4K6BA

Atomic structure of bacteriophage hs1 tail needle knob
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
GSSRISALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSGTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGAAFTATTIKIIAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The tip of the tail needle affects the rate of DNA delivery by bacteriophage p22.
pubmed doi rcsb
source organism Unidentified phage
molecule tags Viral protein
molecule keywords HS1 knob domain
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1120 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k6bA00
4K6BA 3RWNA
chains in the Genus database with same CATH superfamily
4QXCA 4YGBA 1QJU2 2E63A 3LSEA 1NY71 2BDRA 2IFWA 3MI8A 3NNGA 3J7HA 2VZQA 1C1FA 3B00A 1W6MB 2CV6A 5HCBA 4DNYA 1HRI3 3E97A 1W6NB 4QB2A 1H4HA 5CISA 4D3WA 1HB2A 3DYOA 5LW9A 4AEJA 1VB2A 4M0NA 2VCMA 3H1YA 1YQ5A 5FBZA 1C8M1 2W1WA 1WKYA 3FFZA 3T4VA 3J7LA 4AAPA 1US3A 3KVAA 2J1VA 3RSJA 2YBSA 4BWOA 5LK7B 4KGGA 1OA2A 1GKBA 1LODA 1UX7A 3ZSLA 1MQTA 1YIPA 1C4RA 2YGMA 3AX4A 2A1XA 1W6PA 2W1UA 1CAWB 1SBFA 5T55A 4EQVA 3AZWA 3ZFFC 2P4EA 2GDFA 3AZVA 1Y3TA 3IT8A 4XEZA 3MFCA 2FCVA 2R043 5FP3A 1GP6A 2WO7A 5CG9A 5IVEA 2YROA 4NHXA 1ZBA1 4L99A 1PK6B 3HBZA 4HSJA 2VQ0A 3AYCA 4O9GA 3HBKA 1CZSA 3VDDA 4GD4A 1FV3A 1MS4A 5JPNB 5KXCA 2BYVE 2OQ7A 3R6SA 2VY0A 3VB9A 3ZO0B 3ZVXA 4DEQA 5LZ6A 2A6ZA 2L9LA 1LRHA 3V0BA 1HJGA 4RQPB 2Y6FA 2O8QA 4CUBA 1COV1 1G6NA 3PVEA 4S2HA 1QDOA 1O91A 3Q8EA 1D4M2 3DXTA 1FPN3 2G9FA 4XC9A 3WF0A 4YVSC 1KS5A 2AUYA 2RE9A 2WWJA 2P37A 2WWUA 2YBPA 2ZS6B 4YW4A 3RDIA 1NLSA 3V64A 4COZA 4EN6B 2WFF2 1OF4A 3H0OA 2W52A 4WZFA 5E88A 4AR2A 4EYUA 3RPQA 2UWBA 3GZUC 4Q4V3 2R072 5FZIA 3ST7A 1DGWX 2AENA 4RHV3 4CDWC 4WM7C 5F7UA 4Q0UA 5KHGA 1PO23 2GH2A 2D3SA 3KCYA 4FPLA 5A33A 1G9BA 4QPGC 5A70A 3ECQA 2VXRA 5J3UA 4RS5B 1W9WA 2BU9A 4HG6B 3MUY1 5GM0A 1GZTA 1XE0A 1NY72 4CDXB 3WW4A 3HMYA 4LT5A 3WHUA 4DUXA 3EMRA 4MUVA 4MG2A 4XILA 1UW8A 1XQNA 1W3VA 2GSYA 2CYFA 2XONA 3WQ7A 2UYBA 1QOSA 2FDGA 3ZR5A 5A7PA 1G7YA 4QX2A 5FUIA 4YZ3A 4Z07A 3A0KA 4ARYA 4TXWA 3W20A 1GZCA 2ZJCA 1GANA 4PBOA 1CJDA 2O1QA 3J8F2 2RS51 2PAMA 1O8SA 2Z69A 4DY5A 1SLLA 3NO8A 4CE8A 1E57A 1RUE3 2HLEA 4JKLA 3AC0A 4JDNA 1BHGA 1XU1A 3T3YA 1BVVA 3DKQA 4PIYA 3ZYBA 3T30A 4B7KA 4PQQA 1JUIA 4YWAA 3U78A 1F4AA 3VBUB 3UGGA 4JKKA 5KR7A 3M1HA 1WBFA 4F3JA 1JW6A 1W8ZA 2YV8A 4BMEA 1TE1B 5FPAA 5G05L 5A1LA 4RHV2 5LWBA 2Q8OA 3GBWA 3RWNA 1AYN1 2JG9A 1S0CA 2R1BA 1YQ8A 2EICA 2XUMA 1S0IA 5C8CB 3FLRA 3E1F1 4MOAA 3K4DA 1PZ9A 2WYSA 1C5IA 3JD72 1QWRA 1KS4A 3HNBM 5A1AA 5LRSA 1ENXA 3RZJA 5HCFA 5LA1A 4FSJA 2W0XA 4K9SA 3LE0A 3WG2A 3T1LA 1GQHA 1VBA1 1Y4WA 1PMHX 1XRUA 5H9SA 2D3RA 1Q8QA 3WP3A 3LDRA 3VBOB 3MGUA 4ORFA 1SACA 5FXVA 2ZGPA 3VD3A 2G9GA 4LBQA 5JIAA 2ZGMA 1BEV1 4XAAA 2ZA9A 4R9CA 1XPWA 2XBO2 2JB8A 1RVF3 1OI6A 4LULA 2P17A 1A8MA 2Z2SB 3B94A 3ZMOA 3WR0A 4RFT0 4N8MA 3AMHA 2ZGLA 2PAEA 3TEWA 4LKSA 1V6MA 1W8UA 1S0GA 5C9AA 2ZBJA 3HD8B 3OPTA 4XABA 3E6DA 2ZX2A 1YYNA 2CAUA 4NAOA 1KFXL 3APBA 1W8NA 1UAIA 2PHDA 2RM21 2WFPA 3WW1A 4FP2A 2WINB 1ASJ2 3V0AA 4I0AA 4CDQA 3H50A 5L7OB 3JB8A 5GZEA 1HRV3 1LESA 4YRDA 4YVWA 5C3PA 3A22A 2ZKLA 3BU0A 3O0XA 1POV0 4UAPA 4A3XA 3MLLA 4LHKA 3I3QA 1SLCA 4OYUA 5FV3A 5CKNA 1GP5A 5HCAA 1TME2 1AXYA 4AEDA 1Z7S1 3CZJA 1Y9GA 5LBCA 4FTBA 2B9UA 2E7AA 3B02A 4HK9A 3N9LA 2VZSA 3KCXA 1XOYA 1OQEA 2Q8DA 1FNZA 2RJKA 5CFDC 4Z1VA 4LXLA 3MIDA 2W92A 3QH6A 1Z7S2 5CNAA 1Y43B 2D44A 4CCDA 1ODNA 1PMIA 2XQRA 5ABJC 1JMUB 3WNXA 3L9JT 4ZU7A 4N43B 3N7MA 3MIHA 4GMP0 2RS12 1LR5A 1NZIA 3HN1A 4PDWC 3RJRA 3BUCA 5ABJB 3A21A 3JB4C 4M0HA 1O3SA 2ZX4A 1W0NA 1PVC2 2JWPA 3JQXA 1BBT3 2X53S 1N1YA 3OEBA 3NJZA 1I5ZA 4NVPA 3AMNA 4CEWA 1R1A3 1PO12 3SCFA 1UZ0A 4Q2FA 1XNTA 3LF7A 5IFPA 3NV4A 3WVJA 1W06A 4XBNA 1ASJ3 1S0EA 1BBT1 3LA3A 5FPBA 3ZYIB 4BQWA 5IJRA 1VBE2 3RZLA 2HBUA 4LORA 4Y24A 1RUF1 3RVHA 1QJFA 3G6JB 4HKOA 2WT0A 4M3CE 1O3TA 1O4TA 3VKNA 3LEMA 3U4XA 3VL9A 2X09A 2ZX0A 1ND3B 3POSA 1WMEA 1F31A 4DFSA 1H4GA 2V72A 3WT3A 3WNMA 2X29A 2WS91 1NZCA 1Z78A 4L9BA 5DUUA 2QJVA 3AJZA 4P00B 3RS6A 1T2XA 3D0SA 5J1XA 3NNJA 3KV6A 2D7FA 3LQCA 1JOPA 5I93A 2BERA 2R16A 1LENA 1GZWA 3B5LB 5KHKA 1KDMA 4I01A 2JEMA 5JIUA 1W8TA 5A3NA 3FHQA 1ZBE1 3HT1A 1R093 2ZGQA 2GC2A 5JXIA 1JS9A 3OUHA 5M0TA 4CDWA 1CAXB 2Y6LA 3R4UA 4RHV1 5BNOC 5A6YA 1IKPA 2P2KA 5JZGA 3FHAA 4XFCA 4DO0A 4X6QB 1OURA 1SHWB 2TUNA 1W03A 1AHSA 2W3JA 2RDRA 5AVPA 4AEDC 5LEJA 3E5QA 3BTYA 4ZY9A 3GCWA 3WUDA 1I1EA 2NMOA 3OBRA 4IERA 5GJ6A 1ZREA 3WCRA 3USUB 5IK8A 1LOBA 5GLVA 2WLPA 1ZBA2 3GF6A 3JBG2 1QJX2 2A3YA 3CJXA 5F3GA 1LJ7A 1ZZ9A 4YLZA 3T2OA 1UF2C 4LO4B 2TNFA 2ZMKA 3SQOA 3WNNA 4HN1A 1CONA 1OLMA 1SG3A 2R49A 4AGGA 1HIXA 3ZXKA 2WT1A 5FZKA 1B35C 1JYNA 1RUOA 4JDOA 3KMHA 3ABZA 4DXRA 3ACFA 3N7LA 4N53A 1ZRFA 4AVBA 1SBEA 4Y20B 2A75A 1XSQA 3KB5A 3KD4A 1H8VA 3VBRB 3VZNA 3EXUA 3FMGA 2WUHA 2A3WA 5GALA 1HV0A 4Y1ZA 5FY4A 4ZZ8A 2BNNA 4WM7A 3RWKX 2B9VA 2E32A 2PHXA 3OPWA 2C1FA 3I4IA 1D7PM 4P9WA 4GKYA 1LHUA 2BJSA 1DIWA 5E8AA 2UY9A 4BM8A 3PL0A 1RVF2 1LB2A 3GZEA 1IKQA 1UY1A 1JI6A 5EQUA 5J98B 1O4ZA 4YZ2A 1BK0A 3LWCA 4XFIA 4DQAA 2QNKA 4FOWA 3TNQA 2C26A 3B7MA 3I2FA 4HL0A 4R9BA 4Y3OA 1W6MA 1O4YA 4CUAA 4ET7A 2VOTA 4DEVA 2HWC1 1JYTA 2Q8EA 1WMDA 4QKDA 3N9MA 4L8QA 4AHYA 2D6KA 1MZ6A 2WNVA 5BNQA 4NHLA 2DCZA 3VBHB 4Q4X1 4MXVA 4CUGA 2VNRA 1DU3D 3VBSB 1AR81 1ENSA 2Z42A 1F35A 1VE0A 2VCCA 4QHOA 4W6XA 1OHFA 4XFAA 1R1ZA 4N53B 5DN2A 2BWAA 3ALQA 1V6KA 2VTXA 3O7OA 2VMEA 4A44A 4QHZA 3OYWB 3B69A 2VM9A 2WLQA 3K2OA 1WZXA 3H8UA 3CJIB 4H55A 1XNBA 4BA6A 4QT6A 2DF7A 2PMWB 3OG2A 4TYSA 2RR12 4Q4Y3 1HDKA 1BXHA 4RYDA 1RUD2 2WWSA 3JBG1 3BIEA 5FFOC 1GQPA 1VPHA 3KHBA 2VG9A 2JKXA 4DPNA 3ZFGC 5A33B 2WNUB 3I54A 5JXGA 1X82A 1GYKA 3ZXDA 3WQBA 1ONAA 5FK8A 2WO2A 2B5HA 3LKJA 3U75A 3NJXA 5BNPB 5FYIA 3ZFEC 1TME3 3KHCA 3O1RA 2AZ5A 5FYUA 1AXZA 4IEOA 1H30A 1LKNA 4IXLA 1JYWA 2OXBA 5IVYA 4QMAA 3V0AB 5L7OA 2QKDA 3BGAA 3NL1A 1BZWA 1V6IA 2CDOA 2DVFA 4XZPA 2F17A 1C3HA 2VL4A 3MPPG 2XJVA 3HT2A 4NO4A 5JI7A 2BVVA 1UXZA 4IV1B 2EAKA 4R8HA 5FYVA 4CEYB 3NV3A 5I0DA 1UL9A 4O9EA 4BB3A 5BNNA 4N9IA 1NUKA 3WNOA 2ZX1A 4AI9A 1OKQA 4DY3A 2K0GA 1J3QA 3Q8CA 5K8SA 4JZRA 2ZMNA 3I3DA 4SLIA 2R1DA 4I02A 2VZ3A 3OB8A 3FWEA 1GNHA 3SCHA 1GQGA 4RGGA 1FPN2 3IDEA 5KC6A 5JWPA 4YYOA 4KBBA 2K46A 4QX1A 5FZMA 5FXWA 1PM4A 2E53A 1JOBA 5BNOA 2BGCA 3MZHA 4B29A 4BXFA 1OH4A 1HV1A 1X8MA 2JG8C 4I3PA 4META 3UKTA 2DBNA 5JSRA 1UY3A 1MZFA 3LD8A 1VAVA 1DLLA 1QJY1 5DAPA 1H9PA 2BBAA 2JIGA 2LROA 3OD0A 4ITCA 2VU9A 4XF0A 1N3QA 2ZACA 3ZR6A 1IGOA 2WN3A 3EYPA 3PURA 2WA3A 2TEPA 2RM23 4Y1YA 2DCYA 2WJSA 5J48A 4LBKA 3BVCA 4LBLA 5I0RA 3OYWA 5J09A 2WT2A 2ZMLA 3POFA 2RMU3 3TB0A 4DINB 4CCLA 2ZGNA 3ACIA 1HQWA 3MDPA 5C5TA 1TMF1 2Y6HA 3UGFA 2QZ2A 4ARXA 2E26A 1WCKA 2B42B 2VULA 3ACLA 4Y5TA 1V6OA 2EIGA 5FBJA 1POV3 4W6YA 2DCTA 3ZYGA 2OZJA 1ZNPA 4TTGA 3O1SA 5IFTA 3NNLA 2GMMA 4MZUA 4S2FA 4EWEA 3VHOA 2W08A 4IGOA 1VMFA 1F15A 2DFBA 3DN7A 3ZXEA 2C9AA 4MVTA 4Q8LA 5CKQA 3H3ZA 4ES9A 2VTFA 4GULA 4I3GA 5C5UA 3AKTA 4QQ2A 1DG6A 4FXKB 4DRVA 1J3PA 1GWLA 1VBA3 3QACA 4W65A 1HXS1 5CFCC 1H2LA 1J58A 3M3IA 3CQOA 4AHZA 3KM5A 3POJA 1GOGA 5LATA 4CU7A 1OLQA 4UW6A 1J1TA 1ENQA 2ZKNA 4OUSA 3H42B 3M70A 4QU1A 1PGL2 2J22A 3BYWA 2AEZA 2ET7A 2PHTA 1KITA 5FLHA 2GNTA 3J4UH 4P02B 4OI0A 2QDNA 4DS0A 3PTRB 4MGYE 1AR82 3USUA 4BQ1A 1PGL1 2PTMA 4RR3B 1O5UA 2VNVA 5C4WC 5BV6A 4FTEA 1CAWA 5JVVA 5BNPC 3HIFA 5C33A 1RINA 2PHUA 1US2A 3WD5A 1ZZCA 2VMIA 1F9KA 3WG4A 4RGKA 2D93A 3FZ3A 4PHZA 4HFSA 3K46A 1HX6A 2Y60A 4K8FA 2WNUC 5HCHA 2BBVA 2YC4A 4JV4A 2GC0A 4Y5SA 2R041 5DAXA 4ZXEA 1AYM3 2NLRA 3USSA 4UW4A 1PGW2 2AC1A 2QQOA 5EIYB 4CXXA 3VDBA 5FRAA 4YZ5A 1XB9A 4Y33A 1NYWA 2J1RA 4YW6A 3ITQA 2FZ2A 2XJUA 5ANQA 2ZX3A 5CVRA 3JBG3 2IXLA 4QU2A 4C1XA 1D4M3 2ARBA 3LEGA 1JN2P 3TYJA 2VZOA 2LW8A 5IK7A 2H0BA 4ASKA 3SKVA 3AB0A 3CIHA 4XYXA 4XXPA 3F2ZA 4Y1XA 4LTAA 1W04A 3CJIA 3VZKA 5A7SA 2WQ8A 2PHFA 2YFUA 3ZDVA 4CCNA 3FBMA 4YFWA 1EAH3 3CNAA 2IXKA 4D7YA 4D8MA 2NN8A 4OLLA 3ZYPA 1AR83 2WO1A 2WNUA 1OOPC 3M8LA 1VBD3 4PI2A 4Q4V1 5LBBA 1MACA 1ND2B 1YFWA 1RXGA 2VOXA 4FPFA 1OH3A 2VTXJ 1NA1C 1SLTA 2HEVF 2NMNA 3IZOA 1UYPA 3UKVA 1VBD1 3VZMA 4GB31 2IXCA 4ONUA 5GZGA 3GJAA 5JR2A 2JDNA 4XUNA 2JG9B 3RI9A 5I0SA 5FWJA 2RS13 1AR61 3CLPA 1S0DA 3RZHA 4WV8A 4CEYA 2XQXA 1N1VA 4GXLA 4EZ4A 1YFXA 1WA6X 2D43A 4GAZA 1R1A2 2UY8A 1AR71 5A6ZA 4E2QA 3IDCB 2DU0A 2JDKA 1F5FA 1H1IA 1P8JA 2HWD1 4KL1A 3BU7A 3EBRA 4FVVA 3ORJA 5IVVA 2R073 2N7GA 3OGSA 3PDQA 1AR72 1JYXA 3GHMA 2YC2A 4L97A 1BLZA 2X8KA 3ES1A 1YWKA 2I45A 2E7QA 4OUEA 1W0PA 3WSOA 1KFUL 1F5JA 2ZGSA 4QX3A 1D0HA 4OMDA 3I2IA 4Q0SA 5FZCA 1JZ5A 5E6HA 1PGW1 1UD1A 4M00A 2KD7A 3KT1A 3LOIA 4RD7A 2XHKA 1SFYA 3AJYA 3M3EA 3WF1A 1IS3A 2D3PA 4M3CF 3HNYM 2Y6KA 2QQPA 3JQWA 1QIQA 1WA4A 1GLHA 4TZDA 4K6BA 5D8AC 3JCIA 3NAPA 4CDUA 2JDMA 4NUBA 2MEV3 4BOWA 2D5HA 2JG8B 2C6SA 1W9YA 2VVEA 5C7GA 3ZYFA 2R063 3KVBA 4LEJA 4PLMA 2VJXA 1O5LA 3NW4A 2VOVA 2TBVA 4IEQA 4Q4W3 4CYDA 2Z5WA 3WNLA 1VBB2 3ZOIA 1EP0A 3VZJA 2ZEXA 4ZS2A 1UY0A 1J1LA 4L0PA 5JR7B 4CP1A 2WN2A 2XB6C 5FXZA 4PBPA 1AR73 4GJZA 5FZ0A 4CDQB 5LK5A 4P9XA 1HB3A 5EJ1B 4XFHA 5FY8A 4BQ3A 2CWSA 1NOVA 3E5UA 2RMU2 1WW7A 2YHJA 5CYYA 3RI8A 3ZN5A 4YGCA 3ES4A 2XJPA 1W9FA 3ACGA 1VBC3 5DDJ2 3VDCA 4BCUA 3C7OA 4URTA 3WNPA 4HXCA 4J25A 1D0GA 1WCQA 3I2DA 4YVSA 4IL7A 2XOMA 4FFIA 5JSOA 2GNBA 2HWD3 4QGMA 5C4WA 5FO7B 2FDFA 1RUH2 5CU1A 1BCXA 4HT1T 1LOAA 4NIIA 3FLPA 3U11A 2VW2A 1KDKA 5BUVA 1FXZA 2IC1A 2EXIA 1EAH1 4HVOA 5FWEA 5I8SA 2HWE1 1H2MA 3FHIB 3ROUA 3J9SA 4FAHA 5DMYA 4MGSA 1T6GC 4Q4W2 1U5IA 3LA7A 4UOJA 3SNMA 1R082 2VBBA 2VZTA 5EWSA 1CX4A 2A6WA 2RJLA 5FZBA 4XUQA 4HVQA 5HXMA 1CX1A 3JU9A 1RUJ2 5HI0A 1OSGA 4Q4W1 5CAZA 5KC5A 3CHXA 4HSLA 4XJ8A 2BFUL 2VVFA 4FXGB 1SFNA 4LBQD 2G4IA 1C57A 1RUC1 4L2NA 2CNAA 5GZFA 3HWJA 2YMZA 2AR6A 3L2YA 5HV0A 1LTEA 1I9RA 5FUPA 3PJYA 4JRAA 4CCJA 2P34A 1CD3G 3AYEA 4YSFA 4OQ8A 1QH6A 1IPSA 1QOTA 4FPEA 5FY1A 4HPKA 5FZOB 3WDYA 3WV6A 1MQTC 4NR1A 3ZSMA 4IE5A 1ZZBA 1O6UA 1LEDA 1TVGA 2JG8A 5FMDA 3M2MA 4AI2A 1U5XA 1H1AA 3AXDA 1F2NA 2BQPA 2EIEA 3BIWE 3BTAA 4IDZA 2OUJA 5C4WB 2DYCA 2HEWF 2OZ6A 1BYHA 3SITA 5F5QA 1OKOA 1RUI3 1W99A 3N9PA 4OHYA 3I59A 5FUNA 4FOVA 1ULOA 5J96B 5J37A 4BK5A 5JAXA 4BZ4A 2BW8A 2BFUS 4LO5B 1WCDJ 1SCRA 5DAWA 5FO9B 3Q8AA 2I74A 3D3AA 4P9IA 3SXWA 1UPIA 1YO8A 3B01A 3VDDB 2VMGA 2OX0A 2QQLA 4KWJA 3OUJA 5KXEA 4FQ4A 4LIVA 4YG6A 1LGBA 2ID4A 4LK6A 2KM2A 2IXIA 1JH5A 3BTZA 5JZGB 1NXMA 5A3MA 2JDPA 2PLV3 1QDCA 2EA7A 2JE9A 1QXPA 3PLQA 5FKCA 5FAXA 3IAQA 1S0JA 1SBDA 1YIFA 3A7QA 1W90A 3O0VA 3RYRA 4A7KA 1E5SA 3LDBA 3KLSA 1YQCA 1WLCA 4QAWA 1OFNA 3AXEA 3QLQA 2NYYA 4LUKA 4NE9A 4Q27A 1M4WA 4SBVA 3ZN6B 2LS6A 3RG0A 1CR7A 1UYYA 4S2GA 5JPMB 1UZWA 2AREA 2YC0A 4K7JA 3WZ1A 4AZZA 4NHKA 4CUCA 1Q8OA 2UU8A 1DLCA 3N36A 3WF4A 1U0AA 2VUDA 4FCAA 4Q29A 3PNAA 2H0VA 1X36A 1CESA 2Y26A 2DVGA 4COUA 1VMHA 3O12A 3DL3A 4AI0A 3C7FA 4FBFA 3I59B 3C7HA 2E6VA 4CZSA 2PQSA 1R092 3EB7A 2WZR3 1K45A 5CIRA 4FT8A 5DZGA 4AHWA 2OQ6A 1KJLA 1RUE2 4XW3A 4Q0VA 2CHHA 4Q0PA 5DUVA 1W6QB 4W8JA 2D6OX 2RMU1 3A4UA 3I3BA 4YPJA 3WDWA 4EN9B 4H7MA 4IGPA 2W9XA 1PIV2 5I0TA 2OKXA 4NPRA 1U5YA 3TEYA 3WCSA 2ZEZA 4Q1PA 4CDXC 4IEYA 2VUJA 1LHVA 3C2UA 3C7EA 2LUWA 2J1EA 4GB32 1RUF3 4GZ9A 3TEXA 2HEYF 1UU4A 2BWCA 2VECA 2W68A 5BNNC 1CIYA 3UESA 1LULA 2VZ1A 3ZYRA 5KHHA 2MEV2 1ND3C 2V4VA 2WL1A 3MICA 4B1MA 4CEYC 1G9FA 2PAKA 1EAH2 3FUOA 1JZ6A 4XIKA 3ZYHA 3PVBB 2FMYA 4WM8A 2XL9A 1EYBA 5EHDA 2WNOA 1X7NA 1YNAA 1H2NA 3VBOA 1VALA 5A7QA 5AC91 1W2OA 1ZX5A 3ZFEB 4AEKA 4CDUB 2ETEA 2B39A 2P3IA 3GZAA 5C3QA 2ZHLA 3POWA 2VUCA 3J26N 4M01A 1FOD1 1QXJA 3K4AA 1MS0A 2OPKA 4LHNA 4MADA 5SV8A 3PUAA 4QWNA 5C8CA 2D6LX 3N4MA 1VR3A 4C8DA 1ZRRA 4LKEA 1WW4A 3CJIC 1PO13 4EN7B 5IT6A 3H8XA 4E4HA 1VMJA 3GXUA 2WFF1 3NWKA 4FFHA 4HOOA 1OQDA 1WCSA 4LBJA 1DFQA 4N53C 4X8PA 2VNGA 1IPJA 1XU2A 2QVSB 2BV4A 2EXHA 3SEEA 4LKDA 2FZ1A 4IESA 1OFSA 2R061 3KQRA 4OHXA 5A3OA 5FYTA 4LIUA 5AVAA 1AYM2 4A4AA 2LRPA 2QQWA 3IM0A 2OT7A 1BK1A 4FPCA 4QGNA 3ZN4A 4DIQA 2ZCWA 3MF9A 3Q8BA 5BNNB 4AQSA 4NIHA 1GWMA 2PXJA 4UF0B 4JTOA 5FK7A 1FMD1 2WNEA 1AZDA 5JDBA 4RQPA 3E5XA 4AG4A 4OULA 1I6XA 3NKTA 3LZZA 4N7UA 5HBAA 3O1VA 1BMV2 4M3CB 1DQ5A 1JHNA 3HJRA 3LSDA 4XQWA 4ISQA 3SC7X 1OF3A 1UMZA 2V73A 4RA0A 1AX0A 2ZAAA 3I2OA 5A32B 4BHPA 1HN0A 1ZRDA 3PU8A 3W21A 4E4ZA 2ADDA 1PO22 4JQTA 4CTEA 4BQ4A 4F83A 4FPGA 2DTWA 1ALYA 2D6MA 4YW1A 1AVBA 3LIGA 3M3CA 1SDDB 1UPSA 4TN7A 1QJU3 2ZZJA 3MIEA 3OTFA 4C91A 3N9OA 2YPDA 3ZKYA 4PIXA 4BPZA 2Q30A 3FX3A 2GH8A 3THDA 1KQRA 1XNDA 4LLOA 3AVSA 2J1UA 2PQQA 4MO3M 1HRI2 5AFEA 3IBMA 4GALA 2X5IB 4ISRA 4XCAA 5E16A 3UK9A 5A6QA 5FOJB 4FPHA 1RUJ3 3ZIWA 4D69A 1K12A 3D82A 4R9DA 4OI2A 5BXXA 2BUKA 5FMCA 3VKFC 3PVOA 1WMFA 4P9LA 4AI3A 5GZCA 4QQPA 3ENRA 1APNA 2WZ8A 4JKMA 1L3JA 5DAVA 3MFAA 1NKGA 1DZTA 2JD4A 2UWAA 1QGLA 3RMYA 1JZ2A 3PIGA 2Q1FA 3PUSA 1N47A 1C1LA 4OFGA 5FZGA 4XCBA 5A6XA 1MS8A 2DFCA 3SHRA 2Y33A 1PZ7A 1D2QA 3OBAA 1IPKA 1QH7A 3HQUA 5A32A 3RJ2X 3MIFA 4BIFA 2SBAA 5ACA1 1RC6A 4NPLA 2Z4FA 2VZPA 5FZFA 2E9QA 3C3VA 5FKBA 4O65A 5F5IA 2QQVA 2GC1A 2RM22 3U0ZA 4XMAA 1WLWA 3WNKA 1YEWA 2A5ZA 3RZKA 4OHZA 1BKZA 5KXDA 5GKAC 4Q4X3 1ULFA 4WVVA 4LBMA 2YG0A 3MLJA 3J8F3 3ZN6A 1EUTA 3QH7A 5H9RA 4GJYA 5F2WA 3POIA 2GAUA 1LOFA 3DYPA 4UBGA 4JHZA 4D6RA 1MQTB 4K1ZA 4UFHA 4ZPIA 1K5JA 2R6QA 3C8XA 2XWBB 1CZTA 1RGSA 3M4FA 2C0ZA 1UZYA 5BPXA 1PMJX 2HWB1 3D4KA 4YVSB 1PIV3 1YXWA 4AOCA 5A3LA 3S57A 3BKZA 2WZEA 4NROA 1ZBA3 1XXNA 3HNMA 3W58A 3MUZ1 4YZ1A 3MF6A 2HWB2 3FLTA 3I3EA 4PDWA 4XJ9A 4YW7A 2WZPP 3H8RA 2HKXA 4Y26A 1RUD3 3R05A 3T09A 4QPYA 1FI2A 1W6QA 2GP3A 2I2SA 1SCSA 1LECA 1V70A 4YNIA 2OYZA 1VRBA 1VRH3 1Z0HA 5LY1A 1OBNA 4MV2A 5FP9A 1QJZA 1ZYBA 2XKPA 3FE5A 2GNMA 1TZOA 1VBE1 2IVJA 4HKWA 3ZKUA 2Q5TA 1YCIA 2Y38A 1A34A 1C8M3 2Q0AA 3AP4A 4RR3C 2CDPA 3K75B 4CP2A 3ZFFB 1JBCA 2QQNA 4FPKA 2G1MA 5F3EA 4BLJA 4V1PA 4XJUA 1MZEA 3I8TA 4B8EA 5LA9A 2DVAA 2E51A 3P3NA 3ON7A 1RJ8A 4AK3A 4JGZC 1AL21 1Q43A 4QXHA 1G9AA 3KT4A 5EXOA 4GH4C 1YJLA 3JZVA 3WDVA 2K2SA 4UFJA 2JIJA 5C70A 1ZRIA 4QQLA 1QY4A 3H3LA 4XTMA 5FYYA 5CFCB 1OD3A 3S6PA 2HYKA 4MH0E 4QDSA 1DYOA 3O1TA 5LA0A 5GLZA 2FDHA 1WD4A 1YLLA 1KGYA 1UY4A 3LB9A 1UMHA 3AMPA 2BGPA 1CWPA 3NV1A 1GMMA 2CGPA 5KXBA 2MHFA 3WW2A 2AGSA 1XNCA 4DZGA 3PU3A 4XDPA 2YB7A 1DYPA 5LB6A 2IFRA 4BIOA 3KF5A 2VGDA 1SLIA 1WW5A 4LO6B 5ACA3 1LOFC 1H6YA 2GC3A 1AR93 1UWWA 2DVBA 5FZ7A 2Q8CA 4PT6A 3E6CC 4HKLA 5EYXA 4CCKA 5HPOA 1CAUA 4NWWA 3KGLA 1DGRA 4COWA 2VUAA 2EIBA 3VBOC 3MYXA 1QJX1 4AF9A 3T0DA 5AC92 5C9AC 2J1SA 3HAGA 5EZWA 3O0WA 2C9KA 1U12A 3KCCA 2ARAA 1DCSA 4QX5A 4BISA 1LU2A 4BU2A 3DEMA 1SLBA 5F3IA 4A42A 3VZOA 1CAVA 1ZZ8A 2ZGUA 2VZUA 3KS7A 4Y22B 4GWIA 2ORZA 4Y5Z0 4KWKA 5C8CC 3THPA 1RUG3 3MHZA 1REEA 3QBQA 2PFWA 1QF3A 5LA2A 5CZKA 3TWIA 2FCUA 1ODMA 1BEV2 2W39A 5DPNA 5IK4A 4AGRA 2VQAA 2XBO1 1VBE3 1D4M1 3NJVA 4RR3A 1YJKA 2XL7A 1JZ3A 4OHVA 4G9SB 1G9CA 3FUQA 1H8TC 4NRQA 3AL5A 5JXHA 4K20A 1DBNA 1IQDC 1QJX3 4AFCA 1SDWA 4AAXA 4GH4A 1AL22 5ERLA 3VDDC 3VBFA 1AYM1 4IV1C 1CIWA 3B9IA 1UQXA 2JG9C 2G19A 2RJ2A 2LM3A 3K48A 1RXFA 5FR3A 2W95A 1NCQB 2Z79A 5KBFA 4L92A 3S5QA 3S5AA 2Y0IA 2OUHA 2YPJA 3VV1A 2HWE3 1PZ8A 1YQ2A 4I30A 4C1WA 4Y4YA 4I0BA 4YG3A 4Q4X2 1Q3EA 1GR3A 5FZ1A 1FMD3 4XPVA 4XIOA 3K51A 3GHNA 1NE6A 3I2GA 2RS32 4M4PA 3AM2A 3MIGA 4MGTA 2RS52 2FDKA 5FYCA 3AZXA 1JZ4A 4GIQA 1IG3A 1N3OA 3OCPA 5IUQA 2VVDA 1KJRA 3LGRA 3EQEA 3OGGA 4CRQA 4EZHA 4QB6A 1UYZA 5FIXA 1HN1A 4CP9B 4YFZA 1UMIA 4LR4A 3FBYA 3VBFC 4UW5A 1LHNA 4JC1A 4XFGA 3ZMNA 5FYMA 2FDJA 1C5HA 1K5MA 3I97A 4DB5A 1S2KA 4IV3C 4WVWA 3HQRA 1UO9A 1LAJA 1JXNA 4BJ0A 3SMHA 3FJSA 4IE4A 1VBA2 2GU9A 4Q5OA 5EJ3A 3S30A 4XDOA 5IATA 4NIDA 4UXAA 4XETA 4Q1RA 2ZHMA 4LA2A 1RITA 4ZU4A 3O1MA 4N43A 1OLRA 5I0UA 1G9DA 2QBXA 3VBSC 4LA3A 1A8DA 1OA3A 1Q56A 1TG7A 4UFIA 3VKMA 5IVBA 1IG0A 3QCWA 3GZTB 3VBHA 4MSVA 4FPJA 1AX2A 1PK6C 3VBHC 3OBTA 1QJU1 4QDRA 2R32A 3CU7A 1RUH3 1TNRA 3DF0A 3WDXA 4K8RB 5JCTA 1V9U3 5LASA 1W2TA 5TSWA 2DUOA 4PF5A 4EWAA 4AVCA 5CB7A 1L7QA 2VZRA 2JE7A 2GZWA 1J83A 1OVPA 2WS92 3LDKA 5FYZA 4FAGA 1GNZA 3WG1A 5IAVA 4AGVA 3TBDA 1DGWA 2EVXA 1ASJ1 1D4VB 4EE2A 4MGIE 1UOFA 3HQXA 3PHMA 4BQYA 4HLTA 1VRH2 1LGNA 1CPMA 4IEVA 2CGNA 5FY0A 3WP4A 1DGRN 2NQYA 3AKQA 2J7MA 2J42A 5HXVA 3PMSA 3WX5A 4CDQC 1XSRA 2VR4A 1OPOA 2DCJA 3ILNA 2RG4A 4NJ4A 2B8MA 4YG0A 3WLUA 2QE3A 1VRH1 3AP5A 4JCKA 4D6QA 5K9YA 5JMCA 5CG8A 5FZ8A 4UT5A 3TNPB 4Y4RA 3BPSA 1X9TA 1HXS3 1V9U1 1AL0G 4M3CA 1MEC1 1O7FA 1REFA 1CJPA 1HJFA 3ZXFA 2VAUA 3MLKA 1JZ8A 2DUPA 3ILRA 4XQDA 2KA3A 4OMCA 2QQUA 2RS11 2FD8A 1WWYA 1B09A 5FZ6A 1DHKB 2Y64A 2GN3A 1WD3A 3M7AA 5DUXA 1COV2 4NIAA 5FXXA 1FX5A 5GLUA 4AWDA 5C9AB 1FYUA 3UKNA 1JTZX 3WF2A 5JUVA 1GU3A 2WRAA 2OVUA 1EV13 3ZXLA 1UNBA 1SEFA 1H0BA 2WZR2 1W05A 4IE0A 2WC2A 4UFKA 3VN4A 2RR11 2YGLA 4OCTA 1LNSA 4XMIA 1GOFA 1LGCA 2VCBA 2FDIA 1RMU2 5ANNA 2DDUA 5T3NA 3LFMA 2DV9A 2JDAA 3W59A 3IAPA 4BQ2A 1ZVFA 2PELA 4IETA 3OGVA 5I8TA 4DUVA 1XJAA 3NQHA 3CMGA 1Q8PA 1QJY3 1XNKA 5F8PA 2B46X 3VHRA 4XUOA 1NCRB 5J7MA 2YBKA 1HXS2 1POQA 2V5YA 5FZ3A 2ZHKA 4AW7A 3BOPA 4WVMA 1RUF2 2VMDA 3AL6A 4XACA 5CBLA 5FYHA 4K1YA 1STMA 4B7EA 2DUQA 1XBFA 5CA6A 3ZDSA 4C0BA 3T0AA 4MLOA 4KNCA 2WKKA 2D40A 2D6NA 5F39A 1RTVA 4JVAA 4XJWA 4GH4B 2ARCA 3ZX7A 5IWFA 2ZOEB 3RYKA 2RDQA 2HWC3 3ETQA 1C8M2 2GALA 3JXSA 5LRRA 3WINE 3ZFEA 1A6CA 4Y20A 3LAGA 1W9SA 2HYXA 2R7EB 5T5JA 5FPUA 5GLWA 2K9ZA 3GCXA 1XE7A 3WG3A 2VBDA 3N3HA 5F5CA 1NLQA 2XJTA 1AR92 4HPKB 1ZBE2 1Q5OA 3NAPB 3TN92 4K21A 1S2BA 4D7SA 4LITA 5F5AA 3SH3A 4NIGA 5L9BA 1XYNA 3VD7A 4LQRA 4CU9A 3KWVA 3JD71 1UZZA 4QHBA 2XDVA 3V56A 4ZZ5A 2B45X 4AHXA 2ZGRA 1K3IA 5IVFA 4B4PA 5CFDB 4E27A 4AQTA 2EXKA 4QX0A 3NRUA 2Q1MA 4OI4A 4KG8A 3SEPA 2QCSB 5F2SA 2OS2A 3D6EA 3D5OA 3URFA 1DQ4A 2W87A 4IV3B 4PF1A 5K0UC 3QD6A 4CPBA 2PA7A 2ZGOA 5H9PA 4EN8B 3UJQA 1ENRA 2BOIA 1GSLA 3KSCA 2RVAA 3NNFA 4GWMA 5K4LA 4E2GA 2IXJA 2WNVB 1UKGA 2DVDA 1H1MA 2WZR1 2EIDA 4AEMA 5I8YA 2C4XA 1DZQA 2O14A 1POV1 1DQ0A 2AEYA 1BEV3 1L7RA 2FCTA 3VZLA 3T2PA 2PLV1 3WDTA 1RMU1 3DECA 1CAXA 3DKWA 5L7OC 5IK5A 4P5HA 1FNYA 3AZYA 1HB1A 3HR9A 1X9PA 3OEAA 3UNPA 4MGZE 1S2EA 4OI1A 3LIHA 2QZ3A 4A3ZA 3RFRA 1QJEA 2CTVA 1WLTA 3HVDA 3IPVB 1UIJA 1W39A 3BI3A 1ZRCA 1OUXA 2EF6A 4FFFA 4OQ9A 3S0MA 1DF0A 1O8PA 4IV1A 2BOJA 4ATEA 1EPZA 3CZUA 1JYIA 2CU5A 1W6OA 3DCQA 2NZ9A 3LEKA 1RVF1 2WSVA 3KV9A 4C0HA 5JSPA 3T0BA 2JE8A 3ZPOA 2D98A 3BALA 4YVWC 1CAUB 2HWD2 4YZ4A 2ZZQA 4K40A 4O61A 5JLVA 4PI0A 2PHWA 3EHKA 4AFBA 4B4QA 3CL1A 4IEPA 1AF9A 2VXJA 4XUPA 2JDUA 1R64A 1V6JA 4H14A 5F3CA 2DBIA 2MNGA 2RS31 4FPOB 2P6CA 2AH2A 1HQLA 3NNMA 5T5LA 5IYYA 4Y22A 3THTA 1SLAA 4RN5A 3LEIA 2XGXA 4LO7A 5FLIA 3WY6A 3TN91 1RUD1 4CXYA 3UJOA 1PVC1 4COYA 5CADA 2BP6A 3RNSA 2Y6JA 1OXCA 5T5OA 4AI8A 1BBT2 5F6LB 3RGBA 3O1OA 2CGOA 2RV9A 2EALA 4QB1A 2XVLA 4AEDB 5G04L 4KGQA 1OD5A 5FZDA 1FAYA 1MS5A 1RUG1 1GWKA 2KXLA 5EFUA 4Q0QA 3NJYA 1CN1A 2P3YA 3GGLA 4XQ4A 1Y9QA 4J1WA 5FZOA 1CQ9A 3R4SA 3E6BA 4KU7A 4BE3A 1X33A 2ZAHA 5D1IA 1LHWA 1CZVA 3PMEA 2A3XA 1OT5A 2PLV2 4KU8A 1NA1A 1A78A 4HANA 4XFFA 5FLJA 4ASMB 4C90A 1SZBA 3U14A 2D5FA 2I07B 1UCXA 2W1SA 1PX4A 2VMHA 5K7PA 3SH4A 1RIRA 5F37A 1PNFA 4LE4A 5DDJ1 1VAKA 1VBC1 2AYHA 2VW0A 4RS5C 3U07A 2ATFA 5DG1A 1XE8A 3AKPA 3AVRA 3N35A 4AYUA 5IVCA 5JOXA 4EJRA 2FBEA 5FDBA 3BPZA 2IZWA 1AR63 3VUOA 4MXWA 3KQ4B 1E5HA 1JU4A 2F4LA 1TNFA 4FOQA 2BVBA 4JGZB 2GN7A 1BJQA 5FZAA 3VHNA 2HWC2 5L36A 1QJY2 4QDQA 2R0FA 3G7DA 1WMXA 1UX6A 1AJOA 3ZPYA 1FPN1 5GZDA 3ZFFA 5JOYA 5DG2A 4NHMA 1R081 2NP0A 3MW3A 4NWVA 2XLGA 3CDZB 1RB8G 2WA4A 1RUJ1 4XBQA 5DAQA 4PDWB 3ZFGB 1X8EA 1QU0A 3SCGA 4R4XA 4S2DA 1W8FA 4IW3A 2YXSA 2YUEA 4PJYA 5A3UA 3FL7A 1V0AA 2BRTA 2JDHA 4XDQA 1CVNA 2WAAA 2H6CA 5FQ0B 5FPLA 2B4KA 4JAAA 5L73A 4CCEA 1VP6A 2W91A 4ZKTB 1NXD1 4LHSA 3OOXA 1VIWB 2P1BA 1ACCA 3N7JA 2Y34A 3UL2A 3WQ0A 1YHFA 4QKNA 2JICA 3TN93 1QNYA 4NOTA 4TLGA 1N1SA 5FZ4A 3CF6E 3FC0A 4G4FA 4IGQA 4HMZA 1DGLA 3NV2A 4IUGA 1RUI1 1RUNA 3R4DB 4GMP1 5A7WA 3O1PA 2WYFA 1A3KA 1KEXA 2A73B 2W5FA 5FZLA 1C8NA 2XBO3 1J3RA 5CFCA 1MVEA 1UIKA 1ULDA 1VBB1 2C24A 2HWB3 3V0BB 1HW5A 3INAA 2GMEA 3D0JA 4UBHA 2RDSA 1YC61 5FZHA 2RHPA 1VBC2 3OPZA 4KBZA 5DDJ3 4UFLA 3WEZA 4I2OA 1UOGA 2DCKA 2VQUA 3ETPA 5LBFA 1F4HA 1O3QA 1ZA4A 3ZFGA 4ZONA 4BYYA 4D6SA 1DZRA 4LE3A 3K77A 4CP0A 2QDRA 5IW0A 1HRV2 4WVZA 4IE6A 3AK0A 3KV5A 1DQ2A 1MPXA 3AP6A 2AACA 4IEUA 1H8TA 2VD7A 4COVA 1ZBE3 2QFEA 4AVTA 3IDAA 1KXGA 5E1RA 1TEIA 1UKRA 1AR91 2UURA 4LO8A 3D8CA 4XJZA 4ZU5A 4AXOA 1B35B 4DXSA 2VE1A 1W8HA 4L11A 5B4XA 3WHTA 4CCMA 2R30A 4AQ6A 3UV9A 4YARA 3Q8FA 3HPNA 5DXDA 5FP4A 4XXAA 1CAVB 1URXA 3J7NA 3GALA 1RUG2 1JUHA 1UZVA 1WBLA 4XVHA 5EPAA 1FOD3 4E4SA 2GMPA 3MIBA 5T5PA 4JTNA 3UGHA 5DQ0A 2QQKA 3OD4A 5D2AA 2J1AA 3ZSEA 4A45A 3AZZA 2YYOA 2JB4A 4DMIA 5A7NA 5LY2A 1VB4A 1W8OA 3AMQA 3RQ0A 3F95A 3VBUC 3VBUA 1WCUA 2XKOA 1RHI2 3N9QA 4LPLA 1G8WA 2XUEA 4KG0A 3ATGA 2HJIA 4R52A 1EY2A 3VDAA 3K3NA 2D6PA 3WF3A 4IEXA 1AL23 3DXUA 2VZVA 1PIV1 1NCQA 4BQXA 3H8OA 1NQDA 3PIJA 3MV11 4OZXA 1DP0A 2ERFA 2WDBA 3IN9A 3M3QA 4LJHA 3MPBA 3I7DA 2XJRA 2XMLA 5T50A 1RUI2 5C3RA 2BEOA 2DTYA 4QQOA 3W9AA 4CEWB 1W6NA 2JJ6A 2G9ZA 3TOJA 1PVC3 3OSDA 4AFDA 1QHDA 2HBTA 5A1FA 1NCRA 4MX3A 1W2NA 5CKMA 3AYDA 1IS4A 4JQRA 4NHYA 1HLCA 1J84A 1EV12 4KWUA 4N90A 3S7IA 2RS33 2P6HA 1I5PA 4CDXA 4JX0A 4LBQB 4CDWB 5A3WA 4F7ZA 1N1TA 1EUUA 4ZXKA 4EN0A 1RYYA 2A6YA 2WR9A 3OGRA 1FATA 3J7MA 1IZ3A 1G86A 2A7AA 4HK8A 2WNVC 4N7IA 3KT7A 4QM8A 5APAA 5FOBB 5FO8B 1R1A1 3T2TA 2W46A 1HRV1 4XUTA 2LTNA 2HWF1 5C71A 2QQJA 4EROA 5K0UB 4Z92B 4JGZA 3IKWA 1ULGA 4BXSV 3EJKA 1S55A 3P3PA 4AQ2A 1H6XA 1E5IA 3H1MA 2XJSA 3GM8A 3LFIA 4GB33 4XHBA 4YM1A 4YGDA 3V65A 4FOYA 3OY8B 3VKLA 2R042 4PLOA 1LU1A 5L19A 4CCCA 2RDNA 1GV9A 3H7JA 3T1MA 2D97A 5F9TA 3OJBA 3I49A 3IIAA 3BOWA 2BGOA 2W1QA 4P9JA 1NX9A 1SQ4A 4N43C 4PQ9A 1QQP1 4XE9A 3SLIA 2QTWB 5KHIA 3UT0A 4CDUC 1W6PB 1YFYA 2P5BA 5D8AA 2XLFA 1ULCA 3BCWA 4J1XA 4P9YA 1QQP2 3I2JA 5F32A 3O14A 1YFUA 2PN5A 3UETA 3WP6A 1J59A 3VBRA 3CEWA 5FPVA 3ZLIA 4BH9A 2ZGTA 3ME2A 4AVSA 2ET1A 3A0NA 1XYOA 4NPMA 3THCA 2XXZA 4HZFA 3LA2A 4NRMA 3HOBA 3NMBA 1WGPA 3T4HB 3UYJA 4XJAA 4MXWB 4KMQA 5BYNA 2GP5A 4AFAA 1EPWA 4Q4V2 1PVXA 4INDA 3VGIA 1HQNA 2P3JA 5FMOS 1JODA 1W8WA 2V5DA 2ZEWA 3ELNA 4NAMA 1LCLA 1SMVA 1YUDA 2VOWA 2BPA2 3MO4A 3I2KA 3ZXJA 1MS9A 1UU5A 1ZA7A 3JD73 2OW4A 4FQZA 4QKFA 4QPIC 2XWJB 2V4AA 4RS5A 3LPGA 1NCRC 1DQ6A 4WZCA 3ZXGA 5C3SA 2A70A 4BK4A 4CEWC 1AXKA 4LHLA 3WP5A 4XF9A 1PX3A 4KWLA 4AE2A 1AR62 4P14A 4YW2A 4FTSA 1IQAA 4DXZA 1IOAA 3PUQA 3WXPA 3B93A 3LOBA 5F1RA 2VQTA 4CU6A 3BODA 4OVEA 2PHRA 1T6BX 3DYMA 4R4ZA 4MHRA 5H9QA 4XBLA 1VAMA 2GNDA 4HN0A 5L9VA 4XAEA 2ORXA 1UXXX 4HBNA 1U5ZA 4RSUA 2RR13 1NLRA 1JHJA 4Q4Y2 1PGSA 4CU8A 3O1UA 4Z2AA 1RUC2 2MPFA 1RUC3 1UN1A 4UWDA 5JXJA 5AFBA 3OY8A 1LHOA 1QXRA 1V6NA 3RRDA 3JUUA 3RZMA 1RHI1 5A7WB 3QOPA 4X8NA 3EO6A 5FCCA 3RZGA 1FOD2 2WBKA 2ZABA 3VBSA 4DUWA 5I91A 3OGJA 1VLNA 1RL3A 5HV4A 1TMF3 1UOBA 1TMF2 1RUE1 4IQPA 2WQZC 5F6KA 4LOSA 1NE4A 3MBWA 5FZEA 5B2GB 3LCPA 4LK7A 1VBD2 5LEKA 3DUIA 4IEZA 4BMBA 5JZGC 4QM9A 5FPXA 1MS1A 1W0OA 1MS3A 3NKGA 3SKJE 4XURA 5ACA2 3GJBA 3VLBB 2BNOA 3WDUA 2XVKA 1RJ7A 2BNMA 1LOGA 3BN6A 3ILFA 1W9TA 2WAOA 4H2AA 4XOGA 3WOGA 4G3YC 4I09A 4BDVB 3GBGA 4P9GA 2ILMA 2ZEYA 1COV3 4JGYA 1EV11 4QX7A 3SISA 3TRSB 4CSWA 4TWTA 5IAXA 2CAVA 3FN9A 1E5RA 5FYBA 4E8CA 5C8WA 1H9WA 3S7EA 1NA1B 5T54A 2EAAA 3ZSKA 4X6RB 3DPRB 4TSVA 3RYPA 2HH9A 1ND2A 4YM2A 1B35A 1XNAA 1FMD2 1ND2C 2QQMA 4MGKE 3IMNA 2HWF2 1OOPB 3K3OA 4N9HA 4WBBA 5D21A 4NRPA 3SH5A 1MEC3 3AP7A 2NPIA 1OC1A 4QPGB 1BMV1 2UYAA 2JX9A 4WM7B 5E89A 5C3OA 4A41A 2YFZA 3AYAA 4H3WA 4XFBA 2OIIA 1RUH1 2SLIA 4URAA 1DDLA 4GKXA 5JOZA 1YI9A 2ZTNA 1CGPA 4IV3A 2WQ4A 2VMFA 4Q8KA 5CFDA 2VC9A 4AVVA 4RQPC 3I3MA 4AL9A 2Q1ZB 1VJ2A 4IE7A 4NMIA 4R9AA 3VD9A 2J1TA 1OUSA 3B3QE 1TQ5A 2X10A 3H3UA 3PUHA 4GMP3 4UFMA 4D0QA 1FV2A 5BY5A 1NT0A 2FHRA 1HRI1 2VH9A 3ACHA 2YU1A 3NVCA 2ARXA 4I0WB 4CA9A 3MW2A 2E33A 4HETA 3NAPC 4PCRA 1QEXA 1AJKA 3POEA 2R062 3IWZA 4J6GA 1OQ1A 3KV4A 3VKOA 5LCWL 1SPPB 3W5NA 1N3PA 4LKFA 1S4CA 3DPRA 2YDEA 1V6LA 1F8VA 2VOKA 3ASIA 3DPRC 1WW6A 2C5DA 2XLAA 4OHWA 3H1WA 1BQPA 4JRLA 4Y1VA 2F4PA 3AP9A 1R091 1Q8SA 2BTVC 1LOEA 2KR2A 4JHTA 3RMXA 3T08A 5CEHA 1NCQC 2IXHA 1L7LA 4V2WA 4BLIA 2Y0OA 5FMBA 1OVSA 5JMOA 1X50A 4Y1UA 5ABJA 4DXTA 2W2IA 1HKDA 1UYXA 1WLDA 1W6OB 3HN3A 2IUWA 4FI9A 4HONA 3VD4A 3DV8A 4JGYB 4UI9L 5FP7A 4D7TA 2YY1A 2EXJA 4E8DA 4ES8A 2ZHNA 1QQP3 5FYSA 3WQ1A 3B9CA 1IHMA 4AI1A 5FY9A 3U10A 1KRIA 4XF4A 2HWE2 3AFKA 2PHLA 2CSGA 5J36A 2QQIA 3TEZA 3IB3A 1OOPA 2WFF3 4M4RA 1CPNA 1H2KA 1DYKA 2VO5A 1OMIA 2JKBA 4Q4Y1 5DZEA 1S0FA 3H9AA 3IDBB 4QPWA 4QPGA 3P6BA 4MHUA 3CBNA 2CY6A 1PNGA 3H7YA 1I3HA 3AMMA 3OF1A 4W6WA 4YW3A 3RZZA 4YM3A 5D8AB 3IMMA 2VW1A 2XHNA 1AUYA 1IS5A 1LOCA 4UF0A 2WS93 4GWNA 1D2SA 5FPZA 4XF3A 2DWRA 2XPJA 1UOJA 4YW5A 1YQ6A 2OPWA 1GFF2 3C7GA 4FPYA 2X05A 4FO9A 5KHJA 4PIZA 1PHMA 4RGAA 2PYTA 4UW3A 4XHXA 1GBGA 1GUIA 5SV5A 4KH9A 3AKRA 1PK6A 4DOUA 2JDZA 4LBNA 4NN0A 1AYN3 1FT9A 1C28A 2ES3A 2E31A 3MW4A 3POYA 5DZFA 4WM8B 2YZ4A 4UYBA 3GNEA 4HVRA 3U37A 3AFGA 3O5SA 1SPPA 4H7LA 4QPIB 5FZ9A 3ZM8A 1IS6A 1ST8A 1GNYA 2DURA 4YGEA 4CVUA 1ZM1A 2JDYA 3R0RA 1YI7A 4EV0A 1WUVA 4K3UA 1GICA 1JU3A 4LMFA 2P3KA 4JGYC 1K5MC 5FREA 4D94A 5DABA 4YVWB 2CL2A 2VMCA 1O3RA 2B7YA 2BZDA 5ISLA 1NAEA 1SFPA 3POBA 5GLTA 2IWGB 3J8F1 5EYYA 3GBFA 2ENRA 4A7ZA 5A80A 1OPMA 4XTPA 3ZSJA 5K0UA 1REDA 1W2UA 1DQ1A 3T2QA 5KWRA 5B4NA 1ULPA 5L9RA 4LUMA 1XC6A 1W3XA 1UU6A 1NG0A 3AKSA 4LOTA 5FY5A 4V2VA 2HWF3 3PVNA 1V00A 4A7YA 4Z2WA 3PJQA 4EWDA 1RMU3 2WABA 3X29B 3MV01 4FP3A 3W5MA 1MR5A 2R0HA 2O0OA 2E7TA 5FMOL 1AYN2 1Q8VA 1PO21 1NQJA 2ZPXA 2F6BA 5FQ0A 2FMDA 1ZZ7A 4E2SA 3KZ4C 5AC93 3U1XA 1OA4A 3ZXAC 5A3PA 4YM0A 3HEIA 1BVP1 2FQPA 4W50A 4XF1A 2JD9A 1GZ9A 5FY7A 4QXBA 1ZZ6A 5IVJA 4QXKA 3I2HA 4QPIA 4P08A 4WVMB 1S0BA 2LALA 3KF3A 3L2HA 4QX8A 1JYVA 2W94A 3M3OA 1YRZA 3VBFB 3CKHA 4MGQA 2A6XA 4Z82A 4MYEA 5FP8A 4W4ZA 5FJKA 4OUMA 3U4SA 4ZHNA 1HB4A 2XJQA 3A23A 3POGA 3NSTA 4IEWA 4U36A 1ULEA 1VBB3 4AFMA 4ASLA 4B3NA 4Z8BA 1JZ7A 5BNPA 3OUIA 5EV7A 5A7OA 4BQ5A 4CP9A 1QNWA 4LLFA 4XZUG 4QQHA 1XYPA 5T52A 3FFQA 2VBPA 3K4ZA 1GP4A 2O8OA 2Y8KA 2DU1A 4GQ7A 4OZOA 3TAYA 2XH6A 4B1LA 4Q26A 4AVAA 3CO2A 4A6OA 4CCOA 2JENA 2R071 2ZGKA 3WUCA 3IIIA 3PTYA 4RFRB 2XG3A 5FJHA 4QKBA 2MEV1 1O59A 1Z7S3 4ZS3A 2Y6GA 4P5YA 3VHPA 1LEMA 1MZ5A 1K42A 2V09A 2VPVA 1Y7BA 2WSUA 2CWMA 4CXWA 4E9KA 4A6SA 1OLME 1QOOA 1ND3A 5FTTC 5JI9A 3VD5A 1K5MB 2ADEA 4QD2A 2H6BA 4LNVA 1H8TB 3VL8A 3VBRC 5A3TA 1V9U2 1QKQA 4F8AA 3ZYJB 4FFGA 1TME1 3N9NA 4LBOA 5EP9A 1MEC2 2VNOA 4RL7A 1PM7A 3KGZA 3BB6A 2A71A 4WM8C 3WW3A 2RS53 3PUIA 2WO3A 2QUOA 3GYDA 1GOHA 2YU2A 1R083 2OA2A 4E4DX 1S1AA 1GZWB 5C6CA 4KI5M 5JOWA 3BTXA 3DGTA 5LBEA 3P1IA 2X5IC 1KD7A 2X5IA 3OBZA 3MEPA 4JDMA 5DUWA 2JXAA 1AX1A 4DRRA 1JOJA 4U2AA 1JYCA 2WIIB 2XVGA 2JECA 2UWCA 3N7KA 4CPBD 1W2AX 3LPFA 1PO11 5EJZB 3IPVA 2W47A 1W28A 1RHI3 3P5BA 3Q9OA 4ATFA 4O7XA 1Y9MA 2NM1A 1QMJA 4A2UA 4QGLA 1MVQA 1M06G 4GA9A 4PLNA 2IVIB 4KQ7A 5BNOB 2VCAA 2Q4SA 4GWJA 2XR4A 3GDBA 2ZXQA 3ZIXA 4B4RA 5IHRA 4TLFA 1UY2A 2A6VA
chains in the Genus database with same CATH topology
4YGBA 1QJU2 2E63A 3LSEA 1NY71 2IFWA 3MI8A 1C1FA 3B00A 1W6MB 2CV6A 5HCBA 4DNYA 1HRI3 3E97A 1W6NB 1H4HA 4D3WA 4AEJA 1VB2A 4M0NA 3H1YA 5FBZA 1C8M1 3FFZA 3RSJA 4BWOA 5LK7B 4KGGA 1OA2A 1GKBA 1LODA 3ZSLA 1MQTA 1YIPA 1C4RA 2YGMA 3AX4A 1W6PA 1CAWB 1SBFA 5T55A 3AZWA 3ZFFC 2GDFA 3AZVA 1Y3TA 3IT8A 4XEZA 3MFCA 2R043 5CG9A 2YROA 1ZBA1 4L99A 1PK6B 3HBZA 4HSJA 2VQ0A 3AYCA 4O9GA 3VDDA 1FV3A 1MS4A 5JPNB 5KXCA 2BYVE 3R6SA 2VY0A 3ZO0B 3ZVXA 2A6ZA 1LRHA 3V0BA 4RQPB 2O8QA 1COV1 1G6NA 3PVEA 4S2HA 1QDOA 1O91A 1D4M2 1FPN3 2G9FA 4YVSC 1KS5A 2AUYA 2RE9A 2ZS6B 2P37A 3RDIA 3V64A 4YW4A 4COZA 1NLSA 4EN6B 2WFF2 3H0OA 4WZFA 2W52A 5E88A 3RPQA 2UWBA 3GZUC 4Q4V3 2R072 3ST7A 1DGWX 2AENA 4RHV3 4CDWC 4WM7C 5KHGA 4Q0UA 1PO23 2GH2A 2D3SA 3KCYA 4FPLA 5A33A 1G9BA 4QPGC 3ECQA 2VXRA 5J3UA 4RS5B 5GM0A 1NY72 4CDXB 3WW4A 3HMYA 4LT5A 3WHUA 4FTBA 4MUVA 4XILA 1UW8A 1XQNA 2GSYA 2CYFA 3WQ7A 2UYBA 1QOSA 1G7YA 4YZ3A 4Z07A 3A0KA 1GZCA 2ZJCA 1GANA 4PBOA 1CJDA 2O1QA 3J8F2 2RS51 2PAMA 2Z69A 4DY5A 1SLLA 3NO8A 1E57A 1RUE3 4JDNA 1XU1A 1BVVA 4PIYA 4B7KA 1JUIA 3VBUB 3M1HA 1WBFA 4F3JA 1JW6A 2YV8A 4BMEA 1TE1B 4RHV2 2Q8OA 3GBWA 3RWNA 1AYN1 2JG9A 1S0CA 2R1BA 2XUMA 1S0IA 5C8CB 3FLRA 1PZ9A 1C5IA 3JD72 1QWRA 1KS4A 5LRSA 1ENXA 5HCFA 4FSJA 2W0XA 4K9SA 3WG2A 3T1LA 1GQHA 1VBA1 1XRUA 5H9SA 2D3RA 1Q8QA 3WP3A 3VBOB 3MGUA 4ORFA 1SACA 2ZGPA 2G9GA 4LBQA 5JIAA 2ZGMA 1BEV1 2ZA9A 4R9CA 2XBO2 1RVF3 1OI6A 4LULA 2P17A 1A8MA 2Z2SB 3B94A 3ZMOA 3WR0A 4RFT0 3AMHA 2ZGLA 2PAEA 5C9AA 1V6MA 1S0GA 2ZBJA 3HD8B 3E6DA 2ZX2A 1YYNA 2CAUA 1KFXL 3APBA 2PHDA 2RM21 1UAIA 2WFPA 3WW1A 4FP2A 2WINB 1ASJ2 3V0AA 4I0AA 4CDQA 3H50A 5L7OB 3JB8A 5GZEA 1HRV3 1LESA 4YRDA 4YVWA 2ZKLA 3O0XA 1POV0 4A3XA 3MLLA 4LHKA 1SLCA 5HCAA 1TME2 1AXYA 4AEDA 1Z7S1 2B9UA 2E7AA 3B02A 4HK9A 3KCXA 1OQEA 1FNZA 2RJKA 5CFDC 4Z1VA 3MIDA 3QH6A 1Z7S2 5CNAA 1Y43B 2D44A 1PMIA 5ABJC 3WNXA 3L9JT 4ZU7A 4N43B 3N7MA 3MIHA 4GMP0 2RS12 1LR5A 3HN1A 4PDWC 3RJRA 1O3SA 5ABJB 3JB4C 4M0HA 2ZX4A 1PVC2 3JQXA 1BBT3 2X53S 1N1YA 3NJZA 1I5ZA 4NVPA 3AMNA 4CEWA 1R1A3 1PO12 3SCFA 4Q2FA 3NV4A 3WVJA 4XBNA 1ASJ3 1S0EA 1BBT1 3LA3A 3ZYIB 1VBE2 4Y24A 1RUF1 1O3TA 3G6JB 4HKOA 2WT0A 4M3CE 1O4TA 3VKNA 3U4XA 3VL9A 2ZX0A 1ND3B 3POSA 1WMEA 1F31A 4DFSA 1H4GA 3WT3A 2X29A 2WS91 1NZCA 1Z78A 4L9BA 5DUUA 2QJVA 3AJZA 3RS6A 3D0SA 2D7FA 5I93A 2R16A 1LENA 1GZWA 3B5LB 5KHKA 1KDMA 4I01A 2JEMA 5JIUA 1ZBE1 3HT1A 1R093 2ZGQA 2GC2A 4CDWA 1CAXB 3R4UA 4RHV1 5BNOC 1IKPA 2P2KA 5JZGA 4XFCA 4X6QB 2TUNA 1AHSA 5AVPA 4AEDC 5LEJA 3E5QA 3WUDA 1I1EA 2NMOA 3OBRA 4IERA 5GJ6A 1ZREA 3WCRA 3USUB 5IK8A 1LOBA 5GLVA 2WLPA 1ZBA2 3GF6A 3JBG2 1QJX2 2A3YA 3CJXA 1LJ7A 1ZZ9A 4YLZA 1UF2C 4LO4B 2TNFA 2ZMKA 4HN1A 1CONA 4AGGA 2R49A 1HIXA 3ZXKA 2WT1A 1B35C 1RUOA 4JDOA 3KMHA 3N7LA 4N53A 1ZRFA 4AVBA 1SBEA 4Y20B 2A75A 3KB5A 3KD4A 1H8VA 3VBRB 3VZNA 3EXUA 3FMGA 2A3WA 5GALA 1HV0A 4Y1ZA 2BNNA 4WM7A 2PHXA 2C1FA 3I4IA 4P9WA 4GKYA 1LHUA 1DIWA 5E8AA 2UY9A 4BM8A 1LB2A 1RVF2 1IKQA 4YZ2A 5J98B 1O4ZA 3LWCA 4XFIA 4DQAA 2QNKA 4FOWA 3TNQA 3B7MA 4R9BA 4HL0A 1W6MA 1O4YA 2HWC1 1WMDA 4AHYA 4L8QA 2D6KA 1MZ6A 2WNVA 5BNQA 4NHLA 2DCZA 3VBHB 4Q4X1 4MXVA 2VNRA 1DU3D 3VBSB 1AR81 1ENSA 2Z42A 4XFAA 4W6XA 1OHFA 1R1ZA 4N53B 2BWAA 3ALQA 1V6KA 3O7OA 3OYWB 3B69A 2WLQA 3H8UA 3CJIB 4H55A 1XNBA 4BA6A 4QT6A 2DF7A 4TYSA 2RR12 4Q4Y3 1HDKA 1BXHA 1RUD2 2WWSA 3JBG1 5FFOC 2VG9A 4DPNA 3ZFGC 5A33B 2WNUB 3I54A 1X82A 1GYKA 3ZXDA 1ONAA 3LKJA 2B5HA 5BNPB 3ZFEC 1TME3 2AZ5A 1AXZA 4IEOA 1H30A 1LKNA 4IXLA 4QMAA 3V0AB 5L7OA 2QKDA 3NL1A 1BZWA 1V6IA 2DVFA 4XZPA 4NO4A 1C3HA 3MPPG 2XJVA 3HT2A 5JI7A 2BVVA 4CEYB 4IV1B 2EAKA 4R8HA 3NV3A 1UL9A 4O9EA 5BNNA 4N9IA 2ZX1A 1OKQA 4DY3A 2K0GA 1J3QA 5K8SA 2ZMNA 4SLIA 2R1DA 4I02A 3FWEA 1GNHA 3SCHA 1GQGA 4RGGA 1FPN2 3IDEA 5KC6A 5JWPA 4YYOA 4KBBA 2E53A 5BNOA 3MZHA 2BGCA 4B29A 1HV1A 1X8MA 2JG8C 4I3PA 4META 3UKTA 5JSRA 1MZFA 1VAVA 1DLLA 1QJY1 1H9PA 3OD0A 4ITCA 2VU9A 4XF0A 1N3QA 2ZACA 1IGOA 2WA3A 2TEPA 2RM23 4Y1YA 2DCYA 2WJSA 5J48A 4LBKA 4LBLA 5I0RA 3OYWA 5J09A 2WT2A 2ZMLA 2RMU3 3TB0A 4DINB 2ZGNA 1HQWA 3MDPA 1TMF1 2QZ2A 1WCKA 2B42B 2VULA 3ACLA 1V6OA 2EIGA 3ZYGA 1POV3 4W6YA 2DCTA 2OZJA 1ZNPA 2GMMA 4MZUA 4S2FA 4EWEA 3VHOA 2W08A 2DFBA 3ZXEA 3DN7A 2C9AA 4MVTA 4Q8LA 3H3ZA 4ES9A 4GULA 4I3GA 3AKTA 4QQ2A 1DG6A 4FXKB 4DRVA 1J3PA 1VBA3 3QACA 4W65A 1HXS1 5CFCC 1H2LA 1J58A 3M3IA 4AHZA 3KM5A 1OLQA 4UW6A 1J1TA 1ENQA 2ZKNA 4OUSA 1PGL2 3M70A 2ET7A 2PHTA 1KITA 5FLHA 2GNTA 3J4UH 4OI0A 2QDNA 4DS0A 4MGYE 1AR82 3USUA 4BQ1A 1PGL1 2PTMA 4RR3B 1O5UA 5C4WC 5BV6A 4FTEA 1CAWA 5JVVA 5BNPC 3HIFA 5C33A 1RINA 2PHUA 3WD5A 3WG4A 1ZZCA 2VMIA 1F9KA 2D93A 3FZ3A 4HFSA 4K8FA 1HX6A 2BBVA 2WNUC 4JV4A 2GC0A 3USSA 2R041 1AYM3 2NLRA 4UW4A 1PGW2 5FRAA 4YZ5A 1NYWA 2FZ2A 2XJUA 2ZX3A 5CVRA 3JBG3 2IXLA 4QU2A 4C1XA 1D4M3 2ARBA 1JN2P 3TYJA 5IK7A 2H0BA 3AB0A 4XYXA 4XXPA 4Y1XA 4LTAA 3CJIA 3VZKA 2PHFA 4D7YA 3FBMA 4YFWA 1EAH3 3CNAA 2IXKA 2NN8A 4OLLA 3ZYPA 1AR83 3M8LA 2WNUA 1OOPC 1VBD3 4Q4V1 1MACA 1ND2B 1YFWA 2VOXA 4FPFA 1NA1C 1SLTA 2HEVF 2NMNA 3UKVA 3VZMA 1VBD1 4GB31 2IXCA 4ONUA 5GZGA 2JG9B 3RI9A 5I0SA 2RS13 1AR61 1S0DA 4WV8A 4CEYA 1N1VA 4GXLA 1YFXA 2D43A 1R1A2 2UY8A 1AR71 4E2QA 3IDCB 2DU0A 1F5FA 1H1IA 2HWD1 4KL1A 3BU7A 3EBRA 4FVVA 2R073 2N7GA 1AR72 3GHMA 4L97A 2X8KA 3ES1A 1YWKA 2I45A 2E7QA 1W0PA 1KFUL 1F5JA 2ZGSA 1D0HA 4Q0SA 1PGW1 1UD1A 4M00A 3KT1A 3LOIA 4RD7A 2XHKA 1SFYA 3AJYA 3M3EA 1IS3A 2D3PA 4M3CF 2QQPA 3JQWA 1WA4A 1GLHA 4TZDA 4K6BA 5D8AC 3JCIA 3NAPA 4CDUA 2MEV3 4BOWA 2D5HA 2JG8B 2VVEA 2R063 4LEJA 4PLMA 1O5LA 3NW4A 2VOVA 2TBVA 4IEQA 4Q4W3 4CYDA 2Z5WA 1VBB2 1EP0A 3VZJA 1J1LA 5JR7B 4CP1A 2XB6C 4PBPA 1AR73 4CDQB 5LK5A 4P9XA 4XFHA 2CWSA 1NOVA 3E5UA 2RMU2 1WW7A 2YHJA 3RI8A 3ZN5A 4YGCA 3ES4A 2XJPA 1VBC3 5DDJ2 4BCUA 4URTA 1D0GA 3I2DA 4YVSA 4IL7A 5JSOA 2GNBA 2HWD3 4QGMA 5C4WA 5FO7B 1RUH2 5CU1A 1BCXA 4HT1T 1LOAA 3FLPA 3U11A 2VW2A 1KDKA 5BUVA 1FXZA 2IC1A 2EXIA 1EAH1 4HVOA 5I8SA 2HWE1 1H2MA 3FHIB 3ROUA 3J9SA 4FAHA 1T6GC 4Q4W2 1U5IA 3LA7A 3SNMA 1R082 5EWSA 1CX4A 2A6WA 2RJLA 4HVQA 3JU9A 1RUJ2 5HI0A 1OSGA 4Q4W1 5CAZA 5KC5A 4HSLA 4XJ8A 2BFUL 2VVFA 4FXGB 1SFNA 4LBQD 2G4IA 1C57A 1RUC1 4L2NA 2CNAA 5GZFA 3HWJA 2YMZA 2AR6A 3L2YA 1LTEA 1I9RA 3PJYA 4JRAA 4YSFA 2P34A 1CD3G 3AYEA 1QH6A 1QOTA 4FPEA 3ZSMA 4HPKA 3WDYA 3WV6A 1MQTC 4NR1A 1ZZBA 1LEDA 2JG8A 3M2MA 1U5XA 1H1AA 3AXDA 1F2NA 2BQPA 3BIWE 3BTAA 2OUJA 5C4WB 2DYCA 2HEWF 2OZ6A 1BYHA 3SITA 5F5QA 1RUI3 4OHYA 3I59A 4FOVA 5J96B 5J37A 5JAXA 4BZ4A 2BW8A 2BFUS 4LO5B 1WCDJ 1SCRA 5FO9B 2I74A 4P9IA 3SXWA 1UPIA 1YO8A 3B01A 3VDDB 2VMGA 4KWJA 5KXEA 4FQ4A 4YG6A 1LGBA 2KM2A 2IXIA 1JH5A 5JZGB 1NXMA 5A3MA 2PLV3 1QDCA 2EA7A 2JE9A 1QXPA 3PLQA 5FAXA 1S0JA 1SBDA 1YIFA 3O0VA 3RYRA 4A7KA 3KLSA 1WLCA 1OFNA 3AXEA 3QLQA 2NYYA 4LUKA 4Q27A 4SBVA 1M4WA 3ZN6B 3RG0A 1CR7A 4S2GA 5JPMB 2YC0A 2AREA 4K7JA 3WZ1A 4NHKA 1Q8OA 2UU8A 3N36A 1U0AA 4Q29A 4FCAA 3PNAA 2H0VA 1X36A 1CESA 2Y26A 2DVGA 4COUA 3O12A 3DL3A 4AI0A 4FBFA 3I59B 2E6VA 4CZSA 1R092 2WZR3 5CIRA 4FT8A 5DZGA 4AHWA 1KJLA 1RUE2 4XW3A 4Q0VA 4Q0PA 5DUVA 1W6QB 2D6OX 2RMU1 3A4UA 3WDWA 4EN9B 4H7MA 1PIV2 5I0TA 4NPRA 1U5YA 3WCSA 4Q1PA 4CDXC 4IEYA 2VUJA 1LHVA 3C2UA 4GB32 2LUWA 4AI2A 4CDXA 1RUF3 2HEYF 1UU4A 2BWCA 2VECA 2W68A 5BNNC 1LULA 3ZYRA 5KHHA 2MEV2 1ND3C 2WL1A 3MICA 4CEYC 1G9FA 2PAKA 1EAH2 3FUOA 4XIKA 3PVBB 2FMYA 4WM8A 2XL9A 1EYBA 1X7NA 1YNAA 1H2NA 3VBOA 1VALA 5AC91 1ZX5A 3ZFEB 4AEKA 4CDUB 2ETEA 2B39A 2P3IA 3GZAA 2ZHLA 3POWA 3J26N 4M01A 1FOD1 1QXJA 1MS0A 2OPKA 4LHNA 5C8CA 2D6LX 3N4MA 1VR3A 1ZRRA 1WW4A 3CJIC 1PO13 4EN7B 5IT6A 2WFF1 3NWKA 1OQDA 1WCSA 4LBJA 1DFQA 4N53C 4X8PA 2VNGA 1IPJA 1XU2A 2QVSB 2EXHA 2FZ1A 4IESA 1OFSA 2R061 3KQRA 4OHXA 5AVAA 1AYM2 3IM0A 1BK1A 4FPCA 4QGNA 3ZN4A 2ZCWA 3MF9A 5BNNB 4AQSA 4JTOA 1FMD1 2WNEA 1AZDA 5JDBA 4RQPA 3E5XA 4AG4A 4OULA 1I6XA 3NKTA 3LZZA 4N7UA 5HBAA 1BMV2 4M3CB 1DQ5A 1JHNA 3LSDA 4XQWA 4ISQA 1UMZA 2V73A 4RA0A 1AX0A 2ZAAA 5A32B 4BHPA 1ZRDA 4E4ZA 1PO22 4CTEA 4F83A 4FPGA 2DTWA 1ALYA 2D6MA 4YW1A 1AVBA 3M3CA 1UPSA 1QJU3 2ZZJA 3MIEA 3OTFA 4C91A 4PIXA 4BPZA 2Q30A 3FX3A 2GH8A 1KQRA 1XNDA 4LLOA 2PQQA 1HRI2 5AFEA 3IBMA 4GALA 2X5IB 4ISRA 5E16A 3UK9A 5FOJB 4FPHA 1RUJ3 3ZIWA 4D69A 3D82A 4R9DA 4OI2A 5BXXA 2BUKA 3VKFC 3PVOA 1WMFA 4P9LA 4AI3A 5GZCA 4QQPA 3ENRA 1APNA 1L3JA 3MFAA 1DZTA 2JD4A 2UWAA 1QGLA 3RMYA 4OFGA 1N47A 1C1LA 1MS8A 2DFCA 3SHRA 1PZ7A 1D2QA 5A32A 1IPKA 1QH7A 3RJ2X 3MIFA 4BIFA 2SBAA 5ACA1 1RC6A 2E9QA 3C3VA 2RM22 2GC1A 3U0ZA 4XMAA 1WLWA 2A5ZA 4OHZA 1BKZA 5KXDA 5GKAC 4Q4X3 1ULFA 4WVVA 4LBMA 3MLJA 3J8F3 3ZN6A 3QH7A 5H9RA 2GAUA 1LOFA 4UBGA 1MQTB 4K1ZA 2R6QA 2XWBB 1RGSA 3M4FA 2C0ZA 1UZYA 5BPXA 2HWB1 3D4KA 4YVSB 5A3LA 1PIV3 1YXWA 1ZBA3 1XXNA 3W58A 4YZ1A 3MF6A 2HWB2 3FLTA 4XJ9A 4PDWA 2WZPP 2HKXA 4Y26A 1RUD3 3R05A 4QPYA 1FI2A 1W6QA 2I2SA 1SCSA 1LECA 1V70A 4YNIA 2OYZA 1VRH3 1Z0HA 4MV2A 1QJZA 1ZYBA 2XKPA 3FE5A 2GNMA 1VBE1 4HKWA 2Q5TA 1YCIA 2Y38A 1C8M3 2Q0AA 3AP4A 4RR3C 4CP2A 3ZFFB 1JBCA 4FPKA 4BLJA 4V1PA 4XJUA 1MZEA 3I8TA 4B8EA 2DVAA 2E51A 3P3NA 4AK3A 1RJ8A 1G9AA 4JGZC 1AL21 1Q43A 3KT4A 5EXOA 4GH4C 1YJLA 3JZVA 3WDVA 2K2SA 4QQLA 1QY4A 4XTMA 5CFCB 3S6PA 2HYKA 4MH0E 5GLZA 1WD4A 1YLLA 3LB9A 3AMPA 3NV1A 2CGPA 5KXBA 2MHFA 3WW2A 2AGSA 1XNCA 4DZGA 1DYPA 4BIOA 2IFRA 2VGDA 1SLIA 1WW5A 4LO6B 5ACA3 1LOFC 2GC3A 1AR93 2DVBA 3E6CC 4HKLA 5EYXA 1CAUA 4NWWA 3KGLA 1DGRA 4COWA 2VUAA 3VBOC 3MYXA 1QJX1 4AF9A 5AC92 5C9AC 3HAGA 5EZWA 3O0WA 3KCCA 1U12A 4QX5A 1LU2A 1SLBA 3VZOA 1CAVA 1ZZ8A 2ZGUA 3KS7A 4Y22B 4Y5Z0 4KWKA 5C8CC 3THPA 1RUG3 1REEA 3QBQA 2PFWA 1QF3A 3TWIA 1BEV2 2W39A 5IK4A 4AGRA 2VQAA 2XBO1 1VBE3 1D4M1 4RR3A 1YJKA 2XL7A 4OHVA 4G9SB 1G9CA 3FUQA 1H8TC 4K20A 1DBNA 1QJX3 4AFCA 1SDWA 4GH4A 1AL22 3VDDC 3VBFA 1AYM1 4IV1C 1CIWA 3B9IA 2JG9C 2LM3A 3K48A 2Z79A 1NCQB 5KBFA 4L92A 2Y0IA 2OUHA 2YPJA 3VV1A 2HWE3 1PZ8A 4I30A 4C1WA 4Y4YA 4I0BA 4YG3A 4Q4X2 1Q3EA 1GR3A 1FMD3 4XPVA 4XIOA 3K51A 3GHNA 1NE6A 2RS32 3AM2A 3MIGA 2RS52 3AZXA 4GIQA 5IUQA 1N3OA 3OCPA 4CRQA 2VVDA 1KJRA 3LGRA 3EQEA 3OGGA 4YFZA 4LR4A 3FBYA 3VBFC 4UW5A 1LHNA 4JC1A 4XFGA 3ZMNA 4DB5A 1C5HA 1K5MA 1S2KA 4IV3C 4WVWA 1JXNA 3SMHA 3FJSA 1VBA2 2GU9A 3S30A 5EJ3A 4UXAA 4XETA 4Q1RA 2ZHMA 4LA2A 1RITA 4ZU4A 4N43A 1OLRA 5I0UA 1G9DA 3VBSC 4LA3A 1A8DA 1OA3A 1Q56A 3VKMA 3QCWA 3GZTB 3VBHA 4MSVA 4FPJA 1AX2A 1PK6C 3VBHC 3OBTA 1QJU1 2R32A 3CU7A 1RUH3 1TNRA 3DF0A 3WDXA 5JCTA 1V9U3 5TSWA 2DUOA 4PF5A 4EWAA 4AVCA 5CB7A 2JE7A 2GZWA 2WS92 4FAGA 1GNZA 3WG1A 4AGVA 3TBDA 1DGWA 2EVXA 1ASJ1 1D4VB 4MGIE 3HQXA 3PHMA 4HLTA 1VRH2 1LGNA 1CPMA 4IEVA 2CGNA 3WP4A 1DGRN 2NQYA 3AKQA 5HXVA 3PMSA 3WX5A 4CDQC 1OPOA 2DCJA 3ILNA 4YG0A 3WLUA 2B8MA 2QE3A 1VRH1 3AP5A 4JCKA 5K9YA 5JMCA 5CG8A 3TNPB 1HXS3 1V9U1 1AL0G 4M3CA 1MEC1 1O7FA 1REFA 1CJPA 3ZXFA 3MLKA 2DUPA 3ILRA 4XQDA 2KA3A 2RS11 1B09A 1DHKB 2GN3A 1WD3A 3M7AA 5DUXA 1COV2 1FX5A 5GLUA 4AWDA 5C9AB 1FYUA 3UKNA 1JTZX 2OVUA 1EV13 3ZXLA 1SEFA 1H0BA 2WZR2 2WC2A 3VN4A 2RR11 2YGLA 4XMIA 1LGCA 1RMU2 5T3NA 2DV9A 3W59A 1ZVFA 2PELA 4IETA 5I8TA 1Q8PA 1QJY3 1XNKA 3VHRA 2B46X 1NCRB 5J7MA 1HXS2 2V5YA 2ZHKA 4AW7A 3BOPA 4WVMA 1RUF2 5CBLA 4K1YA 4B7EA 2DUQA 5CA6A 3ZDSA 4C0BA 4MLOA 4KNCA 2WKKA 2D40A 2D6NA 1RTVA 4JVAA 4XJWA 4GH4B 3ZX7A 2ZOEB 3RYKA 2HWC3 3ETQA 1C8M2 2GALA 5LRRA 3WINE 3ZFEA 1A6CA 4Y20A 3LAGA 5T5JA 5GLWA 2K9ZA 1XE7A 3WG3A 3N3HA 2XJTA 1AR92 4HPKB 1ZBE2 1Q5OA 3NAPB 3TN92 4K21A 1S2BA 4D7SA 3SH3A 1XYNA 3JD71 1UZZA 4QHBA 3V56A 2B45X 4AHXA 2ZGRA 4B4PA 5CFDB 4E27A 4AQTA 2EXKA 2Q1MA 4OI4A 4KG8A 2QCSB 3D6EA 3D5OA 3URFA 1DQ4A 4IV3B 5K0UC 3QD6A 2PA7A 2ZGOA 5H9PA 4EN8B 3UJQA 1ENRA 4GWMA 1GSLA 3KSCA 4E2GA 2IXJA 2WNVB 1UKGA 2DVDA 1H1MA 2WZR1 4AEMA 5I8YA 1DZQA 1POV1 3VZLA 1DQ0A 1BEV3 5IK5A 2PLV1 3WDTA 1RMU1 5L7OC 1CAXA 3DKWA 4P5HA 1FNYA 3AZYA 3HR9A 4MGZE 4OI1A 2QZ3A 2CTVA 1WLTA 3IPVB 1UIJA 1W39A 1ZRCA 2EF6A 3S0MA 1DF0A 4IV1A 4ATEA 1EPZA 1JYIA 1W6OA 2NZ9A 1RVF1 2WSVA 4C0HA 5JSPA 2D98A 3BALA 4YVWC 1CAUB 2HWD2 4YZ4A 2ZZQA 4K40A 2PHWA 3EHKA 4AFBA 4B4QA 3CL1A 4IEPA 1AF9A 1V6JA 4H14A 2MNGA 2RS31 4FPOB 2AH2A 1HQLA 5T5LA 4Y22A 3THTA 1SLAA 2XGXA 4LO7A 5FLIA 3WY6A 3TN91 1RUD1 3UJOA 1PVC1 4COYA 5CADA 3RNSA 5T5OA 4AI8A 1BBT2 5F6LB 2CGOA 2EALA 2XVLA 4AEDB 4KGQA 1OD5A 1FAYA 1MS5A 1RUG1 5EFUA 2KXLA 4Q0QA 1CN1A 4XQ4A 1Y9QA 4J1WA 1CQ9A 3R4SA 3E6BA 4KU7A 4BE3A 1X33A 2ZAHA 5D1IA 1LHWA 3PMEA 2A3XA 2PLV2 4KU8A 1NA1A 1A78A 4HANA 4XFFA 5FLJA 4ASMB 4C90A 2D5FA 2I07B 1UCXA 5K7PA 2VMHA 3SH4A 1RIRA 1PNFA 4LE4A 5DDJ1 1VAKA 1VBC1 2AYHA 2VW0A 4RS5C 3U07A 2ATFA 5DG1A 1XE8A 3AKPA 3N35A 4AYUA 5JOXA 4EJRA 2FBEA 5FDBA 3BPZA 2IZWA 1AR63 3VUOA 4MXWA 1TNFA 4FOQA 2BVBA 4JGZB 2GN7A 1BJQA 3VHNA 2HWC2 5L36A 1QJY2 2R0FA 3G7DA 1UX6A 1AJOA 3ZPYA 1FPN1 5GZDA 3ZFFA 5JOYA 5DG2A 4NHMA 1R081 2NP0A 3MW3A 4NWVA 2XLGA 1RB8G 2WA4A 1RUJ1 4XBQA 4PDWB 3ZFGB 1X8EA 1QU0A 3SCGA 4R4XA 4S2DA 2YXSA 2YUEA 4PJYA 4XDQA 1CVNA 2H6CA 5FQ0B 4JAAA 5L73A 1VP6A 4ZKTB 1NXD1 1VIWB 3N7JA 3UL2A 3WQ0A 1YHFA 3TN93 2JICA 1QNYA 4NOTA 1N1SA 3CF6E 3FC0A 4G4FA 4HMZA 1DGLA 3NV2A 1RUI1 1RUNA 3R4DB 4GMP1 1A3KA 2A73B 1C8NA 2XBO3 1J3RA 5CFCA 1MVEA 1UIKA 1ULDA 1VBB1 2HWB3 3V0BB 1HW5A 3INAA 2GMEA 3D0JA 4UBHA 2RHPA 1VBC2 3OPZA 5DDJ3 4I2OA 2DCKA 1O3QA 1ZA4A 3ZFGA 4BYYA 1DZRA 4LE3A 4CP0A 2QDRA 1HRV2 4WVZA 3AK0A 1DQ2A 3AP6A 4IEUA 1H8TA 4COVA 1ZBE3 2QFEA 4AVTA 1KXGA 5E1RA 1TEIA 1UKRA 1AR91 2UURA 4LO8A 3D8CA 4XJZA 4ZU5A 4AXOA 1B35B 4L11A 3WHTA 2R30A 4AQ6A 3UV9A 4YARA 5DXDA 4XXAA 1CAVB 1URXA 3GALA 1RUG2 1JUHA 1WBLA 1FOD3 4E4SA 2GMPA 3MIBA 5T5PA 4JTNA 3OD4A 3ZSEA 3AZZA 2YYOA 4DMIA 3RQ0A 1VB4A 3AMQA 3VBUC 3VBUA 2XKOA 1RHI2 1G8WA 4KG0A 3ATGA 2HJIA 4R52A 1EY2A 2D6PA 4IEXA 1AL23 1PIV1 1NCQA 1NQDA 4OZXA 3IN9A 2ERFA 3M3QA 3MPBA 3I7DA 2XJRA 5T50A 1RUI2 2BEOA 2DTYA 4QQOA 3W9AA 4CEWB 1W6NA 2JJ6A 3TOJA 1PVC3 4AFDA 1QHDA 1NCRA 4MX3A 3AYDA 1IS4A 4JQRA 1HLCA 1EV12 4N90A 3S7IA 2RS33 4LBQB 4CDWB 4F7ZA 1N1TA 4ZXKA 4EN0A 2A6YA 1FATA 1IZ3A 1G86A 2A7AA 4HK8A 2WNVC 4N7IA 3KT7A 4QM8A 5FOBB 5FO8B 1R1A1 3T2TA 1HRV1 2LTNA 2HWF1 4EROA 5K0UB 4Z92B 4JGZA 3IKWA 1ULGA 3EJKA 1S55A 3P3PA 4AQ2A 4YGDA 3H1MA 5JLVA 2XJSA 4XHBA