4K69A

Crystal structure of human chymase in complex with fragment linked benzimidazolone inhibitor: (3s)-3-{3-[(6-bromo-2-oxo-2,3-dihydro-1h-indol-4-yl)methyl]-2-oxo-2,3-dihydro-1h-benzimidazol-1-yl}hexanoic acid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
215
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 215
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k69A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k69A02
2I6QA 1GVLA 3GY7A 1O2IA 2QN5T 2G55A 5EG4A 6CHAB 1BHXB 2OC0A 4JMYA 3A81A 1TNLA 1QFKH 1O38A 2B7DH 1WOFA 1O3DA 1W12U 1KY9A 4WXVA 2ODPA 1MKXH 3F9GA 1YLCA 1C5YB 3RXUA 1AY6H 2EA3A 1SGQE 2FP7B 3TGJE 2HALA 1C2IA 3NK8A 2BXUH 2DE8A 5FX5A 3RC5A 4AFUA 1TOCB 3ZV9A 1QB9A 1IHTH 1FDPA 1NU9A 1MCTA 1SG8B 1YPGH 4ABJA 4H6TA 1LHFH 3SNAA 1WUNH 4IN1A 3S9AA 2Z9GA 1YLDA 2CF8H 3L33A 2D26C 4IS5A 3VXEH 1OKXA 4WVPE 3MNBA 1K1PA 2QXJA 1UVTH 4CRDA 1C5SA 3EA7A 3C27B 4X2XA 1GI7B 2OTVA 4B2BA 2Q6DA 1GMCG 3T5FH 3DHKH 4NA8A 4AZ2B 2VVVA 1T32A 4BTUB 1Z6EA 4YLUA 2NU2E 4INLA 2C90B 1QA0A 1W3CA 2FI4E 1TNKA 3IWMA 1GBHA 3UOUA 3LGYA 3A8CA 3LPRA 4ASHA 1S0RA 5ESTE 2PKSB 4NSVA 3GCTF 1QA7A 1O39A 1AUJA 2J38A 1EP5A 2VU8E 4K69A 1IQLA 2H2ZA 1ETRH 3E0NB 2VGCC 2JETC 4YOGA 2A4OA 2BOKA 1ZGVA 5JB8S 1H4WA 4NSYA 1BRAA 1W0ZU 3O8RA 2BD3A 4MNVA 1LKBA 1C2JA 1O5EH 1OWEA 1A7SA 4PROA 2FDAA 1ZLRA 4JK6A 1TPSA 1SGRE 4OS1A 1S6HA 3UY9A 2BY8X 3LC5A 1SMFE 1DPOA 3MH6A 1O2YA 3TH3H 3QN7A 1NS3A 1HAIH 3MU1A 1A0HB 2VH6A 3ZZ5A 2JETB 3LGVA 2F91A 1GCTC 2ZDVH 3PROA 2LNCA 2ZC9H 3A8AA 1GBAA 3AVZA 3A7ZA 1DANH 1UVOA 4D9QA 4E05H 1LVOA 4X1NU 2SFAA 4YM9A 1HIAA 1IOEA 1GHVH 2P3FH 1Z71A 3PLPA 4Q2KA 4ZUHA 2O8UA 2GTBA 1TPAE 1AKSA 1PYTD 3TGKE 1NT1A 5LPEA 2QY0B 2C8ZB 2ZDNA 4Z0KA 1TMUH 1CE5A 3ZVEA 9ESTA 2ANYA 1TGSZ 4AB9A 1F5RA 2ZFPH 1GBDA 4Y7AA 1QBVH 1G2LA 1O2HA 1PJPA 2ZFTA 1GCTB 3DFLA 1W0YH 1EKBB 1PPZA 2YNBA 1A0LA 3SORA 1QNJA 1PQAA 1O2XA 1ANCA 4OS7A 1C5ZB 1UK2A 2ZECA 3NKKA 2QIQA 4O03A 1L1NA 1WTHD 5E2PA 5L2ZH 1P2IA 1O3JA 1H9HE 2TGTA 2BDYA 2V0BA 1ZJDA 2A32A 2OBOA 1KXAA 3SGAE 3PMBB 4WF8A 3SUFA 1QB6A 4TWWA 2XBXA 1QJ7B 1S83A 4GCHG 3SHAH 3ATWA 4ZH8A 2ZDAH 5DP3A 3MWIU 3JZ2B 3HKIB 1BA8B 1GI6A 1HAYB 1HIAB 1W14U 1DY9A 3O8CA 3LIWA 1AKSB 1DICA 3VPKA 2BD8A 1PQ5A 2VH0A 5DJ7A 2FOGA 1AMHA 1CGJE 2ZU3A 1GBFA 1Y3WA 1XXFA 2HVXA 5DP6A 8ESTE 1X7AC 2FOCA 1CT2E 3A8DA 3ZVAA 1SLVB 1VCQA 1UTPA 1GJ5H 2ULLA 1D6RA 3SNBA 2BD5A 3RXEA 4R0IA 2G4TA 4CH2B 1KXFA 4LXBH 1AIXH 3ZVBA 3SI4H 3ZYEA 2R3YA 3BG4B 1A5GH 3ZZ4A 2A7HA 3KQCA 3S7KB 1SGPE 1UHBA 2ZCKP 3AAUA 4B73A 2OC8A 1V2KT 1SFQB 2ASUB 3T27A 1AFQB 3A85A 1C1SA 2ZQ1A 3I29A 1QGFA 3MH4A 4ISOA 1A1RA 1MCVA 1E35B 3A7XA 2Y80A 2SGPE 4NIWA 1UVUH 8KME2 1AVGH 5E0JA 8LPRA 1ORFA 4BXWA 3QO6A 1DWBH 1LVMA 2PGQB 3PTBA 4DG4A 3A82A 5HM9A 4ZKSU 5JBBS 1SGFG 4WMDA 4GHTA 3PYHA 5K0HA 1YPKH 1K1MA 2SGDE 4DY7B 1PFXC 1XXDA 2ZU5A 1V2UT 3B23B 1D4PB 2GDEH 1F0SA 4ZROA 2PSXA 4X8TH 1FY3A 2C93B 5DP5A 5EW1H 1ESAA 3CP7A 1OWHA 3FVFB 2QF0A 3T62A 1O3GA 1S5SA 2XW9A 4ABAA 1GBTA 3U1IB 2ZTXA 4NGAH 1XMNB 3MU8A 1T8LA 4ISLA 4MPWA 4CR9A 4NZLA 1T8MA 2Z9KA 2C8XB 1W11U 2ALVA 3PB1E 1IQHA 2KAIA 2Q6FA 4JYTA 3SQEE 1NPMA 2UWLA 1PPGE 4FUHA 4Y8ZA 2HNTC 1O2QA 3RXPA 1N6YA 1GBCA 1UHBB 4D76A 1V3XA 7KMEH 1YGCH 1BT7A 2XWBI 1AVWA 3BTKE 3DFJA 4UFGH 3NUMA 1JIRA 2FX6A 3V0XA 1C1QA 1LCYA 4IC6A 1O2NA 1PQ8A 3STJA 2VVUA 1AUTC 5A8XA 4XDEA 2O8MA 1AB9B 1SQOA 5FBIA 2EI7A 3ENSB 2ZTYA 2BY9X 2FTMA 2BY5X 1HAZB 2AEIH 3MO6A 1BJUA 3URDA 4FVBA 1T31A 4K60A 2CMYA 1SPJA 5FPSA 1ELDE 1FQ3A 5GPIB 1LQEA 3GDSA 4X0WU 3PMJA 1HYLA 5FPTA 1C2DA 5I25A 1FIZA 4BOHA 1GJ4H 1IHSH 3O8BA 4Y0ZE 1XUJA 1UTQA 1GPZA 5DKMA 1GDNA 1QIXB 1ZZZA 4O97A 2F9NA 1LVBA 4B76A 2UUYA 3GYLB 2XRCA 1D6WA 1O3KA 3D23A 1EASA 2AS9A 3QGJA 2C4FH 1TA2A 1NN6A 1ZRKA 4UD9H 1O2MA 1ZMNA 2KAIB 3GY3A 4AFZA 1YBWA 1MAXA 2F9OA 4I33A 1J9CH 1O32A 1SGIB 1YF4A 1IQKA 1H1BA 2THFB 2WPIS 2Y7XA 3DA9B 5BPEA 4DOQA 3PM3A 1WBGB 3F9EA 2A0QB 2AMPA 1GJAB 3HGPA 2TGDA 4Y6DA 2BVRH 2V35A 3M5MA 3SJ9A 1HAGE 5F8TA 3GDUA 1ZHPA 2RA3A 4OS6A 1O2SA 3PTNA 1EJMA 1NU7B 3AW1A 3ZZ3A 4YLQH 3RXMA 1JIMA 2VWMA 3KHVA 3RXOA 1K2I1 1TONA 4SGBE 4YT6H 2Y7ZA 3BTQE 4F49A 1UTLM 4CRFA 2SNVA 1GHZA 5HGGA 3D65E 3VB3A 1O3HA 1F92A 5E0HA 3TJVA 1Q31A 1BTXA 4MPUA 4CHAB 8GCHF 2Z94A 5LGOA 1QRWA 1SB1H 5FX6A 1C4Y2 2R9PA 5T3HA 4U32A 3RXGA 1TLDA 1O31A 1OPHB 1S0QA 2Z6BD 5C3NA 2BYAX 4HGCA 1AHTH 3BTDE 1BB0B 4RSPA 1C5OH 2C3SA 4X2VA 3ODFA 1C2GA 3N7OA 1ZPCA 1O5BB 1QHRB 1UMAH 2GCHF 4X6PA 3STIA 1G3EA 1O3AA 1C5TA 2XBWA 1H9LB 7GCHF 5HM2A 1TOMH 2G00A 4TWYA 1HB0B 4MDSA 3BIUH 3RU4T 4ABBA 1D3PB 1FAXA 2H5DA 4ZHLU 3M7TA 1C5QA 2HNTE 3U8RH 2VIOA 1TALA 5DGJA 1ZMLA 4DURA 1W2KH 1QJ6B 1ELVA 1MTNB 3FAOA 3T28A 4Q7ZA 1VGCC 2CGAA 3SHCH 1DOJA 1S81A 2P8OC 1U6QA 5EPNA 3VB7A 3RDZA 2HPPH 1SHYA 1V2LT 2BDGA 1EZXC 1TRYA 1QL7A 4NIVA 3ZZ9A 1OWIA 4DIIH 3BEIB 1OP8A 4AG2A 3HGNA 4VGCC 4HI3A 1C5UA 2A1DB 1W7GH 2STAE 3UOPA 3GISB 5FPYA 1L0ZA 3A7YA 1EP6A 2OXSA 1J8AA 1GHAF 1VITH 3PLKA 3FP7E 1VGCB 2Z3DA 3LH1A 2F9UA 2UWOA 5GWZA 2P8OB 1FN6A 3U69H 1QBNA 1ELGA 1MD8A 1MZAA 3U8TH 4ESTE 3SGBE 4WXIA 4JZIA 1ANEA 3LH3A 2FLRH 1P04A 2G5VA 3MTYA 4OGXA 1GDUA 2ZPSA 1PPFE 4NFEA 1SGNE 1AGJA 1CSOE 1NRSH 1SOZA 5J4QA 2ZU2A 1AZ8A 2H9TH 2WV4A 2P16A 4TPYA 3UNQA 2ZDMA 5EGMA 2BZAA 1C5XB 3CS0A 3ZYDA 4K5ZA 5JBCS 1BHXF 2BDCA 1FLEE 4MG3A 3SU4A 1G2MA 2UUJB 2A4GA 2ZGCA 2BDBA 3BTWE 1FI8A 1MKWH 1CGHA 5C5OA 1W10U 1MZDA 2STBE 3VEQB 2W26A 1GI1A 2Z9JA 3BTTE 1AQ7A 2BLQA 1BMLA 1FZZA 3EA8A 4IC5A 2TPIZ 3RXVA 5C20A 2ZFQH 2QGRA 3D49H 3SJKA 3LONA 1TX6A 1A0JA 1LDTT 2JKHA 2BLWA 2QXHA 1C2MA 1ELAA 1TX8A 2BM2A 3P8GA 3QUMP 1DE7H 4AG1A 1GHBF 4AFSA 1YPLH 1FJSA 2O8WA 3SQHE 1O5AB 1UTJA 1XVMA 2SGQE 2CV3A 4X6OA 4JZ1A 1VITF 3P92A 1DWCH 3MFJA 2QYIA 3SU5A 5F6MA 1XX9A 3TLOA 3OY5U 1O37A 1BITA 3PO1C 2ILNA 1TABE 2A5IA 4MLFB 1EAWA 1EX3A 2OD3B 5F8XA 2BLOA 3K65B 1VCPA 1C5VA 3TK9A 2A4QA 1Q2WA 1LPZB 4GAWA 1YPJH 1O3EA 3HATH 4U30A 1C4U2 1QRXA 1LMWB 4THNH 2GDDA 4ZKOU 1EXFA 4J1YA 1SOTA 4ABGA 1TIOA 3RMLH 5B6OA 3RC6A 1IQJA 4ZMAH 2D2DA 2FX4A 2SGEE 5EOKA 4A7IB 1JRSA 2QAAA 1T8NA 2SGAA 2R2MB 5AFZH 1VZQH 1HAXB 9LPRA 1DUEA 1P8VC 2PHBA 1TE0A 1EAXA 2OC7A 4K1TA 3QTVH 4I8HA 3U8OH 1CT0E 5E0GA 1BBRH 3SU2A 1P9SA 3A89A 1V2VT 5A0CA 5DP4A 1MTWA 1SLWB 1THPB 4Q7XA 4WJG2 4Y71A 4IN2A 5FCKA 1H8IH 1V2TT 1ZMJA 3DT0H 3DD2H 1P9UA 1YM0A 1ESTA 3A83A 1WV7H 3ZVCA 1GBLA 1EOJA 2VJ1A 4NFFA 1V2QT 2JH0D 3KF2A 1K1IA 4LZ1H 1D3TB 1S84A 4OS5A 2ZI2H 4YTAA 3UUZA 1EZQA 2H6MA 1MD7A 1TGBA 3TH4H 5ABWA 1ARBA 1F0UA 1T4VH 4IGDA 3GY5A 4BAKB 1P2NA 1ZSLA 3H7TA 3V3MA 4CRAA 4ISIH 3ZV8A 1IQFA 2ZGXH 4X2WA 2UUFB 1THSH 1O2UA 1RS0A 3E91A 1DS2E 4X8SH 1NC6A 1FPHH 2F9BH 2IOTA 3I78A 3RLWH 2QV1A 4UEHH 1QQUA 1DITH 5IDKA 2ALPA 1PPCE 1NFUA 1JXPA 1VITG 4Q80A 4F4OC 1F0TA 2VWOA 4MTBA 2BDHA 4CBNA 3BF6H 1RIWC 1AWHB 2A4RA 1ESBA 1SC8U 1OYTH 1KTTB 1XKAC 2VGCB 3ODDA 3LGWA 3RXJA 4DW2U 3M5OA 4FU7A 3S9BA 1BQYA 2PUQH 3EGKH 1DT2A 4FVDA 1MTSA 3GCOA 4K1EA 2QXGA 3TJOA 2A2XH 1CHOF 3TH2H 5A8YA 1RIWB 2PFEA 3W95A 1HUTH 4GHQA 2FS8A 1KXCA 1YC0A 1WTGH 1W13U 4DIHH 1L1GA 2Y81A 2WUCA 4TY7A 2FIRH 3LKWA 4I31A 4ZHMU 1FONA 2ZGHA 1Y3XA 2ANKH 1O3PB 5EQSA 3MH7A 4YT7H 4NIXA 2FYRA 1YCPM 5F8ZA 1ARCA 1Z8IB 3SN8A 1SGFA 2VNTA 1RJXB 1QL8A 4Z6AH 1ZTJA 1O2TA 4IBLH 1BJVA 1A5HA 3MU4A 4MNYA 2BZ6H 2VIDA 1GCDA 1AFEH 1RD3B 3KL6A 2J4IA 1GJ6A 2LPRA 3TGIE 4FXGH 1O2VA 1KTSB 1O2ZA 1C5RA 5JYIA 3BSQA 4AX9H 1AZZA 2AH4X 2ZA5A 4NZQA 1AI8H 1DFPA 2M5TA 1GI5A 3HPTB 1GWAA 1O5FH 2ZZUH 1XVOA 2G4UA 1Z1IA 2IJOB 2FO9A 5GCHF 2XCFA 1GJ8B 2PTCE 3AW0A 3LGUA 1F7ZA 2H1UA 4IMZA 4ABHA 4UDWH 3GCTG 3ZVFA 1LQDB 1HJ8A 2WYJA 1BMNH 1TQ7B 2WPKS 3EA9A 3TITA 1MBQA 1P3CA 3RUOA 4K2YA 1SVPA 4B75A 4MPXA 3M3TA 1P09A 1HRTH 1Y3UA 4FUJA 2FESH 1V2OT 3RXDA 2XBVA 2GZ9A 3QWCH 3SV6A 4D9RA 2PWXA 3SGQE 2EEKA 3H7OA 2AYWA 4AFQA 1FMGA 3ZZ8A 3T29A 3QZRA 4GSOA 2JH6D 2F9PA 2GMTC 1RXPA 1N6XA 1GJBB 1K22H 3RU4E 1Y59T 5EODA 1GGDC 1J16A 4YO9A 3RMOH 2AMDA 5C2ZA 5C1YA 1YPHE 5EU8A 3TVJB 5DP9A 2FI3E 1YYY1 2ZTZA 3P8NA 2V3OH 5G4BA 3SW2B 1RTFB 4IMQA 4BTIB 3AAVA 4FU9A 2BDAA 2GZ7A 1BDAA 5BRRE 1EPTC 4I8GA 4JCNA 3BTEE 3GY6A 4D7GA 5A0BA 4XFQA 1CHOG 3UR9A 3GYMA 1SLXB 3BN9A 1GGDB 5EQQA 1RFNA 1AWFH 3ELAH 1K1OA 2ZU4A 3GCHC 1TA6A 3LJOA 1ZJKA 1RTLA 1FXYA 1TFXA 5AFYH 1V2WT 1HAOH 1S85A 2A45B 2ZNKH 4KKDA 1HNEE 2SGFE 1PYTC 3A80A 1CVWH 1WAYB 3TNSA 4IW4E 1Z8RA 3M5NA 1E34B 4KGAA 1BTUA 2FI5E 4A6LA 5LPFA 6LPRA 6GCHF 1A3EH 1C2KA 1OWKA 4H42U 1O2OA 1GG6C 4KTCA 1FY5A 1O2WA 2BD9A 3MYWA 1GL1A 3RXFA 3GCHB 3SNCA 1HLTH 2VIQA 1GHWH 2XNIA 1JMOH 1UTMA 2XC5A 1FIWA 4YESB 1BCUH 1P2JA 1TNGA 1C4V2 1K1JA 1ABIH 3RXAA 1L2EA 3SU6A 2VIVA 3U1JB 2ZF0H 1KIGH 4ISNA 3RXBA 1DWDH 1BBRE 1SR5C 5GCHG 1Q3XA 3I77A 1OWDA 2J9NA 3RM2H 2XXLA 3NWUA 4TPIZ 1KSNA 1K21H 4NA7A 2FOBA 4LZ4B 3RMMH 3V13A 1YPEH 3EAJA 5AVDA 1P05A 4M7GA 1ELTA 2SNWA 1UTNA 4RKJB 2HLCA 1C2LA 1ETTH 1C5LH 1JWTA 1K1LA 1QTFA 1G37A 2OUAA 2AIPA 2FTLE 1F2SE 1ZSJA 1T8OA 1NRPH 2BY6X 1YKTA 2BQ6B 1DLEA 1GMDF 4WWYA 2FZZA 5LH8A 3RC4A 1O3NA 1ELFA 2FOAA 1TPPA 1ZHRA 1AN1E 1P2QA 4UFFH 1QCPA 1C1TA 3GY2A 5ESBA 4NWKA 3RLYH 3QZQA 1UCYH 1O2LA 1Y5UT 4X6MA 1E38B 1SFIA 1CU1A 2PTNA 1MKXK 1DLKB 3ATKA 3E8LA 1PPEE 1P3EA 1NO9H 3GY8A 2GX4A 1Y8TA 2PKAA 3NZIA 2ZGJA 4YOIA 1UK3A 4AB8A 2B5TB 1C1OA 1G3BA 2P3UB 2RG3A 1EOLA 1G3CA 1Z1JA 1GVKB 1XUFA 4ZKRU 3P8FA 1SHHB 2G8TA 5HMAA 4HZHA 1TX7A 2PW8H 2FODA 2V6NA 4JYUH 2P94A 1C1RA 1GBBA 3MU0A 4B2CA 1HGTH 1ZOMA 5GXPA 4Q7YA 1LHGH 1NRRH 2A5AA 2J95A 4NA9H 4NWLA 3SV9A 5A2MH 1CO7E 3UQVA 4TY6A 2UUKB 1BRUP 1HXEH 2J2UA 3ATMA 1YP9A 1W7XH 1DXWA 2WPMS 3BTGE 2BX3A 2FOMB 1GJ9B 3P8OA 5H4IB 2TIOA 1FV9A 2FXRA 2W7UA 1O5DH 2AGGX 2G81E 1IQEA 3OX7U 2GZ8A 3PWCA 1DX5M 2BLVA 2XCNA 1SGYE 1B5GH 2VB0A 4BAMB 1MTVA 2PKAB 2B0FA 3M3VA 2WYGA 4XBDA 3QGNB 1A46H 1TWXB 1Z6JH 2GT8A 3KEEA 3SV2H 1TMTH 1BRBE 3PLBA 2PUXB 1WYKA 2FWWA 1A4WH 1DDJA 2YOLA 1RTKA 4WH6A 3TU7H 1QBOA 1DSTA 2AGEX 1TGNA 2P3TB 3BEUA 4FUFA 3LOXA 2CXVA 2P59A 2VINA 3A7WA 4WMFA 3SBKA 5EXLA 1EJAA 2XC0A 1KDQA 4X1PU 4H4FA 1CA0C 1T7CA 1TNIA 2IN2A 4OS2A 1GBJA 1GMDG 5ETXA 3WY8A 3EDXB 4NCYA 2A2QH 3BV9B 4WY3A 4ZXXH 1HV7A 3A86A 3ATLA 4VGCB 1CA8B 1MH0A 1BMMH 1BTPA 4GLYA 1INCA 1HPGA 1CQQA 3RP2A 3VXFH 1SLUB 3E6PH 1RRKA 4UONA 2FYQA 1O3BA 1BTYA 1N8OC 3VB4A 1TBZH 1DWEH 1SQTA 1O33A 2DUCA 4ZKNU 1ACBE 3ZZCA 4XBBA 2IPHA 3OY6U 2EC9H 3UTUH 8GCHG 4Y8XA 1NROH 1BRCE 1KXBA 3UPEA 1IAUA 1L4DA 3CS7A 2Q6GA 5A09A 1GI8B 5EXNA 1J14A 4JYVH 4B1TA 4BTTB 1KDQB 1VJAU 3RXHA 1CHGA 3HK3B 4YZUA 4H6SB 2XTTB 4I32A 1TQ0B 2GCHG 3UNSA 4ABEA 1UK4A 1K1NA 3F68H 4HTCH 1ZRBA 4MNXA 4UE7H 4ZAEA 3B9FH 2K1QA 4AGJA 1GJCB 7GCHG 3BEFB 4CR5A 2TBSA 1SI5H 3RMNH 1SL3A 1EJNA 2Y5GA 3TJUA 1C5PA 2ZHFH 4HFPB 1PPBH 4E7NA 1TGCA 1HFDA 3TK5A 4DJZB 1ZYOA 2O9QA 1GL0E 4JK5A 5T6FA 2DE9A 1A5IA 3RXRA 1CBWC 1P10A 1TGTA 4X1SU 3MNSA 4X6NA 3SJIA 4MPVA 2HPQH 4XBCA 5A0AE 1C2FA 4Y11E 2OP9A 1P03A 3U9AH 2GT7A 5AHGH 2O8TA 3PO1B 5LPRA 3FP6E 1QB1A 1NFYA 1P2MA 2D1JA 2GP9B 2Y5FA 4JZFH 3UR6A 4X8VH 1NFXA 2BQ7B 3KN2A 3UIRA 4DCDA 3SZNA 1GHAG 1BTZA 1C1VH 4K8YA 4DGJA 1H9IE 1CBWB 1FN8A 1UJ1A 1EAUA 1AE5A 3PWBA 4GUXA 3RXCA 1GI3A 1V2PT 4K1SA 1G36A 1AVXA 4YOJA 5CHAC 4ISHH 1O2JA 1OP2A 3SJOA 4XOJA 3QX5H 1GHYH 4FUEA 2ZIQH 4DT7B 2BQWB 3LGIA 2C8YB 4WH8A 2Z9IA 1P11E 3LT3A 2NWNA 4OGYA 3A88A 1Y3VA 4B2AA 3RXTA 5T6DA 1O3IA 4A1VA 3DUXH 3E90B 1LKAA 1QURH 1ABJH 2ZHEH 1BTWA 2ZU1A 1VCWA 1Z7KA 2EI8A 2PKSC 1NTPA 2ANMH 4Y7BA 2FLBH 4GCHF 1MBMA 1LPGB 2JH5D 3MO3A 5CHAB 5FAHA 1OSSA 2AERH 3A84A 3LJJA 1W8BH 4A5TS 3VB6A 4CH8B 1GBEA 1UCYE 3TNTA 2ZFRH 2Q1JA 4Y76A 3VFEA 2ESTE 1O3CA 1C1PA 1PQ7A 2OQUA 1NRQH 1YPHC 2GCTC 1GHBG 3PMHB 2O8LA 1OYQA 3G01A 2OCVB 5L2YH 1Y5AT 4Y10E 1EUFA 5C1XA 6ESTA 2NU1E 1VJ9U 2V3HH 3RXKA 2VIPA 1DXPA 2CJIA 4CREA 1SGDE 2WV5A 4O3TA 1NZQH 3EYDA 3M7UA 4BAHB 1DM4B 4QT8C 3RXSA 4AGKA 2GCTB 1QY6A 1NFWA 1OP0A 1E37B 2FS9A 2TRMA 2EI6A 3KQDA 1LPKB 1O36A 1G30B 2Z3CA 1S82A 1XUKA 1KLTA 5EQRA 3E1XB 5GDSH 1AD8H 2P93A 2H5CA 2PGBB 2RA0A 2ZGBH 4E7RG 5JB9S 5E2OA 1D3DB 1FPCH 4BAQB 3M7QA 2WPHS 2ZCHP 3ESTA 1LHDH 3MI4A 4I8JA 3PV4A 1O3OA 1J15A 1IQNA 2BVSH 1ELBA 1J17T 4B71A 1D9IA 1RGQA 1THRH 1QQ4A 2ZEBA 1UCYK 3H5CB 1P06A 1WQSA 3LDXH 5FBEA 3MO9A 4KP0A 1L4ZA 1HAHH 5DG6A 3JZ1B 2OQ5A 4FUIA 1VR1H 4CRCA 3BTME 3TPIZ 4FUDA 3SUDA 2I6SA 3ZVDA 1C1NA 1BUIA 3TJNA 1FY8E 2J94A 3W94A 2A31A 3GICB 2BDIA 1O5CB 2GV7A 5HYOA 5DPAA 2W3IA 3Q00A 1DVAH 1E0FD 3SU0A 1LHEH 3CENA 1SQAA 1HJAC 3E16B 2QCYA 3KCGH 1LTOA 1WCZA 3FZZA 1WU1A 3A8BA 1O34A 1YCPH 2XC4A 1O3LA 3C1KA 1GJDB 1HDTH 4I8LA 2AGIX 1EQ9A 1GBMA 1GI2A 3NXPA 1B0EA 2QXIA 3KQEA 5HXFA 1DUAA 2H9HA 1BIOA 3BG4C 1TRMA 1SSXA 1Z8GA 2BMGB 2WPLS 1MTUA 5I46H 2BVXH 2GKVE 4UFDH 2ODQA 2Z3EA 1AFQC 3GY4A 1HJAB 3K6ZA 1JOUB 3BTHE 1EPTA 3B8JA 3OSYA 3M36A 3OYPA 3SI3H 5FXLA 2WINI 2ZO3H 3R3GB 4KTUA 2ZHQH 4D7FA 1QRZA 5DP8A 3L3TA 5A8ZA 4O9VA 1GVZA 5DO4H 1G9IE 4Y79A 4AORA 5CE1A 2PR3A 3KGPA 4TYDA 1GMHF 1MQ6A 1B7XB 2HNTF 7LPRA 3ZZAA 1G32B 1A61H 1UTKA 1FY4A 5C5NA 2B9LA 1OS8A 5FCRA 2F83A 1HXFH 2A5KA 2RDLA 3SO3A 4MVNA 1UVSH 3E0PB 1C9TA 1IQGA 2C8WB 1K9OE 1ANBA 1SGTA 5E8EH 1TAWA 2BD4A 4UFEH 3K2UA 2H9EH 1AO5A 1O0DH 2VIWA 3HKJB 3Q76A 3BTFE 3L6PA 4I7YH 1MU6B 2GMTB 3IITA 3MNCA 1QJ1B 2CHAC 1AE8H 2B8OH 3MMGA 1V2RT 1P12E 5TCCA 3S69A 1TB6H 5EPYA 3SV8A 1EB1H 1CGIE 1LVYA 1FY1A 1XUHA 1DY8A 5J4SA 1C1UH 4BXSA 1HCGA 1P57B 3F1SB 4GVUA 2QF3A 1LO6A 2ODYB 2ZKSA 3EQ0H 1EPTB 4Y8YA 2ZFSA 3ITIA 4INHA 5T6GA 2WPJS 1PPHE 1AB9C 2QA9E 2CHAB 1EAIA 5TCAA 1TRNA 4A1XA 3Q3KA 3SU3A 3F9FA 3LC3A 1MKWK 3LGTA 1Y3YA 3SOSA 1HBTH 4XE4A 1C2HA 1KYNA 1EZUC 2PLXA 4NIYA 1QL9A 3UQOA 3R0FA 4AYYB 1ZPZA 1P02A 2FMJA 3RXQA 1V2MT 2G5NA 3V7TA 2OC1A 3BIVH 1GG6B 2GV6A 3UREA 4FU8A 3RM0H 4Y0YE 2AMQA 3GOVB 1ETSH 2F9VA 3TIUA 1O3MA 3OU0A 1OOKB 1KLJH 3M37A 4O3UA 4CRBA 2G51A 3FANA 3SJ8A 2FOHA 4U2WA 4JZEH 5GIBA 4X1QU 1BMAA 3URCA 3ZZ6A 1MQ5A 3PMAB 1GDQA 2BOHB 1C2EA 4D8NA 2G52A 1A2CH 5CMXH 4WMEA 3S9CA 2A7JA 4X1RU 3FFGA 5C67A 2NU4E 5C1UA 2BHGA 3UWJH 1NM6A 4RN6A 3FZDA 3P6ZB 1YPMH 2D8WA 1F5LA 2GVFA 2AFQB 1GMHG 2ZPRA 3K6YA 4SGAE 4A1TA 1JRTA 2NU3E 2CN0H 1NESE 4FUBA 2Y6TA 4LK4A 3U98H 3GDVA 3MOCA 2GGVB 1P01A 1BZXE 1WSSH 3S7HB 5DP7A 5AF9H 1ANDA 4OS4A 4FUGA 4X2YA 1OXGA 3TK6A 1TNJA 4BANB 4XSKU 4CHAC 3Q77A 1GBIA 1C1WH 2WUBA 5SGAE 1NRNH 2FPZA 1TBRH 1DSUA 2PV9B 3KIDU 1FNIA 3UNRA 4MNWA 2R0KA 2ZP0H 3FP8E 1V2ST 1BBRK 3P17H 3RXIA 1UTOA 3ATIA 3OTJE 2ZPQA 3MU5A 1ELCA 1C5MD 1UO6A 3P95A 3ZZ7A 5IYTA 3QK1A 1MAYA 2F3CE 3VGCC 2GD4B 1ZTLA 1TBQH 1TYNA 2BY7X 3T2NA 1EZSC 2ZQ2A 3T26A 3SNDA 3LU9B 4I8KA 1KXDA 3SNEA 1FAKH 1V2JT 1ZHMA 1ELEE 2ZHWH 3S0NA 1KXEA 3QDZB 6GCHG 1ZR0A 4NG9H 3M5LA 1LHCH 3F9HA 2VWNA 2W5EA 3O8DA 1HAVA 1TMBH 2R2WU 2Y5HA 1P2KA 1XUIA 3IG6B 3M35A 3ZZDA 4CBOA 4ABIA 2ZG0H 3MNXA 2R0LA 2Y82A 1MTNC 3VGCB 1C1MA 2W7SA 1O5GH 1IQMA 3NPSA 1O3FA 1SGCA 2ZHDA 3NCLA 1JBUH 4U01A 5K7RA 3T25A 2XBYA 5L6NH 3MH5A 1P0SH 4GPGA 3KQBA 2UWPA 4FUCA 1G3DA 4AYVB 1O2PA 1MU8B 2BB4A 1O30A 1GHXH 1IQIA 2QC2A 3VB5A 3M3SA 3V12A 2FOEA 2FEQH 3UWIA 1C5WB 5EW2H 1K28D 3E3TA 1OWJA 1V2NT 5JBAS 1MMJN 4RKOB 1GBKA 1O2GH 1SBWA 1C9PA 2CF9H 1B0FA 2RCEA 3Q3XA 2BTCE 4R8TB 5JPMH 3A7VA 4K3JA 4JZDH 1D3QB 1WQVH 3RXLA 1HAPH 2PSYA 1HAVB 1O2KA 3EE0B 5JDUB 5GJ4B 2VWLA 3AASA 5FHTA 1ID5H 2J92A 2R3UA 4J2YB 4KTSA 3M61U 2BD7A 3KNXA 5PTPA 3HK6B 3F6UH 2XWAA 2NU0E 1Y5BT 2ANWA 1GI0A 4KELA 1CA0B 4INKA 2HWLB 2YNAA 1GI4A 2ZCLP 2BX4A 4LOYH 2TGAA 5L30H 3K9XB 1XKBC 1ZGIA 1O35A 2P95A 2ZDKA 4ZHAA 1EATA 1GJ7B 1GMCF 2XYAA 1ZTKA 3BG8A 1HJ9A 3A7TA 2AIQA 3RU4D 4MQAA 1ZSKA 3SUEA 1MUEB 1F0RA 1SGEE 4ABDA 2BXTH 2OINA 3UFAA 1F5KU 1FUJA 1OX1A 4BAOB 5EXMA 2OLGA 4X8UH 3SUGA 1TPOA 1N8OB 1P2OA 1E36B 4CRGA 1N1LA 2FM2A 1UVPA 1XUGA 3ZZBA 1CT4E 5DK1A 4A92A 1A3BH 1S6FA 4BNRA 2HOBA 2HRVA 1M9UA 1XM1A 2HGTH 3P70B 1BOQA 1T4UH 3ZVGA 2BD2A 1QR3E 3D62A 2FOFA 5JBTA 4K8BA 1NY22 3GCNA 2Z7FE 4B74A 1V6DA 2J34A 4ABFA 6CHAC 2ZWLH 1L1JA 4AN7A 2VVCA 2Z9LA 1YCPK 1Z8JB 2W3KA 4E06H 1O2RA 1KLIH 1EB2A 4AOQA 1AU8A 1BTHH 3Q3YA 3QLPH 1C5NH 7ESTE 2OBQA 2ZFFH 1ZPBA 2TGPZ 1H8DH 5TJXA 3MHWU 1TNHA 4ZXYH 4DVAU 2ZDLA 3QTOH 3SV7A 1GI9B 5F03A 3A87A 2A7CA 3SU1A
chains in the Genus database with same CATH superfamily
2I6QA 1GVLA 3GY7A 1O2IA 2QN5T 2G55A 5EG4A 6CHAB 1BHXB 2OC0A 4JMYA 3A81A 1TNLA 1QFKH 1O38A 2B7DH 1WOFA 1O3DA 1W12U 1KY9A 4WXVA 2ODPA 1MKXH 3F9GA 1YLCA 1C5YB 3RXUA 1AY6H 2EA3A 1SGQE 2FP7B 3TGJE 2HALA 1C2IA 3NK8A 3OEHD 2BXUH 2DE8A 5FX5A 3RC5A 4AFUA 1TOCB 3ZV9A 1QB9A 1IHTH 1FDPA 1NU9A 1MCTA 1SG8B 1YPGH 4ABJA 4H6TA 1LHFH 3SNAA 1WUNH 4IN1A 4P02A 3S9AA 2Z9GA 1YLDA 3PRDA 2CF8H 3L33A 2D26C 4IS5A 3VXEH 1OKXA 4WVPE 3MNBA 1K1PA 2QXJA 1UVTH 4CRDA 1C5SA 3EA7A 4OM9A 3C27B 4X2XA 1GI7B 2OTVA 4B2BA 2Q6DA 1GMCG 3T5FH 3DHKH 4NA8A 4AZ2B 2VVVA 1T32A 4BTUB 1Z6EA 3PV2A 2NU2E 4YLUA 4INLA 2C90B 1QA0A 1W3CA 2FI4E 1TNKA 3IWMA 1GBHA 3UOUA 3LGYA 3A8CA 3LPRA 4ASHA 1S0RA 2PP6A 5ESTE 2PKSB 4NSVA 3GCTF 1QA7A 1O39A 1AUJA 2WSSD 2J38A 1EP5A 1WXRA 2VU8E 4K69A 1IQLA 2H2ZA 1ETRH 3E0NB 2VGCC 2JETC 4YOGA 2A4OA 2BOKA 1ZGVA 5JB8S 5KEDA 1H4WA 4NSYA 1BRAA 1W0ZU 3O8RA 2BD3A 4MNVA 1LKBA 3DSPA 1C2JA 1O5EH 1OWEA 1A7SA 4PROA 2FDAA 1ZLRA 4JK6A 1TPSA 1SGRE 4OS1A 1S6HA 3UY9A 2BY8X 3LC5A 1SMFE 1DPOA 3MH6A 1O2YA 1E1RD 3TH3H 3QN7A 1NS3A 4Q4LA 1HAIH 3MU1A 1A0HB 2VH6A 3ZZ5A 1OHHD 2JETB 3LGVA 2F91A 1GCTC 2ZDVH 3PROA 2LNCA 2ZC9H 3A8AA 1GBAA 3AVZA 3A7ZA 1DANH 1UVOA 4D9QA 4E05H 3GS9A 1LVOA 4X1NU 2SFAA 4YM9A 1HIAA 1IOEA 1GHVH 2P3FH 1Z71A 3PLPA 4Q2KA 4ZUHA 2O8UA 2GTBA 1TPAE 1AKSA 1PYTD 5HIZA 3TGKE 1NT1A 3N99A 5LPEA 2QY0B 2C8ZB 2ZDNA 4Z0KA 1TMUH 1CE5A 3ZVEA 9ESTA 2ANYA 1TGSZ 4AB9A 1F5RA 2ZFPH 1GBDA 4Y7AA 1QBVH 1G2LA 1O2HA 1PJPA 2ZFTA 1GCTB 3DFLA 1W0YH 1EKBB 1PPZA 2YNBA 1A0LA 3SORA 1QNJA 1PQAA 1O2XA 1ANCA 4OS7A 3MQKC 1C5ZB 1UK2A 2ZECA 2KR7A 2QIQA 3NKKA 4O03A 1L1NA 1WTHD 5E2PA 5L2ZH 1P2IA 1O3JA 1H9HE 2TGTA 2BDYA 2V0BA 5T1VA 1ZJDA 2A32A 2OBOA 1KXAA 3SGAE 3PMBB 4WF8A 3SUFA 1QB6A 4TWWA 2XBXA 1QJ7B 1S83A 4GCHG 3SHAH 3ATWA 4ZH8A 2ZDAH 5DP3A 3MWIU 3JZ2B 3HKIB 1BA8B 1GI6A 1HAYB 1HIAB 1W14U 1DY9A 3O8CA 3LIWA 1AKSB 1DICA 3VPKA 2BD8A 1PQ5A 2VH0A 5DJ7A 2FOGA 1AMHA 1CGJE 2ZU3A 1GBFA 1Y3WA 1XXFA 2HVXA 5DP6A 8ESTE 1X7AC 2FOCA 1CT2E 3A8DA 3ZVAA 1YLNA 1SLVB 1VCQA 4RI0A 1UTPA 1GJ5H 2ULLA 1D6RA 3SNBA 2BD5A 3RXEA 4R0IA 2G4TA 4CH2B 4TT3D 1KXFA 4LXBH 1AIXH 3ZVBA 3SI4H 3ZYEA 5C0UA 2R3YA 3BG4B 1A5GH 3ZZ4A 2A7HA 3KQCA 3S7KB 1SGPE 1UHBA 2ZCKP 3AAUA 4B73A 2OC8A 1V2KT 1SFQB 2ASUB 3T27A 1AFQB 3A85A 1C1SA 2ZQ1A 3I29A 3OE7D 1QGFA 3MH4A 4ISOA 1A1RA 1MCVA 1E35B 3A7XA 2Y80A 2SGPE 4NIWA 1UVUH 8KME2 1AVGH 5E0JA 8LPRA 1ORFA 4BXWA 3QO6A 1DWBH 1LVMA 2PGQB 3PTBA 4DG4A 2K8IA 3A82A 5HM9A 4ZKSU 5JBBS 1SGFG 4WMDA 4GHTA 3PYHA 5K0HA 1YPKH 1K1MA 2SGDE 4DY7B 1PFXC 1XXDA 2ZU5A 1V2UT 3B23B 1D4PB 2GDEH 1F0SA 4ZROA 2PSXA 4X8TH 1FY3A 2C93B 5DP5A 5EW1H 1ESAA 3CP7A 1OWHA 3FVFB 2QF0A 3T62A 1O3GA 1S5SA 2XW9A 4ABAA 1GBTA 3U1IB 2ZTXA 4NGAH 1XMNB 3MU8A 1T8LA 4ISLA 4MPWA 4CR9A 4NZLA 1T8MA 2Z9KA 2C8XB 1W11U 2ALVA 3PB1E 1IQHA 2KAIA 2Q6FA 4JYTA 3SQEE 1NPMA 2UWLA 1PPGE 4FUHA 4Y8ZA 2HNTC 1O2QA 3RXPA 1N6YA 1GBCA 1UHBB 4D76A 1V3XA 7KMEH 1YGCH 1BT7A 2XWBI 1AVWA 3BTKE 3DFJA 4UFGH 3NUMA 1JIRA 2FX6A 3V0XA 1C1QA 1LCYA 4IC6A 1O2NA 1PQ8A 3STJA 2VVUA 1AUTC 3F0PA 5A8XA 4XDEA 2O8MA 1AB9B 1SQOA 5C0TA 1W0JD 5FBIA 2EI7A 3ENSB 2ZTYA 2BY9X 4B6EA 2WZQA 2FTMA 2BY5X 1HAZB 2AEIH 3MO6A 1BJUA 3URDA 4FVBA 1T31A 4K60A 2CMYA 1SPJA 5FPSA 1ELDE 1FQ3A 2XNDD 1LQEA 5GPIB 3GDSA 4X0WU 3PMJA 1HYLA 5FPTA 1C2DA 5I25A 1FIZA 4BOHA 2F4LA 1GJ4H 1IHSH 3O8BA 4Y0ZE 1XUJA 1UTQA 1GPZA 5DKMA 1GDNA 1QIXB 1ZZZA 3PV5A 4O97A 2F9NA 1LVBA 4B76A 2UUYA 3GYLB 2EY4C 2JIZD 2XRCA 1D6WA 1O3KA 3D23A 1EASA 2AS9A 3QGJA 2C4FH 1TA2A 1NN6A 1ZRKA 4UD9H 1O2MA 1ZMNA 2KAIB 3GY3A 4AFZA 1YBWA 5C94A 1NBMD 1MAXA 2F9OA 4I33A 1J9CH 1O32A 1SGIB 1YF4A 1IQKA 1H1BA 2THFB 2WPIS 2Y7XA 3DA9B 5BPEA 4DOQA 4XD7D 3PM3A 1WBGB 3F9EA 2A0QB 2AMPA 1GJAB 3HGPA 2TGDA 4Y6DA 2BVRH 2V35A 3M5MA 3SJ9A 1HAGE 3OTPA 5F8TA 3GDUA 1ZHPA 2RA3A 4OS6A 1O2SA 3PTNA 1EJMA 1NU7B 3AW1A 3ZZ3A 4YLQH 3RXMA 1JIMA 2VWMA 3KHVA 3RXOA 1E79D 1K2I1 1TONA 4SGBE 1MABB 4YT6H 2Y7ZA 3BTQE 4F49A 1UTLM 4CRFA 2SNVA 1GHZA 5HGGA 3D65E 3VB3A 1O3HA 1F92A 5E0HA 3TJVA 1Q31A 1BTXA 4MPUA 4CHAB 8GCHF 2Z94A 5LGOA 1QRWA 1SB1H 5FX6A 1C4Y2 2R9PA 5T3HA 4U32A 3RXGA 1TLDA 1O31A 1OPHB 1S0QA 2Z6BD 5C3NA 2BYAX 4HGCA 1AHTH 3BTDE 1BB0B 4RSPA 3KQ5A 1C5OH 2C3SA 4M9FA 4X2VA 3ODFA 1C2GA 3N7OA 1ZPCA 1O5BB 1QHRB 1UMAH 2GCHF 4X6PA 3WWFA 3STIA 1G3EA 1O3AA 1C5TA 2XBWA 1H9LB 7GCHF 5HM2A 1TOMH 2G00A 4TWYA 1HB0B 4MDSA 3BIUH 3RU4T 4ABBA 1D3PB 1FAXA 2H5DA 4ZHLU 3M7TA 1C5QA 2HNTE 3U8RH 2VIOA 1TALA 5DGJA 1ZMLA 4DURA 1W2KH 1QJ6B 1ELVA 1MTNB 3FAOA 3T28A 4Q7ZA 1VGCC 2CGAA 3SHCH 1DOJA 1S81A 2P8OC 1U6QA 5EPNA 2YMSB 3RDZA 3VB7A 2HPPH 1SHYA 1V2LT 5F53A 2BDGA 1EZXC 1TRYA 1QL7A 4NIVA 3ZZ9A 1OWIA 2WHXA 4DIIH 3BEIB 1OP8A 4AG2A 3HGNA 4VGCC 4HI3A 1C5UA 2A1DB 1W7GH 3KYGA 2STAE 3UOPA 3GISB 5FPYA 1L0ZA 5DSFA 3A7YA 1EP6A 2KZ4A 1J8AA 2OXSA 1GHAF 1VITH 3PLKA 3FP7E 1VGCB 2Z3DA 3LH1A 2F9UA 2UWOA 5GWZA 2LELA 1FN6A 2P8OB 2AHME 3U69H 1QBNA 1ELGA 1MD8A 1MZAA 3U8TH 4ESTE 3SGBE 4WXIA 4JZIA 1ANEA 3LH3A 2FLRH 1P04A 2G5VA 3MTYA 4OGXA 1GDUA 5EIYA 2ZPSA 1PPFE 4NFEA 1SGNE 1AGJA 1CSOE 1NRSH 1SOZA 5J4QA 2ZU2A 1AZ8A 2H9TH 2WV4A 2P16A 4TPYA 3UNQA 2ZDMA 5EGMA 2BZAA 1C5XB 3CS0A 3ZYDA 4K5ZA 5JBCS 4DT4A 1BHXF 2BDCA 1FLEE 4MG3A 3SU4A 1G2MA 2UUJB 2A4GA 2ZGCA 2BDBA 3BTWE 1FI8A 1MKWH 1CGHA 5C5OA 1W10U 1MZDA 2STBE 3VEQB 2W26A 1GI1A 2Z9JA 3BTTE 1AQ7A 1VKYA 2BLQA 1BMLA 1FZZA 3EA8A 4IC5A 1EFRD 2TPIZ 3RXVA 5C20A 2ZFQH 2QGRA 3D49H 1KMHB 3LONA 3SJKA 1TX6A 1A0JA 1LDTT 4FETA 2JKHA 2BLWA 2QXHA 1C2MA 1ELAA 1TX8A 2BM2A 1S6LA 3P8GA 3QUMP 1DE7H 4AG1A 1GHBF 4AFSA 1YPLH 1FJSA 2W6ID 2O8WA 3SQHE 1O5AB 1UTJA 1XVMA 2SGQE 2CV3A 4X6OA 4JZ1A 1VITF 3P92A 1DWCH 3MFJA 2QYIA 3SU5A 5EJZA 5F6MA 1XX9A 3TLOA 3OY5U 1O37A 1BITA 3PO1C 2ILNA 1TABE 2A5IA 4MLFB 1EAWA 1EX3A 2OD3B 5F8XA 2BLOA 3K65B 1VCPA 1C5VA 3TK9A 2A4QA 1Q2WA 1LPZB 1SQRA 4GAWA 1YPJH 1O3EA 3HATH 4U30A 1C4U2 1QRXA 1LMWB 4THNH 2GDDA 4ZKOU 1EXFA 4J1YA 1SOTA 4ABGA 1TIOA 3OEED 3RMLH 5B6OA 3RC6A 1IQJA 4ZMAH 2D2DA 2FX4A 2SGEE 5EOKA 4A7IB 1JRSA 2QAAA 1T8NA 2SGAA 2R2MB 5AFZH 1VZQH 1HAXB 9LPRA 1DUEA 1P8VC 1TE0A 2OC7A 1EAXA 2M2AA 2PHBA 4K1TA 3QTVH 4I8HA 3U8OH 1CT0E 5E0GA 1BBRH 3SU2A 1P9SA 3A89A 1V2VT 5A0CA 5DP4A 1MTWA 1SLWB 1THPB 4Q7XA 4WJG2 4Y71A 1YWUA 4IN2A 5FCKA 1H8IH 1V2TT 1ZMJA 3DT0H 3DD2H 1P9UA 1YM0A 1ESTA 3A83A 1WV7H 3ZVCA 1GBLA 1EOJA 2VJ1A 4NFFA 1V2QT 2JH0D 3KF2A 1K1IA 4LZ1H 1D3TB 1S84A 4OS5A 2ZI2H 3F2GA 4YTAA 3UUZA 1EZQA 2H6MA 1MD7A 1TGBA 3TH4H 5ABWA 1ARBA 1F0UA 1T4VH 4IGDA 3GY5A 4BAKB 1P2NA 1ZSLA 3H7TA 3V3MA 4CRAA 2HVYB 4ISIH 3ZV8A 1IQFA 2ZGXH 2QE7D 4X2WA 2UUFB 1THSH 1O2UA 1RS0A 3E91A 1NBME 1DS2E 4X8SH 1NC6A 1FPHH 2F9BH 2IOTA 3I78A 3RLWH 2QV1A 4UEHH 1QQUA 1DITH 5IDKA 2ALPA 1PPCE 2WV9A 1NFUA 1JXPA 1VITG 4Q80A 4F4OC 1F0TA 2VWOA 4MTBA 2BDHA 4CBNA 3BF6H 1RIWC 1AWHB 2A4RA 1ESBA 1SC8U 5HIYA 1OYTH 1KTTB 1XKAC 2VGCB 2KFWA 3UAIC 3ODDA 3LGWA 3RXJA 4DW2U 2L74A 3M5OA 4FU7A 3S9BA 1BQYA 2PUQH 3EGKH 1DT2A 4FVDA 1MTSA 3GCOA 4K1EA 2QXGA 3TJOA 2A2XH 1CHOF 3TH2H 5A8YA 1RIWB 2PFEA 2QF5A 3W95A 1HUTH 4GHQA 2FS8A 1KXCA 1YC0A 1WTGH 1W13U 4DIHH 1L1GA 5KGOA 2Y81A 2WUCA 4TY7A 2FIRH 3LKWA 4I31A 4ZHMU 1FONA 2ZGHA 1Y3XA 2ANKH 1O3PB 3FN8A 5EQSA 3MH7A 4YT7H 4NIXA 2FYRA 1YCPM 5F8ZA 1ARCA 1Z8IB 2GJGA 3SN8A 1SGFA 2VNTA 1RJXB 1QL8A 4Z6AH 1ZTJA 1O2TA 4IBLH 1BJVA 1A5HA 3MU4A 4MNYA 2BZ6H 2VIDA 1GCDA 1AFEH 1RD3B 3KL6A 2J4IA 1GJ6A 2LPRA 3TGIE 4FXGH 1O2VA 1KTSB 2V7QD 1O2ZA 1C5RA 5JYIA 3BSQA 4AX9H 1AZZA 2AH4X 2ZA5A 4NZQA 2JJ1D 1AI8H 1DFPA 2M5TA 1GI5A 3HPTB 1GWAA 1O5FH 2ZZUH 1XVOA 2G4UA 1Z1IA 2IJOB 2FO9A 5GCHF 2XCFA 1GJ8B 2PTCE 3AW0A 3LGUA 1F7ZA 2H1UA 4IMZA 4ABHA 4UDWH 3GCTG 3ZVFA 1LQDB 1HJ8A 2WYJA 1BMNH 1TQ7B 2WPKS 3EA9A 3TITA 1K0HA 1MBQA 1P3CA 3RUOA 4K2YA 1SVPA 4B75A 4MPXA 3M3TA 1P09A 1HRTH 1Y3UA 4FUJA 2FESH 1V2OT 3RXDA 2XBVA 2W6JD 2GZ9A 3QWCH 3SV6A 4D9RA 2PWXA 3SGQE 2EEKA 3H7OA 2AYWA 4AFQA 1FMGA 3ZZ8A 3T29A 3QZRA 4GSOA 2JH6D 2F9PA 2GMTC 1RXPA 1N6XA 1GJBB 1K22H 3RU4E 1Y59T 5EODA 1GGDC 1J16A 4YO9A 3RMOH 2AMDA 5C2ZA 5C1YA 1YPHE 4Q63A 5EU8A 3TVJB 5DP9A 2FI3E 1YYY1 2ZTZA 3P8NA 2V3OH 5G4BA 3SW2B 1RTFB 4IMQA 4BTIB 3AAVA 4FU9A 2BDAA 2F43B 2GZ7A 3WW7A 1BDAA 5BRRE 1EPTC 4I8GA 4JCNA 3BTEE 3GY6A 4D7GA 5A0BA 4XFQA 1CHOG 3UR9A 1UW7A 3GYMA 1SLXB 3BN9A 1GGDB 5EQQA 1RFNA 1AWFH 3ELAH 1K1OA 2ZU4A 3GCHC 1TA6A 3LJOA 1ZJKA 1RTLA 1FXYA 1TFXA 5AFYH 1V2WT 1HAOH 3N7EA 1S85A 2A45B 2ZNKH 4KKDA 1HNEE 2SGFE 1PYTC 3A80A 1CVWH 1WAYB 3TNSA 5KECA 4IW4E 1Z8RA 3M5NA 1E34B 2YMSD 4KGAA 1BTUA 2FI5E 4A6LA 5LPFA 6LPRA 6GCHF 1A3EH 1C2KA 1OWKA 4H42U 1O2OA 3FKSD 1GG6C 4KTCA 1FY5A 1O2WA 2BD9A 3MYWA 1GL1A 3RXFA 3FO8D 3GCHB 5FL7D 2J98A 3SNCA 1HLTH 2VIQA 1GHWH 2XNIA 1JMOH 1UTMA 2XC5A 1FIWA 4YESB 4F55A 1BCUH 1P2JA 1TNGA 1C4V2 1K1JA 1ABIH 3RXAA 1L2EA 3SU6A 2VIVA 3U1JB 2ZF0H 1KIGH 4ISNA 3RXBA 1DWDH 1BBRE 1SR5C 5GCHG 1Q3XA 3I77A 1OWDA 2J9NA 3RM2H 2XXLA 3NWUA 4TPIZ 1KSNA 1K21H 4NA7A 2FOBA 4LZ4B 3RMMH 3V13A 1YPEH 3EAJA 5AVDA 1P05A 4M7GA 1ELTA 2SNWA 1UTNA 4RKJB 2HLCA 1C2LA 1ETTH 1C5LH 1JWTA 1K1LA 1QTFA 1G37A 2JDID 2OUAA 2AIPA 2FTLE 1F2SE 1ZSJA 1T8OA 1NRPH 2BY6X 1YKTA 2BQ6B 1DLEA 1GMDF 4WWYA 2FZZA 5LH8A 3RC4A 1O3NA 1ELFA 2FOAA 1TPPA 1ZHRA 1AN1E 1P2QA 4UFFH 1QCPA 1C1TA 3GY2A 5ESBA 4NWKA 3RLYH 2J98B 3QZQA 1UCYH 1O2LA 1Y5UT 4X6MA 1E38B 1SFIA 1SKYE 1CU1A 2PTNA 1MKXK 1DLKB 3ATKA 3E8LA 1PPEE 1P3EA 1NO9H 3GY8A 2GX4A 1Y8TA 2PKAA 3NZIA 2ZGJA 4YOIA 1UK3A 4AB8A 2B5TB 4ACAA 1C1OA 4FOUC 3U28C 1G3BA 2P3UB 2RG3A 1EOLA 1G3CA 1Z1JA 1GVKB 1XUFA 1H8ED 3SYJA 4ZKRU 3P8FA 1SHHB 2G8TA 5HMAA 4HZHA 1TX7A 2PW8H 2FODA 1E1QD 2V6NA 4JYUH 2P94A 4ZCNA 1C1RA 1GBBA 3MU0A 4B2CA 1HGTH 1ZOMA 4RT1A 5GXPA 3OAAD 4Q7YA 1LHGH 1NRRH 2A5AA 2J95A 4NA9H 4NWLA 3SV9A 5A2MH 1CO7E 3UQVA 3EE7A 4TY6A 4F48B 2UUKB 1BRUP 1HXEH 2J2UA 3ATMA 3W1EA 2IPQX 1YP9A 1W7XH 1DXWA 2RDEA 2WPMS 3BTGE 2BX3A 2FOMB 1GJ9B 3P8OA 5H4IB 2TIOA 1FV9A 2FXRA 2W7UA 1O5DH 2AGGX 2G81E 1W0KD 1IQEA 3OX7U 2GZ8A 3PWCA 1DX5M 2BLVA 2XCNA 1SGYE 1B5GH 2VB0A 4BAMB 1MTVA 2PKAB 2B0FA 3M3VA 2WYGA 4XBDA 3QGNB 1A46H 1TWXB 1Z6JH 2GT8A 3KEEA 3SV2H 3VG8A 1TMTH 1BRBE 3PLBA 2PUXB 5CDFE 1WYKA 2FWWA 1A4WH 1DDJA 2YOLA 1RTKA 4WH6A 3TU7H 1QBOA 1DSTA 2AGEX 1TGNA 2P3TB 3BEUA 4FUFA 3LOXA 2CXVA 2P59A 2VINA 3A7WA 4WMFA 3SBKA 5EXLA 1EJAA 2XC0A 1KDQA 4X1PU 3F2FA 4H4FA 1CA0C 1T7CA 1TNIA 2IN2A 4OS2A 1GBJA 1GMDG 2J5UA 5ETXA 3WY8A 1WDIA 3EDXB 4XRNA 4NCYA 2A2QH 3BV9B 4WY3A 4ZXXH 1HV7A 4I86A 3A86A 3ATLA 4VGCB 1CA8B 1MH0A 1BMMH 1BTPA 4GLYA 1INCA 1HPGA 1CQQA 3RP2A 3VXFH 1SLUB 3E6PH 1RRKA 4UONA 2LP6A 2FYQA 1O3BA 1BTYA 1N8OC 3VB4A 1TBZH 1DWEH 1SQTA 1O33A 2DUCA 4ZKNU 1ACBE 3ZZCA 4XBBA 1QZ8A 4RT0A 2IPHA 3OY6U 2EC9H 3UTUH 8GCHG 4Y8XA 1NROH 1BRCE 1KXBA 3UPEA 1IAUA 1L4DA 3CS7A 3F2HA 2Q6GA 1GI8B 5A09A 5EXNA 1J14A 4JYVH 4B1TA 4BTTB 1KDQB 1VJAU 3RXHA 1CHGA 3HK3B 4YZUA 4H6SB 2XTTB 4I32A 1TQ0B 2GCHG 3UNSA 4ABEA 1UK4A 1K1NA 3F68H 4HTCH 1ZRBA 4MNXA 4UE7H 4ZAEA 3B9FH 2K1QA 4AGJA 1GJCB 7GCHG 3BEFB 4CR5A 2HLDD 2TBSA 1SI5H 3RMNH 1SL3A 1EJNA 2Y5GA 3TJUA 1C5PA 2ZHFH 4HFPB 1PPBH 4E7NA 1TGCA 1HFDA 3TK5A 4DJZB 1ZYOA 3F0OA 2O9QA 1GL0E 3FOAA 4JK5A 5T6FA 2DE9A 1A5IA 3RXRA 1CBWC 1P10A 1TGTA 4X1SU 3MNSA 4X6NA 3SJIA 4MPVA 2HPQH 4XBCA 5A0AE 1C2FA 4Y11E 2OP9A 1P03A 3U9AH 2GT7A 5AHGH 2O8TA 3PO1B 3DSOA 1BMFD 5LPRA 3FP6E 3H09A 1QB1A 1NFYA 1P2MA 2D1JA 2GP9B 2Y5FA 4JZFH 3UR6A 4X8VH 1NFXA 2BQ7B 3KN2A 3UIRA 4DCDA 3SZNA 1GHAG 1BTZA 1C1VH 4K8YA 4DGJA 1H9IE 1CBWB 1FN8A 1UJ1A 1EAUA 1AE5A 3PWBA 5EJ1A 4GUXA 3RXCA 1GI3A 1V2PT 4K1SA 1G36A 1AVXA 4YOJA 3F3BA 5CHAC 4ISHH 1O2JA 1OP2A 3SJOA 4XOJA 3QX5H 1GHYH 4FUEA 2ZIQH 4DT7B 2BQWB 3LGIA 2C8YB 4WH8A 2Z9IA 1P11E 3LT3A 2NWNA 4OGYA 3A88A 1Y3VA 1FX0B 4B2AA 3UB0A 3RXTA 5T6DA 1O3IA 4A1VA 3DUXH 3E90B 2CK3D 1LKAA 1QURH 1ABJH 2ZHEH 1BTWA 2ZU1A 1VCWA 1Z7KA 2EI8A 2PKSC 1NTPA 2ANMH 4Y7BA 2FLBH 4GCHF 1MBMA 1LPGB 2JH5D 3MO3A 5CHAB 5FAHA 1OSSA 2AERH 3A84A 3LJJA 4ASUD 1W8BH 4A5TS 3VB6A 4CH8B 1GBEA 4P00A 1UCYE 3TNTA 2ZFRH 2Q1JA 5B6LA 4Y76A 3VFEA 2ESTE 1O3CA 1C1PA 1PQ7A 2OQUA 1NRQH 1YPHC 2GCTC 1GHBG 3PMHB 2O8LA 1OYQA 3G01A 2OCVB 3N7DA 5L2YH 1Y5AT 4Y10E 1EUFA 5C1XA 6ESTA 2NU1E 1VJ9U 2V3HH 3RXKA 2VIPA 1DXPA 2CJIA 4CREA 1SGDE 2WV5A 4O3TA 1NZQH 3EYDA 3M7UA 4BAHB 1DM4B 4QT8C 3OFND 3RXSA 4AGKA 2GCTB 1QY6A 1NFWA 1OP0A 1E37B 2FS9A 2TRMA 2EI6A 3KQDA 1LPKB 1O36A 1G30B 2Z3CA 1S82A 1XUKA 1KLTA 5EQRA 3E1XB 5GDSH 1AD8H 2P93A 2H5CA 2PGBB 2RA0A 2ZGBH 4E7RG 5JB9S 5GNDA 5E2OA 1D3DB 1FPCH 4BAQB 3M7QA 2WPHS 2ZCHP 5C17A 3ESTA 1LHDH 3MI4A 4I8JA 3PV4A 1O3OA 1J15A 1IQNA 2BVSH 1ELBA 1J17T 4B71A 5EJLA 1D9IA 1RGQA 1THRH 1QQ4A 2ZEBA 1UCYK 3H5CB 3CNRA 1P06A 1WQSA 2KCOA 3LDXH 5FBEA 3MO9A 4KP0A 1L4ZA 1HAHH 5DG6A 3JZ1B 2OQ5A 4FUIA 1VR1H 2KCPA 3BTME 3DSGA 3TPIZ 4CRCA 4FUDA 3SUDA 2I6SA 3ZVDA 1C1NA 1BUIA 3TJNA 1FY8E 2J94A 3W94A 2A31A 3GICB 2BDIA 1O5CB 2GV7A 5HYOA 5DPAA 2W3IA 3Q00A 1DVAH 1E0FD 3SU0A 1LHEH 3CENA 1SQAA 1HJAC 3E16B 2QCYA 3KCGH 1LTOA 1WCZA 3FZZA 1WU1A 3A8BA 1O34A 1YCPH 3ZIAD 2XC4A 1O3LA 3C1KA 1GJDB 1HDTH 4I8LA 2KCYA 2AGIX 1EQ9A 1GBMA 1GI2A 3NXPA 1B0EA 2QXIA 3KQEA 5HXFA 1DUAA 2H9HA 1BIOA 3BG4C 1TRMA 1SSXA 1Z8GA 2BMGB 2WPLS 1MTUA 5I46H 2V3MA 2BVXH 2GKVE 4UFDH 2ODQA 2Z3EA 1AFQC 3GY4A 1HJAB 3K6ZA 1JOUB 3BTHE 1EPTA 3B8JA 3OSYA 3M36A 3OYPA 3SI3H 5FXLA 2WINI 2ZO3H 3R3GB 4KTUA 2ZHQH 4D7FA 1QRZA 5DP8A 3L3TA 5A8ZA 4O9VA 1GVZA 2XOKD 5DO4H 1G9IE 4Y79A 4AORA 5CE1A 2PR3A 3KGPA 4TYDA 1GMHF 2JJ2D 1MQ6A 1B7XB 2HNTF 7LPRA 3ZZAA 1G32B 1A61H 1UTKA 1FY4A 5C5NA 2B9LA 1OS8A 5FCRA 2F83A 1HXFH 2A5KA 2RDLA 3SO3A 4MVNA 1UVSH 3E0PB 1C9TA 1IQGA 2C8WB 3DCLA 1K9OE 1ANBA 1SGTA 5E8EH 1TAWA 2BD4A 4UFEH 3K2UA 3SZEA 2K0QA 2H9EH 1AO5A 1O0DH 2VIWA 3HKJB 3Q76A 3BTFE 3L6PA 2QF4A 4I7YH 1MU6B 2GMTB 3IITA 3MNCA 1QJ1B 2CHAC 1AE8H 2B8OH 3MMGA 1V2RT 1P12E 5TCCA 3S69A 1TB6H 2L6OA 5EPYA 3SV8A 1EB1H 1CGIE 1LVYA 1FY1A 1XUHA 1DY8A 5J4SA 1C1UH 4BXSA 1HCGA 1P57B 3F1SB 4GVUA 2QF3A 1LO6A 2ODYB 2ZKSA 3EQ0H 1EPTB 4Y8YA 2ZFSA 3ITIA 4INHA 5T6GA 2WPJS 1PPHE 1AB9C 2QA9E 2CHAB 1EAIA 5TCAA 1TRNA 4A1XA 3Q3KA 3SU3A 3F9FA 3LC3A 1MKWK 3LGTA 1Y3YA 3SOSA 1HBTH 4XE4A 1C2HA 1KYNA 5CHBA 1EZUC 2PLXA 4NIYA 1QL9A 3UQOA 3R0FA 4AYYB 1ZPZA 1P02A 2FMJA 3RXQA 1V2MT 2G5NA 3V7TA 2OC1A 3BIVH 1GG6B 2GV6A 3UREA 4FU8A 3RM0H 4Y0YE 2AMQA 3GOVB 1ETSH 2F9VA 3TIUA 1O3MA 3OU0A 1OOKB 1KLJH 3M37A 4O3UA 4CRBA 2G51A 3FANA 3PRBA 3SJ8A 2FOHA 4U2WA 4JZEH 5GIBA 4X1QU 1BMAA 1H8HD 3URCA 3ZZ6A 1MQ5A 2OK5A 3PMAB 1GDQA 2BOHB 1C2EA 4D8NA 2G52A 1A2CH 5CMXH 4WMEA 3S9CA 2A7JA 4X1RU 3FFGA 5C67A 2NU4E 5C1UA 2BHGA 3UWJH 1NM6A 1COWD 4RN6A 3FZDA 3P6ZB 1YPMH 2D8WA 1F5LA 2GVFA 2AFQB 1GMHG 2ZPRA 3K6YA 4SGAE 4A1TA 1JRTA 2NU3E 2CN0H 1NESE 4FUBA 2Y6TA 4LK4A 3U98H 3GDVA 3MOCA 2GGVB 5IK2D 1P01A 1BZXE 1WSSH 3S7HB 5DP7A 5AF9H 1ANDA 4OS4A 4FUGA 4X2YA 1OXGA 3TK6A 1TNJA 4BANB 4XSKU 4CHAC 3Q77A 1GBIA 1C1WH 2WUBA 5SGAE 1NRNH 2FPZA 1TBRH 1DSUA 2PV9B 3KIDU 2VBCA 1FNIA 3UNRA 4MNWA 2R0KA 2ZP0H 3FP8E 4HG6A 1V2ST 1BBRK 3P17H 3RXIA 1UTOA 3ATIA 3OTJE 2ZPQA 3MU5A 1ELCA 1C5MD 1UO6A 3P95A 3ZZ7A 5IYTA 3QK1A 1MAYA 2F3CE 3VGCC 2GD4B 1ZTLA 4ACBA 1TBQH 1TYNA 2BY7X 3T2NA 1EZSC 2ZQ2A 3T26A 3SNDA 3LU9B 4I8KA 1KXDA 3NRLA 3SNEA 1FAKH 1V2JT 1ZHMA 1ELEE 2ZHWH 3S0NA 1KXEA 3QDZB 6GCHG 1ZR0A 4NG9H 3M5LA 1LHCH 3F9HA 2VWNA 2W5EA 3O8DA 1HAVA 1TMBH 2R2WU 2Y5HA 1P2KA 1XUIA 3IG6B 3M35A 3ZZDA 4CBOA 4ABIA 2ZG0H 3MNXA 4Z1MD 2R0LA 2Y82A 2KX4A 1MTNC 3VGCB 1C1MA 2W7SA 1O5GH 1YY3A 1IQMA 3NPSA 2YMSC 1O3FA 1SGCA 2ZHDA 3NCLA 1JBUH 4U01A 5K7RA 3T25A 2XBYA 5L6NH 3MH5A 4AC9A 1P0SH 4GPGA 3KQBA 2UWPA 4FUCA 1G3DA 4AYVB 1O2PA 1MU8B 2BB4A 1O30A 3KYFA 4B6FA 1GHXH 1IQIA 2QC2A 3VB5A 3M3SA 3V12A 2FOEA 2FEQH 2J97A 3UWIA 1C5WB 5EW2H 1K28D 3E3TA 1OWJA 1V2NT 5JBAS 1MMJN 4RKOB 1GBKA 1O2GH 1SBWA 1C9PA 2CF9H 1B0FA 2RCEA 3Q3XA 2BTCE 4R8TB 5JPMH 3A7VA 4K3JA 4JZDH 1D3QB 1WQVH 3RXLA 1HAPH 2PSYA 1HAVB 1O2KA 3EE0B 5JDUB 2IJD1 5GJ4B 2VWLA 3AASA 5FHTA 1ID5H 2J92A 2R3UA 4J2YB 4KTSA 3AK5A 3M61U 2BD7A 3KNXA 5PTPA 3HK6B 3F6UH 2XWAA 2NU0E 1Y5BT 2ANWA 1GI0A 4KELA 1CA0B 4INKA 2HWLB 2YNAA 1GI4A 2ZCLP 2BX4A 4LOYH 2TGAA 5L30H 3K9XB 1XKBC 1ZGIA 1O35A 2P95A 2ZDKA 4ZHAA 1EATA 1GJ7B 1GMCF 2XYAA 1ZTKA 3BG8A 1HJ9A 3A7TA 2AIQA 3RU4D 4MQAA 1ZSKA 3SUEA 1MUEB 2KCAA 1F0RA 1SGEE 4ABDA 2BXTH 2OINA 3UFAA 2RFKC 1F5KU 1FUJA 1OX1A 4BAOB 5EXMA 2OLGA 4X8UH 3SUGA 1TPOA 5HKKD 1N8OB 1P2OA 1E36B 3WWBA 4CRGA 1N1LA 2FM2A 1UVPA 1XUGA 4TSFD 3ZZBA 1CT4E 5DK1A 4A92A 1A3BH 1S6FA 4BNRA 2HOBA 2HRVA 5DN6D 1M9UA 1XM1A 2HGTH 3P70B 1BOQA 1T4UH 3ZVGA 2BD2A 1QR3E 3D62A 2FOFA 5JBTA 4K8BA 1NY22 3GCNA 2Z7FE 4B74A 1V6DA 2J34A 4ABFA 4YXWD 6CHAC 2ZWLH 1L1JA 2KM0A 4AN7A 2VVCA 2Z9LA 1YCPK 1Z8JB 2W3KA 2EQNA 4E06H 1O2RA 1KLIH 1EB2A 4AOQA 1AU8A 1BTHH 3Q3YA 3QLPH 1C5NH 7ESTE 2WPDD 2OBQA 2ZFFH 1ZPBA 2TGPZ 1H8DH 5TJXA 3MHWU 1TNHA 4ZXYH 4DVAU 2ZDLA 3QTOH 3SV7A 1GI9B 5F03A 3A87A 2A7CA 3SU1A
chains in the Genus database with same CATH topology
2I6QA 1GVLA 3GY7A 1O2IA 2QN5T 2G55A 5EG4A 6CHAB 1BHXB 2OC0A 4JMYA 3A81A 1TNLA 1QFKH 1O38A 2B7DH 1WOFA 1O3DA 1W12U 1KY9A 4WXVA 2ODPA 1MKXH 3F9GA 1YLCA 1C5YB 3RXUA 1AY6H 2EA3A 1SGQE 2FP7B 3TGJE 2HALA 1C2IA 3NK8A 2BXUH 2DE8A 5FX5A 3RC5A 4AFUA 1TOCB 3ZV9A 1QB9A 1IHTH 1FDPA 1NU9A 1MCTA 1SG8B 1YPGH 4ABJA 4H6TA 1LHFH 3SNAA 1WUNH 4IN1A 3S9AA 2Z9GA 1YLDA 2CF8H 3L33A 2D26C 4IS5A 3VXEH 1OKXA 4WVPE 3MNBA 1K1PA 2QXJA 1UVTH 4CRDA 1C5SA 3EA7A 3C27B 4X2XA 1GI7B 2OTVA 4B2BA 2Q6DA 1GMCG 3T5FH 3DHKH 4NA8A 4AZ2B 2VVVA 1T32A 4BTUB 1Z6EA 4YLUA 2NU2E 4INLA 2C90B 1QA0A 1W3CA 2FI4E 1TNKA 3IWMA 1GBHA 3UOUA 3LGYA 3A8CA 3LPRA 4ASHA 1S0RA 5ESTE 2PKSB 4NSVA 3GCTF 1QA7A 1O39A 1AUJA 2J38A 1EP5A 2VU8E 4K69A 1IQLA 2H2ZA 1ETRH 3E0NB 2VGCC 2JETC 4YOGA 2A4OA 2BOKA 1ZGVA 5JB8S 1H4WA 4NSYA 1BRAA 1W0ZU 3O8RA 2BD3A 4MNVA 1LKBA 1C2JA 1O5EH 1OWEA 1A7SA 4PROA 2FDAA 1ZLRA 4JK6A 1TPSA 1SGRE 4OS1A 1S6HA 3UY9A 2BY8X 3LC5A 1SMFE 1DPOA 3MH6A 1O2YA 3TH3H 3QN7A 1NS3A 1HAIH 3MU1A 1A0HB 2VH6A 3ZZ5A 2JETB 3LGVA 2F91A 1GCTC 2ZDVH 3PROA 2LNCA 2ZC9H 3A8AA 1GBAA 3AVZA 3A7ZA 1DANH 1UVOA 4D9QA 4E05H 1LVOA 4X1NU 2SFAA 4YM9A 1HIAA 1IOEA 1GHVH 2P3FH 1Z71A 3PLPA 4Q2KA 4ZUHA 2O8UA 2GTBA 1TPAE 1AKSA 1PYTD 3TGKE 1NT1A 5LPEA 2QY0B 2C8ZB 2ZDNA 4Z0KA 1TMUH 1CE5A 3ZVEA 9ESTA 2ANYA 1TGSZ 4AB9A 1F5RA 2ZFPH 1GBDA 4Y7AA 1QBVH 1G2LA 1O2HA 1PJPA 2ZFTA 1GCTB 3DFLA 1W0YH 1EKBB 1PPZA 2YNBA 1A0LA 3SORA 1QNJA 1PQAA 1O2XA 1ANCA 4OS7A 1C5ZB 1UK2A 2ZECA 3NKKA 2QIQA 4O03A 1L1NA 1WTHD 5E2PA 5L2ZH 1P2IA 1O3JA 1H9HE 2TGTA 2BDYA 2V0BA 1ZJDA 2A32A 2OBOA 1KXAA 3SGAE 3PMBB 4WF8A 3SUFA 1QB6A 4TWWA 2XBXA 1QJ7B 1S83A 4GCHG 3SHAH 3ATWA 4ZH8A 2ZDAH 5DP3A 3MWIU 3JZ2B 3HKIB 1BA8B 1GI6A 1HAYB 1HIAB 1W14U 1DY9A 3O8CA 3LIWA 1AKSB 1DICA 3VPKA 2BD8A 1PQ5A 2VH0A 5DJ7A 2FOGA 1AMHA 1CGJE 2ZU3A 1GBFA 1Y3WA 1XXFA 2HVXA 5DP6A 8ESTE 1X7AC 2FOCA 1CT2E 3A8DA 3ZVAA 1SLVB 1VCQA 1UTPA 1GJ5H 2ULLA 1D6RA 3SNBA 2BD5A 3RXEA 4R0IA 2G4TA 4CH2B 1KXFA 4LXBH 1AIXH 3ZVBA 3SI4H 3ZYEA 2R3YA 3BG4B 1A5GH 3ZZ4A 2A7HA 3KQCA 3S7KB 1SGPE 1UHBA 2ZCKP 3AAUA 4B73A 2OC8A 1V2KT 1SFQB 2ASUB 3T27A 1AFQB 3A85A 1C1SA 2ZQ1A 3I29A 1QGFA 3MH4A 4ISOA 1A1RA 1MCVA 1E35B 3A7XA 2Y80A 2SGPE 4NIWA 1UVUH 8KME2 1AVGH 5E0JA 8LPRA 1ORFA 4BXWA 3QO6A 1DWBH 1LVMA 2PGQB 3PTBA 4DG4A 3A82A 5HM9A 4ZKSU 5JBBS 1SGFG 4WMDA 4GHTA 3PYHA 5K0HA 1YPKH 1K1MA 2SGDE 4DY7B 1PFXC 1XXDA 2ZU5A 1V2UT 3B23B 1D4PB 2GDEH 1F0SA 4ZROA 2PSXA 4X8TH 1FY3A 2C93B 5DP5A 5EW1H 1ESAA 3CP7A 1OWHA 3FVFB 2QF0A 3T62A 1O3GA 1S5SA 2XW9A 4ABAA 1GBTA 3U1IB 2ZTXA 4NGAH 1XMNB 3MU8A 1T8LA 4ISLA 4MPWA 4CR9A 4NZLA 1T8MA 2Z9KA 2C8XB 1W11U 2ALVA 3PB1E 1IQHA 2KAIA 2Q6FA 4JYTA 3SQEE 1NPMA 2UWLA 1PPGE 4FUHA 4Y8ZA 2HNTC 1O2QA 3RXPA 1N6YA 1GBCA 1UHBB 4D76A 1V3XA 7KMEH 1YGCH 1BT7A 2XWBI 1AVWA 3BTKE 3DFJA 4UFGH 3NUMA 1JIRA 2FX6A 3V0XA 1C1QA 1LCYA 4IC6A 1O2NA 1PQ8A 3STJA 2VVUA 1AUTC 5A8XA 4XDEA 2O8MA 1AB9B 1SQOA 5FBIA 2EI7A 3ENSB 2ZTYA 2BY9X 2FTMA 2BY5X 1HAZB 2AEIH 3MO6A 1BJUA 3URDA 4FVBA 1T31A 4K60A 2CMYA 1SPJA 5FPSA 1ELDE 1FQ3A 5GPIB 1LQEA 3GDSA 4X0WU 3PMJA 1HYLA 5FPTA 1C2DA 5I25A 1FIZA 4BOHA 1GJ4H 1IHSH 3O8BA 4Y0ZE 1XUJA 1UTQA 1GPZA 5DKMA 1GDNA 1QIXB 1ZZZA 4O97A 2F9NA 1LVBA 4B76A 2UUYA 3GYLB 2XRCA 1D6WA 1O3KA 3D23A 1EASA 2AS9A 3QGJA 2C4FH 1TA2A 1NN6A 1ZRKA 4UD9H 1O2MA 1ZMNA 2KAIB 3GY3A 4AFZA 1YBWA 1MAXA 2F9OA 4I33A 1J9CH 1O32A 1SGIB 1YF4A 1IQKA 1H1BA 2THFB 2WPIS 2Y7XA 3DA9B 5BPEA 4DOQA 3PM3A 1WBGB 3F9EA 2A0QB 2AMPA 1GJAB 3HGPA 2TGDA 4Y6DA 2BVRH 2V35A 3M5MA 3SJ9A 1HAGE 5F8TA 3GDUA 1ZHPA 2RA3A 4OS6A 1O2SA 3PTNA 1EJMA 1NU7B 3AW1A 3ZZ3A 4YLQH 3RXMA 1JIMA 2VWMA 3KHVA 3RXOA 1K2I1 1TONA 4SGBE 4YT6H 2Y7ZA 3BTQE 4F49A 1UTLM 4CRFA 2SNVA 1GHZA 5HGGA 3D65E 3VB3A 1O3HA 1F92A 5E0HA 3TJVA 1Q31A 1BTXA 4MPUA 4CHAB 8GCHF 2Z94A 5LGOA 1QRWA 1SB1H 5FX6A 1C4Y2 2R9PA 5T3HA 4U32A 3RXGA 1TLDA 1O31A 1OPHB 1S0QA 2Z6BD 5C3NA 2BYAX 4HGCA 1AHTH 3BTDE 1BB0B 4RSPA 1C5OH 2C3SA 4X2VA 3ODFA 1C2GA 3N7OA 1ZPCA 1O5BB 1QHRB 1UMAH 2GCHF 4X6PA 3STIA 1G3EA 1O3AA 1C5TA 2XBWA 1H9LB 7GCHF 5HM2A 1TOMH 2G00A 4TWYA 1HB0B 4MDSA 3BIUH 3RU4T 4ABBA 1D3PB 1FAXA 2H5DA 4ZHLU 3M7TA 1C5QA 2HNTE 3U8RH 2VIOA 1TALA 5DGJA 1ZMLA 4DURA 1W2KH 1QJ6B 1ELVA 1MTNB 3FAOA 3T28A 4Q7ZA 1VGCC 2CGAA 3SHCH 1DOJA 1S81A 2P8OC 1U6QA 5EPNA 3VB7A 3RDZA 2HPPH 1SHYA 1V2LT 2BDGA 1EZXC 1TRYA 1QL7A 4NIVA 3ZZ9A 1OWIA 4DIIH 3BEIB 1OP8A 4AG2A 3HGNA 4VGCC 4HI3A 1C5UA 2A1DB 1W7GH 2STAE 3UOPA 3GISB 5FPYA 1L0ZA 3A7YA 1EP6A 2OXSA 1J8AA 1GHAF 1VITH 3PLKA 3FP7E 1VGCB 2Z3DA 3LH1A 2F9UA 2UWOA 5GWZA 2P8OB 1FN6A 3U69H 1QBNA 1ELGA 1MD8A 1MZAA 3U8TH 4ESTE 3SGBE 4WXIA 4JZIA 1ANEA 3LH3A 2FLRH 1P04A 2G5VA 3MTYA 4OGXA 1GDUA 2ZPSA 1PPFE 4NFEA 1SGNE 1AGJA 1CSOE 1NRSH 1SOZA 5J4QA 2ZU2A 1AZ8A 2H9TH 2WV4A 2P16A 4TPYA 3UNQA 2ZDMA 5EGMA 2BZAA 1C5XB 3CS0A 3ZYDA 4K5ZA 5JBCS 1BHXF 2BDCA 1FLEE 4MG3A 3SU4A 1G2MA 2UUJB 2A4GA 2ZGCA 2BDBA 3BTWE 1FI8A 1MKWH 1CGHA 5C5OA 1W10U 1MZDA 2STBE 3VEQB 2W26A 1GI1A 2Z9JA 3BTTE 1AQ7A 2BLQA 1BMLA 1FZZA 3EA8A 4IC5A 2TPIZ 3RXVA 5C20A 2ZFQH 2QGRA 3D49H 3SJKA 3LONA 1TX6A 1A0JA 1LDTT 2JKHA 2BLWA 2QXHA 1C2MA 1ELAA 1TX8A 2BM2A 3P8GA 3QUMP 1DE7H 4AG1A 1GHBF 4AFSA 1YPLH 1FJSA 2O8WA 3SQHE 1O5AB 1UTJA 1XVMA 2SGQE 2CV3A 4X6OA 4JZ1A 1VITF 3P92A 1DWCH 3MFJA 2QYIA 3SU5A 5F6MA 1XX9A 3TLOA 3OY5U 1O37A 1BITA 3PO1C 2ILNA 1TABE 2A5IA 4MLFB 1EAWA 1EX3A 2OD3B 5F8XA 2BLOA 3K65B 1VCPA 1C5VA 3TK9A 2A4QA 1Q2WA 1LPZB 4GAWA 1YPJH 1O3EA 3HATH 4U30A 1C4U2 1QRXA 1LMWB 4THNH 2GDDA 4ZKOU 1EXFA 4J1YA 1SOTA 4ABGA 1TIOA 3RMLH 5B6OA 3RC6A 1IQJA 4ZMAH 2D2DA 2FX4A 2SGEE 5EOKA 4A7IB 1JRSA 2QAAA 1T8NA 2SGAA 2R2MB 5AFZH 1VZQH 1HAXB 9LPRA 1DUEA 1P8VC 2PHBA 1TE0A 1EAXA 2OC7A 4K1TA 3QTVH 4I8HA 3U8OH 1CT0E 5E0GA 1BBRH 3SU2A 1P9SA 3A89A 1V2VT 5A0CA 5DP4A 1MTWA 1SLWB 1THPB 4Q7XA 4WJG2 4Y71A 4IN2A 5FCKA 1H8IH 1V2TT 1ZMJA 3DT0H 3DD2H 1P9UA 1YM0A 1ESTA 3A83A 1WV7H 3ZVCA 1GBLA 1EOJA 2VJ1A 4NFFA 1V2QT 2JH0D 3KF2A 1K1IA 4LZ1H 1D3TB 1S84A 4OS5A 2ZI2H 4YTAA 3UUZA 1EZQA 2H6MA 1MD7A 1TGBA 3TH4H 5ABWA 1ARBA 1F0UA 1T4VH 4IGDA 3GY5A 4BAKB 1P2NA 1ZSLA 3H7TA 3V3MA 4CRAA 4ISIH 3ZV8A 1IQFA 2ZGXH 4X2WA 2UUFB 1THSH 1O2UA 1RS0A 3E91A 1DS2E 4X8SH 1NC6A 1FPHH 2F9BH 2IOTA 3I78A 3RLWH 2QV1A 4UEHH 1QQUA 1DITH 5IDKA 2ALPA 1PPCE 1NFUA 1JXPA 1VITG 4Q80A 4F4OC 1F0TA 2VWOA 4MTBA 2BDHA 4CBNA 3BF6H 1RIWC 1AWHB 2A4RA 1ESBA 1SC8U 1OYTH 1KTTB 1XKAC 2VGCB 3ODDA 3LGWA 3RXJA 4DW2U 3M5OA 4FU7A 3S9BA 1BQYA 2PUQH 3EGKH 1DT2A 4FVDA 1MTSA 3GCOA 4K1EA 2QXGA 3TJOA 2A2XH 1CHOF 3TH2H 5A8YA 1RIWB 2PFEA 3W95A 1HUTH 4GHQA 2FS8A 1KXCA 1YC0A 1WTGH 1W13U 4DIHH 1L1GA 2Y81A 2WUCA 4TY7A 2FIRH 3LKWA 4I31A 4ZHMU 1FONA 2ZGHA 1Y3XA 2ANKH 1O3PB 5EQSA 3MH7A 4YT7H 4NIXA 2FYRA 1YCPM 5F8ZA 1ARCA 1Z8IB 3SN8A 1SGFA 2VNTA 1RJXB 1QL8A 4Z6AH 1ZTJA 1O2TA 4IBLH 1BJVA 1A5HA 3MU4A 4MNYA 2BZ6H 2VIDA 1GCDA 1AFEH 1RD3B 3KL6A 2J4IA 1GJ6A 2LPRA 3TGIE 4FXGH 1O2VA 1KTSB 1O2ZA 1C5RA 5JYIA 3BSQA 4AX9H 1AZZA 2AH4X 2ZA5A 4NZQA 1AI8H 1DFPA 2M5TA 1GI5A 3HPTB 1GWAA 1O5FH 2ZZUH 1XVOA 2G4UA 1Z1IA 2IJOB 2FO9A 5GCHF 2XCFA 1GJ8B 2PTCE 3AW0A 3LGUA 1F7ZA 2H1UA 4IMZA 4ABHA 4UDWH 3GCTG 3ZVFA 1LQDB 1HJ8A 2WYJA 1BMNH 1TQ7B 2WPKS 3EA9A 3TITA 1MBQA 1P3CA 3RUOA 4K2YA 1SVPA 4B75A 4MPXA 3M3TA 1P09A 1HRTH 1Y3UA 4FUJA 2FESH 1V2OT 3RXDA 2XBVA 2GZ9A 3QWCH 3SV6A 4D9RA 2PWXA 3SGQE 2EEKA 3H7OA 2AYWA 4AFQA 1FMGA 3ZZ8A 3T29A 3QZRA 4GSOA 2JH6D 2F9PA 2GMTC 1RXPA 1N6XA 1GJBB 1K22H 3RU4E 1Y59T 5EODA 1GGDC 1J16A 4YO9A 3RMOH 2AMDA 5C2ZA 5C1YA 1YPHE 5EU8A 3TVJB 5DP9A 2FI3E 1YYY1 2ZTZA 3P8NA 2V3OH 5G4BA 3SW2B 1RTFB 4IMQA 4BTIB 3AAVA 4FU9A 2BDAA 2GZ7A 1BDAA 5BRRE 1EPTC 4I8GA 4JCNA 3BTEE 3GY6A 4D7GA 5A0BA 4XFQA 1CHOG 3UR9A 3GYMA 1SLXB 3BN9A 1GGDB 5EQQA 1RFNA 1AWFH 3ELAH 1K1OA 2ZU4A 3GCHC 1TA6A 3LJOA 1ZJKA 1RTLA 1FXYA 1TFXA 5AFYH 1V2WT 1HAOH 1S85A 2A45B 2ZNKH 4KKDA 1HNEE 2SGFE 1PYTC 3A80A 1CVWH 1WAYB 3TNSA 4IW4E 1Z8RA 3M5NA 1E34B 4KGAA 1BTUA 2FI5E 4A6LA 5LPFA 6LPRA 6GCHF 1A3EH 1C2KA 1OWKA 4H42U 1O2OA 1GG6C