q B;  1L39 A;  4D9Z A;  3L64 A;  4OWA A;  4PXK A;  3KJ6 A;  1L81 A;  4NSH A;  4DKL A;  4NG1 A;  5DN5 A;  260L A;  4WOA A;  3DMX A;  1B7O A;  1IP7 A;  4LZM A;  3WXU A;  133L A;  1GBX A;  1YAP A;  126L A;  3HH3 A;  1LYG A;  4G4C A;  4XT1 A;  4YXC A;  2C8P A;  1GB9 A;  1LMQ A;  1LI3 A;  2RBO A;  1C67 A;  1EQ4 A;  1LYF A;  1BWI A;  1L30 A;  2XJW A;  3WUL A;  4B4E A;  4CFO A;  4DD3 A;  177L A;  3RUN A;  2YCW A;  1C6K A;  164L A;  1GF0 A;  1P3N A;  2HEF A;  4H9A A;  1C6L A;  1WQO A;  2D4J A;  4GLV A;  4DDC A;  3PXO A;  4UWV A;  3HH4 A;  2MEG A;  4LDL A;  3C82 A;  3HUK A;  172L A;  3B0I A;  4N4W A;  1LZ5 A;  2EQL A;  4ET8 A;  5I54 A;  1HZX A;  1O23 A;  1VDT A;  5J7A A;  2BQD A;  5G54 A;  4NHS A;  1L61 A;  1L53 A;  2YBM A;  4AMI A;  4Z98 A;  1GF7 A;  3UTX A;  1L99 A;  1OUH A;  185L A;  4I7R A;  1LYY A;  1LSN A;  4ARQ B;  120L A;  4HV1 A;  2ZIK A;  3HBE X;  4II8 A;  4H9H A;  1KME A;  1LSA A;  218L A;  4XYY A;  3UTY A;  4TWS A;  3HH6 A;  128L A;  3EXD A;  1LSM A;  1J1P Y;  3WVY A;  1CUQ A;  3PWH A;  1L22 A;  1BGI A;  3COD A;  5LYT A;  4CGE A;  3F8V A;  3M3U A;  1L79 A;  4WMG A;  4XJF A;  2F4G A;  3WU7 A;  1IWV A;  1OUE A;  1NBZ C;  4HTK A;  2Y04 A;  2B73 A;  1UIA A;  4H94 A;  151L A;  5AZD A;  3QAP A;  4IAQ A;  2GV0 A;  2ZQ4 A;  3N9C A;  211L A;  1GZM A;  1KY1 A;  1IR7 A;  3HTG A;  4B49 A;  102L A;  2YCZ A;  5KXW A;  169L A;  1IW6 A;  4OWB A;  2FYD A;  1C60 A;  2HUK A;  150L A;  3HU9 A;  1L05 A;  2XTH A;  1C6Q A;  4IAR A;  4Z3M A;  1LKS A;  3C8Q A;  1KXW A;  5DL9 A;  2X0A A;  5KXM A;  3AYQ A;  1QUH A;  1IVM A;  123L A;  1OWZ A;  2Y8P A;  161L A;  2MEC A;  3DNA A;  1LJ4 A;  1VAU A;  3DMV A;  1F88 A;  1OP9 B;  4NGY A;  1K28 A;  4ETA A;  3A7K A;  247L A;  4L41 A;  3QBI A;  5LWE A;  1L21 A;  1NMM A;  3A34 A;  1C63 A;  1LYS A;  3VGA A;  1XEI A;  1T97 A;  1LSB A;  1QUS A;  4NSJ A;  249L A;  5IHG A;  193L A;  4B4J A;  2OU9 A;  1LZS A;  3QJR B;  1L75 A;  3ZPQ A;  1OUD A;  1SLY A;  2LCB A;  4ZEE A;  2I6Z A;  1IOS A;  4W57 A;  1LCN A;  1L07 A;  2FBD A;  2B72 A;  3QE8 A;  5I4X A;  243L A;  195L A;  1PQD A;  1HNL A;  4S0W A;  1XGP C;  1B7N A;  4N9R A;  2BQK A;  1OQM A;  1L13 A;  3CDO A;  3S3B B;  2FBB A;  4J1B A;  1C6B A;  3G3W A;  4B1A A;  4YEN A;  1L24 A;  3OE9 A;  229L A;  1X0S A;  1LJG A;  3TXK A;  2RH1 A;  2I25 L;  2Z55 A;  5DN4 A;  3WPJ A;  1GFK A;  2DQI Y;  1I20 A;  235L A;  1IY4 A;  1G0K A;  1OVJ A;  2MEF A;  125L A;  1HEW A;  4NGV A;  4W94 A;  5ITC A;  1IWZ A;  1TAY A;  5LIO A;  1L85 A;  1LYE A;  3WYH A;  1PQI A;  5A44 A;  1BVX A;  3A95 A;  1T8F A;  3HUA A;  5A3Z A;  245L A;  5C1M A;  1NDM C;  1X0I 1;  4HPE A;  1GB0 A;  4N6H A;  1AZF A;  1YAM A;  1SSW A;  3EBA B;  4YOP A;  1IC4 Y;  2HU3 A;  1NWG A;  4W56 A;  4U3X B;  1LZ4 A;  3LYT A;  1WQR A;  2LYO A;  1GDW A;  4WL6 A;  3LZ2 A;  1LHI A;  3P66 A;  1L68 A;  1JJ3 A;  1P2R A;  1LZG A;  1GF4 A;  5T3F A;  8LYZ A;  2PC2 A;  4ANR A;  1G1W A;  158L A;  5KXR A;  1HEN A;  1L46 A;  3HBH A;  1ZV5 L;  2Z6B A;  108L A;  2HUB A;  3CB7 A;  1H87 A;  1GF8 A;  4BAF A;  119L A;  1REZ A;  3WU8 A;  1L71 A;  5B0W A;  4DD7 A;  4GP4 B;  3B0O A;  5JEN B;  3N9A A;  1UCO A;  4DAJ A;  3ATO A;  4LFP A;  3S8F B;  1JIY A;  1B2K A;  1NQI A;  5B2N A;  4ETE A;  1LMA A;  4BUO A;  3CSR A;  5HNC A;  1IY3 A;  4GCF A;  4I7M A;  5BR2 A;  4GN3 A;  1E0P A;  1BB6 A;  1KG8 A;  4NGO A;  113L A;  1HF4 A;  3QNG A;  1UA6 Y;  4GCD A;  1LSP A;  4GPO A;  1LPY A;  1TDY A;  4GN5 C;  1CX6 A;  4CJ2 A;  3ZVQ B;  3SB5 A;  5H2M A;  4FAA B;  3P0G A;  1LGW A;  4TTD A;  2Y01 A;  5EBH A;  4I7L A;  4DD9 A;  4ZIX A;  1CUP A;  3AB6 A;  1L95 A;  1C6T A;  2IFF Y;  4XT3 A;  153L A;  246L A;  2B6T A;  1L0J A;  1L43 A;  1L60 A;  1A4V A;  3A6B Y;  2BRD A;  1C6M A;  1B9O A;  4LDE A;  1CV1 A;  5LIN A;  1LZT A;  2ANV A;  3HWL A;  134L A;  261L A;  2RB1 X;  4BWB A;  3NY8 A;  2YDG A;  4XN6 A;  3SBB C;  4GBR B;  1CU3 A;  4OWC A;  4BS7 A;  1T8A A;  1T6H A;  1EPY A;  1KW5 A;  1QT6 A;  2HEE A;  4KPM A;  4M6D A;  1GFG A;  1DYD A;  5HMV A;  4C5F A;  4WO6 A;  1TCY A;  159L A;  1G7L C;  2BAA A;  4WLT A;  1CX7 A;  3JR6 A;  3A3Q A;  3QJU B;  1JV7 A;  5JJE A;  4EKQ A;  1D6Q A;  5F81 A;  4OO9 A;  4XEN A;  3EMS A;  2LC9 A;  3BVD B;  199L A;  3C9L A;  1ZVY B;  3CSQ A;  2ANX A;  4UWN A;  214L A;  4RLN A;  184L A;  3HT7 A;  4I7O A;  1PXR A;  1V7T A;  2JAG A;  1L88 A;  1BB5 A;  4NGW A;  2H5Z A;  3QAK A;  4ETB A;  4ML7 A;  2D4I A;  3X3B A;  3DN1 A;  3HTF A;  1DZE A;  1L51 A;  1GFT A;  1IW9 A;  2RBR A;  1L00 A;  1FKQ A;  3AJN A;  1JSE A;  3W6B A;  1M0M A;  1C69 A;  1KNI A;  5FST A;  3J4G A;  4OOO A;  2B5Z A;  4B0D A;  4H9F A;  4J0L A;  4QGZ A;  3W6D A;  5KXY A;  5F16 A;  1B6I A;  143L A;  3SBA A;  2VB1 A;  1C43 A;  1GBY A;  5KXO A;  4W53 A;  145L A;  3HDF A;  3TMU A;  1L10 A;  2BQI A;  5TGZ A;  4ET9 A;  4E3U A;  1UCQ A;  4HJY A;  4ARM B;  3HH5 A;  4DS7 E;  4WLX A;  1JPO A;  4TSC A;  3SN6 R;  1VED A;  3C7Y A;  2I1X A;  1QTK A;  5A8E A;  5FEK A;  1BRR A;  1D0L A;  1L55 A;  1CKC A;  5H2N A;  1C6H A;  259L A;  3QJV B;  1REY A;  1AT9 A;  1QTC A;  4MST A;  1NF5 A;  2MEB A;  3A3R X;  223L A;  1KIP C;  3BKH A;  5F9X A;  4NHP A;  1WQN A;  2HUM A;  3SB8 A;  5APF A;  142L A;  5ILC A;  2NTG A;  4BEY A;  1JKC A;  4OWE A;  1UUZ C;  2BQA A;  1L93 A;  2ZYC A;  5KXK A;  1LSD A;  4FBZ A;  1C65 A;  1QT3 A;  2NWD X;  130L A;  1CV3 A;  1LMP A;  3B72 A;  4E97 A;  2CWI A;  1EL1 A;  1C7P A;  1ALC A;  4I7T A;  132L A;  1L86 A;  2RAY X;  4NHT A;  1LJK A;  3TXI A;  1LKR A;  1XFP L;  4G7R B;  1P37 A;  2L78 A;  1LZA A;  1L97 A;  1RFP A;  5B07 A;  3DQB A;  2MEE A;  1L9H A;  4NWE A;  3ZPR A;  4QY9 A;  1GXX A;  4L6R A;  4IAS A;  4FPD A;  236L A;  4W96 A;  1CJ6 A;  2YBH A;  1DQJ C;  4N0J A;  1GB6 A;  1SX2 A;  1IO5 A;  1IC7 Y;  4NIJ A;  219L A;  5A45 A;  2LZ2 A;  1EHK B;  5AHY A;  144L A;  1L47 A;  3LZT A;  2A7F A;  1LZC A;  1DYC A;  2NTH A;  4OV0 A;  2N5Z A;  5KXX A;  3HT6 A;  4MBS A;  221L A;  1JTO L;  4LYO A;  1D3N A;  253L A;  3QBL A;  5KKH A;  1MLC E;  1L57 A;  4DC4 A;  1GHL A;  2W1X A;  4R6C A;  2OU8 A;  205L A;  4CHX A;  256L A;  3EH3 B;  1JSF A;  5JJN A;  2O4W A;  1IP5 A;  2O7A A;  3OE8 A;  5LYM A;  1G7I C;  5HLL A;  2D6B A;  4WG1 A;  1CWQ A;  3QJQ B;  1GB3 A;  1L98 A;  3LN2 A;  3A8Z A;  212L A;  1XIO A;  2DQH Y;  1C6E A;  3TXB A;  1LHK A;  1EQ5 A;  2C8O A;  3DKE X;  213L A;  1PQM A;  1L84 A;  2WAR A;  1BRD A;  5LYZ A;  226L A;  4DDB A;  3SB6 A;  1L64 A;  1LJF A;  1WQP A;  1C8S A;  1L29 A;  240L A;  1UIB A;  1LHJ A;  1CKH A;  1OUG A;  2JAF A;  4H90 A;  2OE7 X;  3VVK A;  1XGQ C;  4X3B A;  1C6P A;  149L A;  107L A;  3CSZ A;  4XJG A;  4BAP A;  1B5Z A;  4UWU A;  1B7S A;  3V2W A;  216L A;  1W08 A;  2B6Z A;  3AGI A;  4W55 A;  1UIE A;  3B0K A;  4LYC A;  1JJ1 A;  1WTH A;  1D0K A;  2BQL A;  2Z38 A;  2ZIL A;  1WQM A;  1DYF A;  2RB2 X;  1SQ2 L;  1CJ9 A;  2CJL A;  162L A;  1GEZ A;  1TEW A;  4IB4 A;  157L A;  3PBL A;  1O0A A;  1TLA A;  1L31 A;  3TMV A;  244L A;  4XTO A;  1QUT A;  5G2C A;  1HSX A;  1LHL A;  1XGU C;  5ITE A;  2DQE Y;  4GRV A;  4LT1 A;  1LW9 A;  3ZEV A;  1GBZ A;  4JQ6 A;  5L9J A;  1L01 A;  1L34 A;  4I0C A;  1F50 A;  1IP3 A;  3CDQ A;  4EOF A;  1DPW A;  5HQ1 A;  4ETD A;  1P46 A;  4JR8 A;  5KXS A;  1CV6 A;  5C6L A;  4HWL A;  224L A;  3J6K A;  4GCB A;  1JGJ A;  5KJ9 A;  1UID A;  2QAR C;  3FE0 A;  3TXE A;  5LVK A;  7LYZ A;  2HPY A;  109L A;  5G28 A;  1L50 A;  1GFH A;  5LAG A;  4PXF A;  1QUG A;  4I8S A;  1GF6 A;  1UIH A;  4MQT A;  3C7Z A;  1L77 A;  1L35 A;  2I35 A;  4IAT A;  1YRO A;  1IC5 Y;  3HAQ A;  5KXL A;  1GFJ A;  1SWY A;  1M0K A;  5K7O A;  2YDV A;  5C6J A;  3W6E A;  1LMT A;  5DLA A;  4G7S B;  4DWX A;  1C6G A;  1HEP A;  1S8J A;  1LSF A;  3WU9 A;  4H8X A;  1A2Y C;  241L A;  1CV5 A;  5F14 A;  3LHM A;  131L A;  1JKB A;  262L A;  4HYX A;  5H2H A;  1GD6 A;  1CKG A;  2DQC Y;  1XME B;  1CVK A;  1L09 A;  2FYC A;  5FCP A;  4NSG A;  3AGH A;  3WMK A;  1G7H C;  3TXD A;  1RJC B;  1LYI A;  1FN5 A;  3A91 A;  1CTW A;  4HJZ A;  4A4M A;  5I4Y A;  5G2A A;  2W1M A;  1L59 A;  4HV2 A;  1R84 A;  4LYT A;  1AP9 A;  1LJN A;  2RBP A;  1GAZ A;  1L80 A;  3WW5 A;  5IEL A;  3C8S A;  1LJH A;  2H9J A;  1ZVH L;  1M0L A;  2YVB A;  4G72 B;  5B6W A;  3L2X A;  1L19 A;  1SX7 A;  1FBK A;  5DHH A;  4XJH A;  4KT3 A;  4WM6 A;  5D5C A;  4N4Y B;  3DDL A;  3HT8 A;  1G0M A;  4DQ5 A;  1B7P A;  1LJ3 A;  3HAO A;  3S8G B;  1JWR A;  209L A;  4UHR A;  1WTN A;  4GLA A;  5EN0 A;  3COC A;  1QUO A;  1LI2 A;  4PJZ A;  3C81 A;  2LHM A;  5FEL A;  1IR9 A;  4YX7 C;  1UBZ A;  3IWR A;  1JQU A;  1JFP A;  1HEM A;  2HEB A;  1REX A;  2LYM A;  1S51 A;  4ARL A;  1CJ7 A;  2BQM A;  2W1L A;  2Z37 A;  1D9W A;  5C6I A;  1DYA A;  4MD1 A;  4BV0 A;  3MBV A;  1LGU A;  1LHH A;  1LZ1 A;  1RI8 B;  1AT6 A;  1QIO A;  3QDC A;  1LWG A;  3HTB A;  2DQD Y;  1GB8 A;  4ETC A;  5I5Q A;  1L41 A;  1P8H A;  181L A;  1L06 A;  1PXS A;  250L A;  3IJU A;  5AMY A;  2YDO A;  2F47 A;  1QSB A;  1JHL A;  3PQR A;  1L28 A;  4YM8 A;  1HFX A;  4IAP A;  1OUJ A;  2BQC A;  1LYO A;  1IOC A;  1B7R A;  1QT7 A;  2OE9 X;  2CUU A;  135L A;  129L A;  2HUL A;  1PQO A;  1L82 A;  4DDA A;  2X72 A;  4KLY A;  4W59 A;  1L0M A;  2LNL A;  1XJI A;  3A90 A;  3WL2 A;  4ZPU A;  4C3W A;  182L A;  5B1F A;  2AUB A;  3BKV A;  1QQY A;  1C6D A;  3RNX A;  4HTN A;  1GB7 A;  1XJU A;  2BQH A;  4GYC A;  4G4H A;  1C8R A;  2EI4 A;  1WTM A;  4WM1 A;  175L A;  2Z2E A;  4H9I A;  1L87 A;  3QY4 A;  1LZB A;  3GXR A;  1VAT A;  2NTU A;  4MD2 A;  178L A;  5BR5 A;  3P65 A;  5ILF A;  1IP4 A;  122L A;  3W3E A;  4DQJ A;  1LMN A;  1FBB A;  1CKD A;  165L A;  5B6Z A;  4WM4 A;  2HED A;  1L38 A;  1P8U A;  1YAQ A;  5G53 A;  1GF5 A;  4NGL A;  1P36 A;  1L15 A;  4MQS A;  1L26 A;  1GF9 A;  1DPX A;  2D91 A;  1LPI A;  4HPI A;  4RW2 A;  4X32 A;  1DI3 A;  1JV6 A;  3FI7 A;  3TXG A;  1C10 A;  5LZM A;  152L A;  3EH4 B;  1D3J A;  200L A;  2B6W A;  3CT0 A;  2B70 A;  1OVK A;  231L A;  1L36 A;  5B35 A;  2A7D A;  4BVN A;  148L E;  1QTD A;  183L A;  3FAD A;  2Z39 A;  2BLY A;  3CDR A;  4DD0 A;  3TXH A;  4WW3 A;  1WVU A; 
#chains in the Genus database with same CATH homology
 4Z46 A;  2EKS C;  2Q9D A;  4G71 B;  3GUJ A;  3NSB A;  1AT5 A;  1L94 A;  1L40 A;  1HSW A;  1P8I A;  1GE1 A;  1LOZ A;  1L23 A;  1QM8 A;  3C9M A;  5G2D A;  154L A;  2WJK A;  3HU8 A;  4EKR A;  1OUF A;  255L A;  1L49 A;  3K2R A;  4EA3 A;  1ZYT A;  1MEL L;  1YKY X;  1HFZ A;  2A4T A;  1L73 A;  1OWY A;  4WAV A;  1P2L A;  227L A;  4H9C A;  1IXF A;  2ZQ3 A;  1MGY A;  217L A;  1I56 A;  1E8L A;  1L69 A;  233L A;  3CT1 A;  3RW8 A;  1GE3 A;  1VDS A;  3CQL A;  4NHI A;  2MEA A;  4WLY A;  2QPE B;  1C6J A;  1IX0 A;  1B0D A;  5H2I A;  4WO9 A;  5AHZ A;  4DT3 A;  1QTZ A;  2ZNW Y;  5H2J A;  1C64 A;  3A92 A;  3WPL A;  4R0F A;  1QKO A;  1JJ0 A;  1P56 A;  4EPI A;  2BQB A;  3C8R A;  5APD A;  4OWH A;  3RT5 X;  4PGJ B;  4TSB A;  118L A;  1JIS A;  1BVK C;  1G1V A;  3D9A C;  4L35 A;  4XXJ A;  1EQE A;  3GUN A;  4OOT A;  1L91 A;  1KXY A;  5KKJ A;  138L A;  1LSE A;  1VDP A;  1XEP A;  3HAN A;  176L A;  3TMW A;  1LN6 A;  3RU5 A;  2OTY X;  2IGC A;  1HER A;  2DBT A;  1GEV A;  1F6S A;  3SB9 A;  1QTV A;  4H8Y A;  1L0K A;  4DJH A;  1XSF A;  1GFA A;  1B7M A;  1LSY A;  2F4A A;  2Z73 A;  1XGT C;  5B6X A;  4ARJ A;  2R4R A;  4EKS A;  1GFE A;  3DN4 A;  4XAD A;  1DYE A;  1U19 A;  1PS5 A;  2RB0 X;  1QTE A;  2NTW A;  1LI6 A;  1XJT A;  5L3I A;  1GU8 A;  3X3C A;  4I7J A;  1D0M A;  1HFY A;  4H9B A;  1H2S A;  1L89 A;  2BLX A;  3W6A A;  1L83 A;  4YEO A;  3REY A;  2G4Q A;  207L A;  1IP1 A;  4I7N A;  2OEA X;  2KSA A;  4XJI A;  4HTQ A;  4G4B A;  4GCC A;  4NEB A;  3S3C B;  3C7W A;  3CT5 A;  2RBQ A;  2QPD B;  4ZFP A;  3QJS B;  4HP0 A;  3SP3 A;  1L11 A;  1YL0 X;  1JTT L;  3UZC A;  1TN5 A;  1LLH A;  4NFV A;  1HMK A;  156L A;  1L90 A;  1YAO A;  137L A;  1L92 A;  2L6X A;  257L A;  5HNL A;  1S54 A;  3GUI A;  2O79 A;  4WL7 A;  1S8L A;  2BQE A;  4LDO A;  1L65 A;  4N1E I;  3WUN A;  4UG2 A;  3IJV A;  1LYJ A;  4O34 A;  1C3W A;  1C68 A;  3VHZ A;  3UTW A;  4A7D A;  1GB2 A;  3FA0 A;  3ZEK A;  5IDD A;  4WG7 A;  2YCX A;  1SWZ A;  1LZR A;  1C45 A;  2BQF A;  4TL3 A;  215L A;  5AX0 A;  3AW7 A;  110L A;  3AM6 A;  1L08 A;  1RCM A;  1L12 A;  127L A;  1NBY C;  2I20 A;  2HEC A;  2HU1 A;  1G7M C;  198L A;  2B6X A;  1OUI A;  4RW1 A;  2BQN A;  4QEQ A;  1ZWN A;  5M1Y A;  1C66 A;  3VI0 A;  1L03 A;  1T6V L;  1J1X Y;  1SSY A;  1CJ8 A;  1FLU A;  1UIG A;  3CDV A;  3WUM A;  2OTZ X;  1P5C A;  4EMN A;  3K3T A;  2LZM A;  242L A;  258L A;  4CFP A;  2CGI A;  5H2P A;  1B5W A;  1JKD A;  5LVH A;  1L18 A;  1PQK A;  1WQQ A;  4EXM A;  4MCK A;  1B7Q A;  1BRX A;  3HDE A;  1QDR A;  1UIC A;  1QHJ A;  4RDS A;  3AZ5 A;  4WM5 A;  3PDS A;  3WQJ A;  1QTB A;  3OAX A;  4OW1 A;  5L3H A;  5J7C A;  5KKI A;  3AZ4 A;  1OUA A;  4WM2 A;  1LYD A;  1V7S A;  1LGX A;  1LHM A;  3KAM A;  1IP2 A;  1CU2 A;  252L A;  2G87 A;  2PED A;  173L A;  4TX7 A;  3S3D B;  5DYS A;  1VFB C;  5LVI A;  4XJD A;  1PZY A;  2Z19 A;  3GUO A;  2BPU A;  3UG9 A;  1LYH A;  3A94 A;  2J4Y A;  1L16 A;  1G07 A;  1IOT A;  1L54 A;  5H2O A;  163L A;  237L A;  1QKP A;  1XGR C;  2RBN A;  3GUP A;  4WM3 A;  3AZ6 A;  2F2N A;  1S53 A;  3QJT B;  4X1H A;  3WH1 A;  1D2Y A;  3TXJ A;  3TMX A;  2DQA A;  3OK0 A;  1JEF A;  1Z55 A;  4KXI A;  3FI5 A;  4ARQ A;  4LYM A;  2CDS A;  1NKH A;  5FHW A;  1QSQ A;  5I14 A;  3D3D A;  5LAF A;  2ZNX Y;  4XTL A;  140L A;  1L76 A;  2M3G A;  1G0J A;  3OE6 A;  4H93 A;  1UIF A;  1IOR A;  1LMC A;  3VW7 A;  5KXT A;  5LXW A;  2HEA A;  2DQG Y;  4LGK A;  1L02 A;  5I53 A;  2KS9 A;  1LSG A;  4I7S A;  3HT9 A;  1F0W A;  3T36 A;  2OU0 X;  2F2Q A;  1LZE A;  1YKX X;  4H92 A;  3AYM A;  1BWH A;  3ULR A;  5APE A;  2G4N A;  3D4S A;  4KNF A;  2B6Y A;  3WW6 A;  1CNS A;  1GDX A;  1P2C C;  1LSZ A;  1VDQ A;  1CU6 A;  4NC3 A;  115L A;  4MR1 A;  1BB3 A;  1YQV Y;  1IP6 A;  5KXZ A;  206L A;  3ATN A;  4AXT A;  1L58 A;  3C80 A;  4J1A A;  3WUA A;  1GFR A;  111L A;  1JUG A;  1JKA A;  2R4S A;  1HEO A;  4M4O A;  2OE4 X;  1P64 A;  5B1G A;  1HC0 A;  1S52 A;  1IWT A;  1DI5 A;  1L70 A;  4QID A;  1NHB A;  1F10 A;  1BB7 A;  1G0Q A;  1R2N A;  4AMJ A;  5D5F A;  4PJ2 C;  3EH5 B;  1LZ8 A;  2Y03 A;  4NGI A;  1JTN A;  5B05 A;  189L A;  4Z41 A;  1KIR C;  1AM7 A;  1OVH A;  1L63 A;  1Q5J A;  9LYZ A;  2BQG A;  3AW6 A;  1LZD A;  1D3F A;  4LZT A;  1CU5 A;  1L74 A;  1JTM A;  5B6Y A;  254L A;  1F6R A;  1G0P A;  1FDL Y;  3SB7 A;  1OV7 A;  2F93 A;  4NWH A;  201L A;  4DD2 A;  2YBN A;  160L A;  3HFM Y;  4AQN A;  2F32 A;  2ZFE A;  1L56 A;  4PHI A;  1FLW A;  4PRU A;  2BQJ A;  5H2K A;  4KL7 A;  4W54 A;  3E3D A;  5KY1 A;  1IIZ A;  1VJM A;  1C08 C;  1HML A;  180L A;  1DYB A;  1OUC A;  1OYU A;  1P7S A;  4EKP A;  1LZN A;  4Y9H A;  3P64 A;  1L96 A;  5B59 A;  2Z12 A;  1REM A;  1GFU A;  5JJJ A;  3GUK A;  3NY9 A;  3AGG G;  1UAZ A;  3CDT A;  1QS5 A;  1GBW A;  168L A;  2EIZ C;  3ODU A;  1C62 A;  4DD1 A;  4J7V A;  4W51 A;  166L A;  238L A;  1L14 A;  1GUE A;  2Y02 A;  1QSA A;  2ZIY A;  3GXK A;  4HJV A;  4NSI A;  3T45 A;  3LYM A;  1IOQ A;  3A6C Y;  3G3B B;  2ZZL A;  5APC A;  3LZM A;  2ZWB A;  3DN6 A;  3A93 A;  4XJB A;  1W6Z A;  3M18 B;  139L A;  1D3M A;  1L44 A;  4ARP A;  146L A;  1GB5 A;  1FLY A;  1QT4 A;  234L A;  1HHL A;  5KXP A;  5II3 A;  147L A;  1X0K 1;  2Q9E A;  1LMO A;  1I1Z A;  1XEK A;  1BWJ A;  1JIT A;  1L72 A;  5LVG A;  1L66 A;  4N5R A;  3HUQ A;  1IWY A;  4GP8 B;  1GPQ C;  1L52 A;  1ZUR A;  2YCY A;  1GBS A;  1QTH A;  196L A;  2YSS C;  1E12 A;  2Z18 A;  4LFX A;  5LA8 A;  1JTP L;  186L A;  4X31 A;  141L A;  1T3P A;  3OJP A;  1C46 A;  4W58 A;  1GE0 A;  1CV0 A;  4LT0 A;  1VGO A;  1QT5 A;  2IHL A;  3CAP A;  1KW7 A;  1QT8 A;  3NS0 A;  2ZYP A;  1B5X A;  251L A;  3LYZ A;  1B7L A;  174L A;  1KXX A;  2QB0 B;  2RBS A;  3RZE A;  1LAA A;  4J4Q A;  1J1O Y;  1LJJ A;  4TUN A;  2XBR A;  1LTM A;  4I7Q A;  2F95 A;  1TN0 A;  3VWO A;  1LZY A;  2Y00 A;  5DM9 A;  1GE4 A;  4H1P A;  2H9K A;  4HYJ A;  2B7X A;  1GWD A;  1L27 A;  3T6U A;  1C6C A;  3HAP A;  191L A;  1C61 A;  188L A;  1L32 A;  2KSY A;  1L25 A;  5B6V A;  1BHZ A;  1GE2 A;  1D2W A;  2EPE A;  5E9R A;  1D9U A;  1DKJ A;  1G7J C;  5KXN A;  1DZB X;  2B74 A;  5LVJ A;  4B4I A;  3ZVQ A;  1FBI X;  1L33 A;  2Q0M X;  1YAN A;  2YBJ A;  1KIQ C;  4NY5 A;  2RAZ X;  4K5Y A;  4PRQ A;  1IWU A;  1LJE A;  3B6L A;  1KGB A;  6LYZ A;  4IJ4 A;  3OE0 A;  1G06 A;  1ZMY L;  1IWX A;  2MEH A;  222L A;  208L A;  3W6F A;  2YBI A;  1L62 A;  4BAD A;  1C6A A;  1TBY A;  2G4P A;  4AGA A;  1C6I A;  4XTN A;  4EPF A;  4LYB A;  1CKF A;  2RSC A;  3G3A B;  1HEL A;  5F9U A;  1BQL Y;  1GF3 A;  5AWZ A;  4YF2 A;  4GBR A;  187L A;  3UON A;  3RFM A;  5AX1 A;  1L37 A;  167L A;  1B5U A;  3A96 A;  2LYZ A;  5E4P A;  5I4W A;  3QBG A;  4DQ7 A;  1C6N A;  1L04 A;  2HTX A;  3DMZ A;  1B5Y A;  1L17 A;  1LWK A;  5H2L A;  4I7P A;  171L A;  4EJ4 A;  1T8G A;  1YKZ X;  1P6Y A;  3C83 A;  1LZ6 A;  1C6F A;  1GFV A;  112L A;  103L A;  2B75 A;  3WXT A;  3GUM A;  1BM1 A;  1KY0 A;  3QBK A;  4LT2 A;  1DYG A;  1BB4 A;  248L A;  4N1C C;  3WVX A;  4W52 A;  155L A;  1IR8 A;  2W1Y A;  4RLM A;  1DKK A;  3AZ7 A;  1I6S A;  4HSF A;  104L A;  1H6M A;  1UAC Y;  4PK0 A;  1LZ9 A;  4YEM A;  5FDJ A;  1LJI A;  2XQO A;  2YBL A;  4LYZ A;  230L A;  3HAS A;  1QUD A;  1L45 A;  3A67 Y;  1IWW A;  4NGJ A;  5HMJ A;  4JKV A;  3G3X A;  5FJG A;  4FJR A;  1GBO A;  1PQJ A;  2VT4 A;  1G0G A;  4NGZ A;  7LZM A;  1L20 A;  5LA5 A;  1QS9 A;  3VG9 A;  3TXF A;  1UC0 A;  4NG8 A;  3ABW A;  225L A;  4BEZ A;  4WLD A;  4H9E A;  1NHE A;  4H91 A;  114L A;  3EO5 A;  5B34 A;  239L A;  1QSW A;  3NYA A;  1WVV A;  3DN3 A;  1FLQ A;  4GCE A;  4ARM A;  4QI1 A;  1GXV 2;  4FDY A;  5B06 A;  3LYO A;  228L A;  2MED A;  4YXA C;  2Z2F A;  5G36 A;  1KS3 A;  2WJL A;  3HAR A;  1OUB A;  4QRY A;  3DN2 A;  1FKV A;  1D6P A;  1GAY A;  220L A;  3P4Z A;  1DI4 A;  2DQF C;  194L A;  1IEE A;  1F4Z A;  4FA7 B;  2BQO A;  3DN0 A;  3HBD A;  2AT9 A;  1Q5I A;  3RZ4 A;  3UTV A;  1G0L A;  4G49 A;  3AYN A;  4QDN A;  2KSB A;  4H8Z A;  190L A;  4G70 B;  6LZM A;  3HTD A;  1RE2 A;  1PY6 A;  3F9L A;  2F30 A;  4LT3 A;  1H68 A;  3EML A;  4N8Z A;  1YL1 X;  1L42 A;  170L A;  1DXJ A;  4G9S A;  2DQJ Y;  1AKI A;  1YIL A;  197L A;  2I21 A;  1OV5 A;  3MGW A;  4P2E A;  5F8U A;  3DN8 A;  1L67 A;  1KG9 A;  3P68 A;  1NDG C;  3N9E A;  4I7K A;  3WPK A;  232L A;  192L A;  1XEJ A;  4GN4 A;  5A3E A;  1QDT A;  1LYZ A;  4DYG A;  6LYT A;  1N4F A;  2XBS A;  4GP5 B;  1B5V A;  2D4K A;  3V2Y A;  1CU0 A;  2I26 L;  4NHQ A;  1L48 A;  2LZT A;  1INU A;  1LSC A;  3UZA A;  2MEI A;  1CV4 A;  4NGK A;  3F6Z A;  1HEQ A;  2ZIJ A;  1YIK A;  3G3V A;  3GUL A;  5DHG A;  210L A;  5ETZ A;  4EIY A;  2DKV A;  3W6C A;  4PPO A;  4G7Q B;  1L39 A;  4D9Z A;  3L64 A;  4OWA A;  4PXK A;  3KJ6 A;  1L81 A;  4NSH A;  4DKL A;  4NG1 A;  5DN5 A;  260L A;  4WOA A;  3DMX A;  1B7O A;  1IP7 A;  4LZM A;  3WXU A;  133L A;  1GBX A;  1YAP A;  126L A;  3HH3 A;  1LYG A;  4G4C A;  4XT1 A;  4YXC A;  2C8P A;  1GB9 A;  1LMQ A;  1LI3 A;  2RBO A;  1C67 A;  1EQ4 A;  1LYF A;  1BWI A;  1L30 A;  2XJW A;  3WUL A;  4B4E A;  4CFO A;  4DD3 A;  177L A;  3RUN A;  2YCW A;  1C6K A;  164L A;  1GF0 A;  1P3N A;  2HEF A;  4H9A A;  1C6L A;  1WQO A;  2D4J A;  4GLV A;  4DDC A;  3PXO A;  4UWV A;  3HH4 A;  2MEG A;  4LDL A;  3C82 A;  3HUK A;  172L A;  3B0I A;  4N4W A;  1LZ5 A;  2EQL A;  4ET8 A;  5I54 A;  1HZX A;  1O23 A;  1VDT A;  5J7A A;  2BQD A;  5G54 A;  4NHS A;  1L61 A;  1L53 A;  2YBM A;  4AMI A;  4Z98 A;  1GF7 A;  3UTX A;  1L99 A;  1OUH A;  185L A;  4I7R A;  1LYY A;  1LSN A;  4ARQ B;  120L A;  4HV1 A;  2ZIK A;  3HBE X;  4II8 A;  4H9H A;  1KME A;  1LSA A;  218L A;  4XYY A;  3UTY A;  4TWS A;  3HH6 A;  128L A;  3EXD A;  1LSM A;  1J1P Y;  3WVY A;  1CUQ A;  3PWH A;  1L22 A;  1BGI A;  3COD A;  5LYT A;  4CGE A;  3F8V A;  3M3U A;  1L79 A;  4WMG A;  4XJF A;  2F4G A;  3WU7 A;  1IWV A;  1OUE A;  1NBZ C;  4HTK A;  2Y04 A;  2B73 A;  1UIA A;  4H94 A;  151L A;  5AZD A;  3QAP A;  4IAQ A;  2GV0 A;  2ZQ4 A;  3N9C A;  211L A;  1GZM A;  1KY1 A;  1IR7 A;  3HTG A;  4B49 A;  102L A;  2YCZ A;  5KXW A;  169L A;  1IW6 A;  4OWB A;  2FYD A;  1C60 A;  2HUK A;  150L A;  3HU9 A;  1L05 A;  2XTH A;  1C6Q A;  4IAR A;  4Z3M A;  1LKS A;  3C8Q A;  1KXW A;  5DL9 A;  2X0A A;  5KXM A;  3AYQ A;  1QUH A;  1IVM A;  123L A;  1OWZ A;  2Y8P A;  161L A;  2MEC A;  3DNA A;  1LJ4 A;  1VAU A;  3DMV A;  1F88 A;  1OP9 B;  4NGY A;  1K28 A;  4ETA A;  3A7K A;  247L A;  4L41 A;  3QBI A;  5LWE A;  1L21 A;  1NMM A;  3A34 A;  1C63 A;  1LYS A;  3VGA A;  1XEI A;  1T97 A;  1LSB A;  1QUS A;  4NSJ A;  249L A;  5IHG A;  193L A;  4B4J A;  2OU9 A;  1LZS A;  3QJR B;  1L75 A;  3ZPQ A;  1OUD A;  1SLY A;  2LCB A;  4ZEE A;  2I6Z A;  1IOS A;  4W57 A;  1LCN A;  1L07 A;  2FBD A;  2B72 A;  3QE8 A;  5I4X A;  243L A;  195L A;  1PQD A;  1HNL A;  4S0W A;  1XGP C;  1B7N A;  4N9R A;  2BQK A;  1OQM A;  1L13 A;  3CDO A;  3S3B B;  2FBB A;  4J1B A;  1C6B A;  3G3W A;  4B1A A;  4YEN A;  1L24 A;  3OE9 A;  229L A;  1X0S A;  1LJG A;  3TXK A;  2RH1 A;  2I25 L;  2Z55 A;  5DN4 A;  3WPJ A;  1GFK A;  2DQI Y;  1I20 A;  235L A;  1IY4 A;  1G0K A;  1OVJ A;  2MEF A;  125L A;  1HEW A;  4NGV A;  4W94 A;  5ITC A;  1IWZ A;  1TAY A;  5LIO A;  1L85 A;  1LYE A;  3WYH A;  1PQI A;  5A44 A;  1BVX A;  3A95 A;  1T8F A;  3HUA A;  5A3Z A;  245L A;  5C1M A;  1NDM C;  1X0I 1;  4HPE A;  1GB0 A;  4N6H A;  1AZF A;  1YAM A;  1SSW A;  3EBA B;  4YOP A;  1IC4 Y;  2HU3 A;  1NWG A;  4W56 A;  4U3X B;  1LZ4 A;  3LYT A;  1WQR A;  2LYO A;  1GDW A;  4WL6 A;  3LZ2 A;  1LHI A;  3P66 A;  1L68 A;  1JJ3 A;  1P2R A;  1LZG A;  1GF4 A;  5T3F A;  8LYZ A;  2PC2 A;  4ANR A;  1G1W A;  158L A;  5KXR A;  1HEN A;  1L46 A;  3HBH A;  1ZV5 L;  2Z6B A;  108L A;  2HUB A;  3CB7 A;  1H87 A;  1GF8 A;  4BAF A;  119L A;  1REZ A;  3WU8 A;  1L71 A;  5B0W A;  4DD7 A;  4GP4 B;  3B0O A;  5JEN B;  3N9A A;  1UCO A;  4DAJ A;  3ATO A;  4LFP A;  3S8F B;  1JIY A;  1B2K A;  1NQI A;  5B2N A;  4ETE A;  1LMA A;  4BUO A;  3CSR A;  5HNC A;  1IY3 A;  4GCF A;  4I7M A;  5BR2 A;  4GN3 A;  1E0P A;  1BB6 A;  1KG8 A;  4NGO A;  113L A;  1HF4 A;  3QNG A;  1UA6 Y;  4GCD A;  1LSP A;  4GPO A;  1LPY A;  1TDY A;  4GN5 C;  1CX6 A;  4CJ2 A;  3ZVQ B;  3SB5 A;  5H2M A;  4FAA B;  3P0G A;  1LGW A;  4TTD A;  2Y01 A;  5EBH A;  4I7L A;  4DD9 A;  4ZIX A;  1CUP A;  3AB6 A;  1L95 A;  1C6T A;  2IFF Y;  4XT3 A;  153L A;  246L A;  2B6T A;  1L0J A;  1L43 A;  1L60 A;  1A4V A;  3A6B Y;  2BRD A;  1C6M A;  1B9O A;  4LDE A;  1CV1 A;  5LIN A;  1LZT A;  2ANV A;  3HWL A;  134L A;  261L A;  2RB1 X;  4BWB A;  3NY8 A;  2YDG A;  4XN6 A;  3SBB C;  4GBR B;  1CU3 A;  4OWC A;  4BS7 A;  1T8A A;  1T6H A;  1EPY A;  1KW5 A;  1QT6 A;  2HEE A;  4KPM A;  4M6D A;  1GFG A;  1DYD A;  5HMV A;  4C5F A;  4WO6 A;  1TCY A;  159L A;  1G7L C;  2BAA A;  4WLT A;  1CX7 A;  3JR6 A;  3A3Q A;  3QJU B;  1JV7 A;  5JJE A;  4EKQ A;  1D6Q A;  5F81 A;  4OO9 A;  4XEN A;  3EMS A;  2LC9 A;  3BVD B;  199L A;  3C9L A;  1ZVY B;  3CSQ A;  2ANX A;  4UWN A;  214L A;  4RLN A;  184L A;  3HT7 A;  4I7O A;  1PXR A;  1V7T A;  2JAG A;  1L88 A;  1BB5 A;  4NGW A;  2H5Z A;  3QAK A;  4ETB A;  4ML7 A;  2D4I A;  3X3B A;  3DN1 A;  3HTF A;  1DZE A;  1L51 A;  1GFT A;  1IW9 A;  2RBR A;  1L00 A;  1FKQ A;  3AJN A;  1JSE A;  3W6B A;  1M0M A;  1C69 A;  1KNI A;  5FST A;  3J4G A;  4OOO A;  2B5Z A;  4B0D A;  4H9F A;  4J0L A;  4QGZ A;  3W6D A;  5KXY A;  5F16 A;  1B6I A;  143L A;  3SBA A;  2VB1 A;  1C43 A;  1GBY A;  5KXO A;  4W53 A;  145L A;  3HDF A;  3TMU A;  1L10 A;  2BQI A;  5TGZ A;  4ET9 A;  4E3U A;  1UCQ A;  4HJY A;  4ARM B;  3HH5 A;  4DS7 E;  4WLX A;  1JPO A;  4TSC A;  3SN6 R;  1VED A;  3C7Y A;  2I1X A;  1QTK A;  5A8E A;  5FEK A;  1BRR A;  1D0L A;  1L55 A;  1CKC A;  5H2N A;  1C6H A;  259L A;  3QJV B;  1REY A;  1AT9 A;  1QTC A;  4MST A;  1NF5 A;  2MEB A;  3A3R X;  223L A;  1KIP C;  3BKH A;  5F9X A;  4NHP A;  1WQN A;  2HUM A;  3SB8 A;  5APF A;  142L A;  5ILC A;  2NTG A;  4BEY A;  1JKC A;  4OWE A;  1UUZ C;  2BQA A;  1L93 A;  2ZYC A;  5KXK A;  1LSD A;  4FBZ A;  1C65 A;  1QT3 A;  2NWD X;  130L A;  1CV3 A;  1LMP A;  3B72 A;  4E97 A;  2CWI A;  1EL1 A;  1C7P A;  1ALC A;  4I7T A;  132L A;  1L86 A;  2RAY X;  4NHT A;  1LJK A;  3TXI A;  1LKR A;  1XFP L;  4G7R B;  1P37 A;  2L78 A;  1LZA A;  1L97 A;  1RFP A;  5B07 A;  3DQB A;  2MEE A;  1L9H A;  4NWE A;  3ZPR A;  4QY9 A;  1GXX A;  4L6R A;  4IAS A;  4FPD A;  236L A;  4W96 A;  1CJ6 A;  2YBH A;  1DQJ C;  4N0J A;  1GB6 A;  1SX2 A;  1IO5 A;  1IC7 Y;  4NIJ A;  219L A;  5A45 A;  2LZ2 A;  1EHK B;  5AHY A;  144L A;  1L47 A;  3LZT A;  2A7F A;  1LZC A;  1DYC A;  2NTH A;  4OV0 A;  2N5Z A;  5KXX A;  3HT6 A;  4MBS A;  221L A;  1JTO L;  4LYO A;  1D3N A;  253L A;  3QBL A;  5KKH A;  1MLC E;  1L57 A;  4DC4 A;  1GHL A;  2W1X A;  4R6C A;  2OU8 A;  205L A;  4CHX A;  256L A;  3EH3 B;  1JSF A;  5JJN A;  2O4W A;  1IP5 A;  2O7A A;  3OE8 A;  5LYM A;  1G7I C;  5HLL A;  2D6B A;  4WG1 A;  1CWQ A;  3QJQ B;  1GB3 A;  1L98 A;  3LN2 A;  3A8Z A;  212L A;  1XIO A;  2DQH Y;  1C6E A;  3TXB A;  1LHK A;  1EQ5 A;  2C8O A;  3DKE X;  213L A;  1PQM A;  1L84 A;  2WAR A;  1BRD A;  5LYZ A;  226L A;  4DDB A;  3SB6 A;  1L64 A;  1LJF A;  1WQP A;  1C8S A;  1L29 A;  240L A;  1UIB A;  1LHJ A;  1CKH A;  1OUG A;  2JAF A;  4H90 A;  2OE7 X;  3VVK A;  1XGQ C;  4X3B A;  1C6P A;  149L A;  107L A;  3CSZ A;  4XJG A;  4BAP A;  1B5Z A;  4UWU A;  1B7S A;  3V2W A;  216L A;  1W08 A;  2B6Z A;  3AGI A;  4W55 A;  1UIE A;  3B0K A;  4LYC A;  1JJ1 A;  1WTH A;  1D0K A;  2BQL A;  2Z38 A;  2ZIL A;  1WQM A;  1DYF A;  2RB2 X;  1SQ2 L;  1CJ9 A;  2CJL A;  162L A;  1GEZ A;  1TEW A;  4IB4 A;  157L A;  3PBL A;  1O0A A;  1TLA A;  1L31 A;  3TMV A;  244L A;  4XTO A;  1QUT A;  5G2C A;  1HSX A;  1LHL A;  1XGU C;  5ITE A;  2DQE Y;  4GRV A;  4LT1 A;  1LW9 A;  3ZEV A;  1GBZ A;  4JQ6 A;  5L9J A;  1L01 A;  1L34 A;  4I0C A;  1F50 A;  1IP3 A;  3CDQ A;  4EOF A;  1DPW A;  5HQ1 A;  4ETD A;  1P46 A;  4JR8 A;  5KXS A;  1CV6 A;  5C6L A;  4HWL A;  224L A;  3J6K A;  4GCB A;  1JGJ A;  5KJ9 A;  1UID A;  2QAR C;  3FE0 A;  3TXE A;  5LVK A;  7LYZ A;  2HPY A;  109L A;  5G28 A;  1L50 A;  1GFH A;  5LAG A;  4PXF A;  1QUG A;  4I8S A;  1GF6 A;  1UIH A;  4MQT A;  3C7Z A;  1L77 A;  1L35 A;  2I35 A;  4IAT A;  1YRO A;  1IC5 Y;  3HAQ A;  5KXL A;  1GFJ A;  1SWY A;  1M0K A;  5K7O A;  2YDV A;  5C6J A;  3W6E A;  1LMT A;  5DLA A;  4G7S B;  4DWX A;  1C6G A;  1HEP A;  1S8J A;  1LSF A;  3WU9 A;  4H8X A;  1A2Y C;  241L A;  1CV5 A;  5F14 A;  3LHM A;  131L A;  1JKB A;  262L A;  4HYX A;  5H2H A;  1GD6 A;  1CKG A;  2DQC Y;  1XME B;  1CVK A;  1L09 A;  2FYC A;  5FCP A;  4NSG A;  3AGH A;  3WMK A;  1G7H C;  3TXD A;  1RJC B;  1LYI A;  1FN5 A;  3A91 A;  1CTW A;  4HJZ A;  4A4M A;  5I4Y A;  5G2A A;  2W1M A;  1L59 A;  4HV2 A;  1R84 A;  4LYT A;  1AP9 A;  1LJN A;  2RBP A;  1GAZ A;  1L80 A;  3WW5 A;  5IEL A;  3C8S A;  1LJH A;  2H9J A;  1ZVH L;  1M0L A;  2YVB A;  4G72 B;  5B6W A;  3L2X A;  1L19 A;  1SX7 A;  1FBK A;  5DHH A;  4XJH A;  4KT3 A;  4WM6 A;  5D5C A;  4N4Y B;  3DDL A;  3HT8 A;  1G0M A;  4DQ5 A;  1B7P A;  1LJ3 A;  3HAO A;  3S8G B;  1JWR A;  209L A;  4UHR A;  1WTN A;  4GLA A;  5EN0 A;  3COC A;  1QUO A;  1LI2 A;  4PJZ A;  3C81 A;  2LHM A;  5FEL A;  1IR9 A;  4YX7 C;  1UBZ A;  3IWR A;  1JQU A;  1JFP A;  1HEM A;  2HEB A;  1REX A;  2LYM A;  1S51 A;  4ARL A;  1CJ7 A;  2BQM A;  2W1L A;  2Z37 A;  1D9W A;  5C6I A;  1DYA A;  4MD1 A;  4BV0 A;  3MBV A;  1LGU A;  1LHH A;  1LZ1 A;  1RI8 B;  1AT6 A;  1QIO A;  3QDC A;  1LWG A;  3HTB A;  2DQD Y;  1GB8 A;  4ETC A;  5I5Q A;  1L41 A;  1P8H A;  181L A;  1L06 A;  1PXS A;  250L A;  3IJU A;  5AMY A;  2YDO A;  2F47 A;  1QSB A;  1JHL A;  3PQR A;  1L28 A;  4YM8 A;  1HFX A;  4IAP A;  1OUJ A;  2BQC A;  1LYO A;  1IOC A;  1B7R A;  1QT7 A;  2OE9 X;  2CUU A;  135L A;  129L A;  2HUL A;  1PQO A;  1L82 A;  4DDA A;  2X72 A;  4KLY A;  4W59 A;  1L0M A;  2LNL A;  1XJI A;  3A90 A;  3WL2 A;  4ZPU A;  4C3W A;  182L A;  5B1F A;  2AUB A;  3BKV A;  1QQY A;  1C6D A;  3RNX A;  4HTN A;  1GB7 A;  1XJU A;  2BQH A;  4GYC A;  4G4H A;  1C8R A;  2EI4 A;  1WTM A;  4WM1 A;  175L A;  2Z2E A;  4H9I A;  1L87 A;  3QY4 A;  1LZB A;  3GXR A;  1VAT A;  2NTU A;  4MD2 A;  178L A;  5BR5 A;  3P65 A;  5ILF A;  1IP4 A;  122L A;  3W3E A;  4DQJ A;  1LMN A;  1FBB A;  1CKD A;  165L A;  5B6Z A;  4WM4 A;  2HED A;  1L38 A;  1P8U A;  1YAQ A;  5G53 A;  1GF5 A;  4NGL A;  1P36 A;  1L15 A;  4MQS A;  1L26 A;  1GF9 A;  1DPX A;  2D91 A;  1LPI A;  4HPI A;  4RW2 A;  4X32 A;  1DI3 A;  1JV6 A;  3FI7 A;  3TXG A;  1C10 A;  5LZM A;  152L A;  3EH4 B;  1D3J A;  200L A;  2B6W A;  3CT0 A;  2B70 A;  1OVK A;  231L A;  1L36 A;  5B35 A;  2A7D A;  4BVN A;  148L E;  1QTD A;  183L A;  3FAD A;  2Z39 A;  2BLY A;  3CDR A;  4DD0 A;  3TXH A;  4WW3 A;  1WVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...