4K7JA

Peptidoglycan o-acetylesterase in action, 5 min
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
350
structure length
350
Chain Sequence
GLLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
molecule tags Hydrolase
source organism Neisseria meningitidis
total genus 125
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k7jA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k7jA01
2O14A 1Z8HA 4DEVA 3DT8A 4H08A 2VPTA 4HF7A 1IVNA 1VYHA 4K7JA 4IYJA 1K7CA 4JJ4A 1FXWF 4Q9AA 2Q0QA 1ESCA 1ZMBA 3DCIA 4RSHA 4K9SA 1J00A 2WAOA 4TX1A 5JD3A 4JGGA 3RJTA 1BWQA 2Q0SA 4JKOA 1DEOA 3PT5A 1ESDA 4OAOA 5CD9A 1BWPA 3DC7A 4M8KA 3C1UA 3BZWA 4XVHA 4JJ6A 5B5SA 3HP4A 4JHLA 3SLRA 4NRDA 4K40A 1ES9A 2APJA 1BWRA 5A4AA 1FXWA 3U37A 3P94A 3KVNA 1WABA 2W9XA 1VJGA 4HYQA 4K3UA 3DT6A 1U8UA 4Q7QA 3DT9A 2WABA 5HOEA 4I8IA 4LHSA 4S1PA 3SKVA 1ESEA 3MILA 2WAAA 4RW0A 4OAPA 4PPYA 2HSJA 1PP4A 1DEXA 1JRLA 1V2GA 1YZFA 5BN1A 3W7VA
chains in the Genus database with same CATH superfamily
4DLSA 2B1QA 3LC7O 3KT8A 2VGDA 3PC4A 2CXSA 2GXQA 4MYSA 1W59A 4BNNA 1X92A 3GDFA 5ER9A 3EW7A 3VX3A 2YOGA 1OIWA 1MJGM 2J6CA 2QTVA 4HB3A 3AEKA 3TAYA 4J7AA 2JRCA 2CN1A 4KIFA 4XDZA 2C3PA 4U2BA 2O2XA 3WMRA 2O2HA 1M1ZA 5FLIA 2YDYA 4RORA 4R01A 2NZJA 2W83A 1E99A 4ZDJA 1E3MA 2G1UA 4PIYA 4CLEA 3MCWA 7MDHA 1MDBA 4BIIA 2WWGA 4AKTA 3OZEA 5JQGF 1A71A 4C1WA 1ONAA 2GF0A 3L7AA 1JU9A 1KIMA 4O4LA 1L7QA 2GN8A 5CFOA 4RGAA 4A26A 1SVMA 2PBLA 3L5KA 2QRNA 2XUEA 1JQ5A 1WU8A 4CXWA 4H7DA 2W00A 1H2WA 3GJAA 1G3MA 4YG6A 2Y64A 4KGZA 3P9CA 2XPJA 4CF5A 4UE3S 3V8NA 4H7PA 2XB6C 4EA6A 3EX7C 2XMRA 1IOLA 5KQSA 5TY0A 2V5VA 5K3AA 3RS4A 1GPMA 3R6DA 1S8NA 3UMRA 2OZ6A 5BSRA 1WXHA 2UUCB 1A04A 1RUOA 1KMHB 3GH3A 1SK9A 1KI9A 2P2SA 4V1CB 3IBTA 1QRUA 2EFGA 4NJEB 3SOPA 3NATA 3X2SA 2ZYRA 5IKXA 1TA9A 3HFJA 4EO4A 1VHLA 4BXOB 5E95A 4I08A 4YRAA 1ODJA 2JXAA 4HS9A 2FU5C 1QX4A 5BW8A 4MIEA 1FUKA 4F12A 5CA0A 3SZLA 1U2PA 2C2GA 3IP9A 4IO1A 2PHRA 5HCUA 4K46A 1R083 3CLUD 4PF5A 4J1NA 5CITA 1KH2A 3OX3A 4IV1B 3TDMA 4GMP1 3BXZA 1C29B 1L5FA 2I8LA 3QNWA 4MADA 1V7PC 1OI6A 2AG1A 3QTLA 3NJXA 3PWZA 3ZO0B 2WP8J 3LT1A 3HYLA 3PNBA 4FX5A 1W6PA 5I6DA 3ZW9A 1H0HA 5DX8A 4XYLA 1W8ZA 3KLOA 1TEZA 4DZZA 3JQ9A 5FV4A 1NUTA 1O0SA 4UVHA 3MJRA 1GIAA 3WLIA 3BSSA 5C8ZA 1B8UA 1UXZA 4HZGA 4FFBA 1OREA 1ZH4A 1FYVA 4JLNA 2QN1A 1QKIA 4NC9A 2IXTA 2CV0A 4IOLA 5FP8A 2AOTB 4BVJA 5FFNA 5IAXA 1PJLA 1K27A 1U98A 5CFCB 2PS1A 5FLXA 1AYN2 1AKTA 3OOWA 3H5VA 2WT2A 3QPCA 3I01M 2Q1UA 5LJLA 5LIRA 1SHLA 4F3JA 3TECE 3BFKA 3G88A 1GQ2A 2EFEB 3L4BA 4BNFA 1CZVA 3LBNA 1W2AX 2OXFA 1WKYA 4FJ2A 3NNMA 5DNWA 3SMVA 1R37A 3K46A 4HAWA 1O3QA 3ILHA 2HMVA 1FOD2 1QGYA 4UEKA 3C16C 2NZ8A 4BLQA 1D2MA 1MO6A 4MOWA 3AKZA 3TRIA 3L8CA 1JHXA 2XBUA 2MPFA 5KMGA 1L7LA 2GLTA 1N9GA 2BFUL 4E5UA 5JY1A 3O7WA 1NXXA 1YS9A 1SKBA 1U2TA 3ZU2A 5HIAA 1TQDA 1LX7A 3VKOA 4R1PA 1WDWB 3KB2A 2NSYA 4WGFA 2BEWA 3FKSA 2M6LA 2WTMA 3U7EB 5IAAA 3V65A 4A2UA 5AH0A 2N1MA 4S04A 4KR7A 4EZHA 4R2XA 4GDFA 4BQNA 3IEVA 5IT9A 3QHPA 4UUMA 2OZEA 4KW7A 4UEWA 4W5OA 2B83A 1M1YE 2FWPA 2PJDA 3D6UA 1NBAA 3OB8A 5IJ9A 4AQ2A 5A0TA 4PX9A 3LVFO 4HDKA 2J7KA 2LTAA 1OLXB 1ZNPA 1Q0HA 3TZHA 6REQA 1UZ0A 2Q3DA 4BO0A 4MQEA 1G5IA 3D5QA 3UVEA 3AEZA 3BDAA 1XMSA 2AUNA 3E22A 1WDTA 4WOKA 2CXHA 4UOQA 2JLAA 1FV3A 2MNGA 4LYAA 3GA0A 1PFUA 3E5XA 2B0JA 4EJSA 3VBHC 1JKIA 2AGVA 4DLAA 3G5MA 3EK2A 1EJ6A 4AB1A 1PV2A 3K9FC 1QJX1 4M98A 3KQOA 2E82A 4ETNA 4ES8A 5DI3A 3ECSA 4PPQA 3I34X 3B89A 5E6SB 1H30A 4AW7A 2BBAA 2UWCA 1YFUA 2HJVA 1F3LA 2J9ZB 4CEYA 4AT1A 1K63A 3W2TA 2WIKA 2XTNA 4RIFA 3LQFA 4L99A 3O91A 4RK1A 1AKWA 1UPBA 5FLHA 2H0QA 2ZGNA 3D4KA 5A2QA 1PX3A 4EPXA 5BOVA 2H18A 5B7GA 2MSEB 5A5VA 3N5KA 2O1XA 5A3JA 2VPZA 3LD9A 3WYAA 3EFOB 4LZOA 1UY0A 3I4IA 3E6AA 3OE4A 4FMCF 4PPYA 2BHRA 2Y1WA 1I0ZA 5GZ3A 1WXFA 1Q0SA 1T9KA 2EWVA 4LZLA 4AJ1A 1SBQA 4CU7A 4L51A 3GRZA 3LUHA 5EJ9A 4O29A 5ANQA 5LFAA 2NACA 3N3AC 2LR0A 1U1IA 1NT0A 3VISA 1ZICA 3FNIA 3IKLA 1DAOA 3FX3A 3CO2A 3COPA 1W8UA 3BE5A 2ERYA 3WLOA 1ZN2A 1E3DA 3RHSA 5FRAA 3UIEA 4MS1B 3KWLA 4MKRA 4UUQA 4A8JA 4CBVA 1ZGBA 2VO1A 4QL3A 2I91A 1ZNXA 1XRRA 5AJYA 3F47A 3GOHA 4IGPA 4R1LA 1S2DA 3AOGA 3Q1KA 4F84A 2F3PA 3NJ8A 4ZYUA 1E5QA 4XAQA 2NV2B 3LDHA 1YL7A 3C6MA 3K2IA 1YIAA 3A4VA 2QDNA 4N5DA 1VMEA 1U0RA 2FUEA 3HAGA 1KZGB 4QUBA 4DCPA 1P0IA 2NU9A 2C83A 2RGRA 3C4VA 4CIYA 4LZAA 1QJU2 1JJBA 1O4TA 4NHXA 1R18A 3L6BA 2HMYB 2D5IA 1QE5A 3WYFA 2B9VA 4MJ7A 5L45A 4DY3A 2VWQA 1SXJA 3NVCA 1UKEA 2HWWA 1EXWA 1PU2A 1WD5A 3W8EA 1V4BA 3F90A 4WKGA 4F3CA 3VPHA 2BEUA 3I49A 1OQDA 3NG1A 4XFDA 4N9QA 4RY9A 4QKDA 4Q4AA 5C9ZA 1II8A 1KQPA 4ORFA 2O8CA 1UZZA 2J31A 3SFZA 2Z5LA 2XLCA 1SBYA 3ACCA 4B1LA 2NO4A 2GHQA 2DUPA 1LSUA 4CZSA 1V39A 5DTMA 1BZWA 4Y3UA 5FAXA 5JH7A 4IDZA 1ZC4A 3DE5X 2PGDA 2FF5A 1SVLA 5L6MB 2WO2A 2H0RA 1X74A 2VAWA 5A7GA 2ONZA 1PEYA 2YS6A 3OU7A 3ECAA 1E1RD 1FP4B 2HRBA 4BYYA 4RHUA 1VSUA 2ZS6B 1XZNA 1HI9A 1IUKA 4G37A 4XVRA 4FKZA 1GV9A 4XFHA 3PVBB 5K05A 3A10A 1MQSA 3V1YA 4NMMA 1HN0A 3WTCA 3NI2A 3I9V6 1GUZA 3KTDA 4JD5A 4F5WA 3G7SA 2E4UA 3CH6A 4YM3A 2QU7A 1ULDA 2VNVA 1N5DA 4OHVA 1HXS2 4BNDB 3OGRA 2DPMA 4M3CB 5EZQA 1HTTA 2HQ1A 4PBOA 1FTNA 1WPGA 5CNMA 3BKXA 4KQMA 5CVTA 3BJMA 4QDOA 3LCPA 2BVNA 4N53B 4BCBA 5C52B 1ULHA 2IFWA 1NE4A 3PC8C 3V33A 1WBFA 1QH8B 4MVJH 4C0SA 5CXXA 5KS2A 2Q0XA 1OX4A 3LP5A 3K0KA 4RM2A 3ZYFA 2YYZA 5REQB 3RKSA 3CE9A 1GKIA 4CG1A 4WEQA 3SCZA 1GGMA 1DU3D 4PAWA 1FJHA 1J3RA 1XE0A 3ELWA 2AW3A 3DV8A 3NOOA 4Z7JA 1CJTC 1RU3A 3B82A 2REBA 4XC9A 1VPLA 1G6Q1 4GS5A 1E3IA 3T2PA 4MX8A 3THCA 1O89A 4XIIA 2QROA 4GR9A 2AUYA 2PANA 3K1AB 1E7MA 3GOQA 2JIOA 1AT1A 2TYSB 4D4IA 2VPIA 2J3MA 5C81A 5KNBH 2I6FA 4J1TC 4UFJA 4DV2B 5AI4A 4K0RA 1F8GA 2XT0A 1JZ6A 3NBUA 3OCJA 2GAOA 1J5PA 3WF1A 4HLCA 4DY4A 3U3JA 5H0IA 1JDSA 4HB4A 4L07A 4LJ9A 3CWCA 2CE2X 4D8UA 1OPMA 1I3LA 5C0OE 4H2AA 1XVIA 3KQLA 1LDBA 3PLRA 1A96A 5A7SA 1VJCA 1T25A 3UXYA 2X6QA 4K8RB 1MJGA 4KNWA 4PXAA 1AJOA 1OE0A 2Y2VA 2FEPA 1JHYA 1VI5A 4PQFA 1FFBA 2RDSA 4B1FA 4EITA 4I8IA 1RRKA 2FDXA 2O0LA 3H9JA 2C8LA 4EG6A 3ROUA 1NE6A 1OZGA 5G53C 3VGPA 4JJIA 4B7XA 1U0FA 3VB9A 3VI3B 3HA2A 2P9ZA 5FCCA 4ND8A 4HWSA 1RZUA 1R1A3 1FS5A 3RRXA 2HJRA 4FZVA 2E31A 1FI2A 4N8DA 1DRVA 5FPTA 4KZKA 3BIEA 1WF6A 4W50A 4ESEA 3RQ0A 1BE1A 4FI9A 1F2UA 1TJ4A 3B70A 1NUAA 1DUVG 2P77A 1A77A 3OPXA 1P9RA 5IJAA 4XWGA 3LH5A 3L6CA 5A7FA 4LOSA 1ENOA 1U7OA 4U8HA 3QFCA 3M7IA 1J97A 1QOQB 3NTUA 2J08A 3GJ5A 4EFLA 1Y8QA 3U40A 4UHCA 2VSXA 3O83A 1M0EA 4DT1A 1JHMA 4DWVA 4PLOA 4XF3A 2XUPA 5JCJD 1RKVA 1QBKC 1BX3A 1N1YA 2WT9A 4YTEA 3S7TA 2EIXA 2JGEA 3K8ZA 3S1AA 1RWBA 1RLUA 2O8EB 3EC1A 1Y5IA 1CV2A 3LWNA 2P3OA 2FR8C 1RHI2 4NE7A 1XPWA 3LU1A 1YR3A 4CEHB 2OENG 4GBED 1D1TA 5HUHA 3N4MA 1ZVVA 2A5ZA 2I6QA 3N86A 2GPSA 4C14A 1RTKA 1I7PA 4DBVO 3S5QA 1XMVA 4O2AB 2ZSDA 3NIBA 2BTQB 2X77A 4DW8A 2WMDA 3GYBA 3TYJA 3LPAA 4NXMB 1ZITA 1CD3G 1TMF2 4IGIA 3IAPA 1Q0TA 4WN9A 4N18A 4NYIQ 2L9LA 4Q4X2 2PHWA 2XXBA 3G5LA 3LC1O 2E18A 4W4TA 4BNJA 3AHCA 3ZIWA 5DNYB 4BVKA 1CUSA 3I2HA 1R9NA 2PD4A 3QEBZ 5BR1A 4ZYVA 1X70A 4HH1A 1KAQA 2E5FA 3HQUA 2ZRCA 5IFLA 1SGWA 3ISVA 4MIOA 1X1BA 3EN0A 2FRDA 2BE7A 3R09A 3AUFA 2JHFA 3VDDA 4DQDA 2SICE 3G7NA 2DMRA 3L77A 3FFQA 4CU8A 1O6ZA 2XNHA 4UNIA 1UMZA 1DLJA 2A9FA 2UDPA 2WWRA 4RELA 1C14A 3IOEA 3TOXA 3K5HA 2R7NA 1Z0SA 4ZICA 1M2OB 2IUYA 2FSGA 5T5LA 3CJXA 3QF4A 2ZBRA 4FOSA 3BFPA 4HDAA 4Z7OB 2VSYA 1SRQA 1M3SA 2VDWA 1CWPA 4WT7A 3MJTA 3H1AA 1FPN3 4JKIA 4JQSA 2YJNA 2P3YA 4CPBA 5H80A 1Z0AA 1X19A 3THPA 2NX2A 2VUTA 2JI7A 4WZZA 2Z2KA 4LQLA 2B5HA 3FUUA 1NW6A 1ODCA 2XODA 2QTMA 1ZZ8A 1QU0A 2WV7A 1E3EA 1TAUA 1IN1A 1AO0A 2D1TA 4EUNA 5JD5A 4TL8A 1G5HA 4WLEA 1G8KA 4Y4YA 1MZ6A 2RJLA 1JKXA 3HHEA 3OPMA 4YWAA 3KQKA 1Z7BA 3MPUA 2O6LA 1P0QA 1OZAA 3SJBA 2VUDA 5TQ0B 3CXRA 1R5JA 4I4TF 5ELMA 4C0QC 2ZJ5A 5DO9A 2FJPA 1W0PA 1UAAA 5J43A 3WOGA 3OM8A 4HETA 3MOIA 1CQIA 5E38A 5BNPC 3T0AA 5MHTA 1D6NA 4HUQB 4W82A 3M6WA 2QVZX 1XP5A 1AKUA 4W1RA 4I5GA 3TBDA 1NLRA 4TYYA 1YV9A 2B7YA 5C8XA 1MACA 3BL5A 2ADOA 1IS3A 5LQCA 3P1JA 1GQOA 1X7ZA 4BJ3A 1GZDA 4CTKA 3F2VA 4EHBA 1RPAA 3C39A 3ZJTA 3OTQA 3BBPA 1JA0A 2YVAA 3UF0A 4EKNB 4HNAB 3IQFA 4C0HA 1E8NA 4WKPA 3KIPA 1P0FA 4ZOEA 2OCIA 3U1BA 1YQTA 1M76A 3JQDA 1DARA 1UN1A 2Q3JA 1HYBA 3Q6IA 3FLEA 2QLFA 3DEAA 1RWWA 4IIUA 1QFJA 3GAAA 4M1WA 2Z5GA 4CCLA 4IKEA 2ZEJA 2ID4A 2VDKB 3H4MA 3RAPR 4LYFA 1GRVA 1LK5A 5A3MA 4UW9A 4NHYA 1POWA 2C0PA 4Q12A 5E0OA 1CUIA 3RJ5A 3BD6A 3C7AA 4Q9DA 1PGQA 4PZYA 3GALA 4ZYWA 2WV9A 1TA0A 5IBRA 3AOEC 4KXMA 4FFDA 4GX5A 4BU0A 2EGGA 3HKDB 4ZOLB 2VMDA 2OBNA 1JLHA 1LNQA 4DINB 5DDIP 4PN7A 5AIAA 1VMAA 1IQPA 1LH0A 4B7CA 3OGGA 5DCUA 1OLSB 2WNOA 1K5MB 1EZZA 3ZNNA 1FPQA 2ZIXB 3BN3A 4FONA 1ZRDA 4FI3C 1X1SA 2FSFA 5HP4A 2WZCA 4CM5A 1PX2A 2PRJA 4B44A 2DFKB 1SBTA 4BAZA 4OULA 3RLIA 4I36A 4OZOA 5DK6A 5LMCA 1G3IA 1QIGA 3ORQA 1RUG3 2F4NA 4XDGA 3WRYA 1SVSA 4YMWA 1CQZA 4H17A 2PT9A 1QGLA 4H55A 3OESA 3BJZA 1CR1A 2KR2A 4BK5A 3QYAA 1IFXA 2DPHA 4LSZA 2QPOA 1OYVA 2P6UA 4DVJA 5ITZA 4Z2WA 3L9WA 1EFTA 4Z4FA 3TRJA 3ZSJA 1QC5A 1KORA 3HFSA 2VKQA 1UMBB 5DMXA 3SXUA 2B6HA 2CUNA 2C95A 1TKCA 2BDUA 4V39A 4I55F 3OECA 4XJTA 3ER8A 3E23A 3KCXA 1NQWA 3U78A 3FMFA 3V97A 4KQIA 3UH0A 2XAUA 1GGNA 1WU7A 3OZ7A 4TQAA 4GKAA 2Y9MB 3QX8A 4TT8A 3RSCA 3HE3A 1UXXX 2ZGSA 1JKMA 3SEPA 3WSOA 1OFNA 3ZYRA 4MUGA 1BVYF 3T15A 1TK9A 5LB6A 1P31A 4F4FA 4P4SB 1L1EA 1ZISA 1CZKA 1W29A 3VSBA 1RINA 3H86A 3BX1A 1E8DA 2J8ZA 4OJKA 4ZD6A 2RGNC 1WULS 5C6CA 1GFF2 4D41A 4RZIA 4LKSA 2UUAB 5LCXA 2FPRA 2RSLA 5C5UA 1CUCA 5A80A 2OVBA 1YCGA 2R8RA 3D2AA 4ASUA 1SKYB 4MRRA 5I9BA 1AS0A 1LOEA 3Q8WA 1YZKA 2VNOA 3S7EA 2C1EA 4XF4A 1S3SA 3V2HA 2FN7A 5F3IA 5A3RA 3K0SA 2F00A 2XYQA 2W6OA 4Q15A 4ED9A 4PQQA 2Y67A 4M0MA 5J37A 2R1VB 3LA7A 1XMQB 4F0JA 4AYUA 1KDMA 1XE8A 2GN6A 1WCXA 1FPN1 1VE3A 1N6KA 2H1RA 1NZDA 1YA4A 2VL7A 3NIDB 1BWQA 4Y67A 4KNYA 2B2CA 2NTVA 1YFJA 3K70D 4W5TA 5I9SA 4CMBA 4D8TA 5B5SA 2VXBA 4W9NA 4QM8A 4BVLA 1QM5A 4I1UA 1EDDA 4UBGA 4F3KA 4EUEA 3ZGLA 5C5EA 4Y3OA 1A8UA 1XZQA 5I7OA 3L0DA 3SYMA 4JHXA 5HIKA 1XDBA 5E1DA 2CYCA 4R83A 2Z8XA 2Z9BA 3TMYA 2B0CA 1RPJA 3NOQA 1ZGJA 3NO4A 4LA2A 3G1TA 4IH9A 2EBFX 3MINA 4IAOA 3GXOA 1D7AA 1A72A 1W8DA 1JOBA 4FLFA 2YVLA 4RTLA 1C1HA 5GWXA 1PS8A 1ULPA 2ZBPA 2FWBA 1BD3A 4P08A 5I8PA 3WL8A 4OHYA 1AZSC 4DXZA 3ILSA 3R8CA 3MLAA 4BGEA 3DW3X 4AYWA 5AFEA 1HG0A 2QNIA 1H2KA 2VVTA 3PJRA 2VU9A 4RJ2A 1TCCA 4BAUA 2A7QA 4EJMA 4S35A 1AKNA 3Q11A 5A9RA 2VOEA 1G64A 1NBHA 1QHFA 3VKGA 4IXWA 2WSUA 5LZ6A 1WXGA 4PXYA 5BYAA 3BB3A 1TB4A 4G25A 2ZZNA 1OA2A 3UHPA 1CVIA 3H9UA 2P6NA 1BXGA 2DHCA 5I01A 4DLXA 4JSYA 4PBRA 2WUDA 1U1DA 3KB5A 3KS7A 3SC2B 3EXHB 1U0BB 4YJDA 1IVYA 1FW8A 1CR0A 1LX6A 4JEIA 3W34A 3JB4C 5HZHA 4FEYA 1K98A 2H5EA 2Y4NA 4PTLA 4KO1S 3FKSD 1DDGA 5FT9A 3F8WA 3ROZA 3OZSA 2X09A 4Q39A 1QGED 4M21A 2DVMA 2CXUA 2IFTA 1US8A 3JARA 2ZYTX 3FUTA 4X92A 5FF9A 4XJ9A 2JD2A 2HSZA 4L0DA 2GNOA 3CPSA 3V32A 4F04A 1XYOA 3JALB 3SHWA 1UC4B 2Q5CA 3VC3A 1Z5GA 5C4IA 3TLCA 5AI8A 2FFRA 1WA5A 3I64A 3TVYA 4P9XA 3E8MA 5DUXA 1CAXA 1FNDA 2JLUA 3OTHA 1KEEA 3IR5A 3UQYS 3KF3A 1R15A 2SKCA 3MRVA 3VDXA 4XXHA 4U2FA 1J83A 1MH9A 2I7DA 1DBRA 2GPWA 4L4UA 1ZW6A 1RWNA 4DRXB 1PK6B 1GQQA 5EQDA 2OAQ1 2PX8A 4NQZA 3MAAC 1ML3A 2PDAA 1UC9A 4EI9A 2I45A 5BY5A 5TF0A 4NEHB 3CF6R 3DH0A 2P75A 4Y6PA 1FPMA 4BASA 5L7TA 2DLDA 5I7RA 1Y98A 4BP3A 4XBQA 1X80B 1NONA 1L6RA 2HMTA 3WI7A 1N3PA 1FC0A 2AA3A 1H4QA 5FXMA 2VQSA 3GRKA 3ZC3A 4FE7A 3QVMA 4MSUA 1NNLA 2YRXA 4JJKA 2WU4A 5C1OA 1NJ6A 1DQ5A 1GQRA 1HRV1 1ACLA 4GG1A 1O9HA 1LV7A 5BPFA 1P2FA 3GDOA 4OAQA 3DDZX 2R6FA 3I3SR 4O8CA 5FCDA 3QMVA 4EZ4A 1KBQA 1H2AS 1YRZA 5HMLA 3V1UA 1V8OA 2WNUC 2EALA 2P27A 1P9LA 3ONDA 1Y7BA 1EAH1 4R2HA 1XZFA 2D2EA 4BX9A 1P0CA 5FBQB 1VRCA 3OX2A 4Y30A 2YYOA 2NXEA 4QXOA 1NLMA 2FPOA 1PT8A 3E81A 3VR5A 3EPKA 4Q5OA 2A3YA 2P3KA 2DBZA 1T0JB 2J0SA 1R50A 4HGPA 5BURA 4EUFA 2XUQA 5C1PA 5JE8A 5FMOS 1BMV1 5A05A 5F2OA 1VALA 3DTNA 2JCXA 4V02A 3QLJA 2P2ZA 1FMLA 1EVIA 2F62A 4EROA 4NWWA 1QHIA 4MVJG 5AJTA 5FZOA 1GP2A 3QUBA 4RHCA 4CMHA 2LIPA 2JFPA 3CG4A 4F38A 3UESA 1SXJE 4GA9A 4H6VA 1C1XB 3MF6A 4NF2A 2GM3A 4BZWA 4D02A 5EEGA 3LLCA 4IE4A 4PSVA 2ZANA 3UC5A 4N0PA 3L8FA 4HSGA 5DBGA 3N9OA 3WEZA 3FBTA 5JI3E 5EY5B 3H1YA 5IVPA 2YOHA 1UMIA 5A7NA 1Z2DA 5J96B 4JB2A 5CAEA 5FPAA 4Y1FA 2ERCA 2P2GA 4V3CA 3TNQA 2CXQA 2RHJA 3TNJA 3KEMA 1ZO8A 1J8YF 2X19A 5DXAA 3RIGA 1JZ4A 4V2UA 2DUWA 3DO8A 4BNYA 1SXJD 5CX1B 1ZK4A 4E3WA 1XHLA 1R1ZA 2RS12 1TM7E 3UFXA 2Z2IA 1NYQA 4DZGA 4OI4A 2WFMA 1YJQA 4D0GA 3SCGA 4YRJA 4M55A 1K7XB 3R6WA 2IYOA 4XUOA 1ILWA 2DLCX 4PLPA 1O8PA 2OFOA 1P1IA 1FX0A 5DB4A 2M1ZA 2JIMA 1AM4D 4LC1A 2O3SA 2AQHA 1NL3A 3AUXA 4DR6B 3GMTA 1JW9B 4DE5A 2OP1A 4BPBA 2VPPA 1JEOA 5C3PA 1SC1A 2CZQA 5EHGA 2BTVC 1V37A 3DXFA 4G4FA 3L1VA 1VMHA 3I9KA 3T3EA 4CE8A 4LC0A 3VNVA 3KL2A 1W6OB 4MXWB 2PQ6A 5AK6A 4ILEA 1PM4A 4G1EB 1YDGA 4XB2A 4MJ3A 4YGCA 1JHDA 1M34E 2QJFA 4W8HA 4J7CA 2O9JA 3VO9A 4QXBA 1AR61 4LTNA 1POQA 3OZUA 4K03A 3NTOA 3ZK8A 4HVAA 5L3RA 1GAQA 3VMMA 4Q01A 1G5PA 3BMCA 4L8YA 4WESB 4N6GA 3WMXA 4B2YA 4DC0A 2F64A 1KKUA 4MAFA 4K1YA 1UJMA 4KP7A 2QLBA 4LECA 1U3UA 3E7WA 4YGDA 1Q1QA 4WSOA 3FCEA 1EFKA 1J9ZA 4HQOA 3ECCA 4FYMA 4QOGA 5BSKA 3ORHA 1DS6A 1ENQA 4AQSA 5CG1A 1W4BA 1G98A 3HP1A 2JIQA 2JFYA 4ARXA 2QGFA 3NPMA 2HZ7A 3G0CA 4DABA 5C18A 5K7PA 3V42A 1Y80A 4XOUA 1Y4DE 4QUDA 2DM6A 4DV5B 4KXNA 3OX4A 1NF2A 2GVDC 1H5NA 2BM8A 3GLQA 1TAGA 2VW0A 4MWZA 4WUTA 3O5SA 4MZDA 5BN3A 4AU1A 2OO5C 1WB6A 5A32B 3TNPB 2OGUA 3G9QA 5FMDA 2FXIA 3WAJA 4G9EA 4KUGA 3U7HB 1Q83A 5G0UA 3D3KA 3S2EA 3Q3JB 1PVVA 3ADPA 3ZMOA 4PLTA 1MF7A 4EQ6A 1QIKA 1XXHA 4BDVB 4IGEA 4DMGA 4BO3A 3OBIA 4NCAA 1YRBA 1WHSB 4YAIA 4J91A 4Q3DA 3VOSA 3R9IA 4LY9A 2IYEA 4MRMB 3MCUA 1RUE3 1ADJA 3IP7A 3NHWA 2G9NA 1H4TA 3KETA 3CNOA 3STTA 2B34A 1CETA 4PQGA 1R6VA 3MLKA 3VYUB 1FEZA 2RH8A 5AM3A 4KO3S 2PA0A 1PO21 2VQ0A 2Q6KA 8GPBA 5A3TA 3F73A 4MV1A 1DQ1A 2O48X 4GRIA 1EV11 1GRQA 3I0ZA 3I5MA 1B35B 3KR1A 1EM6A 4TKUB 2ARAA 4QKQA 3WJ7A 4HWOA 4QGMA 1Y6QA 1W1IA 4EHLA 1L5VA 3AUUA 2BFCA 3AVVA 2H06A 2HHLA 1FXWF 2QTWB 1W47A 4MKFA 4LO5B 2QN3A 3DCIA 4NZMA 2XUMA 4J0DA 1J00A 1RPTA 4H7MA 3N53A 5LLTA 4IH4A 4AO6A 2WUFA 5K0FA 4CIVA 1P2GA 4LC9A 4ZYLA 2HKXA 2QT9A 1QIFA 5KXCA 1PJ4A 3PTZA 3PMEA 3BOSA 1VJDA 1A69A 2EZUA 1HQWA 1ULFA 2C5GA 1I2MA 3UUWA 1DCTA 2GC1A 1H5UA 3LCUA 3FYCA 1VCHA 1DG9A 4EVRA 5C5IA 2WY2D 1JQAA 3CLTD 5HG0A 1E1MA 4QOFA 3EG9A 2JW5A 5H16A 1KIAA 1WCIB 4UD6A 1QGOA 1PQPA 3T2TA 4BZPA 1P4GA 1EUQA 1JODA 4B84A 2AR9A 2P5SA 1AV6A 2X3YA 1LJLA 2WK1A 8ABPA 4ZI5A 4P34A 1W36C 3GEEA 3I3MA 1QQTA 1V5GA 2FP4B 3IT1A 3DZGA 3R0JA 3OLVA 3KK0A 4OY3A 1Q8PA 3OF5A 4OJYA 3QPVA 3T9CA 5D21A 3KO8A 4Q9AA 1GCAA 1O08A 3V0AB 4CL3A 3ZPYA 3DJYA 1Y89A 1JALA 5KOIA 4LO4B 3HY6A 4V2WA 1AS3A 2SHKA 4PQ9A 5SV2A 4ZOCA 3VC1A 2JFVA 3R2JA 1KQ3A 1NQAO 3EXEB 5FYBA 1L7MA 5I0TA 2V7QA 5C7OO 3HCFA 1RHMA 3GRAA 4FFPA 3DZBA 5DTQA 4JI8B 4G1MB 1M8JA 2C8JA 4LF4B 4O2LA 3IDAA 4QXKA 3UJ3X 3R75A 4K8FA 3SEAA 3EIQA 4EA7A 1JYCA 3PZBA 3TE6A 5GONA 4PLNA 4Z3OA 4MUEA 4B6QA 1XELA 1AF4A 5EJ3A 4UAUA 2YY5A 3L82B 4YZ1A 5D3QA 3WQHA 3AFIA 1QXJA 5FH9A 1GGFA 3GVIA 1TM4E 3RREA 4U6SA 3AF5A 2X1VA 5EKXA 3EO6A 4BV9A 1JS9A 2R0FA 4RS3A 1SXHA 1P0MA 1A6CA 3DOIA 1AXZA 3I42A 4LBYA 2AFHB 1J59A 4KQXA 4EGAA 2E49A 1LC0A 2W6NA 1JQLB 1AB6A 2QTRA 2K6GA 1U8EA 3MERA 4OI1A 5K8TA 4RFSA 3QVLA 3RVHA 4CIBA 4O4HB 3NBXX 4LWOA 1CE8A 1QK5A 1SC3A 4EYSA 1UJNA 3Q8FA 5DXJA 1YKGA 1BBT2 3SHQA 1RMU1 4MW4A 4KRXA 2F6RA 4G0OA 2ZJ6A 1KSFX 3IMNA 4ETMA 3KPWA 1PM7A 2YJ5A 4J90A 5CG8A 2I2BA 4WZFA 1CNMA 1C8KA 4WA7A 3B9PA 2YYAA 3L7YA 3WADA 2QE6A 4OB6A 4GWKA 1P1JA 4CPBD 2PGAA 3K8OE 3LWDA 3AESB 1QXSA 4NR0A 1PZXA 4I66A 1IQDC 4RD7A 2ZSFA 2YBEA 1IJKA 2NSJA 3QENA 4G8BA 3LO5A 1IY0A 2W0SA 1QQP3 3KUCA 3HXTA 1NXQA 1PJRA 3KR0A 1ZM3A 4G5HA 3RTEA 2EYUA 3N7LA 4MGIE 5GZCA 1WSBA 3TRHA 4AG5A 1XAJA 4WCFA 3Q0IA 3EDOA 3GFVA 1KAMA 2QJOA 5KPDA 2TBVA 5C7GA 3FWZA 3SJAA 1NCRB 5F51A 4YM0A 5F8PA 1LRHA 4X41A 4WM8C 1F6BA 1ODTC 5H9VA 1K4KA 4KXLA 4IMPA 1L5OA 4Q9HA 5DX1A 2Y38A 1QV9A 2Z69A 4FQ5A 1RUE1 4N8MA 5B4VA 4MI9A 2IKQA 3WRVA 4XM1A 1MAWA 1Y8RA 1DKQA 3DBRB 2ZG6A 3L0IB 3ZHRA 3TJMA 3BRSA 4LMBA 2ZQZA 1C9EA 4LXQA 2EDCA 2YICA 1G8YA 1Z0DA 1NGSA 3CLVA 4Z7QB 1W28A 4WMLA 4BZ4A 4CKEB 4NIIA 4MI1A 2X0KA 3SE7A 4PGHA 1RJDA 2UYCA 3DL2A 2Z5WA 4IP0A 2W90A 3IRUA 5FTNA 4IJ5A 1RVF1 1JDPA 2LNDA 4CKBA 4N54A 5AYVA 2CXOA 3KCCA 2CGNA 4LMFA 1RQPA 3KWFA 3SY8A 5D5HA 4YP7A 4UCQA 5ITSA 4AKGA 1HE5A 1YI8A 3G6KA 3UOGA 2CDAA 3L9JT 2PUAA 2DECA 1L7BA 1ZBA2 4QBGB 5EHZA 3HR8A 3RHTA 4EAAA 1Z62A 2CNNA 3HZZA 3UUFA 4GH4A 1T1JA 3QVGA 1N0UA 1VMDA 3KMHA 2FDRA 1ZGGA 1C7IA 3SX0A 1UK9A 3R4DB 3AL6A 3AW9A 2FPSA 2VFAA 5BXYA 1Z35A 2ET7A 2I76A 5BNZA 4XLTA 2GKOA 3DTVD 4ONUA 1Z63A 3RPQA 1V9SA 1PNOA 3LRXA 5HKAA 3ZSMA 2AH5A 3U4SA 2IXLA 2ZYWX 1FXUA 4B09A 1OAOC 4BJ0A 2D5LA 2ZIEA 1WW7A 4WDRA 3OFKA 4BEWA 4V0QA 4I9HA 5E88A 1DJNA 4BFTA 1V6IA 3EVTA 1I6MA 1QU3A 1VIVA 4I9NA 5FBZA 2HA4A 4NY1A 3JZAA 3BTVA 4LX0A 1BDBA 1E0JA 4YJFB 2ZX2A 4I02A 4WJKB 3ZHYA 4F93B 1OD5A 1QFZA 2ZDGA 2XLBA 4OXNA 4BV3A 4RC9A 4N6OA 4LJRA 1JEYA 1VIMA 3AINA 4ND6A 4ND5A 1WQ4A 2PX2A 3VR6D 4MPRA 5TV2A 4FWTA 3M1HA 1UR5A 2X0NA 5EIFA 1PN3A 2UVPB 1HKDA 4KXYA 2AN5A 2QD1A 4HVTA 1H1TA 3O90A 3EMKA 2VNIA 4MUXA 4KOAA 3T12A 3TG8A 1RYEA 5A70A 2EJBA 3LKZA 1LLCA 4MDYA 1P45A 1BQ4A 2EFYA 4YJGA 3N58A 1QOOA 3U5ZB 2BHLA 1NVDA 2OP0A 3A6GA 1ZM1A 3W9BA 3IPXA 4M0NA 3JWHA 1UZYA 2R6DA 4JFAA 3VC7A 1T8WA 1XALA 4OBWA 4AMYA 3U80A 5LEJA 1QO7A 3O1LA 4UMFA 4X20B 4QTYA 3L41A 4QX8A 1PR4A 3L1IA 4UPVA 1K7YA 4H08A 3DAYA 1PO12 2W92A 3MFCA 1FBTA 4RH0A 2RAVA 1EP3B 1TGVA 5CRIA 3TKLA 4CNQA 1BYHA 3U7FB 4D0NA 3LT0A 3DZFA 1UJ4A 1NIJA 5JAOA 1YKSA 1JI3A 4ASUD 4AF9A 3RSJA 2ZRKA 4IJ6A 5ALXA 4LNUA 1GTG1 2VF5X 1P33A 4ZT3A 1RLTA 2UKDA 2NXCA 3DQZA 2YBPA 5GZGA 3VBUC 1OY1A 3JVDA 1FYWA 3DV9A 5AVXA 2FPMA 4F6LA 4KTVE 3K9QO 4FPGA 2JFBA 2MSWA 1KMIY 3POIA 1KK3A 1TYEB 1LLFA 4ZQBA 4LJSA 2YIDA 2QUBA 3MWDB 2ZE7A 1EE2A 4Y4RA 4K9RA 1XMXA 3IPAA 3STXA 1K8RA 1FYFA 1LJUA 5FO1A 1P6XA 2Y34A 3S4YA 3B6EA 4XTRA 1S02A 2Q1WA 1QQP1 4BECA 3WGTA 3UB4A 3AIIA 1Y8AA 4FXGB 2GP3A 2RHTA 5CR9A 3AFKA 1HEUA 3ANYB 4Z4IA 2WJ3A 1CZNA 5ITVA 3L7CA 2N42A 3OI7A 1PMHX 4RS4A 4I0AA 3HYTA 1ZBE2 5HDBB 4J0QA 4IIBA 1P39A 3RH0A 2OL4A 3NKGA 4JLJA 3T52A 5F3EA 4CCEA 5FBKA 3OJLA 2PSJA 2P9JA 1T10A 1WETA 1RUF3 4R0NA 4BFVA 3WGIA 4MICA 3DMNA 1TTPB 1TO6A 3SDSA 2BGJA 2JCGA 3GBGA 2ZIWB 3UJ9A 5KC5A 5DHRA 4D4MA 4QGHA 1TU4A 3VD9A 1VG1A 1JR2A 4MUYA 4AR2A 2W9XA 2CLHB 2BPOA 1FNYA 3FVQA 3V1LA 1H22A 2XR4A 1Z22A 3BIOA 1IOAA 1UO9A 4GVPA 2QZ4A 4A82A 1AKYA 4HGZA 4EK9A 5C9AA 4PIXA 2Q5LA 4TGLA 3FDZB 1FQWA 4JV5B 5IP5A 4HWKA 3WDLA 3FMGA 2BMAA 2YWHA 4ITUA 4OUKX 1OR8A 1ZUNB 2Z56A 3QE2A 4LXHA 1ZJ6A 1RWVA 1PS0A 2ZTLA 3NM6B 1SLAA 1RUC3 5JSZB 2YZMA 5CTJA 2XITA 4LV5B 3MTEA 1BKDR 4MUMA 2QBYB 3AKSA 3SJCA 1HEIA 2QX4A 1VBE1 5D87A 4ZDIA 3UC9A 3UJBA 1FU7A 5DLPA 1ZNWA 4GICA 2AREA 5AKJA 2AG5A 1EPUA 5IAGA 2AOWA 3QVJA 3GHYA 1G2PA 4QU1A 3SF8B 2JEOA 1YGPA 2E6KA 1ZRNA 3GZ4A 4NMHA 4LHLA 5JOZA 4QO8A 2QVXX 3IMKA 2QLMA 4K6HA 1GZSA 2HPHA 4Y0VA 3USES 5FO8B 2JIZA 3V55A 1LVGA 2XW6A 3I1YA 3LPMA 3EQZA 3FNFA 3T5GA 1DHRA 1BEEA 4LFAB 2JNWA 3FWYA 2GXAA 1HDOA 1MS3A 4FOLA 4JGZC 3ZHVA 1JDUA 1H8TA 3TVTA 3V46A 3RYIB 1L4EA 2NP6A 1V3TA 3UG6A 2C5SA 3KWJA 2ROQA 4ZO7A 4KWKA 5D2CA 2P9GA 3ZWBA 1U9ZA 2WI8A 4PPNA 1O4VA 3LI2A 5DUWA 3MWKA 4F6RB 2M98A 2Z30A 3POJA 4EECA 3DOOA 1B41A 2O3UA 6PFKA 3KOMA 5JHGB 1N1EA 4KU8A 1W9WA 5DNAA 2JVKA 4ER7A 5AW1A 4XDHA 5JRJA 1NYTA 2XB6A 1WQ1R 3FKJA 1A9PA 2XTMA 3THWB 1S1MA 3R3WA 4DY5A 3T3GA 3T2OA 3QH6A 1X42A 3ZTWA 1SUIA 3WXBA 2X13A 4BNHA 3A1UA 5FEUA 2HSGA 5AR1A 1MV8A 1C5KA 4YPOA 2WVJA 4ISBA 4ZV7A 3ZYZA 3HWRA 3SDZA 1JQJC 5JSKA 2H1CA 4WVVA 2PZGA 2HBQA 4DYHA 3ZM8A 3FLBA 2GN3A 5LYJF 3ACIA 4ZO9A 4ZN6A 5COAA 5ISLA 4JA2A 3X1JA 1J8VA 3V2UA 2JDYA 3I2JA 5FOBB 1UMDB 1QZUA 1NSTA 3NQ41 3D3JA 2ZATA 2HIMA 3P0HA 4LJHA 3FVWA 3PNMA 2ZKLA 4DIOA 2ADMA 1B09A 1ZSVA 1R081 1KR2A 4R0VA 5ECWA 2OHHA 1G7TA 3HP4A 3NBQA 4L7VA 2O0HA 4R4ZA 2O5VA 1A78A 2QKYA 3N59A 1EUCB 4YUYA 1Q1NA 2MU1A 4DXDA 4HN9A 1VPEA 3LYUA 1S0JA 5IFKA 2LVBA 1EVYA 1UMCB 1U9JA 5YASA 3ZR5A 2Q1FA 4GI3A 1OTYA 1LDGA 1LSSA 4HV4A 1LPOA 3NHKA 3FBGA 3IUEA 4DM3A 2NU8B 5CXUA 3MBWA 1E0SA 1PGOA 5KYUA 3L8YA 4DLZA 4XHBA 3B9RA 3T5TA 4YMLA 1YD7A 4JTOA 4AN1A 2EF6A 1EM8A 2ZIGA 3DO6A 3UJAA 4ZMBA 3S2IA 1Z4QA 4KBZA 3PQ8A 2JIGA 5FTMA 4YMHA 1AYM2 3BAZA 2REQA 3NU1A 4ISQA 1YS6A 3EFHA 4PHFA 2KB0A 2OD7A 2QBXA 4KQWA 1AB5A 1LV8A 3C3WA 1IAQA 2PYDA 2OE2A 1R74A 4TKVA 2OIIA 1SC9A 3OQIA 1R0ZA 4X1KA 4LIUA 4JL6A 4B3CA 4LRTB 1DGLA 3H5AA 1X15A 3ORFA 5AXBA 5IYZB 3FLTA 3W8NA 4YJ2B 1XNGA 1J2YA 3V7NA 3UT6A 1B15A 4A4DA 1FMCA 1BCSB 4K6BA 1JEEA 2F7SA 1PZHA 3AMPA 5HXVA 2ZK7A 4MQBA 4TS9A 2I3GA 4BATA 3BQMB 1Q5OA 1Q91A 2PXAA 4P3NA 3KALA 4N1AA 3EZ7A 4Q26A 4QELA 1R12A 3WZLA 3N3BC 3NIGB 4KN9S 1JKJA 5D7NA 3DBHB 3NW9A 1WUVA 5J4HA 4WD3A 2XHNA 3K3NA 1UH5A 3NUQA 1IKQA 2EFJA 5J4YA 2AC1A 1EE9A 2J6BA 4OYHA 1C1FA 1W48A 1TVEA 4CI9A 5LRSA 4Z3KA 1V1RA 4LDZA 4J1XA 3PICA 5K01A 2R2AA 4QTZA 3FUQA 3U39A 1GCUA 3WJAA 1NQ5A 2B78A 3QBQA 4NE2A 1W85A 1XXHE 2PKQO 3NBKA 3B93A 3EGXA 1YC2A 4JN6B 2VJPA 4LG1A 3BOWA 1GSAA 4UFNA 3JU3A 1Y3IA 3PJQA 3REGA 1B3BA 5JXGA 3L0PA 2JC3A 2A1IA 3AL3A 3NANA 1ZJ4A 1IE3A 4B7KA 5CBLA 1W9SA 1HEYA 2AG8A 1GV0A 1G86A 5JSPA 1LGBA 4H7EA 4PO8A 3GZAA 1V6KA 3SSOA 5CM9C 5HJ7A 4ASKA 3U11A 5B2EA 2C1ZA 5C8YF 4PHCA 3IA2A 2VJMA 3VBHA 3WK6A 1EHCA 4Q1RA 2DBQA 1CUDA 4ZI3A 5K3CA 2WS93 3C3DA 5BNNB 3T7IA 1L5ZA 2GD2A 2G0NA 4E9KA 4RK6A 2BCJQ 1XEAA 4G6ZA 3TKAA 4I99A 2OZJA 3KPJA 4YAWA 4IGAA 3OMXA 1KS5A 4OGGA 2I34A 5DWQA 5J4VA 4QG7A 4AI9A 3I23A 4RQPB 2OG2A 3LKDA 3A1SA 4RGGA 5F5CA 1CPNA 2OV4A 3DKIA 3RRDA 5B7PA 3NHLA 4KQ1A 4JJ8A 1A9TA 5FI5A 3RWMB 2CVZA 3T4EA 4X93A 3JVUA 5AW0A 2ILMA 1GFIA 4UF0A 4GQIA 1G55A 4NBKA 5JO0A 4DDTA 3OD1A 4IRMA 3PTAA 5AW5A 5E7IA 3P32A 5DCWA 2PM8A 3PT9A 4JJZA 3T95A 3O1VA 2W2LA 4LAFA 5BW4A 1XVUA 3J9SA 1Z83A 1BVVA 2VJQA 4UFLA 3T0IA 3ASIA 4FB4A 2EX1A 1QOPB 1VI2A 2JKYA 1PFYA 1PD0A 1QV7A 5T50A 1L5HA 1HLPA 1E60A 2WU3A 3PS9A 4E2SA 2I3ZA 3UJCA 1MC4A 2R44A 4JI2B 1FS6A 1NN3A 2AX3A 2JG8C 1WVGA 1RXFA 5DIFA 4LZPA 1YMVA 4IIXA 3ERCA 2RKWA 2NMVA 3I3EA 4IVNA 4RMGA 4BVGA 1D4M3 3GEDA 5D5PA 3BGOS 5TMPA 1J0XO 5IM4F 4J3FA 3F6PA 1MORA 2UVDA 2W95A 4LXUA 1U7UA 3CXUA 3LY8A 1N6HA 4C5AA 4Z4HA 3FROA 4YREA 3WX5A 5DDJ2 1VPHA 1PMJX 1MFZA 5AUQA 2W39A 1O94C 3I3OA 2QTAA 1RUD2 1SIOA 2R49A 4WLNA 4ZS3A 3VJKA 2DPYA 4H3HB 4XFAA 3NFYA 5KIAA 3HGTA 3F97A 2QTNA 1S7CA 1U63A 3I2GA 3VKUA 2VJKA 4HAUA 4L8FA 5EZYB 4JB8A 4MGZR 4PNEA 1UK8A 2WTAA 4W5WA 2I65A 3KM0A 3KJGA 2HSJA 4UEJA 4DSTA 4AHWA 3OE1A 1SU6A 2QQGA 1FY2A 1NMSA 5HS6A 5JUVA 4LGVA 2G6BA 4JXKA 4W5QA 1ZIXA 4KL8S 1N3YA 1GYRA 3TN7A 3HG7A 2SLIA 1FSPA 4RXTA 1CPMA 4J6GA 4QT4A 1WCYA 3K9LA 1COWA 3L7JA 3BWDD 4GLBA 5HUQA 1X94A 4NPCA 1JDBC 1I9GA 3U2QA 3B9IA 1MTZA 5AHXA 1NI3A 2EXKA 2X9NA 1JYTA 4JQCA 4L2IB 4PG6A 2NT4A 3EGCA 4ENQA 5IRCD 3FPBA 4HAZA 4BLPA 5IXJA 5CNJA 2DTDA 4QREA 1B8OA 1Y3BE 2VNAA 1FUUA 1GSLA 5FI0B 5HF9A 2CL2A 2CUZA 2OS2A 2Y0EA 4DQVA 4Q5IA 5J4KA 3CUTA 4YAJA 2PHLA 2I6UA 3IKJA 4NS4A 2B9EA 2NXNA 1ECJA 3FSJX 1NW4A 3AEXA 2VP3A 5DZFA 1JEDA 4JBXA 4DANA 2VF8A 4QBTA 4N12A 4LRSB 3K4AA 2QM8A 3PQ2A 4J0EA 4QWMA 2E7ZA 4MSVA 3FLMA 2C1FA 3ZYPA 3PC8A 2EHDA 4NV0A 5AKHA 3GLHA 3V4OA 3ZKWA 5ALVA 3OO0A 4TMXA 1CZUA 2XX3A 1T29A 3NJ4A 1MV5A 3PK0A 3RG2A 1DT3A 1P2VA 2ZA9A 4RHFA 3WW3A 2A67A 2VDVE 4IIHA 4J6FA 1YUBA 3OPYA 3ASYA 1KFCB 4L02A 1Q2XA 1JZQA 4G07A 3QELA 2OHXA 3KTFA 2BE9A 1VLNA 1NHWA 1F2VA 3M6XA 4Q3AA 1XZKA 1FU4A 1QH1A 2ID7A 3UT5B 1PVOA 3AR7A 5A7WA 3VOAA 5BN4B 1DAPA 3U62A 4EYKA 4YRCA 5K6TA 3LWCA 4FCTA 4LDAA 5H59A 3O3CA 1ZQ9A 3CJIC 5A3LA 3UGFA 3ISTA 2J48A 3FA2A 3MFAA 2VZLA 2EQBA 1HNXB 2IZ1A 3AVQA 5J5VA 1ND2B 3LC2O 1PKEA 1VMJA 1N2BA 1K66A 4ZAYA 3WOVA 4GB33 1P7ZA 1I1HA 2ZYGA 3POEA 1K86A 1GP6A 2DG2A 1JQBA 3HLKA 2R87A 5EZ6B 2J5BA 2NQ8A 3POBA 3ENWA 2JANA 1OVGA 3CEPB 2ISCA 3WE7A 3LQCA 3GN2A 4YP5A 2YMLA 4OATA 2B8TA 1H2YA 4BX0A 5EP1A 1A50B 3UAWA 4JXJA 5DN6A 1R1A1 2B1IA 1GAWA 1HF3A 5I3CA 2J0UA 1LBTA 3WQRA 4G0VA 3HCRA 1C0KA 4JI0B 3QF7A 4ZARA 1P2SA 5EZ5A 5I0SA 2VYQA 3VL9A 2HLHA 3P71T 4TMYA 4IFTA 1SCUB 3ZHQA 3JW8A 4UBOA 4WBNB 2H65A 3T06B 1ZD2P 3MJEA 2ZRHA 1XIVA 2OM6A 4DCVA 3CO5A 1Y7PA 5DK4A 2YV8A 2XSZA 3TL2A 1BCXA 2EIGA 1UBGA 2J42A 1ZRCA 2E26A 5P8WA 2FTKE 5HK9A 3DWIA 3PHJA 3FXAA 5I9MA 3TLGA 2IPLA 4IJWA 1H4VB 4EKYA 3E3NA 4QHTA 1JTZX 5JCZA 1I4EB 1V9U3 1TADA 3M83A 5BSGA 3OQPA 2R3SA 5LBBA 3B5IA 3PCRB 2FR8A 3WG2A 3DPRC 3DAGA 1ZUIA 4V2VA 4U9UA 4EH1A 3PEWA 1SRRA 2WTEA 3PGLA 4YACA 5KYWB 3AKYA 4A41A 2GN0A 2VHZA 3UFBA 4BUCA 4ZI2A 1E2PA 1R8YA 5EVJA 3TCNA 3MN1A 4E12A 3BYZA 1QMJA 1IMOA 4YM1A 5LA2A 3BCHA 3CH5A 3EZ2A 3GJQA 2H7YA 3AUSA 2TS1A 1GPNA 2VCBA 1GJRA 5J47A 5JCTA 1DRJA 3M1IA 5ERLA 4QNMA 2ZRIA 1ODMA 3HVIA 3FYUB 3EXUA 2P91A 3OLCX 2WJYA 1VPTA 4QQ8A 1IQ0A 4DGQA 5FJHA 1I14A 3DXUA 3NDBB 3L06A 2PH7A 2R62A 1LQUA 2CVFA 3WWZA 1CZRA 1OWNA 4NH0A 5ESRA 2VLBA 1UPXA 4JT2A 3R7WA 4BB9A 1H3NA 2P67A 5BORA 5L36A 4G23A 5EAIA 2PXJA 1PNRA 1NJSA 2G1AA 4WKCA 3BE4A 1TRKA 2HPZA 2PT6A 1N25A 3KVNA 4ZV9A 5CISA 2ZAGA 1MMFB 2ATIA 2HHJA 1E6UA 4PHZA 3HEAA 2XD4A 4JU8A 3ZOKA 4NIMA 4RGQA 1CUZA 1AGNA 5JDCC 4IEFB 4ZU7A 2PUGA 2A2ZA 3KV6A 4UW5A 3AH8A 1V11B 1J1LA 2HOQA 1C7FA 1CN1A 3WW2A 2DWOA 4HNRA 3RB8A 3L0CA 4UPEA 2PPVA 4CLOB 4NHEA 5JADA 4QODA 3QP9A 1CRLA 5C1IA 1GGJA 1UFVA 5DYTA 3ZE0B 4HVCA 1DQZA 4QOJA 5HKBA 3AKDA 2A14A 4E2FA 1JWBB 3UGGA 1AQNA 3AI2A 2ZUBA 3W5AA 3I4CA 4XVQA 2V1UA 4BNIA 1C4XA 1N5RA 1JEAA 3KJEA 5BMOA 4Q1VA 3C3EA 4IV3B 2EAUA 4Y6GB 5CUQA 3FYDA 2HDHA 4I0WB 3U3RA 1P44A 5EE1A 3SI7A 1V47A 3FVVA 3LDAA 3ASVA 1VIYA 4KGGA 5F7XA 1SVOA 1OX6A 2XOEA 1P7YA 2P9HA 5E7MA 3S70A 4OI0A 2GRAA 2IYYA 3LDGA 1J9GA 2VDJA 2G40A 1GM5A 4R98A 3KTAA 1C9YA 2YN4A 1JP7A 3EDMA 5M29A 3E5HA 3M81A 1UBRS 2W2OA 3L6OO 3PE4A 4A6SA 5KC6A 2RGCA 5FXVA 4D3WA 1T9AA 3L8EA 5FNVA 3ZEAA 2XDQB 5F7UA 1AL23 1P91A 3OIWA 4R69A 1YCFA 1VB2A 3UH1A 2HGZA 4GOLD 4GB31 2BGMA 1LW6E 1UJ2A 3C43A 4S2UA 4D9HA 3PPYA 1B4DA 1GKYA 1GT6A 1PZNA 4XGRA 2XMCA 4HMQA 4ZAVA 2E9QA 5AKXA 4LA3A 1DFGA 3H84A 1QQBA 4PCLA 3W6ZA 1UPSA 1RABA 4CR6A 3PB3A 4B4PA 1FRZA 2RE9A 1QYRA 1LECA 2XE7A 1EI9A 3EEOA 5KOJB 2GO7A 3ZY5A 2KPOA 5L4LA 4D7SA 2JHAA 2WQ7A 2OBYA 3SC4A 2Q8OA 5B2GB 2XQVA 3P52A 2FMUA 3K71B 2ECQA 3GLTA 1P2UA 4B6FA 2F1OA 4NN0A 4IHAA 2SCUA 4M0FA 4R84A 4NK5A 2QR2A 5EZWA 4HXCA 3AOEA 4OQXA 4ZIRA 3FOFC 1P3Y1 2A1UA 1YQ8A 2ZUTA 1D2NA 1E9BA 2Z1DA 3SLIA 5JSYA 1GZWB 3CQ9A 5BOSB 1WEHA 2BV4A 3ZXFA 4AWAA 1MHPA 4HNQA 3JYNA 4DQUA 4JDNA 5BN1A 2QGNA 1YF3A 2XV1A 2DTWA 3VD5A 1B0UA 5LBFA 5JANA 3TW0A 2VZOA 4QUKA 3H9GA 3LK6A 5KYXA 1ZH6A 4QQRA 3C7CB 2E55A 2VHUA 1RUG1 3PX3A 3CBQA 1ECBA 4LX8A 1GANA 1AV7A 3KOYA 4OO3A 1C1DA 4C2AA 1FSSA 2JFZA 4TXNA 3KELA 4K9PA 4JZKA 1DBSA 2JIZD 5A1LA 3LCJA 3GEGA 3DTYA 3EGDB 1OXKB 4DQKA 2YFZA 3BFJA 1RYYA 3TOJA 5DXDA 2XWPA 2CWDA 2QRVB 4BFWA 4TN5A 4E5PA 4ZXKA 3GJ8A 4HEJA 1G8GA 3HMYA 2BRUC 2LUOA 1XR3A 1MQ9A 1MRNA 3CLSC 4ZTZB 1LI5A 1JB9A 4J0FA 5I7UA 3FGOA 3M70A 5FPHA 1UCXA 1T6NA 5C7IO 3IQDB 1J84A 1FK8A 3JTMA 2VZ8A 4EVIA 4UASA 3AX4A 3D8HA 4WXHA 1V9LA 2R5NA 4N48A 1CB7A 4PR3A 4YGBA 5BQFA 4Q00A 3FFZA 5DM2A 4A0HA 3CNHA 4GHWA 4IF6A 1J1ZA 4MR9A 2O8DA 1BW9B 1TQ6A 2PRYA 2ZR9A 4MR7B 3GLIA 1R88A 3F5FA 4RDCA 2A5LA 5HMMA 1JG6A 3TLAA 4CKCB 1XSEA 4P3XA 2RGNA 5BMVB 4Q0MA 1B0PA 4D3XA 3O8QB 1BKZA 2DJIA 2Y3IA 3PIDA 2GESA 1NLYA 1LPPA 3TM4A 2GP5A 2W42A 3CKYA 4AZ0A 1QS0B 2HT6A 1YJAA 2HF7A 3OF2A 4YP1A 4WACA 1LU1A 4O5OA 2YVQA 5CLLA 1RBMA 4D0LB 5B6IA 2DQ4A 4ALLA 1VPDA 3VHLB 1E6EA 2PGXA 5CW2A 1DV2A 4DGSA 2QQUA 1RQRA 4N7MA 4EYQA 1YQUA 4DHWA 3SX4A 3DO5A 3NDIA 4NYMQ 3A6DA 5DYGA 4DOUA 2IC5A 4X7RA 4U0JA 2VPVA 4ME6A 2WYVA 4QB6A 4FKMA 4XJUA 5JTUA 5L9AA 1R10A 4I3GA 4RUKA 2PVPA 1AQJA 2GZ2A 1LFDB 1NC3A 2JGNA 2Q46A 3IFSA 2ZFUA 1ZD4A 4X6YA 2B20A 1A0OA 1RADA 3ESZA 4HYYA 1OKKA 1BE6A 2PYIA 4Q4Y2 2RI1A 4I9UA 3LIPA 1UY3A 4BVBA 1OOPC 1S1AA 2YIVX 3D8CA 1EMDA 3CHYA 4ATFA 4INZA 4V38A 4ENRA 2IS2A 5ABJB 1SOVA 2WR8A 2ONYA 3DC7A 1YYNA 3ZKUA 3JAMA 3PGMA 3MPPG 5DM60 1R8XA 4DFSA 4O7XA 1EPWA 3OLWA 4UOZA 3B6ZA 4P0QB 1AR82 4LO7A 1ZJWA 4ZXFA 4YFZA 4BLTA 5FYDA 3AQ4A 4NFYA 2QUOA 3EVCA 3VJMA 4KGXA 2XE6A 1M2HA 1AL21 1NOIA 4AAXA 4U6NA 3B3AA 1CFZA 4DLNA 4E21A 1KFBB 2VQEB 1A4IA 4FFHA 2ACWA 2WQZC 4P2BA 3OQBA 1RWKA 4ZO4A 2XZLA 1MA3A 1W06A 3I2DA 1JWAB 4V0OA 3ZX4A 4YJ3A 1CJCA 2WJPA 3GU3A 4BNGA 4MLCA 1U8YA 1PR9A 4K6FA 3HKEB 4P86A 4S2EA 4CG2A 3GBSA 4NJMB 1MVLA 2I03A 4TRNA 2AOXA 2I2FA 2H9AA 4JKOA 4Q1BA 3JVIA 4ZEWA 3QG1A 1SPPA 4DNOA 2PNJA 1T2NA 2X05A 3T7KA 3RWKX 3W4KA 1Q50A 1W6RA 3TR6A 4NYJQ 3P9RA 4FJ1A 4MCAA 4ZMSA 3N0XA 3NMUF 3BIFA 4U2EA 4UAGA 2JAPA 3BXXA 4XYXA 3PEFA 4PI2A 2PAEA 2HBTA 3M6FA 4PLMA 4G26A 4H59A 1CEEA 3TFOA 3P3NA 1T9BA 4Q16A 3ESCA 3TYXA 2ZP1A 2FPPA 4E51A 2FEOA 2QRUA 1OLQA 3CBNA 2YMMA 3RSSA 2I4LA 4UHHA 1QFMA 1Q16A 2WF6A 1GTMA 3WNKA 1XJCA 4QRIA 1ID8A 4R1QA 3OFSA 5JSFA 2XZOA 1UBOS 1E1QA 1U31A 3EGWA 1HE8B 2NLOA 4ARVA 1N9ZA 4PANA 2Q5FA 3CJRA 5F21A 3RTCA 4LXTA 1QLWA 4UNNA 1X77A 4C2TA 2YKGA 4NEQA 4OQEA 1KMQA 1KYXA 2HB6A 1ZC3A 4JDPA 4S0ZA 2GMWA 2H5JA 5FPUA 2AJ8A 4EGQA 4S2DA 4E5SA 4W6WA 4L95C 3CZPA 5F37A 5KOHB 5LP1A 1ESZA 4YP0A 1N5LA 2P1BA 1N36B 5AESA 3U7RA 1WKVA 2WNUA 2XB9A 4QU5A 1VBNA 1XJWA 2JE7A 2H1FA 3KQWA 2HHCA 5B4UA 5TJ9A 1QTNA 1QF7A 3MT9A 3QUSA 1NP6A 4U7WA 3ON7A 4TYMA 3WO1A 4B3NA 4R1SA 5ENVA 1PHMA 1OXXK 2OORA 1U3GA 5FFFA 4PAMA 4ET7A 5TQVA 4H14A 5JOYA 1F5NA 4BLSA 3HJRA 1U3TA 2HIGA 2W2LD 4OXXA 2VDRB 1AZLA 4JQYA 4W4ZA 2WFLA 4HAXA 5JS7A 1S0DA 2NIPA 3Q8AA 1O97D 5A4IS 5B4TA 5ILGA 2P2NA 3I1JA 3IUJA 4AI2A 4YONB 2YMZA 1X8EA 2C4HA 2C2WA 2D2FA 1E2DA 1XZPA 4DADA 4QQKA 3JV7A 2B8WA 1HE3A 1HB2A 1D4AA 4XPIA 1S0BA 3AR8A 3AF1A 1ODKA 1Z6PA 1GVNB 5K2OA 5IW0A 4FGUA 2XA9A 3KYCB 5K6RA 3E2PA 1YK1A 5DH9A 2OKGA 2HJIA 2DUUA 1QCCA 1DKLA 4PZAA 4CRQA 4AFAA 3LZ6A 3WQSB 4YRDA 4MUKA 3SJZA 3DKRA 1SOUA 5IT5A 4OMFG 5BNWA 3P0IA 2XWSA 2PLWA 3O1IC 2ZS8A 3T2QA 1IYZA 1LPBB 5T55A 3LFUA 2NO7A 4FC7A 1O59A 3UOWA 1K75A 3EBRA 1K7SN 3GLFA 4Q9LA 5FXWA 3F96A 2L17A 5C8CB 4ZODA 4QOSA 2H1SA 4QGNA 3KLPX 4MQLA 2LP4Y 4X8PA 5DIZA 2X2OA 1F8YA 2WZ8A 4PSKA 1YA6A 4XYMA 4MGKE 3VHRA 3ZXUB 1KKLA 3PGKA 4N0MA 4DHEA 3OGVA 1XAGA 1LD3A 4W6QA 2IEDA 2IIQA 4DUZB 3W5HA 2G4IA 2JBWA 2RGGA 3ZQJA 5BR7A 3MM4A 3HUUA 1ADFA 4ZCMA 2PT5A 4JT9A 4IUGA 4UJ3A 3KJFA 4XHXA 2GBCA 3D82A 5E9AA 1COWD 5B2FA 4F4CA 3OEBA 2HGSA 3CY6A 1T0BA 4CDWC 3OOEA 4N3AA 4GP6A 3HZHA 2RDNA 3EHKA 2Y05A 2DBNA 1NY72 4AY5A 2C2KA 4JLMA 3IMMA 3L18A 1VLJA 3E7XA 4QJBA 1R4NB 5BNQA 1C0IA 4HDNA 3GLHE 3ZJUA 5CBPA 3WAGA 3BWMA 1URXA 3HOBA 4KAXA 1HWYA 1SAYA 5CFZA 2ET1A 2WINI 1TMYA 3NHRA 5G40A 4EX6A 4TV9A 3WDSA 4J4BA 5K6AC 2YNMC 3R7NA 3ZE1B 3TTWA 3GEIA 1KBZA 3TEXA 5ACA2 2GN1A 4XVHA 3JPYA 4Y8VA 5FZ7A 4OFXA 4LJ5A 1M5TA 5HKOA 1E2BA 3UK7A 1QLHA 4DRVA 5CFDC 2GEBA 2Y1GA 3VPAA 5EINA 2EFDB 3UW1A 4JSRA 4GZ3A 2Q30A 1E92A 1RHUA 5J5AA 2OO5A 3HEIA 3HGQA 3EY9A 3LSYA 2J9FA 4C0XA 4Q1DA 5CJJA 1RYNA 5JCPA 1CNEA 2CYFA 5FK7A 1GITA 1F38A 4KVGA 1RCTE 2RE8A 2OSVA 2CDNA 3VTKA 2JI8A 2E32A 2ZYAA 5IK8A 3TD6A 3S0MA 1RP7A 5THKA 1VHDA 1KERA 5GM1A 4MW7A 2BOIA 3GGDA 4NVRA 1WMBA 4DYVA 2CGOA 2X5IB 3ZWKA 3IEUA 3TD9A 2OT7A 3GLUA 5T3YA 3Q7RA 1SLTA 4LPSA 2XDAA 3ZFFB 3ZQUA 4JC4A 4QPDA 5HKLA 4DB2A 1GNTA 1EINA 5IPFA 4FYHA 1W1WA 1SUEA 2JFXA 1V16A 1RUI3 1OBFO 1AKQA 3IUQA 2I1WA 5JALA 3UGTA 4Q2FA 4JBYA 2B8MA 5KWJA 5GV7A 3GQVA 2P6RA 1DJMA 3MGAA 4XJSA 3GRRA 2HMSA 3SIPA 5AVZA 4TS4A 1KMMA 1MZ5A 1ZRMA 1XPRA 3OWOA 1Y3FE 2QTVB 5JJ5A 3DAHA 3AEKB 4M87A 1XU4A 1HX6A 2V4UA 3MPOA 2VTXJ 2GNBA 2G9RA 4PW0A 2C7RA 4HNUA 2YB7A 1P4SA 4OK5A 2XUOA 2G0TA 1XL1A 5AJXA 3PL5A 1J1TA 1COZA 2PK3A 1WPRA 4DV6B 3L79A 4F11A 2R5FA 2CHEA 4F8JA 1ZZCA 4YQZA 2QY9A 3UXMA 3M3OA 1QCZA 1YCIA 4LJKA 4G0NA 1Z26A 3VZNA 2GJ9A 4O4LB 2R6HA 1IZ3A 1WSDA 1RYDA 4GWNA 3SBOA 5FOJB 1G5RA 3DGEC 4XQCA 2YXDA 1G9SA 3DHEA 4TUYB 4BE7B 3E5MA 3SQDA 2B98A 3QMPA 2DCZA 1U0SY 5FOTA 1H9CA 4XETA 1JBEA 2OYSA 1HH4A 4XVCA 5E4JA 4PX2A 4JROA 1NVAA 5CVEA 1EWKA 2DUMA 4X5OA 3L0ZA 5IVVA 1ICEA 4JLVA 4ICIA 1GLVA 4G0PA 2COEA 3BE6A 5GZEA 2F4VB 5H83A 2PLV2 3KPVA 4P5EA 2GQ0A 1PJSA 1JDJA 3PG5A 4MV8A 4JP5A 3QHAA 3ZWQA 2YXPX 1UKGA 5I0RA 2B8JA 2WQ6A 4OLHA 2QMOA 1C0EA 1RYZA 1I2CA 2HWC3 2Q9AA 4TLBA 4LZZA 1T4CA 4DUXA 4A2WA 1P77A 1OHHA 1SLBA 5AC92 3NASA 1J2RA 3OHSX 3C6ZA 5FA8A 4M1OA 1PG5A 4YCBA 4PZLA 2H4XA 4YYZA 1DBQA 3PTRB 4NIAA 3G0DA 2JI4A 1IPEA 3LPLA 2Y68A 3QNMA 1DLIA 4G4SO 2HMWA 2HUPA 4QXMA 5FZ8A 3MSCA 3OPWA 2H2AA 3K70B 1NXD1 2HM7A 4RPLA 1ISPA 1PT5A 5K8JB 2O2YA 1G2OA 4DCMA 5FUVA 1ZRFA 1DMSA 2DLNA 4KO2S 1MVOA 3PVEA 2R1DA 4D9JA 4RFT0 5BV6A 1D6JA 3WNDA 4AXOA 1PBTA 4GM0A 1Z39A 2MR6A 1NDQA 4HNHA 5FZEA 3RVBA 4C01A 4OM7A 2OQVA 2JCYA 2IP1A 2WMYA 3O1TA 4FFBB 2YHIB 3L7NA 1KF0A 5F3RA 1ZGAA 1ELOA 4QX5A 3QKSB 4L5AA 4RAQA 2WJVA 2JEMA 3WCSA 2I7CA 2EL9A 1DC4A 2JLYA 3B36A 1PUJA 3UTDA 1DQSA 5KVSA 2RH4A 5EXTA 3ZSLA 3SHRA 3KQ4B 3OY8A 1ECCA 4W5NA 2AEFA 3IV6A 1GTSA 2Z3ZA 1NA5A 3TQSA 1V7CA 5TMEA 1HOTA 3GFPA 3DDSA 3SNKA 3A23A 4MW2A 3AUAA 3JZIA 3WGYA 1Z4MA 2GTIA 1KU0A 3MJVA 1BWRA 3QVUA 4MVJI 3CMGA 2GFIA 2XVXA 4QDRA 3N2IA 2Q0AA 3S99A 5T5PA 1IUNA 3DF9A 1NU6A 5KMGB 1N9GB 3QYJA 3ZG6A 1ICIA 2WIIB 1Q19A 1DC3A 3DONA 3TR5A 3TK1A 2FEMA 5BPXA 3TW8A 1FDIA 4R3UC 1D9XA 1XKTA 4NLLA 3OICA 1YQXA 3PKIA 1M2FA 4WM8A 3RTAA 3AERB 4OLBA 4LY0A 4AP9A 1QH7A 2VG9A 2ZEYA 2YXEA 3A9VA 2A0WA 2PS3A 1DDIA 4A3SA 5JVDA 4R41A 4OPMA 2GZSA 3A0NA 1Z56C 3SZGA 4EW2A 1IRXA 4JVOA 3PJGA 1QG4A 1RXGA 4Q4JA 4CL8A 2QN6A 1BCRA 4HDKB 1RUI1 1I7SB 5EWSA 1WUYA 3UNXA 1BWPA 2WDBA 4RZHA 1JG7A 1MEC2 3TSCA 5CKQA 3RAFC 3U4DA 2C4UA 2GZRA 3M3PA 4I50B 3KHCA 3M9LA 4H6XA 1QB7A 1KPGA 3E22B 1ULAA 3ES4A 2A33A 2W43A 1I13A 3UTCA 3THYB 4AE2A 3RAJA 4FR0A 1NOJA 3H3ZA 4N9IA 3QXHA 1F2TA 1Y82A 4IHQA 4QT6A 4EJSB 3HLTA 1I30A 1UY1A 5LA6F 2IV2X 4X6LA 1FAYA 4O4HF 1VAKA 4YDQA 5DLYA 3LF7A 3UKNA 5JI9A 2EP7A 4XUGB 1UYPA 1PW7A 5B37A 3C3MA 3W5JA 3WISA 3RS6A 3LUCA 1U1EA 5DI3B 4MO9A 4QX7A 4HC4A 3WLPA 4QYSA 4OQYA 2VVEA 2R4TA 1CUAA 1SXPA 2YW2A 5IYYA 5LZ7A 4BQEA 4MGTA 1AGRA 3CPJB 4OBEA 2ODQA 4BVEA 5JG7A 1M73E 4CU5A 1NKGA 2GHIA 4IX1A 4G1VA 1H2XA 4GALA 5FZKA 5FRDA 2RKBA 3PPWA 2ZCWA 4OHBA 1QANA 1ECPA 2UXBB 5BV1A 2AUTA 2QM3A 1OAOA 3AP6A 2DWRA 4TVOA 1UNBA 5A4AA 2R062 5K3SA 4EW6A 3S5JA 2JLZA 4C0AC 2ZM5A 4X7MA 5FNZA 1M2VA 2GSWA 1FUEA 4KLAA 3FHLA 3NNDA 2WYSA 5C3MA 4UFKA 1DIWA 3LBHA 2WHQA 1G41A 5CKMA 3QNUA 5HYVA 1DLCA 2OFPA 5JECA 3HC7A 2BHNA 1MQ8B 4WVFA 4BMOB 4L78A 3V0BB 5F7JA 3W8RA 3JQ6A 4UQPA 2GCOA 2FVYA 4ZI7B 3JASA 3H13A 4HLUC 2VUIB 1T5DX 1YU9A 4BJ5A 4Y1ZA 3GLIE 5TF4A 5I9LA 2ZWVA 1UOQA 3VR4H 3UATA 4HRYA 1FFDA 1QGUB 2HWKA 1WMFA 1RXUA 1AJEA 1JWLA 2DHDA 1BVRA 3ZDQA 3L0OA 4DNPA 2HMAA 4H7IA 4V0NA 3TL6A 2O2ZA 2H1WA 2DFTA 4G5GA 1NXPA 1CG6A 4FZJA 2HO4A 1RWPA 3PI7A 1XZGA 4KLRA 2FRVA 3RWNA 1K5JA 3DF0A 5LC1A 2GBIA 1GMMA 5IF9A 3HU2A 1NSFA 3JQBC 3QLUC 1YLLA 2QX8A 4G5RA 1SXJB 2OECA 4TSFA 5IK4A 1JFFB 3AVOA 4O08A 2C2YA 3UNPA 4WXPA 2WD9A 3C3YA 4Q9NA 3MMPA 3VR5D 2BEUB 3RVQA 4XE9A 2SBAA 2RS53 2FDJA 4GOOD 1DLLA 3RADC 1TC2A 4QOHA 1II8B 1EWQA 1W3XA 4OQ4A 4DWJA 2YXSA 1M6VA 1B2LA 2RI0A 2I2CA 1RE0A 3H2YA 3Q2IA 4ZT6A 3EUWA 3I2OA 4E1BA 2XYRA 2YROA 4FFWA 4P9WA 2WZR2 3GGGA 2JCBA 1I2ZA 3LXXA 1X50A 4D6QA 5JH7B 3DE4X 1O5OA 5EMNA 3ETEA 2QN9A 1H0KA 3WDWA 1KJ9A 3LP8A 1OPOA 1WLCA 1ISMA 4ZREA 1T6XA 5G1PA 3WK9A 3RGWS 1XQNA 3PU3A 4L2NA 1DQPA 1EVQA 3KL4A 3R9XA 2WC2A 3IKWA 1WDKA 2H0VA 5KWSA 5E8AA 3E1SA 1GGEA 3PKZA 2RJKA 4M4SA 1DGRN 1OB2A 4PO3X 1AO3A 3KEQA 4BXSV 1W4ZA 1WOMA 3MW4A 1I51A 1OKKD 3T5BA 4S0XA 1WCV1 4B48A 4JC8A 4L15A 1DTEA 3RYRA 1XZCA 1Z7EA 2IEIA 3Q2KA 4M4RA 4W5RA 2QQOA 1G4AE 1M34B 4F7WA 4MUIA 4NRMA 1ZUHA 1U8CB 4WVMA 5AUPB 1Y48E 3DXYA 5K0SA 1AF9A 4XURA 2CMHA 5SY4A 1PZ8A 3KKEA 4GOKA 4PRYA 4AY6A 5L3VA 1W8HA 1RUF1 3WLMA 3IBSA 4P3PA 2OCDA 4RK0A 4CEWC 2GCGA 4Y2HA 5GQSA 3KJIA 4JEHA 3C3XA 3P9XA 1PFQA 1ZNZA 4TZ6A 3KXPA 2ISSD 1T2XA 3LDUA 1XRMA 4QPIC 4YJHA 2WZPP 1GT91 3IEPA 3VV1A 3EHEA 3AP4A 1TUBB 3WQ0A 2C2OA 3K8QA 1W0JA 3LX4A 5ENZA 5KTMA 3G2KA 3CUSA 4B2IA 4XWWA 4IW3B 3T3DA 4GWJA 8LDHA 1ZDMA 2CEKA 3A4NA 3LQRA 4YS6A 1IJEA 2WAAA 1DOAA 4FFGA 3ZY3A 2DVBA 2BZDA 2RR13 4LMRA 1RUC1 1E59A 5CCXA 3CF0A 3KYDB 5JJBA 3RYHB 1FTWA 1P6UA 4A7KA 1IHMA 3R6SA 2E3JA 3THDA 5EWJA 4DLLA 3RRYA 3R8FA 4D0QA 2GYVA 1G6KA 2ZUSA 3RVLA 1L7EA 4HDCA 5HRUA 5BV2P 1UK6A 3KCQA 4F56A 1UOGA 2GF9A 1J3PA 1APNA 3DULA 2GKSA 4JITA 4J07A 3VBCA 4LRXA 3BH0A 5KHHA 4PS0A 2NPIA 5CLFA 5CIYA 3A9RA 1I1EA 2ZJCA 4FGWA 2JZOA 2WTUA 1ODFA 1W0NA 1OXTA 2Z1NA 1QHSA 3A6PC 2X22A 3W5UA 2II6A 1I24A 1WP4A 3HV2A 3LFIA 3OH8A 1DC7A 7YASA 1V6CA 3KC2A 1OZHA 3MUNA 2X0FA 4AEJA 5C71A 3HEMA 1YIFA 1IUOA 3SHOA 1CDDA 4Q0SA 3BMQA 1BH6A 1F2UB 3ZJ5A 4WNAA 4BO5A 2PS0A 5KTKA 1SBDA 1VLLA 4HDMA 1ZINA 1M2GA 4LBJA 2C0CA 3J7HA 3FMIA 4U9HS 4YRTA 3CURA 1X9PA 3T0DA 4WERA 4LWPA 4L9BA 2PO5A 1BH2A 5LWBA 2BFAA 3B51X 5E0KB 2DV9A 4BNVA 1Y8QB 4DR3B 3HXQA 5KREA 1K08A 4CIXA 1LOAA 3RHZA 1DAEA 1YU6A 2YZ4A 2SKEA 3KQQA 4X3CA 1GO2A 3SDBA 5EJZB 1K12A 2CJYA 1UC8A 2VUSA 4QBHA 4HBGA 1XRLA 3S1AB 1E3TA 4AECA 3AJ8A 1UDWA 1RBQA 2G1PA 1KO1A 1KC3A 5F78A 1NY6A 3P94A 5FOSA 2V5AA 4YM2A 1RR6A 3QU7A 3ORRA 1PEDA 4C7JA 4XDQA 4RZXA 3PQ3A 2P62A 1UKCA 2AMYA 2QJWA 2BISA 2RS51 4EHHA 2E51A 1YAJA 1CF2O 4AO8A 1LBHA 3PF9A 4Y18A 1VPWA 3A9WA 5ESXA 5HJ5A 4ETIA 3FJSA 3MJFA 4RQAA 1RRFA 1Z2AA 1YZFA 3RBXA 2ZJFA 2P35A 4DLWA 1TNRA 1VB5A 4JR1A 4LK7A 3GLFE 4FHZA 1ZI9A 1DTSA 3KOXA 5TEWA 3LOIA 4COWA 1U3CA 3A2NA 1UJ5A 3ZDXB 5ADVA 2CU5A 1OLOA 3VBRC 3EFEA 4R81A 4JYAB 3UXHA 1T9GS 1JIQA 3ZLBA 5LBCA 4PIVA 3MMZA 1PJTA 1JHAA 2GDJA 4QT0A 4MAMA 3O4HA 2F8SA 4OQPA 2BGRA 4W5HA 5K0CA 4KRGA 1W3VA 4A1FA 1LTQA 3F9CA 4KXFB 2ZWMA 5FYCA 2P1RA 3FW1A 1USUA 5DRTA 4QJ3A 1UBUS 3I7DA 3RZKA 2GERA 2QR5A 2GC3A 2ZBEA 3TUJC 2I4OA 3OJCA 2BGCA 2ODEA 4INJA 2V7QD 1VRWA 3PIJA 4B1MA 3R3VA 3SVZA 3EGIA 1N2ZA 3UPTA 4M0HA 4TT3A 3ROTA 4FLEA 3ZFGC 4YV2A 2ZX1A 1XVAA 4KHZA 1KYTA 1RPNA 2FW1A 2UAGA 2O8NA 2FP3A 1KJRA 3C5WP 3GJ7A 2FMIA 1TAHA 3RTGA 2J85A 4WZAA 3PQEA 2Y6JA 2G8LA 3HDVA 4CTOA 4LXXA 1Y9QA 3W7AA 1IUPA 1OASA 4KITB 3H18A 4MUVA 4LY6A 1F12A 4PINA 2O8OA 2EG5A 1KI7A 4DCOA 5EJ1B 3C24A 4WFJA 4PRLA 4FYWA 4L4ZA 3GAMA 3VDBA 2CBXA 1O7FA 2G08A 1SUCA 3U7JA 2BY4A 4HPJB 5FZ6A 4R2JA 1AG9A 1G63A 1SB9A 1HC7A 1NXWA 2OCYC 3EF1A 2CHUA 4OUDB 3ZI0A 2PKEA 1E6WA 1VI6A 4R9SA 4PXSA 3T7RA 4XWKA 5TIIA 1L7NA 4AS2A 3SICE 2F48A 4YLEA 2EXJA 4G8DA 1OFVA 5JFTA 4PPFA 1VP6A 5EJIA 5LQNA 1U2DC 3K6RA 3BCRA 1XEWY 1IPFA 2KHZA 1DX9A 2XT6A 3QOXA 4D3DA 3BMXA 3I9JA 4XACA 1GPAA 3D4PA 1D7OA 1XCLA 1P61B 3GFTA 5JNUA 1DNPA 4N0QA 1H6YA 1QVVA 4PDWB 2F3TA 4CUJA 3H9QA 2RHRA 4J1TA 5FTWA 4J3NA 3SBXA 3QXXA 2WS91 4OI2A 2BWCA 3ES9A 3F46A 1O0CA 2JLCA 5KZMB 1UL1X 4QDSA 1Y5NA 2H7XA 3O84A 3B7GA 2IU0A 3ISJA 1ZVFA 3QLTA 1UWVA 4LFBB 4KMQA 3DTVB 5CT5A 4NMWA 2WN3A 1LNZA 2MHFA 2RCNA 1NJ5A 5I5GA 4BQXA 3ZW7A 3ZGZA 3QEKA 2PRSA 4QM6A 2V9ZA 2VHCA 3E70C 5B3AA 2BP7A 3P2YA 4YW2A 1HPLA 4A73A 3EA4A 4ZEVA 5ISMA 1WLTA 4PGAA 5THXA 5K8UA 4EEXA 4XGIA 3BHMA 2WKKA 4FK8A 4LIPD 1W9FA 2RK6A 3FWNA 4IQ4A 4QB2A 1KS9A 2JFWA 2YBKA 1UEJA 4MRPA 2JAHA 2NVOA 4I1PA 1W6MB 4IZ6A 3VU9B 5CP8A 3A11A 4X95A 1YO6A 4XQGA 2FX5A 1ZLYA 2ZSBA 2VOKA 5KDLA 5IEJA 4NJOA 4M3CF 621PA 2M2IA 1UXGA 4CW7A 3E27A 2WG1A 3EODA 4RA0A 1XOIA 4M2LA 5DAWA 5IVFA 5TQJA 1BHQ1 2JG8A 2ZGMA 3AMVA 3ORSA 5L9BA 5IAVA 1I36A 4CL0A 2VZ9A 5HNKA 2NQYA 4XUEA 3LSEA 4QOEA 3PUIA 1D4M1 4QFCA 2IEGA 4P83A 1EBBA 2BMEA 4PNHA 5FP9A 3FPGA 1IZ8A 4CHTA 1GZ7A 4DDKA 1W87A 4C4XA 2GK3A 2VOJA 3GRPA 1X9TA 2BIFA 2VYVA 1W36D 3IHKA 1CBUA 2X0IA 3R3SA 4PQEA 1O94A 3B5EA 3F2IA 1UANA 2H1HA 2OK8A 3RYKA 2WSVA 1JQDA 1CZOA 5K0UC 1GG2A 5EIBC 2ZHNA 2XA1A 4URZR 1R6BX 3JQGA 2JGJA 1ZREA 3F78A 1VJTA 1I10A 1Z38A 3V6LA 4ERNA 4WHMA 4UM8B 2IYXA 2JFNA 4NQRA 4MGHA 1HMPA 5AUOB 2HQSA 5HR5A 4KDRA 2ANCA 4PGMA 2Q1XA 1N34B 2BBWA 3SZUA 4EX7A 1OHHD 2H59A 4KBGA 1ADYA 5HOEA 3PVCA 5LQSA 3W5SA 4C0KA 1RAFA 2HWE3 3KU1A 4OXYA 5DMHA 3CUEF 1O5LA 3EMRA 3SK0A 4A0RA 1GUDA 2N1BA 1RE1A 4KXQA 5H3HA 3UK1A 3AYDA 2VZEA 5B7NA 3ZHBA 3CUVA 5GLTA 4ARZA 2FWIA 1KARA 3A6LA 2I4RA 5IJXA 3VBSC 2I2WA 2CD9A 1YZGA 1RAAA 2FGJA 3JQWA 5EXDA 1JA1A 3VDMA 4F1WA 4PIMA 5EA2A 3VPBA 4EARA 5KQLA 3AI7A 3PQ5A 1BO6A 1M74A 4LJLA 1B76A 1YFXA 1H0SA 1XCJA 1DIGA 2EF0A 1XDDA 2JJMA 3GNSA 1ZA7A 4XQDA 5KSYA 3A6KA 3L49A 3IX7A 4EHFA 5K51A 3DBLA 2EX0A 4PGFA 2QAGB 4ZZ1A 2IGBA 3K4DA 5MFZA 1H0RA 1KJNA 4E2GA 2EBWA 4NZYA 1CUBA 4ITCA 5FPYA 4QKBA 1R0LA 3X1DA 2ZX3A 4QJ4A 4JQTA 2W1WA 1XN1A 3GLGA 4BAGA 5DVZA 1Y1LA 1YR9A 2IHVA 1NJGA 5AM4A 3DAPA 2OV3A 1JNXX 2PNFA 4RR3C 3RTDA 2W8BA 1SB8A 4A6PA 2GS9A 3FHCB 4QUJA 3L4EA 4D45A 4GDMA 3PYLA 4M0UA 2ZAIA 3LAGA 2WL1A 3AWDA 4EVQA 3PUZA 1C8LA 3P96A 1CRPA 2AZMA 2XR1A 4JR2A 1UBCA 5BNPA 2IYVA 2D7FA 4O2AF 1VL8A 3BHIA 4JX0A 3MCTA 4CIDA 3L7LA 3QPDA 3ZQKA 3N9IA 3SC3A 4NBRA 1Y43B 3GRVA 1NVGA