4K7JA

Peptidoglycan o-acetylesterase in action, 5 min
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
350
structure length
350
Chain Sequence
b'GLLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
total genus 125
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k7jA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k7jA01
1K7CA 5BN1A 1ZMBA 3DT6A 3DT9A 4OAOA 3BZWA 4Q7QA 1DEOA 2W9XA 4DEVA 4K7JA 1ES9A 1VYHA 4K9SA 3U37A 1VJGA 4IYJA 1WABA 3PT5A 1FXWF 1Z8HA 3DC7A 3DT8A 1BWPA 4RSHA 3W7VA 3KVNA 2WABA 3SLRA 1ESEA 1U8UA 1PP4A 2Q0SA 4JKOA 4HF7A 4JJ6A 1BWRA 4XVHA 1J00A 4K40A 5B5SA 1FXWA 4OAPA 1V2GA 4PPYA 4I8IA 3RJTA 1ESDA 4K3UA 1JRLA 2HSJA 2O14A 1DEXA 4TX1A 2WAAA 3C1UA 4H08A 4Q9AA 2APJA 4LHSA 5CD9A 1BWQA 2VPTA 4S1PA 4JGGA 4HYQA 2Q0QA 3MILA 4JJ4A 4M8KA 1ESCA 3HP4A 5JD3A 3SKVA 4NRDA 4RW0A 5A4AA 5HOEA 3P94A 3DCIA 2WAOA 1YZFA 1IVNA 4JHLA
chains in the Genus database with same CATH superfamily
4IXMA 4JIMA 3WKAA 4W63A 2AYXA 4WZCA 4LXYA 1U2ZA 2RHPA 1GGHA 1JX6A 3TSOA 1O7FA 1TYDE 4JC5A 4RULA 4Z3KA 1V7PC 4HDCA 4C06A 3TVTA 4K88A 5JOQA 3LPGA 2QI9F 2CXHA 4FBGA 1PNQA 2KR2A 3A9RA 3IUBA 4M1TA 3P27A 3RVNA 3T4VA 3SDSA 3L1HA 4KPYA 4NJMA 1SVMA 4EPRA 1Z2CA 1HW5A 2B5OA 3GEIA 4TSRA 4P14A 4E4HA 4IEUA 2P34A 3Q6MA 4B9AA 3VBUC 5TMDA 2LE0A 2VBFA 4V02A 3FFWA 1ZG3A 4J2HA 3N2YA 1ADCA 1YR2A 3A32A 1QGLA 2WE8A 4OL9A 5BR4A 3UZUA 4PLYA 5BWNA 2XQJA 1QJZA 4M1OA 3RVPA 2IY9A 2ZRKA 5K0SA 3BFKA 3OF1A 2JD1A 2V7PA 4QPIA 3U3RA 4P32A 4HK8A 3ESQA 2VPWA 2CDOA 1AY0A 1O6FA 4U1RA 4HNUA 4PFKA 4JX9A 2PXJA 1L5MA 3AUYA 2Y1KA 4CM7A 5C1OA 2ZRHA 2Y6HA 3GAMA 2CNOA 3BXGA 1WLWA 1NTOA 5I01A 2D6MA 4J0QA 2GBLC 2PX3A 4LK3A 3AHEA 4GAZA 4CPBD 5C3SA 2Q50A 5JSHA 2RBGA 1LDGA 3R44A 2WDZA 3I9V6 2YW2A 1PSZA 1ONOA 2WKRA 1E6CA 2FDKA 5LASA 4CCCA 1RYYA 5KNBD 3KYCB 1FDVA 3TW8B 4RANA 3X1MA 4EVSA 3OOXA 1HYEA 1D1SA 3CZCA 3GGOA 4FMCB 3VHXA 3VNVA 1YVEI 1A9XB 5DDIP 1PR4A 3KTFA 1RJ9B 1MR3F 1L7NA 1NURA 3HU5A 3H1WA 1KSGA 2NNWB 3QG1A 2EJWA 3ZLBA 3WG2A 3NNMA 2POQX 4S2UA 1AL22 2HMTA 4PVCA 3NPMA 5FDBA 4M4RA 2MYPA 1RP1A 4YV1A 1V6OA 3JQ9A 2XADA 4D4KA 4YXWD 4UQLA 2G4IA 3W5UA 4YB8A 3I6ZA 4IIJB 4O4LB 3C87A 3VZDA 1HRI2 3JQRA 2ACVA 1POQA 3FKJA 4C6SA 3OJXA 2UWAA 2QT9A 2R7NA 1PR0A 1ZUWA 3UT0A 4N3NA 3L8ZA 2PNFA 4F0JA 1QC5B 4ZTZB 5F3DA 4EJRA 1R0WA 5F9HA 3EXEA 3CXRA 3PURA 4W9RA 3COJA 1NCRC 4MO3M 3E70C 3EZGA 1IHOA 1NRWA 2VDWB 2O5CA 2QENA 3UGGA 3PV0A 4CV2A 4NEGA 5J3UA 2UVQA 4MO2A 3ENVA 1JZQA 2FW1A 2ZBFA 5BOSA 3VRHA 2PD6A 1AL21 4WM7A 1JOJA 1GPAA 3UMMA 4XOUA 3MUEA 4B34A 3OF3A 4OI0A 3BTOA 3RROA 4H7PA 2A6XA 2CEAA 4KPUA 1H4SA 1Y4WA 5LFAA 3DF9A 2X8KA 1H8HD 5T5JA 3L8MA 3P94A 2W2XA 2G07A 4O2BF 1AUVA 3URKA 3B6EA 2ZTVA 3LUPA 3TCNA 2WQ7A 2BUAA 2OIIA 4QTZA 1DCSA 1WW6A 5FLKA 3BIXA 1RAGA 3AERB 3UK0A 2HRQA 3DB1A 3ECQA 2X5XA 1W8OA 4KXWA 3PUIA 3T0DA 1EM8B 3JZIA 4LZAA 1ZRRA 5FYZA 5JH7A 4L4UA 4JUBA 1ZY2A 3HCRA 2JRCA 3U1TA 1RWOA 3POWA 3ZKYA 3FVTA 3INGA 1KY5A 5ENVA 2CWMA 4M3CB 3OLYA 1LPAB 1Q8SA 4EKGA 2D3TA 1N0HA 4AMUA 1JJAA 1U9IC 4IDQA 6ABPA 1JFSA 5E3HA 3ZR6A 4FMDF 5LPNA 1NQ5A 4MJ3A 4AP9A 1SHLA 3I9FA 2VF7A 3ZFEA 3GNLA 4LTDA 3PTRB 1WW2A 3LEMA 3B1XA 3SQWA 4M8NE 2EHJA 4AT1A 3WL3A 4MRAA 5BXQC 2B30A 2PHRA 5EP2A 2Q7OE 1LXCA 2PELA 4JVMA 3EPKA 3BU7A 1YIPA 2OOKA 3DJFA 1GTMA 4PZ0A 4HN0A 2VPZA 3H16A 3RB8A 2YV2A 4M8LA 4RTOA 4WLFA 3WIEA 1M2OA 5C4GB 3REQA 4DNQA 2HMVA 2HJSA 1HDKA 4QLBA 3LKVA 4QJ4A 4GPZA 2IYXA 3VUEA 4F7DA 4CMHA 4W9NC 1AXYA 1GLVA 1YFJA 5FA5A 1ZKDA 4XFHA 3F8WA 4RYLA 1DLJA 2RBKA 2RV9A 5HTKA 4IGEA 3TVDA 2GAUA 1JZTA 4F85A 1TGVA 4WDRA 1S4QA 4RO0A 2XHZA 1RIFA 3SR3A 2VNHA 1H2NA 4WFIA 3WNBA 1TA9A 1CJDA 4BMNA 3H18A 1JRLA 4E2FA 2GXAA 1XZBA 3KYJB 3RRYA 3LPCA 4U7HA 1NE6A 2Y9PB 3IP8A 4JQTA 1LLFA 1PV1A 3U80A 1USVA 2QHXA 1C8M1 3MXTA 1Z4LA 2JX9A 1NF2A 1KRXA 4MS1A 4FHDA 4DYDA 5HWSA 4W1PA 4EB3A 1Z18A 1K5PA 2AOTA 3V1YA 1N6RA 4OAOA 2ZULA 1ZNPA 3BHNA 2GVNA 3U3OA 1KE2A 3OPWA 2Q3EA 2OUHA 3QQ5A 1NMYA 3GLIA 5TSWA 4QYSA 4WAUA 1ZI9A 4YP7A 4LA4A 4JVLA 3D6JA 2C7OA 1N34B 3S7ZA 2A92A 1VCHA 2YS7A 1HE3A 5AOCA 5EXOA 2XAAA 3WWDA 2PUCA 3F67A 1S8FA 4BGIA 4GKXA 1ZK0A 1AF9A 3TD2A 1SDWA 4WQMA 2WLQA 3GGGA 2BFFB 5TJHA 3BDIA 1JOBA 2CJWB 3ESRA 1DWPA 1V1MA 1UK7A 3UMBA 4M0KA 3V4LA 3R8FA 5ED4A 5I4BA 4QXBA 3WNKA 3ZYBA 2WVAA 4B87A 1N47A 5LQMA 2XBO3 3A1EA 3PIRA 5L53A 2HA4A 4LMRA 3KD2A 4B0PA 2G9RA 4KHPB 1PG2A 3QBVA 4N9QA 4IVQA 4DV6B 4D8WA 3BIEA 3GDGA 4XCXA 1JU4A 1TNFA 3JQGA 2VEOA 3B36A 1N0IA 4EN9B 2R8OA 1PEDA 2A6WA 4IDFA 1QORA 2HO5A 4BC1A 3TRDA 5FZ4A 3ONNA 3MERA 5I8ZA 5CFDB 2VP5A 2Z6AA 1UDBA 2WWSA 2NXCA 2QTWB 2JG3A 3D2AA 5IK8A 3ZU2A 1C4KA 3JW8A 2OFWA 1BWPA 2IX9A 1ULOA 3QK7A 2ZSBA 4AUNA 2UWCA 2FEXA 4EG5A 2X5KO 1WMSA 3T3GA 4FKZA 3W7AA 4L22A 1UZYA 3K92A 1UOJA 3LQ2A 5T7BA 4JI7B 4JH0A 2N3ZA 3H3FA 3ACBA 4I4IA 3IMKA 4HAZA 4Z0TA 3J8F1 4IDZA 5DX0A 2FW6A 4EYQA 1X1TA 4DLRA 4LVOA 2ZJCA 3D0KA 4QE3A 1OA4A 2QVCA 3OZTA 3HJCA 2JEOA 1GWLA 5CT5A 4GXRA 4HI0E 4LS3A 5DGDA 5H3HA 5L6MB 2CHFA 4RJIA 4AVSA 3NIGB 4ATEA 5BT8A 1E5SA 3WIVA 2R6JA 3OT4A 4JQOA 3B01A 4F84A 4XWKA 3ZYFA 5IG2A 3QFTA 3RAGA 3R1IA 3R2JA 4HUJA 3LOIA 4BISA 1BEZA 3LKDA 3MMPA 2WHEA 5JXJA 3G5MA 2AEZA 1UEJA 3FWEA 4EHHA 1A95A 4QGNA 4WFJA 1Y1QA 3UFXA 1TIPA 1N2IA 1RVV1 3AKRA 3GVIA 2Y6JA 2ZUCA 3AKDA 2ZW9A 4YJHA 1TAQA 1RXFA 5T8KC 3UETA 4QNNA 2Z30A 3IBTA 2W6NA 5CYYA 1N1VA 3EMRA 4LSWA 3T12A 2AC4A 2ORED 4QQ2A 3WV5A 4Q5IA 1RRVA 3S1LA 4GKVA 3E03A 1P5RA 3AMVA 2P9BA 1TM3E 4U3JB 1S0DA 1MQAA 1J07A 2IXDA 1AMOA 4HQNA 2XIQA 3CB4A 4OCZA 2JAWA 3Q98A 4MDEA 3RYTC 3VU1A 2X2FA 4DW8A 3CZPA 4ER5A 4CMJA 4IE4A 1C81A 1C4OA 3GUYA 3IEKA 4FS3A 5HBRA 1M8GA 3R5HA 3VZOA 4OSOA 3K1TA 2ZT6A 5B4TA 4KGDA 4ASKA 4GD4A 4LEJA 1CU1A 3NATA 3A1TA 1JR4A 4X95A 4D6YA 4QM8A 3KYDB 1Y5NA 3CVOA 1OZFA 2GEFA 1H94A 3VKGA 5LZ8A 3T7AA 3QE9Y 1EJ2A 1IB0A 4BLPA 2P5BA 4YGDA 2D5LA 4Z8YA 2FMDA 1VI5A 1G6NA 2GZSA 5E0KB 5JZMA 1NNLA 5DZEA 1SUFA 1A0OA 1XXLA 3DHVA 2RHHA 4TL6A 5FBQB 1A9ZA 5K8VA 4E4RA 1W5TA 4EJSB 1MOQA 4BU0A 1ZN8A 4FOVA 2WSUA 4O3FA 3UK6A 1YJBA 4TVBA 4C91A 4BMXA 1RKUA 3B60A 1LEDA 1UZAA 4D69A 2A5LA 4FOTA 1OWNA 4G9SB 2FRVA 1MW8X 4P36A 3VTZA 1FDRA 3HJUA 2BH9A 5ITZA 1KZ4A 5DHSA 1OFHA 2Z08A 1ZM2A 3AKPA 2REQB 1PGSA 3T5PA 3RIMA 2HWUA 1HXS2 2M6KA 2JLYA 3P19A 3ZWXA 1GBGA 3G9ZA 1N5RA 2XJ9A 4D0LB 2GILA 3OYWB 4I02A 1RPJA 2CJFA 1ZS9A 5DTMA 3ZCXA 4HMPA 1BKSB 3JS5A 3AP7A 5LLSA 3EX7C 1ELOA 5EXPA 3ZPXA 2AOXA 4ETWA 4XJSA 4OEHA 1GVNB 1HY3A 4LUKA 1CJPA 4BCUA 3BVPA 3SCZA 1FDIA 1JQJC 3RDPA 1ENZA 5DP2A 5JCTA 2JGAA 4IXLA 3B6IA 3V5NA 2QRKA 5IK7A 1TQ6A 4H6VA 1MS3A 2NT3A 5B2EA 4BVGA 1U5IA 1B41A 2NP0A 2HO4A 5CA0B 4QEKA 4XIKA 4NHYA 3S7IA 3FVRA 1RINA 4A6PA 4AVCA 3O84A 1LU9A 3K8OE 1Q8PA 1TW3A 4ZDWA 3ZU5A 1GRVA 5LZ6A 1IOLA 4R2KA 5FUYA 3FPHA 4S1VA 2R6GA 1IY1A 2Y38A 4YVWA 3OJEA 4BEJA 4TL9A 4RU1A 1BVYF 5BN4A 1A8UA 4OXQA 1IBRA 4OQFA 4KBZA 3ZVRA 1AR93 1J8YF 1MEJA 1K2WA 1ACMA 1O3SA 2AEJA 5A9RA 3BL6A 1QWRA 4OHMA 4N8MA 2ZGQA 1VBB3 2IPNA 3HCEA 1VBE2 1TKAA 3W7VA 4MXWA 4HT3B 2O0OA 1I6KA 2XGGA 4G1EB 3VUOA 2E48A 4YW1A 4P4TA 3DTNA 4WGGA 4MV7A 5ELMA 2W2NA 1MGOA 3GHMA 3QVWA 3VZCA 3HB4X 1BA2A 4YRBA 2VHXA 3IWZA 2J30A 3QXCA 1IK6A 4TTPA 4CF3A 3HCDA 4PANA 3P71T 4QPIB 1IONA 3AFIA 4PHCA 4NHEA 4YH1A 4MNTA 2FZGA 2VQEB 1S2KA 3UCEA 4ZVRA 5AFEA 2ZRCA 3EJKA 3FFAA 4BB9A 5I3ZA 2JJ1D 3GRFA 4NMMA 2BGPA 4QOSA 3OUTA 2AQKA 1FBTA 2ZGTA 3LW8A 4LNAA 1RC1A 1GUBA 5JAIA 3WQHA 2P17A 4YM2A 4HANA 3OURA 1QRSA 4C0LA 3RVMA 3KUXA 4ZU3A 4WOCA 2UYCA 1ETHA 1AX0A 2DTWA 1DZ3A 4GEKA 3D8NA 3Q7RA 3VHXB 5L4LA 3ZDQA 1QG6A 3DULA 4CKEA 4B3HA 4RD1A 3DOOA 2C97A 2PPVA 1R6DA 3HN7A 4PAWA 1GNYA 1JYWA 4OQYA 1CGPA 2H7VA 3I3MA 5F35A 2KX7A 3DE2X 1OFVA 1PU2A 2F6BA 4ZI2A 4GECA 4CBVA 3ZFEC 1ZFNA 2NUTA 3KAQA 1ZRMA 2W3JA 2IDKA 1QF3A 3GGPA 3CPHA 4CN9A 1F5NA 3A28A 4JLVA 4IZIA 2W52A 4I5EA 4XDPA 2GSDA 3R4CA 1XEAA 1J42A 5T54A 2QD2A 5LEKA 4U2FA 3RTAA 2PNJA 5CA6A 3UHAA 2ZGNA 2HHJA 5FYUA 3OX1A 3U75A 1PVC1 5AM4A 3X29B 1T8TA 2GD1O 4V24A 2PZJA 1DJMA 2O2CA 3HVHA 5BNZA 3BU0A 3AU9A 4QUKA 4DZGA 2P4QA 1RCFA 5IBRA 4QUIA 3E9YA 2VNKA 2FX5A 3D8BA 3E27A 3K3OA 1NAIA 5CVEA 3ANNA 1NYQA 4KBGA 4BVHA 2QVXX 2ZS8A 2RHGB 4XFCA 2ZKIA 3MINB 2XTZA 1EQUA 4NNOA 5BOSB 2QJTA 4WM7B 1RRGA 1LI5A 1BNCA 1L4YA 1W88B 5CB6A 4Y20B 5IAXA 1KFCB 3LPFA 2XUMA 1JPVA 2VZTA 1O5UA 3IVGA 2Y66A 4KPUB 4QUDA 3WMRA 3BYWA 5EY5B 1KARA 2B3DA 3K6RA 3DWIA 3IEUA 1E2PA 4UD6A 2PVSA 1Y6QA 3QX9A 2QGFA 4EM6A 1YS7A 4CTMA 1YRLA 4FDUA 4WEOA 3LFIA 4Y3UA 1FTQA 5T6MA 2QOEA 4DDTA 2FZLA 5A3NA 3W5BA 3HR4A 3K16A 4Y67A 4ZCPA 2J67A 3D3EA 1SIBE 5LQSA 3LZCA 4G0XA 2GN3A 2HNKA 3B53X 2BYVE 1PF7E 4LRUA 1R6XA 2H5EA 1Z0UA 4NX2A 1KVRA 4EECA 1GNRA 5JH7B 3DFFA 4OLJA 4P9JA 3H19A 2I4IA 1WEKA 1DUIA 3WK8A 1AJOA 4BNUA 3CGGA 5H02A 4JZKA 3UMSA 4AQDA 4GXLA 3RWOA 4XW2A 1ANKA 1ZGAA 1HX7A 4R8KA 5B36A 1E2UA 1DQRA 3ZIXA 2PMFA 4ZKDA 3RS2A 1OPOA 5T41A 3GX1A 2XUPA 5F5LA 3RTCA 3HLKA 2YJ3A 2X1VA 5LWBA 3LF7A 4R51A 3ZOZA 4RSUA 2VHWA 4EN7B 3WRYA 2ASEA 2R49A 4B4DA 4A2QA 4Q7KA 2CK3A 1K8YB 3OIFA 5JSKA 2IPMA 1QP8A 2IUYA 4YZ3A 3NKFA 1SUDA 1ADGA 2HQRA 3IUYA 3UBMA 1M10A 3AVXA 1MXHA 3HS3A 4I1PA 2W00A 3Q3JB 3N58A 1JODA 1ZBA2 4TM7A 1QR6A 3WUCA 2YINC 3REQB 1KITA 4KFRA 5ILOA 3QPDA 2EA7A 4MLDA 3L07A 4U2AA 1JHVA 2B5WA 4P0TA 5IYYA 3COPA 1M7HA 4PRLA 3PI7A 3FNQA 4XX1A 5AKHA 1G4UR 1UOGA 5HE9A 1LV8A 3L3BA 4QAJA 2GVDC 4PRKA 3TPFA 2WUFA 1NVKA 1AE1A 4IIDA 1EDZA 3M0EA 1E3EA 1SK9A 1UZLA 1V9CA 2PV7A 1WKVA 4MA4A 3ZYCA 2MJLA 3FCOA 2D7JA 1FXWA 1NN1A 3SBEA 1VB2A 2I7CA 1H6CA 3OHMA 1SQGA 2IGTA 5IVBA 3RVLA 3IMNA 1KIMA 5FMCA 4EFMA 1NXMA 3IT0A 1KYQA 4XGKA 1M2HA 2J9RA 4DQXA 2IP1A 5JOWA 3UJ6A 2JH9A 1ZHOA 1GNVA 5A0TA 3ROTA 1ZIOA 3C4QA 2EZUA 1UC5B 2O8VA 5JWPA 4MS1B 3HJBA 2PGJA 4REMA 3ZQUA 2AOTB 2J9XB 5EA2A 3HVRA 4ZN6A 5E1MA 1QP7A 5GLUA 2Y6LA 3GLIB 3POGA 5GZFA 3VD9A 1DTWA 2UXBB 1R0ZA 5JQGF 3CH4B 4DBZA 2PGXA 4R6WA 4GOKA 4XW3A 4YJ3A 1CX1A 4Q4W2 1P19A 1X74A 3FCCA 3SEAA 4UBKA 4MI9A 1KERA 4KO2S 3PDJA 4DG9A 3N1UA 2OVFA 3ROPA 3PENA 1C0PA 3ZKWA 1PNGA 1XWFA 2H0VA 2DBNA 1RYEA 1UAGA 2IXTA 1GTZA 1QP0A 5KDDA 1P1RA 2BFMA 3RZHA 2QTFA 1A8PA 4WK0B 1V1MB 4UBOA 5JFOA 4BB0A 1RMU2 4LNHA 3NRJA 3OT1B 3IXMA 2PEYA 2P6PA 2HBRA 3LY9A 2J22A 4MRSA 2J6HA 4HDRA 3NHZA 1GG9A 4B33A 1XU4A 2PT5A 1T8PA 1JYIA 2G88A 3JQGB 3D7KA 3LQKA 3ADDA 1G8MA 3EASA 4AZ3B 2G08A 4N3GA 4BMPB 2HWB1 3DHNA 5AK4A 2JGNA 3N07A 4AI8A 2I2BA 1ZW1A 2VP4A 5EE5B 4CRWB 4RSRA 4A5SA 3A6GA 2ZEWA 5L51A 4DADA 1Z4JA 3S2UA 4N0MA 1HE5A 3EARA 4GO1A 3KAJA 1HE1C 4CL3A 3P9KA 1W75A 4CV3A 4RS5A 1HZZC 3HZOA 5J48A 4XLZA 3LLVA 4YLEA 2J6CA 2QK4A 1E3SA 2CV1A 5CTAA 3W2EA 3I3OA 1FV3A 1M0WA 4Q1PA 4NOTA 3BJIC 5CVCA 3G68A 2B7CA 2NTEA 3SD7A 2I4NA 1E2BA 1FYFA 3BCHA 5J9FA 4BQRA 4PLZA 1U0NA 4K40A 2QL5A 4MQ4A 2ZEYA 2XA9A 3R09A 3OZCA 5LYJF 3I3EA 2FCVA 2VSFA 1VLMA 4DAOA 4IRXA 1CN1A 5JAHA 4NXMB 3GZNB 3KSRA 5EXSA 4UAVA 1I4LD 2X7HA 4F6RA 4HNGA 4QJBA 4POOA 4L15A 3NG1A 3A2NA 4AQ7A 3QHAA 3C5CA 1MAVA 1T3GA 2H2IA 2GVZC 1VKRA 1Z5UA 1LFDB 3FJ1A 1ZH4A 4DKJA 1UPCA 2QRLA 3CUYA 4HOYA 1DJNA 3IAXA 1CEXA 4DSOA 3UPTA 4EL0A 5JZ9A 1FA9A 1XZPA 3JQFA 4I3HA 2I0FA 4O4HF 4B5KA 2I6UA 5FPAA 1C9JA 1U1DA 4ND5A 2YWFA 1Z8NA 2H5JA 5E95A 3WRXA 3F47A 3UFXB 1BCSA 3VPFA 3LDHA 4PXSA 3KCCA 1UWVA 1SC4A 4YCBA 1O5TA 2BN4A 1SBIA 2ZUEA 5KJEA 3KE9A 1Q11A 1Q8OA 4JA2A 3QM1A 4L7QA 1K8RA 4YUZA 1PD0A 3ZYRA 2Y6UA 5JTUA 1JXQA 1ZJWA 4QPJC 3WNZA 4O59O 2OQRA 2PWAA 2C9DA 3IVRA 4YA6A 1HF3A 4CHGA 1AMUA 4TKUA 3ZQ4A 3C3JA 5GP1A 1XV5A 3NIFB 1N3YA 3R0IA 4RW0A 2FPOA 5K5EA 2WWXA 4U7PB 2CF6A 2LM3A 3BORA 4JDUA 2MTBA 2BTOA 1HSOA 3TDKA 4BZWA 4PYKA 3O31A 2ZUBA 2PUFA 5H4HA 3QPCA 1L5SA 1YNSA 4JL6A 1EIZA 3D6MA 5F5IA 3RJ5A 3DKIA 2XNKA 1RVF3 1NPDA 1H2MA 1FZTA 3SH3A 4JOQA 4FC7A 4INPA 3K9GA 3WJAA 2RSLA 4QASA 3QH6A 4P0QB 1A8DA 3MYRA 5ARBA 1XNCA 3KKQA 4GOLD 1PTJA 1XTUA 4FCCA 3AEUB 2GALA 4XOIA 2K4MA 1CUUA 5C7YA 4XF4A 1MR5A 4A6DA 3W2FA 3P9PA 3IM0A 1J49A 1TYBE 4Y2YA 3K6SA 3PC3A 2IYZA 2NTYC 4OOEA 4GLLA 1VECA 4G0QA 2LXNA 2UZ4A 3OE1A 4B7CA 1Y7LA 5KCZA 1T5TA 3P2JA 1YR6A 3OBRA 3I5XA 1OXXK 4CEIA 1PZXA 1V5IA 2FDFA 1U7ZA 1DYPA 4FK8A 5CXXA 3ZCTA 4K2HA 4RCZA 3ZYZA 1PZMA 2WJ4A 3I8TA 3R5XA 1UBOS 3IRUA 4DLYA 2ZJ3A 4YN3A 5FPUA 1DU3D 2TMDA 2AXPA 5TPWA 4GSLA 4DUXA 4C7VA 1FT9A 2ZWMA 3B69A 4G5YA 3UBTA 2PE5A 1E2IA 4AK3A 3KEMA 1GA6A 1CS4C 1GQPA 5HV4A 2VP3A 3TXYA 1TJPB 2JATA 4RWEA 1NXPA 4GYJA 5C35A 2ZJ7A 5FNVF 1P81A 1Q22A 4ZRNA 2BSXA 1IQ0A 4DV4B 4QGGA 2P79A 4XLLA 3RS7A 3H1PA 3PNPA 3OGVA 1IY8A 1YSCA 4XFDA 2EWMA 3GJYA 2D00A 3G13A 2QE6A 5JDIA 2XLFA 2RJKA 3UKDA 4DE5A 3FPBA 1LBTA 2O3RA 1UL1X 1GZTA 1RZRA 1WCKA 4IFBA 3TJMA 3V4OA 2FDIA 3F98A 1CQPA 4MS3A 4K9QA 2JWPA 3G9QA 5DTEA 3TXXA 3AO0B 4DLUA 3AB0A 3QEAZ 2UDPA 2Q28A 3AOGA 2CK3D 4YVWB 1E89A 5FPKA 3QTLA 2NSLA 2LWIA 4PYJA 3P3PA 1A50B 5BN4B 3KCNA 3VBOA 3IMFA 4KOEC 5ANNA 3OTGA 4YC7A 3VR5H 4G4GA 2C2KA 5CU1A 2YROA 4BFWA 2XL7A 2NT4A 3PC6A 3PHJA 3O3NB 4XLTA 4QAWA 3KQSA 1KAGA 3GZJA 2RK6A 1T2UA 4IF6A 3O1RA 5K0FA 1CIPA 4LUCA 2ID8A 1L3IA 1NUTA 4GE3A 4K6BA 4I9FA 4W6ZA 4BXSV 1V4VA 3M5PA 2FPUA 3U3MA 3S2EA 4CW7A 1NN3A 4CQLA 2ZFUA 1TQ5A 4H15A 3ZHZA 3VU0A 1YV9A 2H1HA 1MJHA 1PHPA 1M3SA 5JBIA 3IJRA 2AKYA 3NBZC 2VRWA 2YFKA 4H27A 4BRWA 5LDGA 5HIKA 3ZWBA 2PFGA 5COAA 3QOXA 2XCIA 1G59A 4CM8B 5DM70 3ZQKA 2EARA 3MJEA 3OOYA 2H6CA 5C4WB 1SBHA 3O7OA 4H6XA 2B83A 3T7SA 3KEGA 4DA9A 2Z58A 1VA5A 1POXA 3BQNB 2FH5B 3IKTA 3S5AA 1P0FA 3GK3A 2RVAA 1P9NA 4JLSA 4CKEB 2QZPA 2WWGA 3VNAA 1RWKA 3G6KA 3DZIA 1N6NA 3HBLA 2X42A 1JFRA 2BEKA 2P3SA 4JOCA 1LOCA 1TYZA 4MOWA 4NZMA 3WKDA 4M0PA 1MO5A 3KQWA 2NUTB 3L79A 3AJAA 5HSGA 4XAAA 5CKQA 2JAOA 5EUMA 1EQ2A 3ZMOA 1R0XA 3GZAA 3KQNA 3NT2A 2X86A 4BX3A 4LY0A 2RGEA 3S2SA 2R751 4FT4A 5EQDA 3JV7A 4TPKA 3WQSB 2C58A 2VDRB 4QDKA 4OI4A 1J8VA 4COOA 4BQNA 2EW1A 1Z83A 4KI7A 2F8LA 1ZXLA 3CLUD 5HK8A 1MCZA 2CLEB 4TYNA 2OV3A 5G4LA 1NCQA 1N8SA 4X65B 3TLGA 2C96A 2HI0A 4DVJA 2WSVA 4D8YA 2WIJA 3B00A 5FZ1A 1AR82 3NHJA 4EGSA 2PO7A 4FXPA 5HQ3A 3M82A 1U9IA 3WCRA 4MICA 4RPKA 2I91A 1OROA 1OU4A 1NOJA 1JZ3A 3ENRA 5DNDA 1XZIA 2CL6X 2WC1A 4FVTA 3IBMA 3KVVA 3WX0A 3OUIA 4RTSA 4FPXA 4C4YA 4EI8A 5BSRA 5AWFC 4TLEA 3IUNA 5FREA 1BN7A 2OWDA 1UMCA 4UW9A 4MOAA 4UHBA 3CVXA 3PIJA 1EFPA 3UMGA 1POWA 2CHGA 1S0FA 5C37A 5DNVA 2V7EA 3HQ4O 1CNMA 3ETEA 4GS5A 4AXOA 4FPGA 5ELLA 1X0XA 2R071 2J46A 3OHSX 1FQKA 2OCKA 3FZ3A 4UTRA 4MHTA 4RMHA 4DLNA 1V43A 1NIJA 1E1MA 3TOVA 2GN7A 1SXGA 4Q93A 1XRSB 2MINA 3CUUA 2A9JA 3WYEA 4BUJA 3GGDA 4MADA 2C92A 5DX8A 2E6KA 4WNAA 2AOUB 4LQCA 3QJ5A 1SLAA 5DYIA 5H82A 1H2XA 4BE7B 1Q8QA 2IH4A 4XFJA 3NHMA 2QE3A 4FGUA 4YRAA 3W3AA 2CW5A 4CCSA 3L7IA 2JD0A 1JP7A 2ZYRA 4EUKA 2QQWA 2X7JA 4RVNA 7YASA 3QMPA 4GOJA 4G3XA 1Q3KA 5CXSA 3CLUC 3WDKA 2JFOA 2D1FA 1F0YA 4EKNB 2DH5A 5H9RA 1JZ6A 4KB5A 3OM0A 3AINA 1UY1A 2V8BA 4G67A 4F5DA 3SCFA 2C5FA 3R3JA 3ASZA 4JWKA 3P1IA 1PJLA 3L8HA 1H22A 5LA6F 2P6HA 3RSSA 5DW3A 4AJLA 4D44A 2H9IA 3DVAA 3QMVA 2GH2A 4YFVA 5A7SA 4BXOA 4RS5C 1YJCA 5EIWA 5LWHA 4IKEA 5HIJA 3BA6A 2O54A 1X1RA 2BGCA 2VJCA 3G6WA 1XA4A 3U5ZB 2YY7A 3ZE1B 3LC2O 3I3SR 3RMXA 2IU0A 4U00A 3SKXA 1IRXA 4KKXB 4W4ZA 1FCJA 3CRMA 3A3NA 2F67A 3OZGA 3PNKA 4B3JA 4M0CA 2PN5A 3KQKA 4LF9B 3MOSA 4OLLA 1P7VA 1QJX1 3R3XA 4GWJA 1KK1A 1ECBA 1COZA 3FPFA 3W2IA 3E82A 3OQBA 1WHSB 4JC1A 4N49A 1RRPA 3AK4A 1YDWA 3L1IA 4JBNA 4RMNA 3B3GA 1QPZA 3ZWOA 2V7GA 3K94A 4J2OA 4MAAA 5EP4A 2ZSKA 3KLPX 4HVQA 4YJ3B 2RD2A 1HQWA 1DKQA 2XZOA 1Q44A 4DPMA 3OE7A 4I1RA 2REXB 3MYXA 1YKFA 3DH0A 3JQFC 3ZKWB 4GA9A 3D4KA 1IHYA 3B9RA 1JDNA 3BBPA 4TTGA 2VZRA 1U6JA 9LDTA 1VG8A 2C82A 2OD2A 1FLAA 2ZGVA 4PQYA 2DPHA 2JAUA 2JF0A 2CNNA 4QWWA 1WW4A 2D40A 4AL9A 3VAAA 5P8WA 4BO6A 4JHZA 3H2KA 2PRYA 2HYKA 3KR0A 3VDMA 3PGVA 3AP5A 1VBD3 5P21A 3TSAA 1BHO1 3STTA 1YYNA 1U6IA 2FW0A 3WLUA 3E9NA 1B6SA 4NPCA 4GC9A 1WZ2A 1QFYA 5DGHA 4HG6B 1GG2A 3AFNA 1KU0A 3SXJA 4WVWA 4CT5A 1D7PM 2WD7B 2PRSA 4RBNA 2HWC2 2XJTA 4YJFA 4FJ2A 2VHTA 1RZRD 5A9SA 1E4EA 1R6BX 4LHXA 2IKQA 1Q7CA 3LDBA 3M4JA 4EAAA 3LHDA 1IMOA 2NPOA 1UMBA 1WA4A 3Q1LA 5EMMA 4YV0A 1DJPA 5LK5A 1IN1A 4A7YA 1T10A 5AI6A 1I2BA 4W5RA 1W1IA 1PTJC 2CLDX 4N53B 1AHNA 4HTFA 4M87A 1X0VA 5T8KA 2KJQA 2VA9A 1ZNQO 3UJ3X 3BIWA 1MQ9A 3ZXJA 5E1DA 3WGUA 1E61A 2WQ6A 4ZEWA 1I1EA 3E81A 3AJDA 2C2BA 1LS1A 4JKIA 4L73A 4H08A 3GLUA 2YJNA 1WDKA 2PRIA 5EZSA 3PXGA 2JDYA 2OR3A 3ZI0A 1Z22A 3HSYA 2HWC1 4TLFA 1XNQB 3GJ5A 4AAYA 5BV8A 1OBHA 1U2GC 4QM6A 1L5FA 1MVLA 4C0WA 5A3LA 1XBTA 3SK0A 5DHUA 2IFTA 3MWYW 3KAKA 1JZ4A 2ES4A 1WO8A 3GNQA 4A10A 1RUD3 1U7DA 5EJ5A 1NW3A 1FJXA 3E6BA 1OT5A 1Y8ZA 3ZTYA 4R98A 3FA2A 4IWNA 1HNNA 1N2SA 4BEVA 5CAEB 4GWIA 4UULA 2IVZA 1SEFA 2BPOA 2DHEA 3KVOA 4A0QA 3OEWA 1FYVA 1R9NA 2QQ5A 2WF6A 2NYYA 3TBKA 3GZEA 3SDBA 1QBGA 1NQTA 4DJEC 3VDXA 4B40A 4N01A 4UOJA 2CUKA 3H1BA 2W39A 2ZGOA 2E9SA 5C6CA 1RTKA 3IJEB 4Z2AA 1PWXA 4D46A 4ZCSA 2I2CA 1OC2A 1ZRHA 4TKUB 5JDIC 5T5OA 2QGNA 3IV6A 2X14A 1HDIA 4AF7A 5L3VA 3GPLA 3BMQA 3IDFA 1W3XA 5L9VA 4DQKA 1U1GA 1LDBA 4OXXA 4NK4A 3W6PA 3RVKA 4C1WA 2RMKA 4BV9A 1MAAA 3JU9A 1KY3A 4CMIA 3WL7A 1NLUA 5F2NA 2P2CA 3GPIA 1PWHA 4B1FA 3VBOC 3O03A 2RAVA 2GJSA 4IUDS 4IV8A 1YRWA 3NEPX 4QBKA 2CY0A 2HRRA 5IKMA 4QDSA 1KE1A 4PO8A 1N2CE 4EY8A 5F78A 5JPIA 4RLFA 4EB8A 3ZFFA 1NMEA 3UMRA 5H3LA 10MHA 3DC7A 2GEJA 1JN0A 1FS6A 2CLKB 3THTA 4TUYF 5A3MA 1B7GO 1H5NA 4BFUA 2PUDA 2OKXA 4KFTA 3K6SB 4EITA 4B44A 2NLRA 1H8VA 3LGXA 1IVYA 3D9QX 4FGLA 1Y7PA 3IDBB 5F3EA 3ZV3A 2PX6A 2I5PO 2WUWE 2YZMA 4ZZ2A 1H6AA 4NULA 4NIDA 4IEVA 1DB3A 1OYYA 1OB5A 3TL6A 3CMCO 4KQ2A 1QFMA 1EXNA 2PAAA 2ZYSA 1L8OA 2YBPA 3GH3A 2PUJA 3D8HA 4CEIB 1WVGA 4YWAA 3WLTA 1CWPA 4XASA 1S1MA 4XF1A 4K81B 2CXPA 4QIHA 3PVBB 5I7EA 1OLRA 3P0EA 4OF4A 5AVUA 5C8YA 3LLUA 2QTHA 1W6QA 3NAMA 1LB1B 1QLWA 1NXVA 5TPWB 3LYAA 2JIBA 1PZEA 1DP4A 4OYRA 1VBMA 5IJWA 1Q16A 4R9VA 1OWLA 4M00A 4BWGA 5KPJA 1YS1X 4HWRA 1T9GS 2XVGA 1JB1A 3WZMA 1C9YA 4PLOA 2GK6A 3VBUB 1HDYA 1RHQA 1M2WA 4LGVA 4OCTA 1EFTA 3AOEA 4G86A 2Q41A 2VAUA 1T2FA 1XHFA 1YB6A 1SEPA 1VJDA 4HNAA 1G60A 2AE1A 3PC7A 1OXMA 4M0UA 2VW0A 1DZTA 2BHTA 2RAPA 5ECYA 3F7OA 3L8DA 2JICA 3BILA 4A2UA 1AKNA 1SCRA 3MHZA 2G7MC 2LUWA 4RAOA 3DWGA 2JLZA 1GPUA 2FCAA 4K1XA 5H68A 3IJPA 5BMVB 5I3CA 1F5FA 4XQWA 4AYWA 1PE0A 1W34A 1VRVA 1DEKA 2JLUA 4ZZ5A 3KU4A 1E5IA 3W3AD 3FBTA 4XEHA 4Y5SA 2XH6A 1SZJG 3EXFA 4HVAA 3OQ1A 2G63A 4LW8A 1HRI1 4DBLE 2WUDA 3SEFA 2E37A 5H5JA 5F3GA 3VBOB 1T9DA 1Q91A 2JA2A 1K0UA 4EJ2A 1NCQC 3MAJA 3PFGA 4DIUA 4ARVA 1YLLA 2ZB4A 5GM1A 2NSJA 4HMQA 1GMMA 3VOAA 4LBKA 3EIXA 5E16A 1CPMA 1IQAA 4XHBA 4UXJA 3O9MA 3T7CA 3WDTA 7GPBA 4AP5A 3C41J 3ZDYB 4LWPA 4BPZA 5FZ6A 2Y99A 4O1HA 2G4CA 1SBEA 2ZAGA 3H05A 1TTQB 3TLXA 3BHIA 5GZDA 2Y6KA 4JP8A 1KDKA 1E1DA 1YHFA 1H8EA 1YASA 4CQLB 2GM4A 4NKRA 3IDCB 3DXXA 4IXDA 4FCWA 1MORA 2YN0A 4DZZA 4BBJA 1AR62 4FAGA 1EH5A 1M33A 3VJMA 4NABA 4OGKA 1RT9A 2WFPA 2PGOA 4PHZA 2GERA 1WIWA 5MN4A 4ER6A 2AH2A 5JOYA 3O74A 2PJRA 5DRTA 5FFMA 2UY8A 3KSAC 4PHGA 1PR5A 4OQPA 4IDEA 1MNAA 1DWQA 4CU9A 2VHZA 3MRSA 3P9CA 4BFLA 4N4AA 1CY8A 1RU3A 1NCRB 3MT0A 2BH2A 4NG5A 4UDNA 4K7JA 1EZZA 3WLLA 4BQ1A 1UODA 4XTMA 3AF0A 3NGMA 4L9SA 2VMIA 5LLTA 3D0JA 1M2KA 1ULDA 3OE7D 5B37A 5EKTA 4NYJR 5IARA 3MTGA 3KQOA 4FOWA 1YEWA 3S99A 2HBQA 4RQUA 2JFUA 2C2OA 3ZNNA 5AT1A 1NM5A 4V1CI 4XFIA 4MW0A 4LJ4A 2HU8A 3TYXA 5J96B 1L2TA 2JJ1A 2ZMKA 2HBTA 4IDOA 4ARCA 4RIFA 1JMKC 1PBTA 1D5WA 4K3UA 4B3SB 1L6IA 1O6CA 2IXAA 4MGZE 1WP9A 1W4AA 2E7AA 4HOOA 4QM9A 1E9FA 1E5LA 1WV1A 4R4XA 1H2AS 2RR13 5J5VA 1DQ1A 2FGKA 2ZM5A 3T2QA 3NW4A 4DMRA 1NCQB 4XF0A 2GMMA 3TLGB 2WS93 3AMNA 4CCAA 2CAUA 4DUWA 1LOGA 2YFUA 1VRWA 2D93A 5KIAA 3EYAA 4M9ZA 4DO0A 1C3EA 1UOOA 4ITVA 1IM8A 4K20A 3C7FA 3OGSA 3S1SA 1KP2A 2FHSA 3L7AA 2JE8A 5HQ3B 4FYPA 5FHRA 3OGGA 3FWKA 5A5FA 4IPTA 1IS3A 2DHRA 3MWJA 1PL6A 1C0EA 1G7RA 1XVUA 1TJNA 3F74A 5IFKA 3MTEA 5LCXA 3VBFA 4ZQEA 4GMP1 1JQ5A 5TT1A 4IHQA 2HRBA 4KQMA 4Y24A 3PP8A 2RS13 1JDJA 1NSYA 3EJWA 1LRJA 1D9ZA 3QLTA 2AMFA 2RH5A 1G291 2ZBQA 2CJYA 4HN2A 2JFBA 1UMCB 4YAJA 1CAVA 1HGXA 1EFPB 2QUJA 3X1XA 4OGFA 1UQUA 2FPKA 3BC1A 4RHXA 5KC5A 2QTVB 2VTXA 2X8BA 1SXIA 2VF4X 3LBIA 1T5BA 4PCVA 1LB2A 4ATNA 3PCRB 5EP9A 1V8DA 4BMEA 2QQEA 1G3RA 3ZM8A 3UFBA 2FSHA 1OHHD 3TBFA 3TB0A 4EDFA 1K7CA 3T7DA 4MUFA 5HTOA 2DJ5A 2R97A 4P5EA 1L3JA 1ES9A 4YUWA 3N8NA 3J4UH 2A5FA 3E18A 4XUCA 4WNAB 2XOEA 1Z8DA 2AK2A 3AESA 3F6BX 2JK0A 3GH1A 3DKQA 3J81k 4OM7A 3BB1A 2HLPA 1LBHA 3KETA 1G9TA 3QJGA 4GZLA 5IBQA 3ZVKA 1AA6A 3QU4A 1UXZA 1D09A 4Q05A 1CY4A 5DTJA 2GTHA 2YIJA 3MWFA 5FR3A 4XRRA 5B3LA 2OKGA 2ZBJA 3WMEA 2FZ1A 3RJTA 2PA7A 1S7CA 3O9ZA 2C31A 2CUTA 4Q1RA 2AS0A 4CM1A 2X8AA 5IYZF 1K1EA 2FDXA 4GM1A 3X1YA 4Q7LA 2WT8A 2Q30A 1E7QA 1Z34A 1U1IA 3ANYB 4LOIA 2VO1A 3WUDA 4PZEA 2P3JA 3DVAB 5A7NA 4C03A 4ZEMA 4C22A 5EQFA 4JI6B 1TO2E 4NSNA 1QUFA 2ZR0A 4BXOB 4TVOA 3T52A 1I32A 3EVFA 1YC61 3QE0A 5F37A 4BTEA 2JFPA 1ZISA 3FHQA 4DMMA 4LKFA 1R00A 2XKJE 3FI9A 4BZPA 1KEKA 3N9PA 1DCKA 5BRJA 3PCTA 2Q1MA 4MRRA 1Z4PX 4D9CA 3Q3IA 3C5WP 3F3MA 4H2DA 3QHPA 4E51A 4YP0A 3OQVA 1I1QB 2WHYA 3G2JA 3HN2A 4DXZA 2UZAA 1Z0AA 4NBRA 3LQFA 5DEOA 4JKOA 4B43A 1ZBE2 3ZOKA 3DOCA 1KI7A 3KUCA 1NI5A 1P2GA 4MQ5A 2B1QA 4X20A 3MIEA 3SOPA 1IIRA 3F6SA 3D7MA 3E3AA 4CE6A 1N4AA 5JVDA 3M3HA 1EJBA 2P4UA 2IT1A 4S2GA 3H97A 3W8NA 2PJZA 3MLEA 1DIBA 3O5AA 2DUOA 5BYAA 1DRKA 4KHZA 1HZZA 1W06A 3L7MA 2I6SA 3NIDB 3VM6A 821PA 4L97A 4E9KA 3AEQA 2JLQA 4F6LA 4TL8A 1GRRA 2IYVA 4P4GA 1X9PA 5BN1A 5I7FA 3ED1A 4NBNA 3DBRA 5JNLA 1W0JA 4C7MA 1W39A 2QRNA 4QICA 3FFZA 1XNJA 1U2PA 2EF1A 1AH2A 2VR4A 4M1WA 1JLHA 5E4JA 5K3CA 2AEFA 3NVDA 2JHGA 4RTQA 4ALNA 4AJJA 4X3CA 1P9RA 4X44A 1B15A 1RJFA 1TZMA 3IH5A 3I2JA 3LA6A 1GL3A 5I7UA 2RJNA 4C2TA 2CSXA 2O3TA 5AVRA 1U8YA 1O3QA 4EYEA 4EHIA 3ICVA 3LPLA 3V4VB 4D43A 1YU9A 1PL0A 1Y7IA 2POCA 4ZAWA 3B9BA 3THYA 2YG0A 4YJFB 5FTLA 4P1ZA 5DLDA 1F2VA 1U0OC 2D13A 1NR5A 5A9SB 3L0PA 1E79A 4O2AB 1X1EA 3UAZA 3VBSA 2PQ2A 1UMBB 3GFGA 2WFLA 2F90A 3S44A 4BMSA 1N7IA 2VHJA 5C7LO 5F52A 1SBTA 1JLRA 3CQ9A 1IUOA 2OXEA 2HQOA 2JKYA 4QDTA 3ZFFC 1IB6A 5A06A 3KKKA 4HTFB 4JMPA 2Y26A 1EFHA 2HGZA 3VSAA 5GLVA 3IQEA 3RG0A 2FOXA 1K4KA 2NUAB 2BMDA 1BC5A 2B92A 3CYFA 1RRFA 3TAYA 2CXUA 4UE2A 5DWDA 2H65A 2F8SA 2BV3A 2X76A 5TGTA 1H8ED 1Q0TA 1HXS1 4G1BA 2YR0A 1SKYE 3OVMA 2OBLA 2WLTA 4HDMA 1Q57A 3BRQA 2HCJB 3KJXA 4JLUA 2OP1A 4G4SP 1IOAA 4MP3A 1LC3A 2FPGA 2ZWPA 4I9HA 4F7ZA 2NU7A 4FR5A 2LV8A 4WZBE 4KO1S 3HGTA 3HSKA 1L7RA 5E2BA 1OKKA 3RC2A 1EXDA 4J0HA 1PFKA 3WGZA 2JLVA 4LYGA 2ZUVA 4UZEA 4NJMB 1EMDA 1W2OA 4BVFA 1QH7A 5C3UA 2GNDA 2ZI9A 2CYAA 4A8TA 1JDZA 3LCCA 1JTZX 3DSRA 2XWJB 4J0EA 5ES3A 2ZBUA 1IJBA 2HXSA 3KJFA 3EMBA 2I66A 3QEJA 1GV9A 3AOEC 3O93A 4P34A 4EKEA 5B4XA 3T38A 4WSOA 1FB5A 4HYYA 1GN9A 2ZTNA 2WG2A 4KBYA 3EA0A 1I6WA 2CZCA 3EGDA 5C1PA 3MWGA 4K9OA 3AL3A 4IH1A 2Y76A 1PIV2 1QDLB 4EA8A 4NBVA 3BMQB 1K97A 4I1VA 2JGLA 4G09A 3DC2A 4ZYZA 1G6KA 3AW9A 4QQOA 4C01A 1E9SA 2PL5A 1G3QA 3UGHA 4ZHQF 3V8EA 4BBZA 1LUAA 1NW7A 4CMIB 1FP4A 4ZVSA 4ZI7A 5D8AA 1UKEA 1GLGA 2C8LA 3PEVA 2KM2A 2YHSA 4UHCA 2A7XA 4GX2A 4C0BA 4AFAA 5FXWA 4D8VA 5G04L 3T9DA 1UBRS 2OV1A 3ECCA 1VBE1 5LOVF 4LX0A 5TIIA 3O4VA 2XZTA 5SV5A 1ACJA 4WA8A 2PR7A 4I2VA 4J0IA 3E9MA 3GGCA 2C84A 3STXA 2QA5A 1PWYE 2L82A 2A67A 3SZGA 5H81A 5A6SA 2VWGA 1X7ZA 4MUAA 1KDZA 4LBJA 1UU4A 2YMQA 1OASA 3KM0A 4E5MA 3U7RA 1U8EA 2PN1A 4RK1A 3TRHA 2R47A 1JXMA 2ATEA 1XVTA 5HBGA 1FU8A 4A7PA 2VVEA 5FFNA 4LK6A 4G97A 1Q43A 1U5YA 2E18A 3OY8A 4G0OA 2X2OA 2V55B 2EKQA 2H06A 1JIJA 4F3JA 1ZSYA 1T29A 3D4IA 3M89A 2Z1MA 4NP6A 4LRXA 1BK1A 3KXPA 1NFFA 1W9FA 4ONUA 3VHNA 3HBNA 1UQRA 4DV3B 3MF4A 4Z2WA 5HCBA 4EKDA 1NXQA 4CLRA 3G5AA 1W6QB 1CULC 4JVNA 1XOYA 4TLMB 1Z75A 3CR8A 3T6KA 2A71A 3LA3A 2OBNA 2UVPA 3DM9B 5FBLB 1GGMA 2ZUFA 3MJRA 3NQ41 3EXEB 1GXSA 5C3RA 2E7QA 1A34A 1J8QA 3ZE7A 3AUTA 1ALYA 3NOOA 2XZLA 1ZVVA 2VUSA 1YI7A 4Q8KA 3TNJA 4BE3A 4D7SA 1RUG2 1C0IA 2ERYA 2R042 3AM4A 3VZBA 1AZTA 5I8SA 4QYTA 3RGBA 4JP2A 2ZTLA 2P37A 2RFLA 1M83A 1V8FA 2IIPA 3K9QO 4U2GA 5FTNA 3C8HA 3KVNA 1NM5C 4MYCA 1E2GA 1L8LA 2PU7A 4PRYA 3IEXA 3OBZA 3C3AA 4XM2A 3GA5A 2NU6A 3RI9A 1CQIA 4G9BA 3UHPA 1P8AA 4GYKA 5BRNA 3QEMA 3CKKA 3S7EA 3S70A 4A41A 4R2JA 1KVSA 4JX0A 4HGOA 4TYWA 1ASJ3 3EXFB 1W47A 3FGZA 1QPGA 1F9KA 3POFA 4CCDA 5IUNC 3ZIDA 4MCHA 5EXXA 1ZREA 6PFKA 1EG2A 1T9HA 1T25A 3OU7A 4UM9D 4PQFA 2KYRA 2BSQA 2AZTA 1WHTA 3O4JA 4M55A 2A70A 2I71A 1N2ZA 3EVGA 5JEDA 1EHYA 2CXOA 1MX3A 4MYEA 3OPXA 4YTEA 3B12A 3PHIA 4ES6A 3WNDA 3HLYA 3HB5X 1XALA 3HR9A 1ZLYA 3AC0A 5I9NA 3MAAC 4EY3A 3L0ZA 3NWEA 3SGLA 1LNZA 1MS9A 1USKA 1UOFA 5DB4A 5HFJA 2NVBA 1GNHA 2C95A 1T3LA 2HEIA 3WG4A 2D4HA 4W5QA 1NTRA 3ZFEB 1N7JA 4XD7A 4KWLA 3KT4A 3HTXA 4G5HA 2WJPA 4KXQA 3VBFC 2CVQA 4QDXA 3AJYA 3PTAA 4KRFA 4BA6A 3T3NA 1LWOA 3MEPA 2FEKA 4RL6A 1G7CA 1R1A2 2GHRA 2PHXA 4B2LA 2IFRA 4EQZA 3VOSA 3BWCA 2R9VA 2GO1A 1SBQA 4OUSA 2QM0A 3LBYA 1ZYUA 5LZ4A 1TZ2A 1M2OB 1NF3A 4OQQA 1MQTA 4KWHA 4HYQA 3CW2A 1VPLA 4GVPA 2EVXA 5CFRA 3SU8A 1SQ6A 1D4M2 4XJ8A 2J0EA 2RB5A 4HAXA 4BNNA 4S05A 4FQ4A 1SBNE 2JC3A 5HKBA 1QJEA 3C45A 1IPFA 1CG6A 5FR2A 4RHV3 2O57A 2H54A 1XYVA 3B38A 4I46A 5A7QA 1X36A 3I61A 2MYNA 3D3QA 4EENA 1E6MA 3ZV7A 3TZEA 2VZ0A 2J9GA 3RJ2X 1XFDA 1N2GA 1UM8A 4X54A 4KFSA 4LN1A 4D25A 5T4EA 4HBZA 2X0KA 1VE1A 3C6KA 4NAUA 2YYYA 4I8DA 1XR3A 1W0JD 3NONA 2RJOA 3E7WA 2RDMA 3IMCA 1SACA 3K2IA 1SGWA 3SDZA 1V3VA 5A0FA 3SH4A 4HADA 4OB7A 2W2TA 1ZBA1 3V55A 4ES9A 4MR9A 1KNQA 5D7BA 4EHJA 4BTLA 3EVEA 3GLFE 1NW4A 2I2AA 1P6UA 3PNOA 4PF1A 1PZNA 2WINB 2FUEA 5BYKA 1V26A 4O4JA 2CF5A 1VR3A 1ZZCA 1CVNA 1UC4B 3DYIA 4B2YA 4EPVA 2YC2A 5K6AA 3TCXB 1IPSA 3BHJA 2D6NA 2WDPA 1W73A 2QRHA 1PR1A 3LMKA 4ER7A 5FO1A 2HWD3 4M4SA 4OBWA 5K4GA 1JDUA 1Q17A 1N3IA 1E79D 3MPBA 3GJZA 2AIRA 3G2IA 1FVXA 4CV1A 4QOGA 4LKEA 2HDHA 3EQ2A 4AQSA 2YU2A 2Y1CA 1ONAA 4K2AA 5FLJA 2TECE 1KAOA 1CZTA 4BO3A 2O7NA 1W99A 1UXIA 3UMJA 1QG4A 4N3CA 2Q8PA 2YY6A 3KS9A 4TN7A 3LT2A 4P53A 1L5ZA 4B0OA 2KE5A 1I5PA 4M83A 1Y9DA 4WPGA 3SBDA 3T4XA 2DPMA 4KTTE 2CFCA 3KDSE 4HPKA 8OHMA 4LA3A 4E32A 2D3RA 1XDBA 1BZWA 2G83A 1PJTA 4DIKA 4Q4W1 2HFKA 2HA0A 2ADEA 5A0VA 3I9NA 4G1FA 3W1VA 3KWVA 3BE8A 2ZRDA 4QX6A 3NTLA 3A1NA 4FHFA 4UQOA 1QTIA 1GYQA 3IVMA 3PFIA 5F2OA 3F3YA 3GO4A 2TYSB 2UYYA 3FZNA 2XE7A 2VJBA 3DPSA 3PQ2A 3AESB 1RMU1 1OKKD 4FSXA 4QUAA 3FE5A 1YDHA 2DCUA 2QRJA 3QKSA 1YNAA 4LV6A 1H9BA 2RJLA 2ZXEA 4D81A 1J3QA 1Q15A 4JLMA 4MLCA 4OQ4A 5ICSA 4QDRA 1B14A 1Q95A 4GMP0 2BFUS 5ALOA 3G5LA 1S0IA 3IVXA 1RM3A 5FXVA 1QR2A 2IS2A 1W6NA 4EG4A 2WQ4A 1QV7A 3WWEA 4IE0A 3Q8WA 3RFCA 1XDDA 3U4DA 5F8PA 1TT5A 4EHDA 1H9WA 4BKRA 3LTEA 3TQTA 3QXXA 3CISA 3W5MA 7ADHA 2D97A 4Y9DA 3ABZA 4IQFA 3VBSC 5CT8A 4MPJA 4MX8A 3GD5A 4X7MA 1GT6A 3DE0X 5A2GA 2R0HA 2EKPA 1OXTA 1B8NA 4WLEA 1H30A 1Z78A 3E3LA 3GCZA 2WRAA 3AM2A 3NTXA 1UWCA 2ZZNA 4YJHB 4FWTA 7AT1A 1DL5A 1BBT3 3JSXA 2OY0A 3WNLA 2XRFA 4A0GA 4J29A 2QPOA 4ZZ0A 2ADMA 1UBMS 4EUNA 3E48A 1KHHA 1KMQA 4L11A 1UQXA 1X19A 3H1TA 3ZWCA 5KSOA 2V7VA 3IT2A 2H4ZA 2CXTA 4FJ1A 4DRRA 2EG9A 3HRIA 4C4AA 3KR1A 3UXEA 2I3BA 1IL0A 1JSRA 5EIOA 1EI9A 4XFAA 5GZEA 1W87A 3TE7A 5C71A 2DKNA 4CI0B 1A9PA 2OGTA 4DCTA 4EFNA 4RPHA 3AEQB 4L51A 1J9GA 1H5UA 5DM1A 4GMHA 4ER3A 3MAGA 5JPMB 1U1CA 5AW2A 3DBRB 2XZPA 3ET4A 3EVNA 1E3QA 3RAPR 5THQA 3AFMA 2QL7A 4TSVA 1QKQA 1HFWA 4EW3A 3D6TB 1FRVA 4PC6A 4Z82A 3UQZA 3K35A 5KDLA 3PGLA 2CVFA 1Z7S3 5ALWA 2NNLD 4S1WA 3P5SA 4NYIR 4GM4A 5HILA 4XYGA 1G21A 4KAJA 4XKJA 4AFDA 5BUVA 1Y80A 1W0NA 1NKTA 1U0TA 2OECA 4BB6A 1WETA 4FDVA 2RJ2A 1S89A 1VL5A 2YPDA 4P9NA 5JEEA 2ARAA 1WXGA 1EK2A 5HP4A 1U2QA 1F1BA 4GWMA 5ITZB 1T1IA 1U2GA 4LK2A 2VA8A 1H2BA 2HUPA 1QO0A 2CYFA 3FGOA 3BKXA 5D8AC 1DBQA 4CP0A 4F4JA 3VBSB 1F12A 3HAGA 4RKFA 3AV3A 2WFLB 3U26A 1KH3A 3ILVA 5TC4A 1R3UA 1WV0A 4R2IA 3UKOA 4OMUA 5EWLA 4B74A 2JAPA 5FYBA 2W95A 1QHFA 4HZUA 2I1LA 4QXRA 2PAEA 2V4AA 1BW9A 3MUFA 3PA6A 4ETIA 3LSYA 2Y1WA 4WOJA 1IATA 3CMMA 2PHDA 4D8MA 4ZZ8A 2DWUA 3R6WA 4IO1A 4BLTA 2C4UA 3DZCA 1FLVA 4OU4A 1HNXB 1J2YA 4CFZA 3Q8LA 2R60A 2YYAA 2BFEA 3E5XA 2ODBA 3ZXXA 1C3HA 4CG2A 4XD7D 3CX7A 1G18A 2QSZA 3LIGA 1ZVJA 2IS1A 3UYKA 2I45A 4HDMB 2W71A 1ODLA 3MLKA 1VBC2 4HS4A 2FPGB 1JA9A 2PTHA 3FNEA 2QTCA 4DIOA 2ZMLA 4QQFA 2JDNA 5H9VA 1THZA 3OFNA 3JQPA 2NTJA 4AX4A 2N42A 4QQRA 1F1JA 1X39A 3EZ9A 3NNLA 2PZ8A 4LGMA 4RXMA 4W7IA 2H4HA 4ZT7A 4MXWB 4CODB 4RVFA 2W4MA 4AQYB 3CH5A 3VDCA 2VNJA 1I9RA 4ND2A 4PYQA 2ZJZA 4QXAA 5DSZA 5B4NA 5AM3A 1MAUA 4JI5B 1DT3A 2HF2A 1UK9A 1MFPA 1Q83A 2GEKA 2H2HA 3MJCA 2FV8A 2TMKA 3WIUA 3KQVA 3T1LA 3COVA 2OMKA 1PJZA 1NVTA 3OSDA 3EGDB 4AVYA 5EHXA 5I4KA 2IU3A 4MYTA 3E5MA 4HQOA 3U81A 4JYAB 3HRHA 2WHXA 2BL4A 4G5OA 3Q41A 2NMOA 3Q2OA 4COKA 2QIOA 1SH7A 1B09A 2MDTA 5J2TF 3E58A 2ZJYA 3DF0A 2VDLB 4YP5A 4ZI7B 3JXSA 5D8AB 1RQRA 2QTLA 3E4DA 1JPNA 4CT0A 4EZHA 1EP9A 4UAJA 4IEYA 1CR7A 5KQSA 1X1SA 1MX1A 4UU8A 3T5AA 1A5TA 4I2OA 2VZOA 3ZV6A 3FR7A 5L7OA 2RHMA 1KS9A 2J3JA 3C16C 2QDNA 2PYDA 1JHDA 3IHWA 4XDYA 1C9EA 4UFKA 4Q29A 1GSLA 1XRLA 4HFMA 3ACLA 3FDFA 1Y43B 4LDAA 5NULA 3U62A 4DZRA 4BO9A 1ZH8A 4XDHA 5CVTA 2GC1A 2CDNA 4ZAFA 4QZVA 3FCXA 4K6MA 2H57A 3OY8B 3LYLA 3B1FA 2BM8A 4ZCIA 1HRV2 2HXYA 4LY3A 4UTVA 1YZGA 3U16A 1J1IA 3VPDA 3PRHA 4EQVA 4CLRB 1MQTC 1SMVA 4Y30A 2FX2A 1Q1AA 3WGIA 1IQPA 4DT1A 2UVPB 4RF5A 3RS8A 3WYAA 4JJKA 1UP7A 3UC9A 1GXSB 4AD8A 3FE2A 4GEGA 2EJBA 2PA0A 3SAJA 3JQ7A 3ZCRA 3TWIA 1XZMA 1SVLA 5BSKA 3MQFA 1G2QA 3U07A 4PQGA 5JYDA 5LQKA 3JVIA 3M9WA 1SCBA 3FBWA 3BWYA 4CDMA 5EYXA 4HKOA 3OLWA 1H69A 3B3QA 3PEYA 1XCOA 3N4MA 2BW8A 3BJZA 3L6CA 2I3ZA 1VPDA 2W1WA 2NU6B 3UUFA 2WWWA 1CQIB 1YE5A 1C0KA 2GN0A 3QEMB 3A6HA 3HN3A 3LWNA 1VIMA 3V4RA 4IG4A 5TRTA 4UOQA 3DGEC 4C78A 4MB6A 3H1AA 2PD4A 4YGCA 1ND2A 3GNSA 3OU2A 1E9BA 4WVLA 1QFJA 1G19A 2P2NA 3VFDA 2CL2A 1ZNZA 3A4MA 2HZBA 1AR81 4A8PA 2YC2C 4ZVMA 1U4SA 5H0IA 2CAVA 5K6AC 4J0GA 5JU6A 2O8CA 3NV2A 1EP2B 1XQ9A 4IDBA 4OFBA 4MH0R 2I2SA 4TTQA 5IMSA 1S0CA 1DFIA 3OICA 3CFYA 5A3UA 3EXIA 4N8EA 4Q0MA 4KWTA 5CK4A 4KOAA 2OXCA 1XG5A 3VMMA 3CS3A 3V97A 3B9QA 4OSPA 2H2GA 2HIGA 3RNOA 3E23A 1DX9A 5D3ZA 2AR7A 2XZDA 1H4VB 4KE9A 2WQZA 1PT6A 1HA3A 4AMVA 1BD4A 2ZBVA 4C1XA 3U11A 1VPTA 3X2FA 4DR3B 2CUNA 2QY9A 1ESNA 3VNBA 1MQTB 3K09A 3COZA 4E70A 1USWA 3Q7QA 1TK9A 2QQVA 4P84A 3BICA 1KQ3A 3AMMA 3E5QA 2Q8OA 1DARA 1RFLA 5I4CA 3HFJA 1GPH1 4DDHA 2OSBA 4DN6A 4QXPA 4NHOA 2OFXA 3IAFA 1VIDA 4Y2HA 4D9HA 1L5OA 3GLHA 3SJZA 5IJ0A 1DXHA 1NP7A 3T5TA 2C24A 2IS6A 4QUJA 2K46A 4YROA 1AR92 2B4KA 4ZXPA 4RKQA 4C88A 1SVUA 3EGEA 1VXRA 1VBB2 4ZQHA 2PLV3 3PTZA 2P2YA 2XQKA 5LBBA 3TEYA 2Z2XA 3I5MA 1XAGA 2PVCA 3ZCSA 3T4EA 2BBTA 1ETUA 1FRQA 4FX5A 1GDTA 3MRTA 1OBNA 3O26A 3MK31 1ZIXA 2E82A 2I8LA 1L5GB 3UGJA 1QMPA 5KWJA 1VCMA 4MR9B 4D94A 4LJ6A 4MVJI 1FMD3 2C9MA 3R5KA 4XA8A 3DDSA 4ACAA 1Z2OX 1GP6A 2OGZA 1HT1E 4REQA 4A0RA 1O03A 2CCGA 3T9CA 3L05A 3A1UA 1DTWB 4O4JB 1ULCA 1Y3TA 5ISLA 1O4ZA 1KDRA 3NUGA 2W68A 1XZGA 3T2OA 1XQWA 2B1IA 3JQAA 4LVCA 3PR1A 2GMWA 3ZWVA 5FUPA 1IN8A 3LY5A 1U65A 3RZLA 1EKXA 4ZCTA 1JR3A 1MS0A 3SSNA 1G64A 4NY1A 4KQHA 2WJWA 3RC7A 3MNFA 1YJ5A 4FOYA 1R3DA 1QO0D 2AHRA 2V6BA 3B1YA 2I74A 2UYAA 3HQXA 1PL8A 2XB8A 4GVXA 1NVVR 4DA0A 1MZ6A 1QIQA 4WCFA 1MVEA 4Y26A 2W46A 4CFSA 3WT3A 2E4ZA 3GJ8A 5I7HA 2AF4C 4GB32 3C6QA 1PZ7A 1NPYA 1MTOA 4UAUA 1U2EA 1YHZA 5KQGA 4HVLA 4WT7A 2WSIA 2N7GA 1KY2A 3GW8A 1B76A 4HDRB 4M98A 4JUDX 4J4HA 3GCXA 2PLAA 2OBFA 4UWDA 1W59A 2H9YA 2NSYA 4ZOLF 1E1RA 2OBMA 2B69A 2IY7A 2ZGMA 3NMBA 5TF4A 3N2NA 3JVEA 2W91A 2VNOA 1KXGA 3BB6A 1G0NA 2JVIA 1BWQA 1G20A 2WE7A 4QB6A 4DXDA 4S2HA 2CNDA 4RS5B 3MS4A 3TIXB 1UDWA 2WIGA 3GJXC 2JCSA 1GWNA 4D9GA 2PWZA 3N9NA 5KHLB 1AKQA 1RYZA 1FFYA 4RIIA 1ONNA 1CY6A 5I9MA 3WGNA 4DUVA 1DQPA 4DHWA 3OFND 2XLGA 2RH9B 4QQLA 1T0IA 1GL9B 5JLAA 5FQ0A 1XNBA 1BHGA 2JZOA 2Y4NA 3LDRA 3IAM6 1W9TA 1ORRA 1X8XA 2RI0A 2E2WA 1T2VA 3N9MA 1S2BA 5JCXA 2FNAA 1JYFA 1PR6A 1T2EA 1Y1TA 2ZIGA 2ZIXA 3WW1A 3P0JA 3PNAA 2OXRA 4F6RB 1VLQA 3HB7A 1FFCA 2VNRA 5TV2A 2K7ZA 1Z6PA 5LYYA 3V0BA 2R062 1OHHA 4MRPA 5C1DA 1D2RA 1SQ4A 3D31A 3ORSA 4JLOA 4PFJA 4G25A 1KF0A 1TT5B 2GJ9A 1UU5A 4WADA 4OHFA 1STMA 2AN9A 5FO8B 4H7JA 5HZMA 3GJBA 2XMBA 3A1SA 2HNBA 4JUFA 3SC7X 4DF3A 2VZSA 3ADCA 4AJ9A 3W79A 1SU6A 4HUQA 4MDYA 1BCSB 1EUYA 2F62A 3R7NA 2HJWA 2AKAB 4JT4A 5AJUA 1UOEA 5AKGA 5FPLA 1B1CA 3E1GA 5LBTA 2DCKA 4H60A 2FQPA 5CBPA 1WXEA 4MV3A 3UKJA 3PQ3A 1CE8A 2QLNA 4OFWA 2B7BA 5IDXA 1U5ZA 5BSGA 4TMKA 3W5NA 2WICA 1JJVA 4FHCA 3IUMA 3QBTA 1RMQA 5ENZA 2CHVA 4MP8A 5BUCA 1JUIA 3ETPA 1T35A 1T4GA 3CZJA 2FLVA 4PCRA 2OQ7A 4C7BA 4MPDA 4RTPA 3OUZA 3N2EA 1K0FA 1Q0UA 4QRIA 3RSHA 5DTIA 2OESA 2WZEA 2EZ8A 5JJKA 1WPQA 5KOJA 3EFEA 2BZGA 2O7QA 2Z43A 3EVZA 5FH9A 1R0RE 1BYHA 4ZU4A 3NO4A 3B1ZA 1U7XA 4Q4HA 3BZWA 4ZYWA 2CNLA 1QAOA 1G21B 3P6BA 4PX5A 1EZ4A 4ISBA 1MW9X 1ZP6A 3BTVA 3NNNA 4WRRA 4MKHA 7MDHA 5F4BA 2VHQA 1P4GA 5HCAA 1CZLA 1ZQ1A 3L7DA 3AUAA 3BERA 2DULA 5FXZA 2O1EA 1KVQA 2X4LA 1IJFA 1VKJA 3A4IA 1JG3A 1UP6A 2UV8A 4RH1A 2O2EA 4CETA 1W7AA 1XN4A 3CINA 1ZUD1 1TK3A 3X1KA 4KDEA 2MSNA 2R2GA 2AFHA 4WECA 1I13A 4P8RA 3P52A 2RM22 4FZ3A 1L1EA 2ZANA 3ZE8A 2I6FA 2C4NA 5HZKA 3I49A 2R6CA 3WP3A 1L1FA 3IOMA 4W6WA 1JQDA 2WFZA 4GOOD 2QTTA 3GEHA 3O83A 3TM4A 2O8QA 1BW9B 3ZXYA 2FMKA 4KJXA 2YWJA 5LATA 5L7OC 3P9XA 1YQEA 1Q21A 2A94A 4MGYE 4B4PA 3QA9A 4FW9A 5DBGA 4Q4CA 2VMFA 4B3DA 1GZVA 4YUXA 3EYWA 5BN5A 1ZXBA 3WSTA 1HB4A 4GKBA 3PX7A 4XUOA 1FSGA 2BFEB 1YVDA 4E3ZA 5JISA 4EE2A 2XLAA 1QMGA 1VE0A 3A9VA 4EVQA 3OTIA 2Q9BA 5BYJA 1HEIA 3TFOA 2VNAA 2AV6A 5CLFA 1UPBA 2DVDA 4MS3B 2QDRA 4CUCA 3A6PC 5FWDA 4QRDA 4TTTS 1KNXA 3DUIA 2WOOA 1S1AA 1GQRA 2EJUA 1QIIA 3OJBA 2RM21 4KI5M 4RD3A 3ZI4A 2QQ0A 1S2GA 1XEFA 3GBFA 3S6JA 1YQ2A 5CRIA 3FUWA 3S27A 7REQA 1GILA 3T95A 5BV6A 1H9PA 2ZTSA 4UBLA 2P1BA 3MCTA 3FETA 3GFTA 5FBKA 2G1JA 5SV8A 2ZJBA 5DM60 5C8CA 1Y4DE 4H16A 3OETA 1NBME 1Y34E 4O4IA 1SCAA 1RHI3 2JFQA 4ZONA 3TM5A 4DMUB 3FMFA 2J3QA 2I62A 1KFJB 3CPEA 1YRYE 1HQLA 4M76B 5DT2A 4UBGA 1Z5NA 2GPTA 4ARZA 4C21A 4TWAA 4QPWA 1Z28A 4JBGA 1C57A 4DCPA 3ABIA 3RJ9A 2H2DA 4RE5A 1QJY3 4K0RA 3WZ1A 3VJLA 2JB9A 3I2GA 4B8EA 1JAZA 3RS3A 2JGJA 4H9GA 4MSVA 4MVJG 4HONA 1KKUA 1XZCA 4L95C 3TYJA 1A8IA 4MHRA 2XNSA 5L3QA 4V1PA 2JPDA 4N9IA 2ZBGA 3WGVA 4B6GA 4ZK6A 5JHGB 3G59A 4RK4A 1ONBA 1ITZA 4TX1A 3VSDA 1CEYA 1ND2C 3PGKA 1T4DA 1YFYA 1VQ1A 4NF2A 3K7EA 1QCZA 2GZ2A 3TKAA 2O8FA 4A7KA 5U1PA 1XZDA 2CN1A 3IEIA 3L4SO 1DFQA 3VSBA 3DFKA 1YBHA 4X97A 5LC1A 3KSUA 2VZ1A 3ZUGA 3JQAD 3AY3A 4A23A 1IZZA 2VJYA 1TIKA 4DMKA 3KB2A 1JR3D 3VBRC 4BO5A 4RH0A 2EP5A 5PNTA 3N0TA 2ZBDA 3BDVA 2B0CA 3ZG6A 2XKAA 2JGRA 3OZBA 4CMAA 4FPFA 3H5IA 3EGWA 4JTOA 4ZS3A 1A9OA 1W8IA 3ZI7A 1RUOA 4IEZA 4EDHA 1AR61 1UIKA 2CFTA 4LULA 4C4OA 4QQHA 1PFWA 2WQZC 4FHGA 1DS6A 5EPOA 3K9WA 4YY3B 2O0HA 4CPDA 1RW4A 4OK3A 3SMHA 4DVGA 2CZQA 4CDQA 2XKKA 3PVOA 3K09C 1I5RA 1LVGA 2YIMA 4D6SA 2UWBA 4IHAA 3QNUA 1IN5A 5JCZA 2PQ0A 1WCYA 3T1HB 4DT1B 2IHYA 1EK1A 2GCIA 1RXVA 1XKXA 1E1RD 1Q7BA 4RD4A 2SCUA 1GR3A 2LBPA 3JQ7B 2D54A 3W5CA 2ISSD 2EP7A 3T0AA 3KV9A 1XKQA 5J09A 4NPAA 5CKMA 5HKOA 1EVIA 1POV1 1FFWA 4QSHA 5K09A 2F43A 2P3OA 2D06A 3EN0A 4QKNA 2WZR3 2VXRA 4K9RA 1ZCZA 4YSFA 2ZIZA 1QGDA 1VA4A 3VN4A 3WLAA 1QQP2 4YAIA 2ZU6A 4LHYA 2YWXA 1RR6A 4O33A 5A5DA 2D1QA 2MMCA 3QVMA 1R9MA 1XEWY 1ENXA 4NN0A 4U8GA 4TLLB 2GKSA 4QXKA 4M53A 3TLMA 5KVCA 5FYCA 2ENWA 4HD8A 4FU0A 1E3MA 3CNAA 5CM8B 2LKDA 4YGYA 5HDBB 1PX3A 3UJAA 1UKRA 3MMZA 3UYJA 5DEIA 2O8CB 5COQA 1LW7A 3KV3O 3U7QA 4NE9A 4QU1A 2Q4BA 3AKTA 2EVWX 4B80A 1W8WA 3QEKA 4IRMA 2MINB 2QP3A 2ZRGA 3U61B 4K6KA 4X90A 4XYXA 2YV4A 3U0BA 3I9LA 2BP7A 4OTZA 3EXIB 4P83A 1GFZA 3AJZA 4QGMA 2B21A 1TDJA 4WCFC 5IAJA 2X3FA 5FD8A 1YVUA 3ORJA 2XECA 2IDZA 3AUSA 5ADHA 2YBDA 4RKRA 3UNPA 2PAKA 1RJ8A 2ODAA 3GEDA 3QLJA 5JY1A 2OG1A 1Z6QA 1RC6A 3H2IA 1FFSA 2EX1A 3WEZA 5AFBA 1HE2A 5EHDA 1IWOA 5LNK1 4TQGA 1TC2A 1V6CA 2PBLA 5HS4A 1QVVA 3WC4A 3CXUA 2VJXA 4TS4A 2BVVA 2Z9DA 1SOAA 2PL1A 4OJTA 1NQDA 1MB0A 4BVAA 1DEXA 4B85A 3AGQA 3KKEA 4CKCA 1SKBA 1OFGA 1BKDR 3IP6A 3D6FA 5AI8A 2C83A 3GLHB 3RF7A 4NBUA 5H8WA 5KYUA 1OH5A 1PQPA 2PKWA 1V70A 4LJ5A 4BXFA 1WUYA 4DR2B 4KH9A 3ZQJA 1VC2A 4IKPA 4A6XA 2BGOA 3U6KA 1GAQA 5IVPA 3AMHA 4FTSA 4PPNA 1BXGA 4P9WA 1PBNA 4AVAA 3LVFO 5AVXA 3ZNPA 3CUKA 1MO4A 2O2YA 2EGHA 5AW3A 3Q85A 3CT6A 2H2FA 4GR5A 2UUOA 4F2DA 3F5QA 4X1OA 4CCOA 5DMXA 3AVQA 1LR5A 2AG0A 3IL2A 3FCUB 3V1LA 1EGQA 1H4GA 3RKUA 1W90A 1DQNA 1ESMA 3JD3A 3JQAB 2WSBA 2WD9A 3B7GA 3ZXFA 5BQ3A 4WE3A 1QYVA 5DUVA 2BKAA 1QHDA 1GZ7A 4J07A 5J4YA 5FV4A 4ANFA 3WP4A 5K4AA 1OIVA 2OCAA 4BWYA 3DF7A 4GM0A 2P9GA 5FL7A 3WLRA 4M89A 1KRWA 4WCFB 3ABQB 2AJDA 3O47A 2HLDA 5CFQA 3O1UA 2QVYX 3F3KA 4K6OA 2P0EA 4HXGA 5IDWA 1NX6A 1ZBE1 2YZ2A 1O6UA 1Z45A 1NZJA 3WAGA 1D2SA 4N8SA 5E9QA 3BREA 3ONVA 1JI3A 4KPFC 2BEJA 3JQ6A 1KEWA 2I78A 2P77A 3WY9A 4YRTA 1Z68A 2DWPA 5CG9A 4CUKA 4KVFA 1YS2X 3OUUA 1CUEA 3LF1A 3FYDA 2I99A 4NHXA 3U1XA 1Y9JA 4UZSA 4FSJA 4MZXA 1KMNA 5KS2A 3WL5A 1QIHA 4MRNA 4NBLA 3JD2A 3REOA 3E3NA 3AU8A 2WZBA 1E4EB 1E7SA 1QMJA 1G20B 1AKMA 2BEOA 1ORHA 4U63A 1J56A 3ND9A 2KSQA 1X13A 3TPCA 3EGIA 3P4XA 3FDIA 2ZRJA 3ER9A 3ZDBA 3RU7A 4W1SA 1NLMA 1GGEA 1RL3A 3GLGA 1RUC3 1XD8A 4ERNA 3LRPA 3WLHA 4CIBA 2GPWA 5AVYA 3ROGA 1RWBA 2Z1NA 3BM5A 2ZR8A 1M5TA 4MVWA 3POIA 4EV0A 5FUQA 4NZPA 5JCJA 2FVXA 4LXIA 4ZGGA 5K0GA 5BV7A 3HCOA 5T3NA 3ZHRA 1OC4A 3KV1A 2H08A 4ZA2A 4MGSA 1CAUA 2EFCB 2ZIXB 1TRHA 3CIFA 3EBPA 1EWVA 1E4OA 2F1KA 1L1RA 1RUE3 4FPJA 4CF4A 1A7JA 6YASA 4PLMA 3WB2A 4HPXB 1R16A 3HACA 4ND6A 4NCKA 2D7CA 5AXAA 4D4MA 5H3CA 4ZT2A 3FKSA 1P9WA 4KDRA 1BWRA 3A0NA 3F49S 2W0MA 4HZIA 4KV7A 3WR5A 1UDRA 1HQDA 4HAVA 1E3TA 2W47A 1FSPA 4M0HA 1TUEA 1FYXA 3EE6A 3I8SA 1IQRA 3E1KA 1RAFA 1YOBA 1J5XA 1KJNA 4JQCA 4LYDA 3K2BA 2DCMA 1LTHR 5LU8A 1V6SA 1CD3G 2AWNA 2DWRA 3I7DA 4MUYA 1TMGE 1EVLA 4XWAA 3MD9A 4R0VA 1N8KA 3MIDA 4XFFA 1UY3A 4Q3DA 5JJ5A 2NP6A 2VXOA 4RGYA 5CYGA 4I1IA 2B82A 5CBPB 2IX3A 4OJKA 3SNMA 1KHTA 4RL4A 1J58A 3T15A 1BEUB 4E4TA 1CE8B 1HE8B 4BLOA 3G2HA 2QQGA 1MJGM 1G9FA 2O0LA 1JIUA 1KPGA 5BQXA 2WT0A 2YJZA 3MUOA 4MA5A 2ZIEA 4I55A 1NASA 1SPXA 3PHCA 1T0PA 4URZR 4YHBA 5CYPA 3Q15C 2CMDA 1RGSA 2XUGA 4E15A 4DMCA 3QENA 3OPQA 5FI5A 2C4MA 2N1BA 2QG4A 5AW4A 2IHNA 2FPLA 3NM5A 3V7NA 4O63O 3MLBA 3HO1A 2AN5A 3RPEA 5LQUA 4A4DA 5AO9A 3EVBA 4WOKA 2FMTA 5FEUA 1G8SA 1RLUA 3AHGA 5A3TA 2ZB7A 4YNBA 1EE9A 1NLZA 5KOJB 5I7RA 5BT9A 3QF4A 1JWLA 1ESCA 3DP7A 4L8GA 2JHAA 5C8CC 3ELDA 4KGXA 5EP3A 3ZFFB 1RKBA 4QWMA 1WZUA 2ZVQX 2QLMA 1OXCA 2HWXA 2P2GA 4KFCA 4BLIA 5C33A 4KC0A 3VV2A 1NDHA 5K9ZA 4NUBA 5IK2D 3CZMA 4Q9IA 4NS1A 1SIUA 3MPOA 5IM4F 4W50A 2AG8A 4FCTA 5IVHA 5GLZA 1PIV1 3AQ4A 4HSEA 1FJHA 1BGXT 1NJ8A 4JQSA 3GA7A 5DFAA 1U4NA 4GLFA 1YZVA 1FMJA 6ADHA 4D4HA 3E8XA 3D7NA 2ZE6A 1ESEA 5TR9A 3U0ZA 3MZHA 4MUKA 1SXQA 5IAEA 3TN92 4AQTA 1CEEA 4Y2VA 1QIJA 3MA0A 1W4ZA 3RIHA 5DI9A 5C8YB 3CBQA 1ZN2A 2FUKA 2AFHB 4I8IA 1O58A 4HN1A 4PV7A 1T2CA 1P2SA 3IMMA 2VQ6A 4Q3AA 1NHWA 3LU1A 1ZUNA 3GJTA 4GMKA 1L5KA 1MVOA 4KO8A 1DX4A 3PITA 1G5HA 4OBEA 3TR6A 5HCUA 4QKBA 1KKMA 5KWVA 3JVDA 4PEVA 2V58A 2C4HA 3AZOA 1RXGA 2JFWA 5IHRA 2NPIA 1OA3A 1OKOA 1R4AA 4G0UA 4WKPA 4LXXA 1OI3A 4LDJA 3ZV5A 4HNAB 3SZ3A 3ZLUA 5KC8A 5EIYB 4FYHA 1UJ6A 5ADVA 2NU9A 3F2ZA 1K6IA 5BN5B 1PW5A 1NWHA 3O1LA 4LQLA 2WJZB 4B4VA 1IHUA 1XNRB 1GD1O 1Z56C 3O92A 2FWNA 1JI0A 4BZZA 3BEDA 4OFGA 4GP7A 2ID4A 5L19A 4OXNA 2QMOA 1MMFB 3CPSA 1IQDC 4FD3A 3L4KA 3T3EA 2MOKA 4H3HB 5LZ5A 1NQUA 1AQLA 5K05A 3CE9A 721PA 3HDYA 4AJOA 3EO6A 3SQNA 3EMVA 2XMRA 1GA4A 4CDQC 1FQWA 3TAXA 2H51A 4BNJA 1QIDA 1Q14A 3RHSA 2AUNA 4JCOA 3K3NA 4O9GA 1HDGO 2Q4SA 3HY4A 2ATCA 3S2YA 4ZT4A 3DOEA 4FZVA 1JPJA 2DFPA 4YJ2F 1U1FA 1GP4A 1RUG1 2R041 1RUI3 3MHPA 2XQFA 4LZPA 1N78A 3AHCA 4QL3A 2XUQA 1S1CA 4X61A 3AP2A 3UJ9A 4GBJA 3O4FA 6Q21A 3HDHA 3IMEA 2BI4A 4CN8A 1W8NA 8AT1A 1BDHA 1NYRA 1YMQA 5EFUA 3KV5A 3LUJA 4Q1CA 5D01A 2VZUA 2VJPA 1VKNA 3WNNA 3WYFA 2CBZA 1A8SA 3CRW1 1X2BA 1EBBA 2CBGA 2EKBA 1O77A 1H0RA 3L9WA 5GTDA 3A58B 2RHOA 5DRYA 4DL9A 5L3QB 1UPIA 3KQYA 2J1VA 3PXCX 3CRNA 5AUQA 3VO8A 2W4QA 3DEJA 4HB2A 1GSHA 2EQBA 3AYXB 3IE1A 2QN8A 1HUQA 2AUYA 3K2OA 4LF8B 5FYHA 1S0JA 2YV5A 3ZH2A 1LLDA 3AY7A 1HJGA 3AF6A 1KU6A 3AV0B 1GAWA 1V1RA 1E18A 4PICA 4D0SA 1R4MA 3BGDA 1RTTA 2OFOA 1K88A 1HB2A 3KHUA 4LO4B 1V00A 1UJCA 4I9UA 2C2MA 2QMHA 2NPFA 1OX6A 3TCKA 1M0TA 4Y4RA 1CR6A 1WVMA 2OHVA 1F0KA 1GPLA 1HKDA 1KZ9A 2DEUA 3TB4A 2PHLA 1R1A1 5EI5A 2CXNA 5FL7D 4F4IA 3HXKA 1Z37A 3G9UA 3TEXA 1IAQA 3OQIA 3SYLA 1LOBA 3WGOA 3SSAA 2R3SA 2HLDD 3OUHA 5LA2A 4CL0A 4G41A 3AW8A 4O2RA 1KDPA 4HQ6A 1GTRA 4DLWA 1MDFA 2FCUA 3EPHA 4F1WA 1U8UA 3F96A 4GI3A 4U2EA 1THTA 3DYVA 4A6OA 4CDQB 3FAKA 3U4CA 3SZLA 4BV3A 3JWEA 4YFZA 1D4M1 2C9KA 1MOSA 4PZZA 3ACFA 5FP4A 2VZLA 1YI8A 3ZKUA 4H1WA 4R1QA 3EA4A 2SCUB 4ETMA 2JG8C 4KQ7A 4BIMA 1OC1A 4XVCA 2XLCA 2EBHX 4AOCA 4JAAA 4V1CA 2V4ZA 3MJVA 5LBCA 1QE3A 1I01A 3A0RB 1EX7A 5HXMA 2AMVA 3VBFB 4BYMA 3QW4B 5D1HA 2XODA 2JNWA 1VIVA 1I51A 4B4WA 2QLFA 3K70C 1ORVA 3GLKA 2DHDA 2RMU3 4UU0A 1W49A 1FSZA 4Z4FA 4GXNA 1I5ZA 4FLMA 1CAVB 3WB1A 1BE8A 2R5WA 3WGKA 5JCJD 3PJYA