4K7JA

Peptidoglycan o-acetylesterase in action, 5 min
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
350
structure length
350
Chain Sequence
GLLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
total genus 125
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k7jA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k7jA01
3DC7A 4XVHA 3W7VA 4TX1A 1ESEA 4JHLA 1J00A 1VYHA 3DT6A 4PPYA 3PT5A 1BWRA 4I8IA 4Q7QA 4K3UA 1IVNA 2WABA 1YZFA 1BWQA 4JJ4A 4S1PA 4H08A 3DT8A 4DEVA 3BZWA 5BN1A 4JGGA 4NRDA 2HSJA 4OAPA 2WAAA 4K9SA 3P94A 2Q0QA 4Q9AA 1FXWA 1ESDA 4RSHA 4LHSA 3KVNA 4RW0A 4OAOA 4IYJA 1DEOA 2W9XA 4HF7A 3HP4A 2Q0SA 3RJTA 4K40A 1JRLA 1ZMBA 4HYQA 4K7JA 4JJ6A 2VPTA 1ESCA 1WABA 3MILA 1ES9A 2O14A 5CD9A 1U8UA 1V2GA 1PP4A 5HOEA 1DEXA 3SKVA 3DT9A 3U37A 2WAOA 1FXWF 5B5SA 1K7CA 5JD3A 1VJGA 4JKOA 1Z8HA 3DCIA 2APJA 3SLRA 3C1UA 4M8KA 1BWPA 5A4AA
chains in the Genus database with same CATH superfamily
3PGLA 1DGQA 4IXDA 4RYLA 3HQRA 3C97A 2FJPA 4FD2A 3LRPA 3SC2B 5BWBA 4EENA 3HDYA 4TLAA 2BAGA 4R2IA 3HL4A 3ZJTA 1H66A 3MIHA 3GA0A 3FWPA 1NQUA 4NFHA 3KKZA 3LIIA 1TUBA 1GFF2 2NX2A 2WJVA 3USCS 1NLSA 4XFHA 4C88A 1NONA 4B3BA 4UVGA 4NCXA 2ZBVA 4NRQA 1U7TA 2W2KB 4IV3A 2YY1A 2Q8OA 5IPFA 3EZ2A 3IQGX 3P2IA 3HD8B 1O8BA 1GVNB 4E30A 1TJPB 4WM7A 1GG2A 3CEAA 5J43A 1PGNA 4UZEA 2QL9A 1V8PA 2NUPB 1R10A 2EF6A 3CJTA 4PZDA 1JPNA 4WCFC 1NQDA 1RR6A 3K5IA 3C5WP 2PTHA 4OH1A 4PLNA 2QZJA 4FZ5A 1VM6A 3OQ1A 3ZE8A 4UAUA 4BEVA 3F97A 4QPGA 3H99A 4ZEMA 3GMTA 4PQGA 5J40A 3FMIA 3LKBA 2D1QA 1UT8A 3JATB 1CVIA 4QVGA 3GRZA 3BD7A 3CHXA 1R4AA 1HLDA 5KBFA 1OQ1A 4BB3A 3L1IA 4UNNA 2P6CA 2CCGA 2YZ4A 4TSFD 1GKYA 3N3HA 4RHV3 1MX9A 1X36A 3MBOA 5E38A 5AKLA 2GB4A 1IB0A 4RY8A 1DCFA 3P9XA 5DB4A 2VBFA 4U5QA 2WT1A 1LOBA 1KQOA 5LBIA 4DHWA 3JSXA 3ZKWA 1QJU2 2EARA 3U14A 1ZBDA 4IZIA 1SCUB 1U5BB 3ITNA 2Y6VA 5LYJA 1YULA 1CEXA 1DEHA 3OEWA 4HDCA 4OATA 3SKVA 4NE7A 3PVCA 2JPDA 3EIHA 4FW9A 4TYYA 3F0TA 2WNUC 5EHNA 1ZA1A 2I67A 1SVMA 5EIAA 1W6NA 4MGTA 3BUCA 3KCNA 3MF4A 4WK6A 1K7EB 5DBIA 1VMEA 5NLLA 1I1OA 3FH0A 2YVAA 3AUUA 5F33A 2GFHA 4P9IA 2J3JA 4ZVLA 3SH4A 3RTAA 4RZQA 1BD3A 4M0MA 2RGRA 2ZYSA 2O3RA 1GSLA 1ONAA 2XNKA 3CF4G 4LRTB 4MRVA 4I55B 3VDDC 1J1TA 3U48A 2ZBJA 4BK4A 2NT3A 4EG1A 1LY1A 4NZNA 3RSLA 3U3KA 1ZI8A 2JHCA 1TYAE 1WF6A 4H1TA 5DN6A 5AH0A 3BB4A 4E4TA 4OSOA 5F2WA 4JNKA 4UOQA 3RKRA 4Q26A 1YVPA 2O8CB 5I51A 2P4SA 1RW4A 3DF0A 3LWBA 3T3PB 3LP5A 2KB0A 3NYQA 1ILEA 5I7WA 3ZHRA 2YPDA 1AMUA 1UWCA 4II3A 4EJFA 3O94A 3JWGA 5LNK6 1NJ5A 1C9DB 1NMEA 4RZSA 3K09C 1XRQA 4OLLA 3BUSA 1YKGA 5HRCA 2WHPA 2YZGA 4MAMA 1J33A 3PC3A 4N3CA 2GVZC 4D9BA 2P0EA 5DTMA 3CIOA 1W4CA 3KUKA 4GT1A 4NCIA 3EGXB 3TQHA 4FJ2A 3ZWQA 4X9XA 3CLSC 5JU6A 1G20E 3THDA 2GAOA 2Q99A 4DNPA 4ZP1A 3E9EA 2VULA 5JPDA 4O4LB 1RMYA 1ULDA 2QTLA 3BORA 3ENVA 1YJXA 2A0FA 4CLOA 4G5QA 1LVHA 4G5XA 4AI0A 3H65A 2ST1A 1KFBB 5FZ6A 2DUJA 2NV6A 4XLTA 4KNCA 4LYDA 3C5EA 5FYDA 4CM5A 4FGSA 3AHJA 2RGBA 4IUDS 3ZWDA 2B35A 2DDUA 2CHFA 2YHIB 1DFHA 1YIDA 1LBIA 3DYOA 1X3SA 1KVUA 2IS2A 4H7FA 3S5QA 8OHMA 1Y1LA 2QRQA 3H7IA 5H81A 5IT9A 4JBNA 1LCIA 1Y9AA 4JVNA 1Z25A 1SOMA 2UYHA 2UXDB 2JIRA 3I92A 4R8LA 3NIGB 4DEQA 1CS4C 4BNLA 3LNCA 4QPJC 1X6VA 1PRYA 2AEYA 1DQ1A 1WBJB 4QYIA 3VR6H 3U19A 2C2BA 2ZWIA 4QYTA 1YWKA 3WR0A 4AURA 3K77A 1HRI2 2CXOA 1BKSB 1RVF2 2JLQA 3LC7O 4CYDA 3FLPA 3C5VA 1ZH8A 5THXA 5KX5A 4TS4A 2I62A 3T7DA 5FP4A 3DE6X 4EYEA 5JVVA 3CE9A 4DXHA 2XQFA 1QG2A 4G0WA 2CMHA 3WYDA 3TTVA 4B71A 1OX5A 4EAQA 2FDJA 1WPGA 4PZYA 1SU4A 2C78A 1UBUS 2FEPA 3ZOKA 1UQRA 3K1YA 4L8GA 1FQKA 4UW5A 2POCA 3KTDA 1JDVA 3QE0A 3FKJA 4B40A 3PXAA 3O14A 4ASKA 4Z49A 4HT3B 4IGIA 2G07A 5TJHA 3MWDB 3FVTA 4BLOA 4GDMA 5G53C 3EWAA 2JJMA 2B42B 4Y4RA 4JGYA 1YV9A 3OYWB 2OGWA 2HA5A 2VG9A 4QDOA 3O93A 1NW7A 1NJGA 1MGPA 3NJXA 1NNEA 2D8AA 1KTVA 1H2LA 2C03A 2Z8YA 1X39A 4JQRA 2YZMA 1MBZA 2PWAA 2NSLA 3RG0A 3BDVA 3A2LA 1CJTC 2E48A 1QWOA 4OBXA 2GXQA 4GBJA 3D8HA 1KARA 3TWIA 1SC4A 1SUEA 2W95A 2RCNA 3TN7A 3K9WA 5KTKA 3GJAA 2VT7A 4LY6A 4NOTA 4RMNA 4BKPA 1FYVA 2BKAA 1O91A 2GPWA 3AMVA 4YJHA 4CMGA 4FR5A 4P93A 4CDWC 1SHJA 2QTFA 1DYKA 3USUB 2NTNA 1QIQA 1NUSA 2CLMB 4YJGA 1M6WA 1C8M2 4RQTA 1YE8A 2DX7A 2G3YA 3SE0A 3O9VA 4HXCA 1PR3A 3RPQA 1ZUNA 4P02B 2QP3A 3VZDA 1C3EA 3MIBA 5KXBA 5JSRA 3AKQA 5FBZA 1YRQA 3JUUA 4RVOA 5KKNB 1LV7A 1AJKA 1W36B 2J0QA 1QJU3 1SRQA 4M9QA 4O65A 2EJUA 4MKHA 4K9DA 3V1KA 1LHNA 2QXTA 3BH0A 3CH4B 3JY6A 5EP1A 1Z82A 3BN3A 3DJFA 3AZXA 4HZUA 3U13A 1DBQA 3K20A 4XMIA 4HGQA 2DU1A 1L7QA 2UUBB 5IJRA 4IV1A 1C0KA 1KAGA 1NP7A 4F6LA 2GF0A 4MI9A 1DJNA 2JG9A 3EH2A 5A3JA 4UZFA 3UT0A 5DMHA 1Y6QA 4M0FA 1JZQA 1XCPA 4HMPA 1E5HA 2QQJA 4UE2A 2SKDA 1EYZA 2CC2A 1CJVC 1MTOA 2V4UA 4QKFA 4P5EA 2DKOA 2D0DA 4S2FA 5LQDA 2C5FA 4IGOA 5KR7A 1AR81 1FQJA 4E46A 4KXXA 2WJ3A 1WCSA 4V2IA 1UY1A 3FAKA 3UWMA 1IHXA 1HRKA 3GN2A 3WLFA 5G1PA 3O1LA 3FMPB 2VHCA 4JAVC 2ZREA 2R4TA 4XJ9A 1I3OA 1Y7LA 1I3HA 1NSFA 3A6KA 3GJRA 3AM3A 2IYVA 3LGSA 1E58A 3HCRA 5K4AA 3D6HA 4W6YA 1W3VA 3WG3A 4BWVA 4FOVA 4PYMA 1A3CA 2IWRA 3X2FA 1Y8RB 1EUCA 4M9RA 4QULA 1N5IA 1GWLA 1JFRA 3PFGA 3VD7A 1EVIA 3TRJA 3W8EA 3F7NA 4N7IA 4HUQB 1FVFA 4BBJA 2J9RA 3EIUA 3DZDA 1ZC4A 2XWSA 1MORA 2OCPA 1DLIA 4LO5B 3BILA 3CRQA 1VQ1A 1S0FA 3FOCA 5DSXA 1E6WA 4YT4A 3PIDA 3WLHA 5AK0A 4CMEC 3HEAA 2GNAA 1TE1B 1NG9A 3W6OA 3MRSA 1TQ4A 3RS6A 5JH7A 2RHOA 2GKGA 3N36A 4LHZA 3UO8B 4WVLA 1U0HC 1B0UA 5DGTA 1W9FA 2Q41A 2GI4A 4GR5A 1K7YA 1IKQA 2PZGA 3V34A 4BJ1A 5CD1A 1QO9A 1THGA 4I81A 3WP6A 1OVGA 1U0TA 2XUIA 2VMGA 1K97A 3UN1A 3WP4A 5JBIA 2IHZA 2VTVA 1KGYA 2W6ZA 2HX1A 4DZTA 2R6R1 3CKMA 1YACA 1E89A 2IWGB 1ETUA 1PWZA 1Z6TA 2P4QA 1HRI3 3HR7A 1W2NA 1SK9A 1E1QA 4P08A 2AI2A 4EG8A 4C0LA 4COKA 4YR9A 5FI1B 2OV8A 1QP8A 4GPZA 1J39A 3VRHA 3EFBA 5CIQA 3ZX5A 5FKJA 5JY1A 3ZGVA 1ST8A 4X7MA 2XZTA 4B43A 1KOGA 3LPAA 3ESYA 1KH1A 3ZDXB 4DIMA 4DV0B 3H2HA 5AKIA 3UV7A 2C9OA 1HDZA 2YR0A 3Q0EA 1EXNA 1GN9A 3C45A 3QLJA 4I36A 5BXXA 4UMDA 3G1UA 3AR2A 1OZFA 2XDYA 5CLQA 3I2IA 1IEQA 1FFWA 3EPJA 2Z8YM 5JDIA 5IZCA 1VIAA 3Q8XB 2C9YA 4IXMA 1AUOA 4JQYA 4BVHA 2HQOA 4W5OA 1I51A 1YKFA 2IXCA 4JN6B 4DXRA 2I80A 3PRYA 4JODA 2JJ1A 1Z28A 5DLYA 3G8CA 3DOFA 1PX0A 2QX6A 2O8VA 2DFTA 3RRBA 4W9MC 1UBCA 3O92A 2GFIA 1DG3A 1NJ6A 4BV8A 5AQ1A 3L82B 1R6DA 4RL6A 3RUHA 1JA9A 5F64A 5CFCA 3OCCA 1Y33E 1YB2A 5CYOA 2VHZA 1YFWA 4XVHA 1ESEA 3OBTA 3BTXA 2TBVA 1NOJA 2DPYA 2X23A 2E5LB 5B1DA 3U3XA 4U2DA 3OUTA 1HETA 4B3TB 5B4VA 1HN0A 3A2MA 2GSWA 2OXIA 1DBPA 2JB9A 4IDBA 5K51A 3IOYA 2G09A 5T4BA 1RUD3 3GFQA 4QHYA 4N7JA 4V24A 3H11A 4NRDA 1P8JA 1YQXA 5I4BA 3LQ1A 1VMAA 1C8M3 4PJYA 4GP6A 3O1VA 4GX2A 4AQ6A 1QP7A 1F8FA 3EJWA 2XVKA 5KVQA 4CQLA 4PNEA 2OO5C 2ODPA 5I7HA 3QEBZ 3TGWA 4P7FA 1ZNWA 1Q19A 3AXEA 4DQVA 1VI5A 3W7AA 3G82C 1NV8A 4E21A 3VBRA 4LHVA 1OGJA 5CD9A 5CB6A 3QX9A 4WXHA 3K5HA 2VUSA 2RGCA 2JK0A 2JF0A 2QFEA 2FUEA 5B6IA 1P1KA 4ORFA 3NV9A 5FXZA 5NULA 4PRZA 1GITA 4GA9A 4I5IA 2Q5FA 3UGFA 3L9JT 4JBHA 3ANSA 2E5FA 5KVSA 4GKKB 3VHNA 4DLZA 1WPQA 2JDMA 4NVRA 3S7ZA 3JB4C 3B02A 3GJ3A 1H8VA 4HGNA 2FX2A 1WKYA 1RE1A 4XD2A 1PIV2 4AJ4A 1VHJA 1S2BA 3EGDB 5EKSA 5HM8A 2REQB 3ZDYB 1G9DA 1KK1A 4J1TA 2Q2WA 1L6RA 2VSFA 3P2YA 3HHEA 2IU6A 2ODEA 3I3MA 4ATNA 4HEJA 3W79A 2W3JA 5LXTB 3ZN2A 1N5RA 2VTKA 3VZQA 1Z17A 1GXSB 1S8OA 4J1NA 4BVFA 3OJXA 5C8CC 3L7AA 1OWOA 3URFA 2R7LA 1YJ8A 4EHAA 2B4QA 1OUXA 3D4PA 3D54D 1V8ZA 5J3JA 2J3HA 1XTIA 4FKMA 1VJDA 2WBKA 2Y76A 2GASA 2ICAA 1N4DA 2AS0A 3S2SA 2CXTA 4G8CA 1HY3A 3K4ZA 2JIQA 4W63A 2D59A 4GXRA 1QGUB 2C9KA 2OD9A 3DOOA 3PTLA 1E9SA 1YASA 3X44A 3DWGA 5CT4A 5L9BA 3HJUA 2VPYA 4G0ZA 5FFMA 1JLHA 3CPHA 5H82A 3RU3A 3EVEA 3QUAA 3DFIA 2GLUA 5CB4A 3SYTA 3OTQA 4MHUA 3OPYI 3DXYA 2WTXA 1EE2A 2JLRA 5JAHA 3BT7A 3EC7A 4C6SA 3EGCA 1KMMA 3O1OA 1HLPA 5KQRA 1X42A 2IHNA 1H2XA 4DB2A 3N7AA 1MG0A 3I8OA 1T2UA 1WM1A 3PUHA 4UCWA 4M0KA 1YOVB 5JI2E 4U0JA 2QTMA 4DV7B 1H5UA 2AJLI 5IYYA 3ZWAA 1K5JA 4G4JA 1XHLA 5A3RA 2QUHA 1NPTO 4TYNA 3PEFA 3I23A 2HD4A 4PQFA 3ZK9A 4RFSA 2XH6A 3OFSA 1GLNA 3LHFA 1MS1A 1WBFA 1MG5A 3Q5EA 4I5DA 1GFZA 1I1HA 5F2KA 3AJ9A 5K0CA 3GYBA 1WCQA 3LCPA 1D0IA 4KU8A 1UOOA 4DUXA 4BH9A 1T2EA 5JZMA 1KZGB 2XB6A 2ZOEB 3A1WA 2ZHMA 4WT7A 1KMQA 2XUAA 4G0QA 1V3QE 3KQMA 2IUYA 5ALWA 4QB2A 3HT2A 4FPXA 1H3EA 3WNOA 4HDAA 1RXWA 4D0RA 4Z99A 1U81A 3M70A 1UQTA 1DP0A 5DTRA 5E95A 1YZQA 1JH5A 5IWFA 2J1LA 2WFLA 3C4VA 5JNUA 1TFRA 5DVZA 2EZTA 1SFNA 1WDTA 4D96A 1POXA 2Q7OE 4TL7A 1Q1ZA 3JQ6A 5SYAA 3KEMA 5YASA 1VBKA 1XE8A 4RW0A 1PL7A 2V72A 4FFPA 2G5PA 5A03A 4RA6A 4MWEA 1W44A 4WLEA 5DG1A 2PVSA 3VO9A 1OHFA 3DBHB 4JQTA 4DLNA 2XZLA 2BF4A 2Q9AA 1I4WA 4BMSA 2M98A 4TN1A 1G9XA 1Y9ZA 1HG0A 4AVBA 2PU5A 1GZ4A 4CM3A 3U4AA 4INPA 3CVXA 3C6XA 3UY4A 3BFJA 4BNTA 4WGGA 1B23P 4DCSA 3RIMA 3GT0A 4GKVA 3AZWA 2BGRA 2QQ5A 3HN1A 3FOWA 2FK7A 1ZRHA 2O5VA 1FS4A 2VZ9A 4NIAA 4FOLA 5DE3A 4JRAA 2B8NA 1DIOB 4P81A 3V1MA 1S2LA 2ZW9A 4K28A 3W5NA 1TKBA 1L1RA 1FDVA 4GPBA 5FR3A 4NBWA 3KJGA 1QMGA 2NP7A 3O0VA 4UMVA 4FBMA 1TYZA 3FFBA 1DGRA 2ID4A 1R0KA 4MGIR 3SYRA 3VDQA 3KYCB 5BW6B 3U9LA 2XHKA 1C1HA 1KI2A 3WL7A 3L8ZA 2I4OA 2QBYB 3QE2A 4L50A 1T9DA 5HOEA 4KQGA 1XNRB 4FUTA 2MINA 3RVNA 1SY7A 5CDTA 2BM0A 1GPNA 3LKDA 2FE1A 1CE8A 4IMPA 2GJ8A 1BEUB 3KOOA 3CIHA 3ZY4A 4EZHA 1QBKC 1T8PA 2R6HA 2Y68A 5FAKA 4TKVB 3F5FA 4JV4A 3COWA 4MDHA 2OAP1 3C5HA 3TVTA 3HKCB 1R6AA 2QIOA 4ES6A 1E2JA 3U26A 1M2EA 1UFVA 1PIV3 3IVAA 3PNMA 2PFGA 2CDOA 3N8NA 1JDBB 3PQ3A 2ZI5A 5CT8A 2GBPA 1QZZA 3TS1A 3ND5A 4MINA 4QGGA 2IX3A 1AKVA 1FMCA 4WM8A 2R96A 3J8F1 2WB4A 3TW6A 4QM8A 4OQYA 2RGXA 2FOXA 1TL7C 4DCTA 1IBSA 2R8ZA 5A3VA 2D6FA 4ARXA 3T0AA 4XVCA 4CIBA 5CEFA 1YCHA 2XJTA 1IUNA 3ZHTA 1L5LA 4G9EA 2GX6A 2Y77A 4MS3B 2FPRA 4XJWA 3QFTA 4RMIA 2WF7A 2VZQA 2PT7A 5B1YA 2EKBA 4ZALA 3F3YA 3C3AA 3TOZA 4QM6A 1TDJA 4DJAA 5JDCA 3AI3A 1C50A 4LEJA 5DW3A 1BMQA 1LF5A 5FR1A 1IM2A 4PIXA 1C1YA 5DXFA 3L7LA 4QRHA 1KXJA 3E97A 5AVUA 3NAQA 3ZWKA 4JLWA 2HF7A 1WPRA 3QLTA 1YQUA 3NNJA 3RQ0A 4YECA 1X7XA 5KKCA 1L8OA 1RKBA 4ZDKA 4DQKA 3M33A 3UJCA 4AKHA 1SCDA 4RCYA 3OTIA 1MXFA 1XJWA 4HO1X 1WZIA 1U1GA 5BN1A 1RBZA 4TTTS 2X0FA 4KJXA 2MSNA 2GHRA 4A41A 1ACMA 1R15A 3E58A 4UXHA 3DCJA 5FTMA 2B0JA 2CL7X 1FUIA 1HB3A 3NM5A 3W3AD 2G4CA 1AR62 2II6A 5KMGA 3RAPR 1NW8A 4I2VA 3A2KA 3GNLA 1Z7S1 4X20A 2BCEA 3ZZTA 4INDA 2IYRA 3EDYA 3KFLA 3IM0A 4Y6QA 4FHGA 1E1RD 1KDPA 3GG9A 3DONA 3N0TA 2OFPA 4CUZA 5KDLA 1SFRA 1KU0A 1O1YA 2JIOA 2RR11 3UAXA 2GN9A 3LHIA 2I2WA 2V4VA 4Y2TA 3OZBA 2ZPAA 2FZGA 3L0CA 1WY5A 1NOIA 1P2TA 3E3LA 1B8OA 3HM9A 5A4IS 3QMVA 2QXUA 4NBRA 4EN9B 4K0RA 1QOOA 5EWLA 3C0KA 4I9NA 3Q40A 2HO5A 2FEWB 2DWOA 3DDCA 3L5OA 1G8FA 5MHTA 4YMVA 1G21B 2QG6A 4BNWA 4TN5A 5CM9C 2I22A 2OCGA 3AVYA 4Q8LA 2AEEA 3MFQA 1UPSA 2OZLB 1F4PA 2IUSA 1ZH4A 4UNSA 2G0NA 5EJIA 1B93A 2QT9A 4PGMA 1C30A 2P1DA 4PYJA 4XDZA 2OGTA 3KQWA 2QJWA 2R7KA 5BWMA 2SLIA 3HP4A 2RAFA 5BVHA 2E4VA 5F76A 2C95A 2XKJE 5F2OA 1UMCB 3OSDA 4AJ9A 3GAAA 3OOXA 5AR1A 4OI2A 2R60A 5I6DA 3D8RA 4D46A 4Q4HB 1Z26A 1QCZA 3B52X 2Z2IA 2ZVQX 2L82A 3IOMA 5FUBA 3STWA 4QEDA 2OM6A 2JB8A 4HWKA 1LKZA 1JPUA 4QXBA 3HNOA 2J48A 2XE4A 3NG1A 3O8QA 4META 1AKYA 4AJHA 2VBBA 5GV7A 4FX2A 3NTUA 5B3LA 2XJPA 4JHLA 1HWYA 5F77A 3SLIA 1Y5RA 3HO1A 4Q02A 1H0RA 5DYYA 1D7PM 4XFIA 1TZJA 5KTRA 4MMZB 3OE5A 1KEPA 1GZSA 4Y6RA 3VH4A 3DSRA 1E7RA 3TWOA 1ULHA 3LUAA 3N8HA 5KC5A 4RD1A 3PZRA 4AI3A 1NNSA 4KNVA 3NIBA 3PU3A 5LL6P 1NN0A 4E2WA 3A1SA 1LGNA 4B87A 2FUNB 1NBMA 1XAIA 3DHVA 1ECLA 4DG9A 4MS4A 1U2GC 1UZNA 1E79A 3VKVA 3FRJA 1LI5A 5FZGA 3B51X 1OBFO 3PWSA 1KNXA 5A80A 2XKKA 3G2NA 2W2VA 3A22A 2ALJA 3BIOA 3MELA 3EJ6A 1KEWA 1GDHA 1XWWA 3RO7A 1B09A 1SN7A 4NU0A 3ES4A 3STUA 2ANCA 5CGZA 4XURA 2Q4BA 2HEVF 3FHQA 5TJ9A 2VTEA 1D6MA 4WBBA 5JXHA 4FFIA 1FFDA 2XBO1 5JCOA 2VM9A 2FZVA 5HVNA 2HFJA 2X8BA 3NFRA 3LBYA 1URPA 5BNFA 4ZAXA 1P1IA 3PTAA 4GS5A 1KO7A 2COUA 4J0HA 5JZBA 4P4SA 3LT4A 2ENRA 2IHTA 1KWGA 4BFUA 3CMMA 1O95A 3FUTA 5ALLA 3CBNA 2AG8A 2BRUC 1NUPA 4J07A 1N5JA 3VA7A 2VA9A 3B3QA 3CEPB 4N18A 2PHUA 4UBGA 3V00A 4HK4A 1JILA 3EMVA 4XBLA 2P0AA 2GUWA 1YF3A 4M1SA 4PSDA 1Z2OX 1IS5A 2IXDA 4XSHA 3B94A 3M4ZA 4G5OA 1GY8A 5HMLA 3L0DA 3P96A 4KCGA 3RNOA 1TVCA 2BEKA 2QSJA 1P0IA 4X6LA 1EJ2A 3DAPA 4MI6A 2Q7DA 2R87A 1W8OA 4XYLA 4B4UA 3BL8A 5CXQA 2LXNA 3PLNA 1GM5A 2J7KA 3QA9A 2AACA 4BO5A 4NMIA 3BRWD 5CG1A 3CLSD 4I50A 1AJEA 1H8TA 1QNFA 3M3IA 2CD9A 2ODAA 1I80A 2OXEA 1QOQB 4G4IA 4UE6A 3O7MA 4MVXA 1Z5VA 2X2EA 3FHIB 5EJFA 5J7MA 1NMXA 2OUJA 4ZZ3A 3BDAA 4LE3A 4ENWA 2UU9B 2RHDA 1KRXA 1Q0ZA 3ZE2B 3KO8A 2NGRA 4TTGA 1DEKA 2R6GA 1ZUWA 1M2JA 2LBPA 3E0XA 5TVGA 2WRAA 4GWJA 2NZ8A 4EF5A 4O4JB 1TTPB 1QJY2 5KXDA 4PLPA 4DIQA 3M1HA 4P9YA 1U9ZA 2A2ZA 4LBYA 2JKZA 4FE7A 5DX8A 5EUQB 3MUZ1 2GC3A 1AR63 5BNPB 2GDJA 4JSRA 2I7CA 5U4QA 4WK0B 4MDYA 4RORA 2OEPA 1LOEA 3ZDQA 4KQ6A 1U8EA 4JIGA 1IHUA 1NA1C 2Z4FA 1VLJA 3UAVA 4YCJA 1HJGA 1I4OA 1TA4A 4CDXB 1RHQA 1KVRA 4JXJA 3J7LA 4F2DA 1PJRA 5BNOB 5ACA1 2G9GA 5FZ8A 3HFSA 2H7CA 3BIEA 2KBFA 2FCRA 2CV1A 5TRTA 2WIIB 3Q1KA 1U1FA 5FZ0A 2OA0A 2UZIR 4JLKA 1PJ8A 3WA7A 4R1MA 2BI4A 1LVUA 1LXCA 3TOCA 1QXSA 4FN4A 5D51S 4FJ0A 3L41A 4EUHA 1SHUX 4MUBA 4DLVA 5PGMA 1KF0A 4F4IA 1CUSA 5D8AC 4B74A 4ZS2A 3C16C 3IPYA 1JHRA 2X1MA 3C6MA 2O20A 1X33A 4DMUB 1LSJA 3GGJA 1WBDA 4M0UA 3SZRA 4BS9A 3CF6E 3VOBA 4ZT4A 1KQGA 2OHJA 9MHTA 4KMRA 3W9BA 2H1CA 2FU5C 1RHI1 2K46A 4JYCA 5AI9A 4XDPA 1ZJWA 1TK9A 2JGNA 5TX7A 4JI8B 3OZEA 3QFRA 5AVJA 2HT6A 1EFRA 2FETA 3QPWA 2WT4A 3MUNA 1CRLA 2WWHA 5LA2A 1HT3A 4GZLA 5HA5A 2CNOA 3LD8A 3ELNA 4XIKA 5FRDA 3KLPX 3OIVA 4UAJA 1W0JD 3RC7A 4D9IA 4P84A 3LK6A 5J59A 1JAHA 3EYPA 2QP4A 4U8GA 1XDZA 5J98B 4BJ5A 4HVTA 3HRIA 1L8QA 3L49A 2P2DA 2DUMA 3F8TA 3CEWA 2ZK7A 2WP8J 1OYOA 4ZCQA 1Y4SA 2C1XA 3GZNA 2QUOA 4Q4JA 2D3SA 1XNGA 5A9SA 1UL1X 3KYDA 2PVCA 1HQDA 4ID3A 3FMFA 1K3UB 4FFHA 2FHPA 3I76A 4P00B 1FDOA 4GH5A 1GICA 4X90A 4OX9B 3L4JA 1UDXA 1Z29A 2PD6A 2WICA 5J23A 4K9MA 4DR1B 4JGBA 2C57A 3TJRA 2ET1A 3P2EA 4LWPA 1T3TA 3NQ41 3NBFA 2RHBA 4GWNA 4BFSA 3JPYA 3VL8A 1ZXXA 2IV3A 1QQBA 2PRIA 2D44A 3E5MA 2VF4X 2VBGA 3PFNA 4JCCA 1HYHA 1IFXA 3G5LA 1VKZA 2D1TA 3DZCA 1OU0A 4H60A 3WKAA 2JJ2D 3V3KA 2AZ5A 5CFOA 4OQMA 5LYJF 3VX3A 4GKBA 4P3PA 2I99A 1TADA 1X1CA 4Q47A 5LUAA 3VTAA 1DT5A 1P61B 1DLJA 3WV5A 5SYMA 5F2SA 1VJ0A 2XKOA 4NHOA 4HVLA 1FOEB 3RAGA 1SBZA 3P94A 1FP4B 2M9MA 2P6UA 5LPNA 3TBFA 3Q8BA 1OXVA 4RSMA 3U7HB 3SOPA 2XUFA 3M6WA 4BXSV 1MOQA 5ETJA 5DNCA 2J3MA 2R3SA 5EQTA 3MICA 5HX7A 2V1XA 1SHZA 3BF8A 1Z5WA 2NLRA 1Q17A 5EE0A 1UKAA 2HSDA 5A3SA 1XKQA 1XUOA 1PT9A 4LJ9A 1OX4B 3ZIAA 2FZKA 1HV1A 4YAKA 1HE8B 2GOYA 2Q45A 2PKRA 3AVWA 4NICA 2WO3A 3DYBA 4Y6PA 4BVKA 1BX3A 4ZJPA 1WCYA 4M99A 3ENKA 3ANTA 2GP5A 5T4EA 3MQFA 1TG7A 2IJGX 1REQA 3SF0A 1KEEA 2I6QA 2MSCB 4A8JC 3Q8MA 3Q1LA 4WVMA 1ASJ1 2ATVA 3G79A 4QUBA 9ATCA 5BV8A 5IDYA 1G6KA 5KJ6A 2XONA 5EIWA 2VTDA 4H27A 5IVFA 3GF6A 4FPJA 1Z0UA 1TAUA 3N6VA 2XRYA 1L4UA 2Q2OA 1U3GA 2H3HA 5IWAB 2Z2ZA 2AQ8A 1KI6B 3CVVA 1QHHB 3AKEA 3PLQA 2AX4A 3QKRA 1YI1A 2VAUA 3B2NA 5DU2A 4P86A 1OURA 1S2EA 3U4DA 5AHXA 4DCNA 1NJ1A 4PYKA 1HQNA 3HXKA 1L8AA 1QJY3 3S0MA 1AL21 5DHPA 1PUJA 4LWOA 4DKXA 4V0NA 4BNZA 3AONB 3IHWA 3HPNA 2OCDA 3JQEA 5LU9A 4NCHA 5B4XA 3I04A 3MHZA 3PVZA 2GRAA 3UKOA 3O8OA 3DZ8A 4A7YA 2V74B 5LATA 4C0WA 1E7MA 1QVAA 3HY6A 4ROSA 4FNOA 3E3NA 5LY2A 4JITA 5ISLA 2ZGUA 2BJSA 1BROA 1BWPA 1TCAA 1WMFA 4COYA 3BL5A 3I9NA 3R23A 2W5FA 1C1FA 3JX9A 2WSMA 3WYCA 2PA3A 3GJ8A 1T4CB 1JBEA 4YA6A 1ZRDA 2YC0A 2BM9A 1C81A 1E0KA 1HTTA 2VDWB 1E5SA 1NG1A 1OKKD 1K2WA 4LPKA 3VBFA 2W94A 1N3PA 3Q2IA 5FV3A 3TEMA 3HBAA 1OIVA 4ANFA 1WCUA 4N0PA 4KE6A 5KX5F 1JDNA 3NZEA 3U3RA 3COPA 4DIOA 3RRDA 1MKYA 4PR0A 2HA4A 3IMKA 2UVQA 4OA8A 5FYCA 2IU3A 2EKQA 1N2OA 1Z0KA 5DNDA 4CP9B 2P30A 2R47A 4D3DA 5ALUA 1RQRA 1JTZX 1QS0A 2DKNA 5B36A 3DDWA 3EC1A 1A9QA 4IKEA 5K0JA 1BW9A 1E4OA 4CDQA 2D1RA 3HXPA 3M1LA 1ZI6A 1SA0B 4ZU3A 2IITA 2RGEA 2IOHA 1XU2A 1PGW2 3DP7A 2I2AA 3M9XA 2CLSA 4OMCA 3C3WA 4ZI3A 4TZTA 2GEKA 2B1IA 2JBHA 4LQCA 2XGGA 2DF8A 4ET7A 2DULA 1WDWB 3PR3A 5AKYA 1W6MB 2VNOA 4FEAA 4ITVA 1ZAYA 4OHXA 1OD5A 4K9KA 1Q8PA 4L2IB 1XFDA 4FQ7A 2FFJA 3CFYA 1KDRA 4CKCB 4X65B 1JIXA 1F0KA 3L06A 1Z7GA 4F4FA 2XDQB 1N1GA 2VNIA 4GG1A 1RWPA 2XGSA 3ZBPA 1QYDA 3OFNA 1D3AA 1WCV1 1SXHA 4BA6A 2ZYGA 1JHPA 3R0ZA 4GI3A 1Q3TA 2VW2A 3H87A 3N0XA 3WTBA 4MCJA 5C18A 4JYZA 3ZXYA 1CQXA 3L9XA 3O9MA 5A7HA 4U7WA 2BCJQ 1F4HA 3GJXC 2UXBB 2JANA 3ZR6A 1QDUA 1A7UA 1TT5B 1EQ2A 4OU4A 1V1JA 1WXEA 3REOA 3OD5A 1A0OA 1ZQ9A 3W5MA 3W5BA 2EX4A 1VDZA 1DG9A 1P3DA 3L05A 2FSSA 1Z33A 2PZFA 3OZDA 3C1AA 3KQQA 3IE1A 4TLGA 3CF4A 4P31A 3BXZA 5IVJA 2VZOA 2ARKA 4GE0A 3HB9A 3TLCA 2ZCJA 1JHQA 1GG5A 1DS6A 2YYOA 5IBQA 2VOXA 3ZNOA 3T1VA 4MLOA 3B7PA 3BM5A 5C71A 2O3TA 1JFTA 3SC4A 3WGLA 1BHO1 2PGAA 3FTPA 1GKBA 3U5TA 3FLBA 1WL8A 3IH5A 4HDQB 4PYLA 4YFVA 4S24A 5D1HA 2ZZKA 3X1XA 4XM1A 3ZXXA 1AUVA 4Q1EA 4P53A 5F6LB 4MXWA 3JCIA 5IK2D 2VDNB 4LBQB 3WCRA 2WD7B 1CJBA 4O0MA 4IW3B 1XNCA 3AEZA 3RIEA 3TTTA 3RVBA 4MQ6A 1PV4A 1WKBA 2WO2A 3IUMA 3BHMA 5HF8A 1FSPA 3IT2A 3I0ZA 2X3FA 4G01B 1GTZA 3ABSB 2GM3A 1NBAA 4Q1AA 4MUHA 1I7LA 4CF4A 3SHFA 4PAMA 3NNDA 3L7BA 4MA0A 3O1TA 1IQRA 3D2AA 2B30A 3E2IA 1JLKA 4QEKA 2F4VB 1XHFA 3VC7A 3OQPA 3AJRA 5A02A 5FOBB 4M83A 5FI3A 4RS5C 1SVSA 4JUIA 4A8PA 1DWQA 1GPH1 1L5RA 1LX7A 5AUNB 3V48A 2XODA 1TU0A 2HWXA 3WGGA 2CYFA 3F2VA 4M0DA 1JJ7A 4TTRA 1IXRC 2FN8A 1JYIA 3I04M 3GT4A 3SLGA 2P6PA 1TC2A 1Y37A 4ETMA 5EE9A 1YO8A 1FPMA 1TVEA 4URVR 4G3XA 4BKUA 4ENVA 2V97A 3MMSA 4LDRA 2XNDD 1R0WA 5DM2A 4WPGA 2GZRA 2EU8A 3C39A 3MJDA 2CJPA 1PMHX 2OO3A 1PNVA 2OBYA 3DUFB 2C7VA 4CXWA 1EX7A 4YCSA 2ZRMA 3ZR5A 5JH7F 2A5ZA 3O1MA 1IUKA 1VSBA 4AOCA 5BMVA 3JQRA 3I3DA 3IE2A 1MVEA 5DQ0A 3GQVA 2I65A 4H6XA 1IG3A 2BELA 1M1YB 3WG9A 1V5WA 3B6IA 7GPBA 4DL9A 1OFNA 4TKUB 3AP5A 1EFVA 2EKPA 3K3OA 1ZQ1A 3GLIA 3LHDA 1XTSA 2ZSDA 1Z7BA 1DKOA 3DZIA 2W0XA 3KTAB 5FIUA 1Z6XA 4XAAA 3KB1A 3VD4A 4ZZIA 2G9UA 5D7BA 2ZI9A 3PGXA 5FKCA 2Q2VA 4YPFA 4CTJA 1JEDA 2KQUA 1ZM7A 2AENA 4B3DA 1I3LA 1JI6A 2EW1A 3H5IA 5ALPA 3JQ8A 5JJBA 1MC5A 4EV0A 2YYSA 1QV6A 5FWYB 1CHDA 3C24A 4HXYA 3OOEA 2WWFA 2P11A 1O5OA 2FD8A 4EWEA 1FXUA 3NONA 1W0KD 4NSNA 4UOZA 3KUDA 3UMMA 1M0WA 3BI3A 2QD1A 1M2NA 4ZO6A 3FBGA 2VZ3A 2XRMA 5TMPA 2RDSA 1DC4A 3DNPA 5ARDA 4L2NA 3GJQA 2PD3A 5AVZA 3NDRA 3GEDA 2XUOA 3VZMA 1CQZA 1TJ5A 5EJ4A 3PUWA 4RTSA 1RRMA 4TMVA 1AXEA 3OJCA 4P9XA 4PG4A 5HDBB 3AOGA 1E2PA 4DR3B 5DYIA 5HCIA 3U61B 1EDEA 3R5XA 2PYIA 2RK6A 4L72A 2GLXA 2HLNA 1I4DD 2EKDA 3PV0A 3T3GA 4H17A 5EESA 2EIHA 1E5RA 2O3QA 3W9SA 5BORA 1YO6A 4G65A 2QA5A 3OJLA 2VUUA 3ZW9A 5KQSA 1CY7A 4ZT3A 4XW2A 4WTOA 3W7BA 2O06A 4I6GA 5I0SA 2CCKA 2YRXA 3L40A 2VG8A 3K0AA 3TEJA 1Z34A 4KFUA 1H2MA 2V7BA 2MSLA 3MUEA 2O3SA 3RI3A 4C2UA 2QLFA 5G2OA 4L6AA 5FXXA 4EA8A 4BDSA 4MVCA 3KF5A 3OC6A 3GA5A 1V6LA 1V4BA 2Q5EA 2HKIA 4HN0A 3UOAB 4MYSA 5KHHA 3U4IA 3SSNA 1XYVA 1OU4A 2IEGA 3O2SB 4N7BA 2VWHA 3QXGA 3UGHA 2VDQB 4Q9NA 5BWOA 4Q3CA 1CLUA 1M76A 4F6CA 5EJ3A 4JUDX 3X29B 1GQFA 1REDA 3PDIB 3MG9A 4ZZ8A 3RHZA 5C9AC 1Q2XA 3QMWA 2QDXA 3K92A 2PZLA 2WPNA 1YRBA 2MYNA 1HNNA 4IF4A 4XPZA 1J56A 4HNSA 3IAAA 3WBKA 3CNEA 3FJYA 2FPGB 3F2ZA 3G85A 1V96A 1XP5A 2E4AA 3UBMA 3F8WA 2QNKA 1LQUA 3SOZA 3TZQA 1NLFA 3OFVA 2YZ7A 2GM9A 3SXJA 3KV6A 4YVWB 4RHUA 1XZHA 1LPNA 2C5SA 1SXQA 4UCQA 4QELA 3DP9A 3FFZA 2CSUA 2F3SA 2VSYA 1EVZA 2HJVA 3VZKA 3B1XA 1OH6A 5HXVA 5KHAA 3G0IA 3PD0A 2IYQA 2BDEA 1DXOA 1RL3A 5JR2A 4AO8A 2C7QA 1O6UA 1ENRA 3WISA 1P2VA 5DIFA 3UK6A 1NTOA 4QD2A 4S1OA 3BF7A 1N1VA 3RFRA 4PX5A 1CDOA 1R1A2 1GQHA 3SHTA 1H2AS 1GSHA 4JDOA 4NU8X 2PKYX 4QVKA 2IGBA 2VHJA 1V7CA 2Q3LA 2JRCA 4LE0A 1BLZA 3I53A 5FFFA 4JEIA 2Y9MB 1VHTA 1YDHA 2Y1EA 3FB4A 5DKFA 4JELA 2I29A 3H0EA 5EPOA 1QQTA 3QLEA 5CB4F 3WHKA 3STHA 3JQAA 4XFCA 5FBRB 1I13A 4IV3C 2VYQA 3ZYCA 4EJSA 3AOEC 2Q1YA 5E4FA 2D5CA 4WM7C 3C43A 3RT1A 1U7XA 3K7EA 4XAEA 3IP3A 2WJSA 3GGCA 3OTHA 4YRCA 3HKBA 1ENZA 4AMYA 3L4SO 4O2AB 5CW2A 2PAAA 3NEPX 4JT4A 4LBOA 4D3YA 1JXMA 4X60A 1CZTA 1R5OA 3A23A 1W29A 2LWIA 3OEAA 4XFGA 4HDNB 2OESA 4K6BA 3GT7A 1AKNA 4UAGA 1GCGA 2JI9A 4F9EA 1Q0SA 4XGNA 2G1JA 3ZD9A 1PGPA 1U0AA 5HQ3A 2BBSA 3TBDA 2HK8A 3RAJA 3F1LA 3MWEA 3VR6D 3TEFA 4PHTA 1A8PA 3LJKA 3LP6A 1YL7A 3EVNA 3E9NA 1DKPA 4Q7EA 4XFBA 3FI0A 2XEDA 1OYWA 2J45A 3FWEA 2J46A 3R7BA 3L0BA 1FP1D 5LDHA 1Q8VA 3HZOA 2NQYA 4B3RB 4LYYA 1SBIA 1VBB1 4OGLA 5A06A 3JQQA 3IE0A 2HLEA 4GMGA 1WCIB 2IIVA 4OA5A 5DM70 2XWBF 1T1SA 5LOVA 3F95A 4QGFA 2CYBA 4INOA 2B39A 2PTMA 4MS1A 1W85B 3F74A 5F4BA 2F62A 1QGLA 1GRNA 1Z22A 2EXXA 4LIVA 4EO4A 5MN5A 1OLSA 2PXHA 2I3DA 5AJZA 3NUQA 1T2CA 3M6VA 3Q2KA 1Q43A 5LP6A 2R11A 4EWLA 3R3JA 2QRKA 5JZVA 2HMYB 3LT0A 4B1LA 2FR8A 1QFJA 1WO8A 5L8VA 4LC9A 4BX3A 5AVRA 4QDTA 1RUH1 3EVFA 621PA 5KQLA 1WGPA 1CYDA 2GD6A 3KT8A 4ZGWA 4XM0A 4ALJA 1AKWA 2X0NA 1E60A 3HCFA 4JFRA 1CW2B 2XWJB 1LKNA 1VRH2 2ZBRA 4TM7A 4NOLA 4HLTA 1P19A 1TU3A 3K9LA 3VL9A 1EP1B 1E1KA 3L8EA 3NBAA 4UFLA 4LGMA 1KDYA 3WIDA 2CFRA 4E1BA 4RM2A 2X41A 4Q1DA 1N0VC 1QJX2 4DR4B 3BMOA 4JSYA 1ZRIA 3DM9B 1QRSA 3BQ9A 2P3KA 1BEZA 4FQ8A 3FIJA 4L78A 1T91A 4FB4A 4YALA 4DV2B 2IHKA 2AJ8A 3EFEA 2HI0A 1N6LA 1E3SA 1JPVA 3EK2A 2VK1A 4C4TA 3SR4A 3CNAA 4L02A 5JNLA 2BFDA 1ZD4A 4CHGA 1UDAA 5IARA 1FYWA 1RHJA 1J2JA 3DE3X 5TE9A 4EPRA 2WQZA 1ZU4A 3NRBA 1WRBA 3HNYM 2PWYA 4DC1A 3REQA 4TVSA 4BZ4A 3WDWA 1JU3A 4YQZA 4EQVA 2G1UA 3W9YA 3QVUA 3I3BA 3GGGA 4O2BA 5A71A 3G9XA 4N0MA 3AB3A 1PFGA 1RTVA 1W3XA 1HDIA 3NNNA 4GM0A 1XDSA 2JLYA 1XU1A 3R5KA 1UMZA 1KY4A 1OUSA 2WI8A 4ZTZB 2CLOB 3RR2A 1YUMA 1I3NA 3RTBA 4K1YA 2QB5A 2NO0A 1VP3A 5K3FA 1APBA 5KYWB 3RIXA 4UBHA 2GM4A 2WJWA 3V8QA 4NU5A 3QPUA 3TLBA 4B45A 2O0HA 4E2SA 2YUIA 4XF9A 1KFCB 1XU4A 1X3LA 1W8DA 4TLBA 1YBFA 1PGQA 3F7TA 1MACA 4K7JA 5JYCA 1KY3A 1RVF3 2DLCX 1MS4A 5EJ7A 1ST2A 3WFIA 1VXRA 1POQA 4KBBA 3QBQA 3E7DA 1LHVA 3JYHA 1FYDA 1G8SA 1Z13A 4DHEA 1XQWA 2OCYC 3HKDB 4P4GA 1LB2A 1FYXA 1WCWA 3TCKA 4RHCA 2NZ2A 2XVXA 1F2UB 4BQSA 2IC1A 4AKTA 1EVJA 1YRLA 2EF1A 5M2QA 4JUFA 1E9DA 5SZJA 4NOKA 3TUJC 4FCCA 3TZEA 1PMJX 2J1EA 3RDPA 1R1A3 4NYJR 5LK5A 5JUVA 2W2LD 4LR4A 2J7PD 1TJYA 1N2XA 4GGPA 4CTOA 4HVRA 4CQMA 3OIFA 2C4KA 2OENG 4CFZA 3QHAA 3PICA 2EGGA 1IVYA 3RANA 5A6SB 4DLPA 3PHBE 3QFSA 1UC9A 4MYHA 3GDHA 2X8KA 2R6FA 1DIRA 3FWKA 1LH0A 1PG5A 4IEXA 1X7HA 1XV5A 1ISRA 4GKJB 5HDQA 4MX3A 1S5PA 3LY8A 4Q21A 3H0OA 5IVCA 2AW5A 4Y4YA 4JGYC 3SLKA 4IDCA 1WXXA 4HNAA 3WW4A 1F2DA 1OJ7A 3AU9A 2CLEB 4LMFA 2H7XA 5CLIA 4CP2A 1ILWA 5DYNA 4Z3KA 3JALA 3ZS8A 1XB2A 2C07A 3FLAA 2PX2A 3THRA 5CXSA 1C14A 3RSCA 2O2GA 4UHKA 5CTJA 1GV1A 4P0PB 4TGLA 4W9RA 1T24A 1ZLXA 2PBFA 1JAYA 4CEHB 3ZYZA 5ECGC 4WESB 4N03A 4UM9D 4RK5A 1RWQA 4AUNA 1EGHA 1H8HD 3JZVA 3ZV3A 3THTA 5HP4A 3X1YA 3BSFA 4MWTA 1L4LA 3GLGB 2JEMA 1UY2A 4WDQA 4AJPA 3KWFA 1IZYA 3RLIA 2W9XA 1LW7A 3DKVA 2C00A 3MEQA 4ZOLA 3NHPA 4SBVA 2A0UA 3OTGA 4JR1A 1LPSA 2WA4A 4WNCA 5C5UA 5IFKA 4EROA 1SQ6A 4BVJA 1CQ9A 2X4DA 1V5IA 5LD2C 3RYPA 3NRUA 4XWAA 1ONBA 4AN1A 3EF1A 3CH6A 3DMPA 4QEZA 3WBFA 5EPEA 4Q3LA 4ZT5A 1CNFA 2FP3A 3IVXA 4J1SA 1UMBB 2WIJA 4E4ZA 4AW9A 1LJ7A 2B8WA 1QB7A 3ELWA 4TTVA 5K05A 3ACBA 2Y8EA 4ZVPA 2Q3BA 1NCQB 3KSMA 4CRWB 1XCMA 1SB9A 3DLIA 3ICOA 3K2BA 2RCYA 2JG9C 4MUAA 3NJVA 1ND3B 1DRKA 2ENWA 1L4KA 1L4BA 2V58A 5TIIA 1PVVA 3RUDA 4P5PA 4WASA 3KKEA 3KSBC 4YACA 3TX2A 4KHPB 1S8AA 4B7AA 1VRH3 1XNBA 2MEV1 3ENWA 1GPMA 3A4TA 1L7OA 1AS0A 5KOHB 4WW0A 2PS1A 4QRIA 2Y6UA 5EINA 5C5CA 3C14C 1ZEJA 3ZFEB 4MJ7A 5A5GA 5CB8A 4NYIR 1QJX3 3U5ZB 2COKA 4Q3KA 3H3FA 2E87A 3G2IA 4TOIA 2YCBA 3IMGA 1P3Y1 5HKKA 3RV3A 3I5AA 1XEXA 4M6WB 1E61A 2WTAA 2GPNA 4MDEA 3OEBA 3ZGLA 3N8DA 3ZE1B 3ASVA 3FY4A 3UF0A 5BR7A 4W5HA 2WM8A 2FQWA 1BDMA 5BYJA 4G0PA 3S2FA 4ZYVA 3ZFGB 4YM3A 4DCJA 3JWPA 3UKDA 4X1IB 5TF0A 2AMLA 2QQUA 2V6BA 3I62A 4RVFA 3U7FB 2N42A 2JB4A 4HUJA 3KS7A 4AKSA 3HCOA 4QPPA 2EZ8A 4E8CA 2ZX3A 4FGJA 3ESXA 2L69A 4OUSA 4RIEA 4MH0E 1I3KA 3EW9A 5FPYA 4MWBA 5B57C 3OUHA 3DE5X 3R1IA 1PO22 1NCRA 2XT9A 1IVSA 4QWMA 4C4SA 4AG5A 2HSWA 4UU8A 2HR1A 1EP0A 3OZGA 3HVKA 2JLZA 3I5XA 5FY5A 2P9HA 3ORYA 1PV1A 2AR9A 4I5EA 2W6ID 1NN5A 1W9TA 1YQTA 3WNBA 4XJUA 1DGWX 2WNSA 3OIYA 1H3FA 1IWOA 1AK1A 4KSCA 3CVUA 2DTWA 4A6XA 1QTQA 1Z3IX 3Q88A 4R4XA 3PQ2A 1BO6A 3E2PA 3ZS9A 4KH9A 3FJSA 3MFAA 1JLSA 4ON9A 4UTZA 3B9RA 1NXPA 4M7PA 1CQWA 5KJFA 2BFWA 2ISSD 3KEGA 4QX1A 3HVIA 4RKWA 3KZOA 1R081 4KJZA 4DR6B 3S70A 1NXMA 3DKRA 3U4QA 1JDUA 3OLCX 3GJ4A 4N53B 4PHCA 5AUOB 4O4HA 4F3YA 1Z2DA 4AIRA 4D7YA 2PWZA 1E6EA 4QG3A 1BRMA 3VDNB 2PUJA 2FWAA 4RPLA 4YMGA 4I50F 3CJRA 1MRZA 4XW3A 2VJCA 4E2QA 5JVDB 3IDQA 1AF9A 2VYFA 4Q7JB 4MEAA 2XJVA 1E4EA 3F2IA 3UTCA 1WF3A 3BMNB 1SD2A 4EKIA 4AI2A 4TN7A 5JDIC 5IZCC 2X8WA 3EN0A 1WQ3A 2ZX4A 3NDIA 2D1SA 1D7OA 3C70A 5JPIA 1OF1A 3T0FA 1RIFA 3O3MB 3ITKA 1A9YA 2Q9CA 1YB4A 1HRDA 2FSVA 1OC1A 4LF6B 2PE5A 4BLIA 4XRGA 3PL1A 3DAOA 5D3MA 3LBAA 9ABPA 5LBEA 4IV8A 2H4XA 4WXRA 2OP0A 4BYMA 3OFJA 2H4YA 3WVJA 4J03A 4TT3A 2JRLA 1AQUA 2FJUA 2XE6A 5JSFA 4MPJA 4AX8A 2ZR7A 1FVXA 1Z8NA 4GX1A 3VU1A 3O1PA 5DCYA 1Y4DE 4ZDIA 4L97A 3H13A 3ZY3A 5K3SA 4YW6A 4A5OA 4Y1FA 2BFBB 2IH5A 1XMIA 4DCUA 2ZSJA 4I1UA 4BMBA 4U7HA 4M1KA 1E1CB 3PB3A 4NARA 3I30X 3MINA 3LSYA 1ZN9A 2HJRA 4Z3DA 5GLTA 4LISA 1H9AA 4B32A 4DIDA 1XMVA 3EY4A 4D80A 5AM3A 1N92A 4I4IA 1SUBA 4FKBA 3FA2A 2HLPA 2P1RA 1JEAA 4WERA 1VSTA 2GCPA 1R9JA 4BE9A 4Q39A 1A77A 1Y3IA 1QOSA 4K6OA 3FBYA 3S1SA 3BTUA 2LP4Y 3K8OE 5ESWA 1O89A 2A3XA 1EPZA 2H59A 3OA2A 1QQP2 3VBRC 1QQAA 3RBXA 5HW0A 4BZQA 5EEHA 4U6NA 3VSEA 1UP4A 3EISA 4Q16A 3AFOA 1TRHA 4TXHA 4KQJA 4CU7A 5DMXA 1M1UA 5DYWA 4URHA 2QQ0A 2ZJ3A 5CEJA 3KOYA 3HR4A 5KQGA 2HCTA 4EVQA 3L6OO 3FHJA 1C3OB 5K5EA 5HILA 2H52A 3L2HA 2DF7A 5CKMA 4GMXA 3UV6A 2PH1A 1I6KA 4M1EA 4RZ3A 5K0TA 1NASA 4QOIA 1P4AA 4HWPA 4J1TC 4EX6A 3PNQA 1A8DA 1BC5A 2F17A 2RMU1 1BOOA 3ON5A 1SU7A 2HQSA 4IFEA 4BEJA 5A1LA 2R68A 4Q7MB 4N47A 5CH3A 4HX9A 3UETA 2OLKA 2XR4A 4H7KA 1X87A 3QJYA 2ZYUX 2W98A 4ZS3A 1O5IA 5AVYA 3I37X 4QU9A 1RLJA 2RHLA 4ZVTA 1LGBA 2XSZD 1QKIA 3PDCA 2RS52 3PFWO 3WSOA 3GEEA 1JKXA 1MH9A 5JATA 1YTUA 1XBTA 3EXG1 1NVBA 1GWKA 2FCVA 4PXSA 3SNKA 5FK8A 1MIHA 3EMKA 1KWKA 3Q12A 2XA9A 2JCVA 4H4EA 4MIOA 2BFNA 1SUSA 2X40A 4YCLA 2EWMA 2PGXA 1PT6A 2VJKA 4HQRA 2YXDA 3MD0A 1KMIY 4ZHQA 5K8JB 2A9PA 5FP9A 4ZJYA 2FAXA 4DQ0A 3VBOA 4QU2A 4LCBA 1GV0A 4AP9A 1XF9A 3ZHBA 1LS6A 1ZJZA 1K27A 1R8XA 2ZUVA 4OHBA 2P2NA 4K26A 1H1LB 3LUBA 1PO23 1L9KA 1LUAA 4RJIA 2PYZA 3DBOB 4K1XA 1UJ2A 3N4MA 2JK1A 2FI1A 3I2HA 2ZJBA 2FK8A 4HDKA 4NWVA 4IILA 3M3CA 2I7XA 4HDSA 2VJMB 3AYDA 4NX2A 3BFXA 1VHLA 3EARA 3QV2A 1EV12 5HMMA 4R16A 2D6KA 3USES 1AV6A 1Q95A 1K5MB 1AUQA 2J31A 1MAAA 3D6TB 4CMIA 1GGJA 1GWMA 2XB6C 2YJ4A 3FCOA 3U44A 2IOFA 3DGTA 5CYYA 1QWSA 2VJYA 2HSGA 5LA6B 1BH2A 1VLMA 2I4MA 4O2LA 4MADA 4COZA 2Y1KA 4FZVA 4X8PA 2O7RA 4ZA2A 4GO1A 1UBKS 2QDRA 3O21A 3BE6A 2VCEA 4FP2A 1Z06A 1H1IA 2ZTUA 1XHEA 3PIJA 4DOUA 1ZRFA 1UZYA 1T8UA 3O0TA 1U5IA 4HSJA 2OV3A 3IAFA 4CODB 4EB6A 1ODLA 4WOCA 4NFSA 4RGGA 1J9EA 4U00A 2ZYHA 2RHGB 4MR8B 4FWTA 2ARAA 4LC0A 4JTOA 4LHEA 5J48A 3KSAC 3KXLA 1E62A 3MTDA 4ZMRA 3UG7A 1MJFA 1T9AA 4QXMA 4Y2JA 3UAZA 5JR7B 3LDHA 1Y7BA 3CXRA 2VH1A 1C7ZA 3WZ1A 1AQ6A 3DBIA 4GBGA 4JC1A 3HTXA 3U7RA 5ITSA 1Z0HA 1A9ZA 5IF9A 4F5ZA 1QH8B 3B9BA 3L6CA 4S1WA 1RZVA 5CZKA 2ZUFA 4YPJA 2DCKA 4CPBA 2PLNA 2I0FA 1Z0IA 3H1GA 4OHZA 4YM1A 4HNRA 3R05A 2QF7A 4MW4A 4FXOA 5D7NA 5TPZA 3WWCA 4EG6A 2Q3JA 5T5QA 3M2MA 3COZA 2GWHA 3UFBA 4BNKA 1MO3A 3G13A 1L5GB 4N5DA 4Q1CA 3DR5A 4YGEA 3OSZA 1N2GA 5LBCA 5FPVA 3BD8A 2WYFA 3N9LA 1V9U1 1XQNA 3PL0A 2IYEA 1SGWA 4XOGA 1XDBA 4HSLA 3RARA 4RGKA 4C7BA 1VA4A 2C5AA 2VMHA 4PGAA 5T4HA 4BWYA 1NYQA 2LGJA 2R5NA 1RXUA 1VECA 4ZODA 3RGGA 1QQP3 1CUVA 3O3NB 3RBVA 2CCJA 3PD7A 2HMUA 2CUKA 2J5XA 2PUBA 4CCCA 1JU4A 3EXHA 5FYQA 1UADA 3EOZA 2XYRA 4GD3Q 4Y18A 3BKZA 4MQ4A 2X13A 3OKCA 4G23A 1AUPA 2A35A 4LO8A 3JVVA 1U0LA 2YBSA 3V1UA 5E0OA 2GNTA 3LQ4A 2VMDA 2JGRA 4BGUA 2RARA 2O2DA 3VO1A 2PT9A 3L7YA 5GJVC 1CY8A 2ZSIA 4XB2A 4JA0A 4EZIA 2VQDA 5AKZA 1BKZA 1Z36A 1Z68A 2UU8A 4LG1A 4H7HA 4GL4A 3WO0A 4WM8C 3AZVA 3LI2A 2JJ8A 2AHOA 4TWJA 3NHZA 1Q8SA 2XQIA 1KJYA 3J7TA 4UHDA 2IXLA 1RMQA 4N8SA 4XQ9A 4EQZA 3BIXA 2RS53 3AVUA 4PHHA 1AMOA 4OZOA 5L3VA 2DLNA 4IHKA 1UZUA 5JDCC 1FRZA 2FQPA 1FUYB 4BNNA 4Y2QA 5K03A 3OSUA 3FGNA 3WJ2A 1DO2A 5J58A 2H0AA 3N35A 3LY7A 2J1SA 1AGNA 3KPVA 1G7TA 5K09A 1TMF1 2EGUA 2ASEA 4R41A 7REQB 3RV4A 1GZUA 5BUVA 2ORIA 3IMMA 3KTOA 4Y2UA 4LJYA 3OE7A 3RD5A 4NEGA 1CEQA 2FZ1A 4G1CA 2FA9A 3ANNA 1V7QA 5CITA 3EB7A 3QG1A 1N9GB 1SFYA 4LN1A 2VR4A 3K0KA 4OXRA 3IPLA 4LVOA 4NRMA 3F6CA 4B81A 3BK2A 2PHLA 1FAYA 4AEDA 5AXCA 2KM2A 4RWEA 4Y98A 1MX1A 1OZ0A 4BQ3A 4BDVB 1LNSA 2PKWA 4DINB 5IDXA 3HPQA 4RLQA 2ZP1A 4YUWA 1EIWA 1CR2A 1EV13 5DABA 1XLUA 3PR2B 1Z4LA 2D7FA 4XCAA 3JYPA 4UHBA 2WDBA 2B7YA 5IJ0A 3WBJA 5GLUA 1LLUA 4OL9A 1DJPA 3OEHA 3NV1A 2Q9BA 5IK4A 4US0R 4KK4A 1GNYA 4OSEA 2JE9A 3CBGA 3GQBA 3JQ7B 1H6BA 1EGAA 2VNVA 2WT2A 4NABA 5AIAA 4ARSA 3NHMA 4BX9A 4W50A 3PE3A 2VHTA 3V97A 3J26N 1Q3HA 2V65A 4NCKA 2B46X 4JASB 4BZXA 4MX8A 3EGEA 3KKQA 1GDDA 1ZDMA 4QDJA 1AX2A 4OHUA 5MGBA 1EFAA 1SG9A 3OT1B 2O2SA 3IUQA 1L7RA 3ZE6A 4Y1RB 5CDFA 3C8MA 3FVRA 4ZU6X 2RMKA 2GXUA 3C1TA 3JD4A 5B1HA 3IZOA 2JDKA 1VJRA 3O26A 2CNNA 2YOGA 4ALNA 1U8FO 2ONJA 4FPLA 1J9GA 1J2TA 1H5NA 1UYPA 3KGZA 4BLVA 3IHTA 3U40A 4V0OA 1LU2A 2QD2A 1V8FA 4URXR 1SCNE 1J23A 4CQNA 2MWMA 4XWYA 4GRIA 1GZ9A 3H5AA 1Z2EA 3TCNA 2F67A 2Y2VA 2VN8A 4H14A 1PQPA 1JIIA 3D8BA 1ZCJA 2ZXQA 3QXHA 3WNDA 1UXOA 2ECPA 4JNCA 4EG4A 1DXQA 1BNCA 5KTNA 2ZSFA 2Q1MA 3AP7A 4C4RA 3FYUA 1PK6B 5BMVF 3VQTA 5LA0A 4LNUA 1RI4A 2CWMA 1ZG3A 3BH7A 3TE7A 5FZCA 4YFZA 3OCZA 5FBLB 3WLSA 4TS1A 3GD7A 3ESAA 3EQEA 1OJLA 4JLJA 4KKXB 2HHLA 4V1CA 2YV2A 5K8IA 4WNAA 1OR8A 3DGEC 4XLLA 3D6UA 3ML1A 5EJEA 3T5PA 3I9LA 3R3WA 3BVCA 4PDWB 5I3ZA 1ODNA 1V5FA 5AJVB 1EWYA 2X09A 1D6SA 3I7DA 3Q8WA 1J07A 1G5FA 3EZYA 2YOFA 3W1VA 5CAEB 2EZ9A 5EMJA 2GKOA 5F35A 1ZZGA 1RP1A 1GPUA 1B16A 2WU1A 4B6GA 5CLJA 3N2EA 1UM9B 5K7SA 5L9RA 2P9BA 4Z0TA 3K1AA 3COYA 2IUTA 4NTZA 1E2GA 2EX1A 4EJ0A 2NTYC 3H1WA 4INAA 4A3XA 4Q0VA 4U4AA 4GPAA 2HMWA 3GUHA 5JCOC 1XNQB 3BEOA 3ZOZA 3DFFA 2H0BA 4BCBA 4KN9S 1ZIPA 2BZGA 4G09A 1QQ6A 1WOYA 1LSSA 3V2HA 1D0VA 2DBVO 3RRMA 4XUCA 3ZC3A 4DLXA 3I54A 5DN6D 2OUHA 1XZMA 2HWB2 2O2EA 1O95C 2V59A 2WNVA 2W90A 4ZEVA 4H16A 4ZRNA 1EY2A 3R24A 2EC5A 1F60A 3SPXA 1Q7RA 1Z56C 4GE3A 4BRWA 1KPIA 4AXBA 2J59A 4EYOA 1RCUA 3HP7A 2GBLC 2VYND 5COAA 5IYZB 3CCCA 1XPRA 1HA3A 1DSSG 1OC2A 4WOKA 4QSMA 2Q8PA 4YVSA 3DTVB 4GOMD 1VB2A 3MB5A 4DLRA 4JI6B 4D69A 3A27A 2X2OA 4DDUA 4DRYA 2DUWA 3FPAA 2NU9A 2L42A 1KO1A 3CJIC 2EDAA 3SIWA 2GNOA 1ULCA 4RK1A 2I6SA 4Y3UA 3KQTA 5JZ9A 2VDMB 1ZZ7A 2H2WA 3SAJA 3AXTA 2EP7A 5K0ZA 2BEUB 4L9SA 4NS4A 2QN1A 3IP7A 4OHPA 4DUWA 4QYXA 4B7KA 1U3VA 1A5AB 5CIWA 3LSEA 4TL9A 4I9FA 2VVTA 4L8VA 4M8NE 5KAMA 5ESDA 3K6SA 2OORC 1GSAA 1PQWA 4QD3A 3D5TA 1S2MA 4J90A 4KH0A 4LJ7A 5FWEA 1LNQA 1Q5PA 1JBKA 3NMUF 3L0IB 2IHJA 2HDHA 2AG6A 4X3CA 2JCYA 3JQFA 5A5DA 4CUBA 4URUR 1LDMA 4YP6A 1ND2C 1E2UA 5DNUA 1AO0A 2MMCA 1NLQA 4KLZA 1UK6A 2QN6A 2F3UA 3WDXA 2QKDA 1X1TA 4PS0A 1UJ5A 1QIMA 3WF0A 3CLRD 2P0YA 4DWJA 5FCDA 5DWVA 5A04A 1K4YA 3THXB 3UB2A 4IIJB 1DELA 3N3AC 3THYA 3KK0A 4DCMA 2VOEA 4BRZA 3U7GA 3HNRA 4RM3A 4DC9A 4NH0A 3D2BA 2O2XA 4JLBA 4MRMA 2OD7A 1PR9A 1RXCA 2FF7A 1IPKA 1ULTA 3D6AA 3Q3GE 1XPWA 1LZLA 4G24A 1D2NA 3JXEA 3RWKX 4C1BA 2A0YA 2MMGA 4H08A 5EWMB 3HNMA 3PCRB 5ALOA 4BNJA 4ZVQA 4CVNA 3HK2A 5AI5A 2NMVA 2REXB 1EG2A 5CLGA 1U5ZA 3OCJA 4QPYA 4NZYA 4CM7A 1Y80A 3OVMA 5L3SB 5JOWA 2AOTA 5DN9A 5ICCA 4E3ZA 2R00C 3KHCA 5FMOL 4FS3A 1SXIA 4NE9A 1YAJA 3EX7C 3RC1A 4RPJA 3PDUA 2QK4A 4FPGA 1TEHA 4AS2A 3KVRA 3MXTA 1EAYA 2HWD2 2RAPA 1GFWA 1W8UA 1K0UA 1K8RA 1SQFA 4BX0A 3NEYA 3NKLA 1B8UA 3NAPB 2YBDA 5F2NA 4MUEA 3UKVA 4RSRA 2GDZA 1Y7TA 2H2IA 1Z0JA 2B21A 3TEXA 3KOMA 5DNVA 2DQSA 1GLGA 4XX0A 2VXJA 2ZR8A 3BK1A 4BB0A 1FDUA 2WZEA 1FY2A 1ID1A 4Q4AA 4PG8A 4ND5A 2XQGA 3BICA 1ZREA 3ELDA 4ARUA 3BGIA 2ZWVA 3QVOA 2P2KA 3AZOA 4CM9A 4L11A 1VHDA 4K8FA 4D6SA 3USSA 1FP6A 4LHSA 3RK1A 1H2HA 2QZSA 4XF3A 1RPJA 4H3VA 2D98A 4XHBA 3KC2A 3C7EA 4NJEA 2H1FA 4RU1A 1NAEA 1ZMBA 4U2CA 1JE1A 5HKOA 2VVEA 2I2XB 1DKQA 2NSDA 1QDEA 4EB0A 1ZVQA 4FHDA 4KIGA 1MFPA 4E4HA 1QB8A 3FFTA 3HV2A 4CDGA 4CKBA 4Y22B 1L5HA 5H9RA 1DYPA 3ZGOA 1H2FA 2BHRA 4I2NA 5L53A 1IRIA 4QX5A 4HFJA 3AMPA 2X86A 4L4SA 1F5NA 3IPVA 1DKRA 2IS6A 4PV7A 4JGZC 2I8LA 5I9MA 3E1GA 3GLQA 5LOVF 4K2AA 4CL0A 4KWEA 2YWFA 2KE5A 3E9MA 1GRQA 1YZUA 1D0HA 5EXTA 2A1TR 2UZ3A 2VP4A 4YP9A 3WKEA 3HJBA 1DCSA 4OO3A 3JARA 3P2JA 1PNTA 1PG0A 1KI9A 4U9UA 3Q8KA 5LP6F 4FQ5A 3K0SA 4ESHA 2J6HA 2HWB3 3AEXA 4D0QA 3DF7A 2BKLA 3ZJ4A 3RASA 2RG1A 3BDIA 5BN3B 5D3QA 1KZ6A 1NBEA 4L07A 3EEFA 4QYWA 1B00A 4U2BA 2DCMA 2HH9A 3I4FA 4DABA 4QX0A 3OJWA 1WA4A 3VPFA 1QFSA 3AKSA 1KO5A 3UOWA 4OBBA 5C7OO 5TEVA 2QQIA 1Q16A 1UAAA 2HEYF 1RYFA 3NTRA 3ZG6A 4YP5A 4TQAA 1U2DA 4OCTA 3Q87B 3SG0A 5EERA 4GBED 3TJMA 4XJXA 2JAOA 1CNEA 3K70C 3H9JA 2FPLA 6REQA 1FPN1 4RBNA 4NULA 1I6LA 2G82A 1PE0A 3NHLA 4GVLA 3WNCA 3ZD6A 4NFLA 4ERNA 1AE1A 1SLIA 1REFA 2A9JA 1WMAA 2FPWA 4IMJB 1MT0A 2BMWA 3K0CA 3QWIA 4IJ6A 3UESA 3VO2A 2OD2A 3NB0A 2BHLA 1R4NA 4U3JB 2CVFA 3Q8CA 3I59B 1DRWA 1B35A 3REFA 3DZHA 2VOJA 2RJ3A 4JT9A 4MWCA 4O2BF 4HN9A 3UK9A 2G76A 2FJ0A 2VDKB 1K8ZB 5JAOA 4AEJA 4G0MA 1QQ5A 3GRAA 2YZNA 2CFSA 3T4PA 2EAUA 3N2ZB 3PQFA 4I02A 2JG8A 3SHOA 4HDRA 2QX4A 2I45A 5K3EA 4B3HA 1UN1A 3SHQA 4R1QA 3CGWA 3ENNA 2Y3IA 2N47A 4F1JA 4K05A 4R9UC 4KSBA 3X1WA 4N9QA 1G7CA 1FBNA 1SBNE 2K0GA 5IU6A 2DHDA 1ORRA 2WINB 1ODMA 3FWNA 5B6JA 2ZBEA 3ZN4A 3TNDA 3MBWA 4LXYA 3CV3A 4KI0A 4QU1A 1X0XA 1N2CA 1T8WA 1L4NA 2A6VA 4YX9A 4XGIA 3VBFC 4WKNA 2HNBA 2QL6A 1U98A 4ZFNA 1R091 1V3UA 5D5HA 1UBEA 4LX0A 4EELA 4TYSA 4DDKA 2AF4C 4RSUA 3H8WA 2ZX0A 4UUPA 1SLCA 3DPSA 2WWJA 1Z0DA 1AG9A 4XFAA 4ND8B 4R7TA 5BNNB 1L5QA 3ANMA 4LKOA 3SQNA 2BFPA 2JJ1D 5IVVA 4EQ6B 3CSSA 4UBNA 1FOD2 1F48A 2XMRA 2C31A 4L3VA 1BQ3A 1QOTA 5CRIA 2H51A 1WCDJ 3CKYA 3BOPA 1GCIA 3B82A 3FWZA 4IIYA 3I1IA 4S1VA 5FYMA 2VPZA 2NZUG 2DBQA 1LPBB 4XDOA 2P6NA 3PGA1 1NSYA 1B2RA 1ZC3A 5KTYA 3G02A 4S2EA 2XUDA 1SO8A 4XCXA 2AQKA 3ETCA 3JVIA 3PQ6A 5LJLA 1ATZA 5EJ9A 3IP9A 1F31A 3LLSA 5FZBA 4L92A 1L5WA 1U8YA 2VHWA 1BJKA 1A5TA 2NQTA 2E37A 1JMVA 1R2QA 3KAKA 1N8TA 5AXAA 3MTBA 1NXD1 1DQPA 3C3MA 1LFAA 3DEZA 1GKLA 2C99A 3E53A 3DV0A 2QRMA 3TOXA 4YEDA 2CHHA 1J7JA 1RJGA 1R6XA 4ZEXA 1ICEA 2DOKA 3SJ7A 5EJ8A 1MHTA 2Y1FA 3WMGA 2GPTA 1CJPA 1J97A 3LSTA 3A1VA 3EZGA 5F37A 2D3PA 1COV1 3B7WA 1YZNA 3ETHA 1VPHA 1YS1X 4E1VA 3FBTA 4GU5A 4Q29A 4CM8A 1E9BA 2NO5A 4UW4A 5A6XA 5FXMA 2JFFA 4HJXA 3A3YA 4D7TA 1Y6GA 2R62A 5L7OA 2V4ZA 1ML3A 3T15A 4ZOLF 5FY7A 3X1JA 1T2VA 3BIWA 3T41A 1SWVA 3G2JA 2B9VA 1C5KA 2R30A 4QX6A 2XHZA 1G9CA 1R4MA 5KJCA 2C8KA 4AJ2A 1S3GA 5DBOA 2G1KA 5FZ4A 2E89A 4RO0A 1R00A 1VHWA 2NSYA 2IRWA 3TKAA 4YUZA 3LDAA 4EA9A 2H17A 4OV6B 5JZSA 4DKJA 2OT3B 4WGFA 4N43B 4BQ5A 1OA3A 5ED0A 4QC2A 1E6LA 4YLEA 4PIVA 2O0KA 3M82A 3KDSE 2IGTA 1QU2A 3LS2A 2ZIZA 4YRQA 5TV2A 5SICE 1O4TA 5IUKC 3ASZA 5CBPB 1SQSA 2D7DA 4F3KA 3ISVA 3ELUA 1DBNA 2O4CA 4ATFA 3Q8FA 2G83A 3KD4A 3MJVA 4LOKA 2WB2A 4HSEA 3RI9A 2ORED 1T2XA 3H1BA 1H3NA 1NKSA 2YH2A 3SISA 4GAEA 1WZ2A 3IQIX 3W2HA 2B37A 4LOLA 2DR3A 3FLTA 4MARA 1GYRA 1WDKA 3NTVA 1EDBA 4AYTA 3A6EA 2QM3A 4BL5A 4O4IA 2IA5A 1DMRA 3G6WA 4JU9A 2J08A 2AEFA 4A6OA 3J7MA 3WJ7A 3TDKA 3N8IA 2ZRNA 2V5DA 4UUQA 1VDMA 3M5PA 2PHDA 2ZRLA 3FKQA 4HQLA 4P3XA 2C9ZA 4B80A 1JKJA 2FZLA 2K6GA 4N76A 5C7YA 3G5AA 1KKUA 3S30A 4PLWA 3LPGA 3GG2A 1BHQ1 3OCWA 3LT1A 1N3QA 4CCEA 1WWKA 3QKWA 4MR7B 1X7YB 4WZFA 1M0SA 4DCGA 1VFPA 3ZY2A 4QPGC 3GVPA 3DZBA 4X45A 1II0A 1P29A 3DQZA 3VPGA 2HPAA 2X15A 3WXMA 5IAGA 1PW7A 5TC4A 1DL5A 3O1JC 3GHHA 4NG4A 1Z07A 2VOTA 5J4KA 3VZNA 4MV1A 2FXIA 4M22A 3G0DA 3KGLA 3VI3B 3WE7A 4GLOA 4CEYA 1NVUQ 1Y8QB 4OG2A 3QOPA 1PLLA 3QVGB 4LHWA 3G7NA 3FDJA 3IAUA 4F4CA 2WD9A 2C5EA 4DSZA 4F9FA 2BZDA 1U0FA 4GXQA 2ZCWA 4RHTA 4AL4A 1CD5A 4LIPD 1PM7A 3VZSA 2IS4A 4QNMA 5KYUB 4YCMA 5CA0B 4ZQHA 1JHAA 1YQGA 3VMMA 1PVC2 3UAOA 4O4HF 3ILXA 2IFWA 1HSZA 4BECA 3TDNA 2YY7A 5HZMA 2QRNA 3VLBB 1TTHA 1DU3D 4PZEA 5JJKA 1E9VA 3AYAA 3T7KA 4Y1ZA 2FDRA 3WRWA 1XQYA 1UFOA 4AFNA 3G23A 4KQKA 1H1DA 5CJPA 1JHYA 2ZWAA 5AVXA 3QVMA 5KPDA 4PF5A 3NTXA 1LLQA 5JSHA 4L16A 4YRMA 4QRDA 2O57A 4P9WA 5FV4A 1CD3G 3S44A 2NQ8A 4QWWA 2GMPA 2SCUA 3S1AB 3GB9A 1MN6A 2WJ6A 3ASUA 3PR1A 3RSHA 2A1UB 1RUE1 2B98A 1F0YA 1XYOA 2QN7A 3H16A 2QI9F 3NEAA 1LAJA 1ACCA 3OEYA 5FNVA 3LQYA 3OEEA 4V1PA 3AETA 3NJ4A 2WAAA 4OK6A 5JLAA 3VSBA 2JLUA 3D4OA 3KBOA 5L9VA 2RDQA 1X1BA 1DJLA 2Y34A 3QEJA 2PXCA 1JHNA 3Q9LA 1UFRA 3VDMA 5EP2A 1R7RA 4S0ZA 1UBOS 2NU8B 2PXXA 5FO1A 1QZXA 2RDNA 2WYOA 4GB31 2NWQA 3G68A 3MUY1 4L4ZA 4ZQCB 4XB6B 2VDUE 4EI8A 2WHEA 1OMIA 5FTWA 3WB9A 2PGNA 3AERB 2FMHA 3IOEA 3WRYA 3SJZA 1EAH2 3HDHA 1ZRRA 4M3CB 1YR3A 3KV3O 4IL5A 3B7GA 3LPMA 3GMDA 3NIWA 3NVAA 1C9MA 3ETDA 4ZXFA 3B5EA 3ZWOA 1AZTA 1T5TA 3RS7A 1HKHA 4Z4EA 2CSGA 3S29A 1BDIA 1K4KA 2X42A 3WCSA 1G41A 1K86A 3CZCA 3I2DA 3GNQA 1YHNA 4KXVA 1ALYA 4I3FA 4HNUA 5IVYA 2XYVA 1WV1A 2ZRJA 4XQWA 1WP9A 4ZANA 3KZ4C 5DHQA 5B58C 1KOLA 5IJXA 4IJWA 5CURA 2BV3A 2EHJA 4IO0A 2ZM6B 4C07A 3PFKA 4D9JA 4LRSB 1JB9A 1H30A 3CLRC 3E5UA 4C76A 1I7SB 1N2ZA 3SS9X 1KO4A 4COUA 1SOUA 1O0BA 1OZGA 1IOAA 2WM9B 2TMDA 2LS6A 3QHQA 1ZJ4A 1TTQB 3WP1B 3RZKA 3KVVA 4GZ9A 5DCWA 3H7JA 4LV6A 4DLWA 2IH4A 3QBVA 4KPYA 3X43A 2NYUA 3FYTA 1BKDR 4XD7A 4WN9A 2XMZA 2BVVA 3NETA 8MHTA 2RBGA 5CNMA 1JLLA 4XTCS 2C5BA 4U6QA 2AFVA 4U2AA 5DHRA 3U62A 2AYHA 5A3OA 4HNHA 4K2HA 3HVRA 5JJIA 2XGXA 4BB9A 4UFMA 4GNRA 1M1XB 1ZBQA 2D4AA 2PGOA 3KQUA 2AEZA 3OF5A 4X44A 4NNJA 1L4FA 3OO0A 4ZHQF 3SEAA 1GA4A 4L74A 4EJSC 1A9SA 2BWAA 1VCHA 3UUGA 2X9NA 1TK2A 1L8XA 3MT8A 3OQJA 4B82A 2H0RA 4K20A 4BFCA 1X38A 4D3WA 4YJ3A 1JW6A 1ZINA 1FU8A 4QXHA 4GBMA 4R2WA 4D8WA 1W49A 3ETNA 5CW1A 1OGIA 5DHTA 1S4QA 3AL5A 3ZYGA 4KLRA 1A8IA 3LFUA 3FNIA 3VVMA 3NWBA 5EE3A 4RJ2A 3HDJA 1TMKA 3FTCA 3ADDA 3EVZA 1GR0A 2JHAA 1WLSA 2JAPA 4C7OA 4EKEA 2C26A 1OH5A 3C3YA 5A7OA 4A45A 1I36A 2SBAA 4ARZA 5ANNA 1FYEA 1MC4A 4P3YA 2QQGA 3R4SA 4QYMA 5HR5A 4FT2A 1PKEA 4OXYA 3KG2A 2IEAA 2PKXA 4C6TB 1C28A 16PKA 4DWVA 2FMYA 1PVC3 4RPIA 4LYGA 2RM21 2I3BA 1F4AA 3FZYA 4FZJA 2XCOA 2VAMA 2UUCB 3ZE9A 2F59A 3IODA 4AUEA 2W00A 2EL7A 4HLUA 1GCOA 3AJZA 1NI4B 1T6NA 5BNQA 3OUIA 2OW4A 4IV1C 4I1IA 2HOQA 1ISGA 5C1DA 2DV9A 4FFOA 1KAMA 3ZZ0A 1AYN1 3H1PA 4RAQA 4PZPA 3BS4A 4CDMA 2BGPA 5LP6C 3F9IA 4YO7A 3JAMA 4DRRA 5E4YA 1EHYA 1P7PA 4YRNA 2FR8C 3R0VA 4V3BA 1JEYA 4FLFA 4URYR 2JI4A 1OOPB 4HKTA 1JN0A 4CKYA 2F9MA 5JWPA 2CGPA 2CNWA 4QUEA 4KO8A 4D4HA 4WZBB 4JB8A 2H5LA 1D0SA 4DR7B 2ZGKA 4FOQA 2OM2A 3OKFA 5KOJA 5DIZA 3I49A 4AQSA 2N0SA 3SJUA 4MJXA 3GGSA 1NBMD 4DNOA 4RABA 3K3PA 2BNMA 2I6GA 3B1ZA 4IHQA 3M6LA 1E79D 3AK4A 5E1OA 3DFUA 3GALA 5I8YA 2IBMA 3QA3E 3FZGA 3TRSB 4C05A 4YG0A 2RJKA 3SQOA 2AN1A 3QNUA 4YJ2B 4DIFA 3O95A 3D9QX 2QUJA 3G88A 4YUXA 1JGTA 1XQ1A 3SX4A 1IRXA 4IERA 3M9LA 4UVEA 5CH8A 2WWXA 3EQ7A 4NMMA 1DV2A 1AB5A 4M0LA 2ZEXA 1ABBA 5AKXA 2WQZC 3H9CA 1K0FA 3W5UA 1EAH3 4CLDA 3GMIA 4YYEA 2DYCA 1QGAA 3CNOA 3AVQA 3HB1A 1RRFA 1VRCA 5A4KA 1QHIA 3TSOA 1W8HA 1O95D 4JY7A 3SQLA 5TB5A 1M8KA 2O0JA 5BN4A 1RVV1 2RIPA 3RSOA 3BSSA 2I74A 2YJ5A 4F4UA 3E9RA 4HDMA 4M1MA 5C1PA 3H9BA 3HJNA 5H02A 2X1HA 3WNPA 4NK4A 5HCFA 1DAMA 5A7GA 4KQ2A 3NWJA 3MW3A 4Q0PA 5KWVA 2I66A 4X1OA 3PFCA 5K8SA 1NF8A 4KPUA 3VGIA 4HEA6 3C8HA 1C3LA 3Q9OA 4DPKA 2VF8A 3SXUA 4QOJA 4YTEA 2B1JA 3UFXA 4P80A 3TGPA 3ICCA 4YBRA 3QLVA 2X5IA 3D0OA 1KMHB 1KYYA 3CF0A 1QH9A 4X3OA 3E5QA 3LEGA 4IIGA 4U2EA 1MDBA 1Z5OA 3LPFA 2ATFA 1G9FA 3RQSA 1G2OA 2WIAA 3EWNA 1XALA 4A0FA 3M2PA 1CAWA 3D3KA 4OQDA 2VQAA 5KYXB 2OZKA 3QU4A 2X6TA 5JS1A 2E55A 4J29A 4PZLA 4ENQA 4PN3A 4IEVA 2UWAA 2IPNA 4RSGA 3G49A 4BXOB 2X0JA 2GP3A 4ZZ0A 3ORHA 4Q0UA 1V3VA 5JHHB 1OLUB 4HH0A 3JQWA 1OZAA 4QOGA 1WMSA 3GVHA 4IIHA 2AFHB 2VXCA 1P8AA 3D6VA 4N82A 5C3QA 1U0NA 1H85A 4BX2A 2ERFA 1ZD2P 3GEGA 4BVBA 1X80B 1SOVA 4AZ0B 2FDFA 2I1QA 3DMNA 3WKBA 1C4KA 1BQPA 4IQ8A 1WE2A 1XD2A 2ATXA 2Z1DA 3UB3A 1YCDA 1BCRA 4CZSA 1XTTA 3UEOA 1UINA 4GMHA 2BFFA 1EFDN 1FTNA 4IDFA 1FS5A 3B20A 1XNHA 4XE5A 3VUEA 1FFHA 1NRIA 5HE8A 5CFCC 5BRAA 4FD3A 3ZTTA 5JNSA 3P71T 3R9KA 1XTVA 4C1WA 3SDBA 1DXHA 3V8RA 4Q12A 4TLMB 1NDQA 5FQNA 4NWWA 4LXQA 1P62B 1GQYA 1DC7A 3GHNA 1Q0RA 1PU2A 1SVLA 3UNXA 3S2GA 1CFJA 1K12A 1J0DA 2IDJA 1H6YA 3L1UA 2G9RA 1LI7A 2IYPA 1KETA 4BRSA 4WXPA 4MVJA 2IUUA 3S99A 4PIZA 2XCIA 5I48A 4LHYA 4LBVA 2V6IA 3R3HA 1JEQA 5A7WA 1Y9MA 2WVGA 4D98A 4N5LA 4NENB 5EPAA 3CT6A 3LVBA 2G06A 1JI0A 5CX1A 3PDQA 3O1RA 1NBWB 3EAFA 2VC9A 4R9RA 3BRCA 4BFLA 4PLCA 2ZRPA 4RIIA 4CEJA 2CLKB 2PBRA 1ZM9A 3AZPA 2YHAA 3IA2A 1AK2A 1ULBA 3R4CA 4OTZA 1EFRD 3P3NA 1ZXLA 3THSA 5JAMA 4NCNA 1KE1A 4HAYA 2GTIA 2XV1A 5A3PA 1GQRA 3G5TA 2W4MA 3BFKA 1PKXA 3I8XA 3BD6A 3KHTA 2G1PA 1AQLA 4CCKA 4TKMA 3GV0A 5KEIA 1FFCA 3RBZA 5K6AA 3SHWA 1X9IA 1NBME 2PXJA 2G4LA 2LVBA 4UHCA 1QP4A 3LQ2A 1H4TA 3ITQA 4CT0A 1W88B 3AFNA 3V42A 2D3RA