4K7JA

Peptidoglycan o-acetylesterase in action, 5 min
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
350
structure length
350
Chain Sequence
GLLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 125
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k7jA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k7jA01
2Q0SA 4JHLA 4OAOA 1ESCA 4K40A 1FXWA 1FXWF 1ZMBA 5CD9A 5HOEA 3DT6A 5B5SA 2VPTA 4JKOA 3SLRA 5A4AA 4M8KA 3SKVA 1Z8HA 3KVNA 4PPYA 4K7JA 3BZWA 1BWPA 2W9XA 4OAPA 4RSHA 1DEOA 1U8UA 4K9SA 3C1UA 3PT5A 4I8IA 4JJ6A 1DEXA 2Q0QA 4TX1A 4LHSA 1ESEA 1ES9A 4HYQA 4NRDA 4Q7QA 4HF7A 4JGGA 1VYHA 3P94A 3RJTA 4Q9AA 1K7CA 4H08A 2APJA 4XVHA 4K3UA 3DT8A 2WAAA 1V2GA 2O14A 3W7VA 4JJ4A 1WABA 1BWRA 1VJGA 3DT9A 3DC7A 3HP4A 1IVNA 3DCIA 1BWQA 1PP4A 3MILA 3U37A 4S1PA 2HSJA 5JD3A 1YZFA 1JRLA 5BN1A 1ESDA 4RW0A 2WAOA 4IYJA 1J00A 4DEVA 2WABA
chains in the Genus database with same CATH superfamily
4LGYA 3LGXA 4X1KB 4ZMBA 2ZTSA 2RGNA 1ZL2A 4QDZA 4KK3A 2ECKA 3K9FC 3L79A 5FWXA 3EPRA 3L7OA 3IP6A 4GNKA 4BA6A 4B3HA 1VLMA 1PO22 1RINA 1W5TA 4P3YA 3C3YA 2EFEB 5I3CA 1SQ0A 1PT5A 1NLMA 4IGFA 5L3ZA 1AU9A 4B5LA 5AI9A 2WFF3 4UFKA 1WNFA 1PX0A 5IZCC 1T0UA 3T0IA 1UK9A 2K7ZA 4KVGA 1L4BA 1ZJYA 1M06G 4JR0A 1NXD1 2WFF2 4OMFG 1CFJA 3I45A 2CHVA 2HRCA 4A0HA 3LHDA 2SKEA 4R8KA 4IVQA 4L72A 5JO0A 1P0MA 3R8FA 5FBJA 4BV8A 3GIWA 3RFRA 5FPVA 3SJAA 1Y9MA 3BWVA 2B5WA 2DBVO 2BKXA 1JMUB 3WD5A 1T8RA 1JLHA 1VHDA 2REBA 3HCPA 3IJEB 3BBPA 3MILA 4GMDA 2BN4A 2Q1YA 4M83A 3B78A 4Y2TA 5L7YA 4EKYA 3PEFA 3NBUA 1AJEA 5DGTA 3FLRA 2E53A 5LMNB 1U9IA 3D5TA 4QMAA 1RQPA 2K4MA 3KQWA 4D9GA 1KQOA 4YJGA 3BGSA 4BCCA 2BEVA 1DIBA 4M87A 1YOBA 3NHYA 1PYOA 3K3OA 2KE5A 1S01A 2FMXA 1BXHA 3T34A 3GCWA 5JPCA 2Q8NA 3ZM8A 5IYZF 4UPVA 5BSKA 2YWJA 3AL2A 1E64A 4EWAA 3UANA 1U8EA 4CDWB 2PKCA 1MVEA 3HSSA 5E3IA 2REXB 4ET7A 2Z2YA 5GLZA 2O0MA 5LZ7A 4JA2A 2A1UA 3BFPA 4P9NA 3R0XA 3D8CA 2C2ZA 3TFQA 1G7CA 4OH7A 4XWWA 4ED9A 4DIUA 1D6JA 5F12A 4YM1A 3L6CA 4R8VA 4LOSA 5FBHA 2E21A 4QPIA 2OGTA 4EGAA 2P9EA 3E8MA 4M1MA 1QZ3A 1LDEA 3W3ZB 1PNOA 1EGHA 3QVOA 3RYCA 1ODNA 4JI6B 5A1AA 3POFA 1YHZA 5FUMA 4NROA 2NU8A 3IIAA 4RF2A 1JLSA 2WNIA 1RMQA 4DR7B 3UGHA 2H1HA 4F9FA 5F3DA 3ADCA 3EAFA 4J0KA 5JLJA 5EPEA 1EUYA 2OBLA 5ITVA 1J5XA 3CTPA 3TDNA 5E1RA 4JKOA 1OWNA 3S1SA 4NBTA 2TEPA 5FR3A 3CNHA 4DZZA 5SV2A 2AEFA 4BASA 3HJBA 3KZXA 1Q84A 2DY1A 3AEQA 1NLUA 4B09A 4LK2A 2X6RA 1E57A 1WHSA 5JCOA 3JTMA 4JP8A 4FKZA 4J9UE 1J0AA 2Y60A 4HGYA 4O4IB 1UZYA 2Z79A 3PURA 1OB2A 3RF7A 3U3OA 1EB8A 5DX0A 2OQ7A 3PQ3A 4BLUA 1V8ZA 1EZ4A 4OSPA 4ZIRA 4WW0A 1JJVA 1ZUNA 4RXUA 3D02A 2C9BA 1WW8A 1UR5A 1AE1A 5BV6A 4XQ9A 1U0EA 5BNQA 2PKYX 3KX2A 4LF9B 2F8LA 3GLHE 5COAA 4OK3A 1RHJA 4QPGB 1EFPA 4OL9A 3AWDA 2JFGA 5FWAA 4KZPA 1XALA 5TGDA 4E3WA 2BSAA 4A7PA 3GV0A 5DHUA 4TS1A 1BE1A 1U4NA 4EECA 4DUGD 3FIJA 1AR72 3GK3A 3PQ4A 5EE9A 1VE5A 3ZWAA 2RGRA 2XQFA 4GVPA 3TL2A 2F00A 2ZPTX 2C9CA 4GYJA 3NS7A 2WRAA 2OQIA 3FOAA 1Y9QA 1I7DA 4B84A 2W6OA 1PJZA 1HF3A 3P45A 1G8GA 3L0ZA 3MWEA 3D3QA 4D7SA 2YCLA 1DIWA 1W4CA 5HF8A 2JCVA 1S2EA 4BOYA 1M33A 1IAQA 1DAFA 1OIWA 1T8WA 3A1SA 5TS2A 4IZOA 5E8RA 1I2CA 2WV9A 3GYGA 1GT6A 5HRUA 4JLSA 3PUWA 3C98A 4OXXA 4MVJA 4C20A 4OX9Y 1NFFA 4S35A 3N2YA 4QUEA 4F3RA 3I2OA 1L5VA 2IE8A 2VF7A 1SLBA 3LT2A 1Y81A 1ULHA 3GPLA 4WZBB 1ULSA 5C1BA 2O8NA 3S2EA 4DPNA 2G1MA 4Y2XA 3BQ9A 1CX1A 3HSKA 3ZX7A 3R4VA 4YVSC 4RN5A 3L3BA 3FPGA 1XRPA 4B3SB 3D3WA 4C08A 3L9WA 2PBFA 1RAFA 1VHWA 4GKVA 2A70A 3O4JA 5A4JA 4Q4DA 2RJ3A 2LZ0A 1COWD 3TR0A 2BHNA 5DSTA 1ZVMA 3MIBA 1C4WA 2J0VA 2VQSA 5C7YA 2GDJA 5E38A 5EE0A 1LBEA 2X3UA 4ATEA 4KLRA 3ZWYA 4LK3A 2HPZA 2EZ9A 5EZYF 2XKKA 4HMZA 1EUTA 2QW8A 3DTYA 4LQDA 2ES3A 4HUQA 2PXJA 4C03A 2NADA 1USVA 4PHHA 3N2LA 5SZIA 4QTUB 4WM8A 4LY3A 2RV9A 1WUVA 4LFCB 4DUZB 5DDJ1 2YY7A 4QU8A 2D5BA 2P35A 4LXTA 3FFXA 5AVTA 4M0HA 1RWKA 1KYWA 3K30A 3QW2A 1HRI1 2RGNC 4XFDA 3QYJA 5BN1A 4J6GA 3U9SA 1DKQA 4ZAWA 1KDVA 1XVVA 2WIAA 3E7XA 4WWHA 2XONA 5EQTA 1I3NA 1O6GA 4OQYA 3VPFA 4BV3A 3C1OA 2AHRA 4FQ7A 5FUIA 2DT8A 1LFDB 3ELDA 1O96A 3I9MA 3TMAA 2QIPA 5TQJA 4QNMA 3WMXA 1AX9A 4MRSA 3C8DA 1VRH3 1DJLA 5AFEA 4TRNA 4HLQB 3TSCA 2Y6JA 2IV7A 3F95A 1MABB 3ETNA 5DF1A 1H3EA 1GLVA 5ARDA 3M49A 3NT2A 2UWAA 4F2HA 1XX6A 4A6DA 3FUVA 3I92A 4GIQA 1X70A 3ZDXB 1VG8A 5A5EA 4Y4RA 1E6KA 2AV6A 2C0QA 2JFFA 3DZCA 1WMDA 1W6NB 3ROFA 1ESDA 5HG0A 4EVIA 3W20A 1ML4A 3I2GA 3VSDA 2O3UA 1KYZA 3TSOA 4RKEA 5ALLA 2HEVF 3KBBA 3AUFA 3WNZA 2D1FA 2B25A 3U07A 1JWAB 1O6FA 2GEFA 4NIDA 2WDZA 4DA9A 2DCKA 3H9UA 3G2PA 2J5XA 5C5CA 1C0IA 2VCAA 2QRMA 4WFKA 1KHHA 121PA 1CP3A 3FCAA 3BWXA 2Y4OA 3A9UA 3H3ZA 4UMEA 2W2MA 4A26A 4R40A 1RRPA 2FRVA 1J1TA 5TE9A 4S0XA 1E6EA 5IULC 1YL7A 2VNRA 1OASA 4JBYA 2Y99A 2IHBA 1X80A 4DNPA 4RK1A 4GIBA 3I53A 4QSMA 5TPZD 4F6LA 4FCVA 3GLHB 5I01A 3S29A 3OOXA 2JJ6A 4QX2A 5C8YA 4WJLA 3EF3A 3IN9A 2G17A 1ZLXA 1O7FA 1RS0A 1J2TA 1DIGA 3H1MA 2Y27A 4BXOB 3TLKA 1RE1A 2O1WA 5JTTA 4D81A 1JP7A 4TTGA 5KTYA 5AW4A 4I99A 2COKA 2FE4A 4YNIA 5DZGA 4DA0A 3T3DA 1UXHA 3OZAA 2AC7A 3T2QA 1APNA 1V5IA 2P40A 5CLHA 4BHTA 1QIKA 4EI2A 4J1WA 1UDRA 1TYZA 2OBBA 1ULTA 4KO1S 1L5NA 4DY4A 3OI7A 1IQPA 2D98A 2WNSA 1E92A 4IEVA 1M8KA 2ET1A 5EP9A 1PEYA 3SSOA 3HM9A 4FEAA 1W7AA 1HFKA 2YV8A 2BI8A 1BZYA 1CVNA 4EGFA 2JH9A 1E2UA 3LRXA 2JDHA 3AVSA 2NSLA 3R2JA 5T5QA 1QRTA 2QPLA 3D6EA 2HQSA 3MWDA 2QP4A 4IMPA 1PGOA 3AR6A 3MUEA 4LW8A 2PN1A 2XR1A 4D8WA 2A5YB 1OREA 3KT0A 4ZT2A 2B7YA 1SKYE 3SD7A 4KPEC 4D6RA 4MV6A 5FH9A 2OP0A 2YQ4A 3TQOA 2JJ2D 3I01M 5FPSA 4IILA 2V72A 2F7SA 4D9IA 1CUCA 5IAVA 3KXLA 1MFZA 2JLUA 3IPRA 1DTSA 2QJTA 1DADA 1HLCA 2VTVA 5F23A 4WV3A 1EX9A 4BMDA 2QMQA 1ZH2A 3T5CA 3QYPA 4OHUA 1K92A 1D09A 1GQFA 2QBYB 3WLHA 4OHYA 4B3TB 4M1ZA 5TQ2B 5JD5A 4LVOA 3VPXA 1UKBA 2FUCA 1G9AA 5CDFA 3BCHA 2PGOA 4V0RA 4F3KA 1DO0A 2GYUA 5IAJA 3SC2A 2I0FA 3QITA 5GONB 3WTCA 4CKBA 3DR5A 4QXQA 1OA0A 2C04A 3STYA 2B21A 4WY2A 4QPGC 1IRXA 3R0RA 3D6FA 1W30A 2GC1A 2H8GA 4IF4A 1X1EA 3IE0A 3O2JA 2NUPA 3BN3A 1YO8A 2XRZA 1I1EA 3D6TB 1L7PA 3BGVA 2XGOA 1UPCA 4H15A 2GD0A 2E32A 1EFVB 3H17A 1CETA 4FPFA 2FMDA 4AXOA 2JI9A 1N2BA 3ZHOA 1I6WA 2H2FA 3BOPA 5D5HA 1KMQA 1HTTA 3OQ1A 4DLZA 3PNBA 5GVSA 1N9KA 5FB3A 3PQ6A 3B3AA 3I12A 3PI7A 1ZJ6A 4S1PA 3BIEA 3TSWA 5TSWA 3ROEA 4IUCS 5DBFA 3GNSA 3G89A 4J6FA 3UAWA 4URZR 1TNFA 4FFGA 1J3PA 3E9QA 1TYAE 4AXBA 3W5DA 4YQZA 3GEGA 3PEEA 2WUVA 3W3AH 2ZU0C 3BB1A 3H5AA 4QOIA 3UATA 2O8BA 2A9OA 5HOQA 1VBC3 1Q3HA 3HJFA 5FTMA 4Q0QA 2C7BA 3BJEA 1NY71 4PSKA 2PAMA 4DUWA 1GR0A 4LZJA 4N8EA 2PLV1 4K1YA 4E88A 3CNOA 2J1SA 3C6XA 1UEJA 1ELOA 4AZWA 4HB3A 5DXFA 3BHMA 2V09A 4U0KA 4AFNA 1U8FO 3P71T 4LZOA 1ABBA 4RGKA 4YR7A 3DL4A 5BV1A 3HRKA 4KGQA 4UFOA 3KVYA 1ZAKA 2Z8YA 3FZGA 4I2VA 2VHYA 3LUHA 3RYIB 1CUYA 5AOCA 1NVVQ 3L6OO 5K0GA 3NKGA 1ZC3A 1WIWA 2G7ZA 5FTKA 1NYRA 4JDPA 1NXMA 4QQLA 3F2ZA 1IXRC 5ESDA 1PG5A 3ASVA 1Z22A 4KRXA 4KYUA 3GYBA 3SC4A 1O94A 2R8PA 1XNDA 1CZHA 1YZFA 4WNAB 1PT6A 3WLRA 4LJSA 1XNAA 4DR6B 1NCQA 4LMRA 4IW3A 2OY0A 5FF9A 4IFEA 2Q0SA 2DTEA 2WR9A 1NUUA 5TPWA 2PMCA 1W03A 4NCHA 5DLQC 4HD8A 4JU8A 2PUFA 1UM9B 3TG8A 3L7AA 3PPYA 1BX0A 4FS3A 3O74A 1CY2A 4YMSA 5KC6A 2VUDA 3GNLA 4B3IA 5CNAA 3GJBA 2HD4A 3NTLA 1P2TA 4KFCA 4BX0A 2BRUA 3W21A 2WQ8A 3WW1A 4JYBA 1Q43A 4RV5A 3RGGA 4DM3A 2VSNA 4YRSA 2VEDA 4FSXA 4F38A 1I1HA 3HWRA 1PWXA 2MSCB 1RLTA 1TCAA 3FZQA 1R8XA 3NZEA 4EHBA 5L19A 1C9MA 1RYZA 3D7NA 2EIGA 2NXJA 1VAMA 4U9UA 5JTUA 4OI4A 5HCIA 2C7PA 2UUPA 1QQ7A 2XUPA 1OAOC 1RI2A 4N43C 3R6LA 1XZBA 2I7DA 1EIWA 1K08A 3WKBA 1FDTA 1MB9A 3GROA 1PL7A 2HYKA 3L4SO 5IFTA 4WTOA 3THWA 2YDEA 4M38A 1JEYA 1CULC 4A92A 3OFVA 5I7EA 5F6LB 1Z08A 1RUI2 2X0DA 3QVXA 1JDTA 3PDWA 1UAYA 3N74A 4KE6A 1E94E 4RX1A 1EE9A 4OO3A 4KIFA 5K4AA 3NRJA 4PC3A 2IKSA 3GT7A 3H5TA 1JKMA 3E1KA 4BCDA 5JS6A 5C4GB 4CUAA 4RTKA 3SF8B 1NG9A 1UF9A 1EAYA 2XWPA 2AMVA 3IM0A 4WT7A 3ETHA 1K86A 4F96A 1Q7BA 1FZQA 2XYQA 5T3NA 2W58A 4FEGA 3WXMA 1X7YB 2ZTNA 1PF7E 2DFVA 3JD0A 3C8HA 3V2HA 4NRQA 4DBLC 1GZCA 2OT7A 1T4GA 3OMXA 3HBMA 4QHBA 3WYAA 2MEV3 1C4XA 2DE0X 2Z5WA 5FPQA 4OBXA 1R4NB 3KQQA 4B9AA 2PM8A 4ML3A 3KT1A 1TADA 1P5ZB 2Z09A 1JRLA 3PJYA 1YTLA 1POV0 5HFJA 3IMCA 4V39A 3RRJA 2CLFB 1I5RA 2O48X 2J41A 5K09A 3G0IA 2WAXA 4W1RA 1V37A 4MR7A 2LBPA 4NNJA 1FTGA 4A6PA 1PBTA 3AUXA 1CEEA 3T2PA 2Z2ZA 1K4YA 1XZPA 1PT8A 3TRJA 5LZ5A 1OFSA 4LXHA 2GNTA 5K8UA 1WLDA 2R96A 2PA3A 4PZZA 4HNTA 1H4SA 4EY3A 1QTNA 4HN0A 4BAUA 5LUAA 2VECA 1N6NA 3PHHA 3L1KA 1KO4A 2F62A 2RDQA 1AK9A 2UXCB 1RGSA 2Y1EA 4XETA 3OUZA 4M21A 4U7GA 4EN7B 4UATA 1NMXA 2W87A 3FZNA 1NVXQ 3CR8A 2J1EA 1RHI3 2L2QA 1SFPA 1MW9X 4DMHA 2LDXA 4HY3A 4DQXA 3RAEC 4GOMD 1BWQA 3CG4A 4KQ6A 1EFLA 3I6QA 4LT5A 4QFMA 5A33B 4R2IA 3N9QA 2I9KA 5KR7A 1XJWA 2IDZA 5KMGB 4BS9A 3IH5A 2JGDA 1JAZA 1GPH1 1U3GA 3FA2A 3MUNA 3B89A 3MUY1 2VZ3A 2IIQA 3QMWA 1S2IA 3OFNA 1SVWA 4QB6A 2B1RA 3GUCA 2VMHA 5AC91 4KWTA 3UC9A 5B58T 4IZIA 1RUI1 2J32A 3FUCA 1X86B 4N47A 1H2KA 1U8UA 1O89A 2IXGA 3VVCA 4BKRA 3RMYA 4GB33 3U4HA 1QZUA 5EGNA 4CQNA 1DG1G 1CY8A 3C5VA 2NT3A 4M9RA 3PF8A 3OQPA 2J87A 3FLAA 1JAYA 2YRXA 1N3QA 5J2TA 3EPHA 1YZQA 5EJMA 3BRWA 2O23A 3KG2A 1KZ7B 1QH8A 5EE1A 4XYMA 4XZPA 1ODTC 4K9QA 4E08A 4EEKA 3L8EA 5KNDH 2WKWA 4M0PA 4PYQA 4UE6A 1UDBA 1YBHA 4MV9A 4D94A 2ZRAA 1O96B 4L51A 3TSAA 1R0XA 3IEVA 2ARBA 5K8CA 3NC0C 2ZBFA 1YGYA 1ZXXA 4Y2QA 3ME2A 1BGWA 4M01A 1JS1X 4C14A 4PBTA 1NKVA 2R061 1VBC2 3THOA 2QRVB 4LDAA 1XVLA 3OU6A 2XQRA 2EX4A 4MO2A 4TRJA 2DR0A 1NCQC 2NZ2A 1T36A 1Q0QA 2PSEA 1SR8A 2R5FA 5FBVB 1QPBA 4CKYA 4GE0A 2ZYWX 2Q6OA 1N2JA 2QJRA 2ZM5A 4BO3A 3FFZA 1IEXA 3VBOA 1ZVQA 2P1ZA 4DKJA 1WW7A 3RGWS 3VNRA 5KJ6A 5A6VA 2NU9A 1H9PA 2WMOB 4MVJI 4HSLA 2J85A 5J40A 1XAIA 3UOAB 1J0XO 2WU4A 5JJLA 4AGVA 5HJ7A 2VM9A 5DB4A 1VBE3 3AB8A 3D3KA 2HADA 5FEMA 3PDIA 3KL2A 1RRMA 2IF2A 3RSFA 1CQJA 1MZVA 3POBA 2E7TA 2FV8A 3CUTA 4DBVO 3GCXA 4JRAA 1E8DA 1K8XB 3L4BA 3X3HA 2VK1A 3AUSA 1AGRA 3AP5A 3NEAA 2FHSA 1JKJA 1P9RA 1RI4A 1S0CA 3LDKA 1XSRA 5AQ1A 2UZAA 1KPIA 1NWHA 4RSRA 1AKTA 3TLAA 3UGTA 3WGIA 2YVKA 3OEWA 2A5DA 1USUA 2G70A 4JQOA 1X7YA 4ASKA 2CHGA 3HR9A 3POEA 1XKTA 3MLEA 1DQSA 1QYRA 3PE4A 2JC3A 2NQTA 3DBHA 4UU0A 2PQMA 4WINA 1GP2A 1AV7A 4LKFA 2JD2A 2FPSA 2POQX 1W2NA 3CSUA 1TOAA 1DEKA 1ECCA 2B9EA 3JQQA 1C1XB 3UENA 1OKOA 4RGGA 5ALYA 2E51A 3HGQA 1MIHA 4E5YA 2F1IA 4WLFA 1KJNA 4J0FA 3TE7A 1IZ8A 2BOVA 1Y7LA 3DXFA 1R4MA 4KQWA 1VJGA 2EFHB 1TA0A 1V39A 3F46A 3AVYA 3USUB 3KTFA 1MVQA 1N2CB 5AC93 2XGSA 2PKRA 3R0VA 2JEYA 3H8VA 3B1WA 3HCCA 2PCJA 1HJFA 4Q4W1 4BZPA 3GOQA 3HJTA 4PCAA 1C5IA 5A3JA 1S0FA 4IIJB 4XEZA 4FIZA 3WW2A 2ZETA 1TW2A 1UZNA 3KCQA 5K2MA 2J5QA 1K3TA 1KHTA 5IK5A 4FTSA 4N43B 3BMOA 4IDZA 4NHOA 3NI2A 5SV5A 4CT4B 2ATEA 2Y38A 3JD4A 5FR1A 3A4TA 4E09A 2JGFA 3T4VA 4HGRA 2JAUA 3KB1A 4NE9A 1VL2A 2BMEA 1MG0A 1EK1A 2IYEA 3I1IA 1BMTA 4O33A 1TMKA 2K7FA 1A5AB 3AZVA 3VDDA 2E48A 5FV7A 2AVNA 2I6XA 5TPWB 5DE3A 1LEDA 4DAEA 2XJPA 3W6OA 3QEMA 1K8RA 1AQJA 2XBO1 3QKIA 2HZ7A 1PNQA 2VNHA 4EVSA 4RZ2A 3R6SA 5DHQA 1YBVA 2TMYA 3AP2A 4PO1A 2BFDB 3JARB 4FX2A 5ETJA 2F3SA 5HQ3B 2ZI7A 1YC61 5K8TA 4HX2A 4BMXA 3KPJA 4A2UA 1RJ9A 2AF4C 1JEQA 4KOEC 1U2GC 1VE0A 4LX0A 1HMPA 1NDHA 1RZRD 1JPVA 2OTCA 4Y8VA 2WY2D 2GN1A 1VCHA 3L0BA 4LTNA 2H16A 1FOD2 2VHWA 1KI4A 4B3CA 5K6AC 2XB9A 2MEV1 1CJKC 1O4TA 4OUEA 1LXCA 4ND5A 3WLTA 3O8CA 2QDXA 4GM1A 5DKFA 4YRRA 3AOEA 2VDMB 4O4HF 4AF6A 1FRVA 5B30A 3O1JC 4MDFA 3EHKA 3WMGA 4A8JA 2MU1A 4XX0A 3R9KA 4JL8A 4WACA 4UBKA 4FP3A 4A5OA 3OHPA 5B2ZA 3L07A 1YOVA 5KVVA 4NBRA 1U94A 3BE6A 3CU7A 3WHKA 1DGQA 4F6RA 2ZS7A 3T08A 1OFUA 2WRZA 3WLNA 1NVFA 3J9SA 3K7EA 1LDMA 4IV8A 3OEAA 3LZDA 1CV2A 4AUNA 2IEIA 1Z2PX 2GZDA 1RVF2 2XOXA 3T7KA 4KJZA 4CI0B 1TJYA 4RKQA 5HOEA 3LUJA 3QOFA 2AT1A 1U11A 3ZK7A 3NHJA 2FW0A 2PMKA 3A1EA 2PXXA 2ORZA 2UUOA 5CVUA 2PELA 2WI8A 3REGA 1FJ2A 4TROA 4GZ6A 4HB2A 2GILA 3FOEC 2FSHA 4IJWA 1X1CA 4IQGA 5ESWA 1BAPA 1OX5A 4XFGA 4XQCA 2FDJA 3EAQA 4ZRDA 3QLUC 1BC5A 3HU3A 2ENRA 5J37A 4PXYA 4L15A 4ISCA 5CA0F 4RCVA 1PIV3 1AL22 3COWA 1H8TB 4GI1A 4K88A 1WV1A 4PIYA 4EV0A 2F1JA 3DMGA 1M2KA 2RDRA 5KSPA 2JDYA 1VG1A 3K53A 3ZFFB 1B09A 1POV1 2WIFA 2ZRQA 3X1WA 1B16A 2H1WA 4LNHA 4RVOA 5K05A 1BVRA 2AFIE 3H5OA 3NTQA 4FVTA 3VTKA 3EC2A 5CFCB 4LEIA 5JLAA 1A77A 4M8LA 1V26A 2UYBA 5JR3A 2I2FA 2OSBA 3KKOA 3OO0A 2ARAA 2DBYA 1DAKA 1PI3A 1Q6YA 1JIXA 1S89A 3E9DA 5A4MS 1Z7YA 4LOTA 3FCEA 4Z82A 4P58A 3RT9A 5AVOA 4RHXA 5C4WB 2IYNA 3MIDA 3V0AA 3N3AC 1F2VA 4DY6A 2OQVA 2NACA 4NPMA 1GHTA 4MKGA 1A1SA 1NFQA 5D3ZA 3TZBA 4IJUA 5BNPC 1QNWA 1IEQA 1TT7A 3FSRA 1OU4A 4YRIA 5C8VA 2VOVA 2OQ6A 3I5MA 1QHGA 5C34B 1T4DA 4CM8A 1E6LA 2F3TA 3RS7A 1YS6A 1SC3A 5L7OC 2AUNA 4Q21A 3CX6A 3BMCB 1M6HA 1PKXA 5JALA 4QGMA 4BKUA 1GAWA 1JIIA 1K6JA 3L77A 2R68A 4OB8A 5LBBA 3DEHA 3QU4A 3TXAA 2NMNA 4URTA 3GOHA 1QH7A 4D4HA 4D42A 1UBFA 3VNSA 3CE9A 4QKFA 1OROA 2R6ZA 4E4SA 3N86A 4BIMA 4CEIB 2ERXA 2X77A 2HKIA 2F55A 2AUYA 3U49A 3ILFA 3OZEA 1KP9A 1QAOA 2WNUC 3D6JA 5C7LO 2OCIA 3BDVA 1EVZA 4ESOA 1QV9A 3BZBA 5EPAA 2AD5A 3LG2A 3VC1A 2EALA 4D6SA 3HKBA 1N6RA 5ES4B 3SEAA 1Z39A 3BXHA 1KKUA 4I55A 4MLOA 3JBG1 4UOZA 3BHNA 4M9SA 1TEZA 1I7LA 2AWOA 4CTJA 2KPOA 4FDLA 4WMLA 5AJVB 2ZB8A 5IVIA 4O25A 3FAZA 1OGIA 2PZBA 2NOAA 3SZGA 3J7AC 2ZTLA 2B3DA 2OXRA 4GMXA 1Z8NA 3IKMB 3V8QA 3FOWA 3KJQA 4FLFA 3VBOB 1W9YA 5IF3A 1U6IA 1M0EA 3ES9A 1X74A 1KIAA 3LHKA 3ZY2A 4ASUA 2QUOA 2ST1A 1MNAA 4RKYA 3QW4B 1OI4A 3QBEA 1UBSB 3ROPA 4LDQA 2YFZA 2PXAA 3V97A 3OAAD 4KC0A 1HRV2 3B7GA 4G09A 4OFGA 2WVHA 1E2PA 3BULA 1SCNE 1U8AA 4MLPA 4X1IA 1TE2A 2BHRA 4A45A 5A1FA 1RT9A 4ZOLA 1RUD3 1C50A 3OQBA 4M1EA 3ICVA 3I73A 1ZUIA 5BY5A 4KE8A 2PX3A 2WWVD 2NUAB 1C3OB 4JLKA 4UXHA 4YGCA 2CDRA 1Y3BE 1XD2A 4RYDA 2A1IA 4YSFA 3VBFC 1GGKA 1PU2A 2P0EA 2OORA 3WGMA 2BP6A 2NLRA 2H85A 5EZSA 1NE2A 2HRZA 3W6PA 4LQLA 2EQ5A 5IAXA 3A6GA 5CTAA 2R79A 1NY72 4LXYA 3WA7A 4U8HA 1TUBA 3UO8B 1Z16A 2WG0A 1KBQA 5CEJA 2YIJA 2PG3A 5ALEA 4UZFA 1DQ6A 1MLDA 3LHSA 2F59A 2X5OA 1CF9A 721PA 3EOAI 1DLIA 4MB2A 2BFEA 3OY8A 3JQWA 4C7OB 1AOXA 3OQOA 5CJPA 5LBFA 3FMPB 2WZDA 1BBT3 3JW8A 2R44A 3OE7D 4R8RA 2ZIFA 3U09A 2GXUA 1W96A 3IRUA 3OIUA 4FYKA 2BJHA 4MO9A 4R2XA 4IHQA 1AH2A 1C8M3 4KDEA 3FDIA 3PU3A 1H9AA 4CMCA 1CNMA 1EAH1 3RANA 4X8LA 2BBWA 3REQA 4Q01A 1OVGA 3JVIA 5HK8A 1VBA1 3I1FA 4OULA 1JFFB 1RAAA 2FMYA 3E3OA 5KC9A 4BXSV 3PIIA 2VH2A 5C5TA 1GU1A 1KQ3A 1U6KA 4RIHA 3BCUA 4RYLA 3ZFEC 4Q1CA 3PL0A 4U7JA 2AEJA 2GF2A 2C5EA 4JYCA 2V1XA 4H6XA 3RLIA 2J3JA 5DTJA 1W0OA 4DB5A 4Y0AA 5IAOA 1GADO 3W1EA 3LI2A 3EDOA 3KHCA 4PX2A 4WIAA 4J91A 4AKHA 2FSVC 4FTBA 5DAVA 4ETIA 3U7RA 1V8DA 2W00A 4S1NA 3WDTA 1GVNB 3KAJA 4MKHA 3PJQA 3ENRA 4KIWA 4KWLA 2AGVA 1SXJE 1L4GA 2VCHA 2LW8A 1SBCA 1ID8A 5LR6A 5EJFA 4TL7A 4FHCA 1RQNA 2WG1A 4FE3A 4RQUA 2WUEA 3U7JA 3EJ6A 2PZJA 1PJBA 2PL1A 3D8SA 2NU6A 2XF8A 4F2DA 4R9AA 3GFSA 1KEUA 3WQHA 3LX4A 5D2AA 4R6XA 1J59A 1HZZC 2ODBA 4E94A 1C8M1 5IHPA 3RVHA 3NWJA 2HHHB 1Y42X 1YIFA 1EP9A 1DKPA 1HGXA 4NCKA 4BVGA 2FR0A 2QZPA 4D4JA 2O2IA 2UYQA 2VP5A 2AUMA 2GS9A 4AVSA 4JP3A 2WF6A 4MRAA 1TJ4A 3VGIA 1BDJA 3QK7A 5K03A 4DV5B 3ZCVA 4K8RB 2ZEZA 3S5JA 4AFMA 5AKIA 4FZJA 5EMMA 3CW2A 5H16A 4EA6A 2ZBJA 3Q3GE 4XD7D 1A4XA 4JI8B 2ZBGA 3VO9A 2VZVA 5KOHA 1XU2A 3GEBA 2ORWA 2NO6A 1NXPA 3HTXA 3B6JA 2JE9A 4NJMB 1TQ6A 3LNCA 4AQTA 4M1OA 4MHUA 1OLOA 3ZV3A 1P3Y1 3R24A 2WSIA 3ZFFC 1JE1A 4BRUA 5CEEA 4TT3A 3D4IA 2GEUA 2I2BA 3PIDA 1TKCA 5JZGA 2YMLA 5TEWA 3EVFA 3UWOA 2IDKA 1WLYA 1XQ1A 1IIBA 1P9OA 2IGTA 2P4UA 4QBHA 3U4XA 2AEMA 1LLCA 3A0RB 4IEFB 10MHA 5JC8A 4NZZA 4HX5A 2ZAHA 3DF7A 3DCYA 3QZUA 4QPCA 3TWIA 4NS1A 5E0KB 3PVCA 4KGZA 2P69A 3M6LA 1AHHA 2C20A 2XJVA 2W2IA 4CPBD 2QDKA 4Z0TA 3A4YA 1K6XA 3EN0A 4ZVSA 4PE5B 1P0PA 3G7DA 4JQYA 1AA6A 1US8B 1AF7A 3H2ZA 1O0SA 1OVMA 2E7AA 2DCMA 2JGJA 1F6DA 3I0NA 2WSUA 1SXIA 1ENSA 2GWHA 4V0LA 2R4TA 4EY6A 3EB9A 1EXWA 4Q9HA 3HXOA 3TM4A 4PSVA 4LS3A 1H85A 3CXUA 3FHQA 5EWMA 3Q8CA 3H19A 2CWSA 1TQ8A 1VCOA 1SXJB 2UXBB 1OC1A 2YUEA 4K1XA 4MR9A 2B37A 1V1RA 3EW7A 1N1YA 1W0CA 4V0NA 2I45A 1OF3A 2DBRA 3DULA 5HBGA 1VKJA 4JC4A 5K6TA 2IP4A 1V11A 3NHFA 5L95A 2YHUA 4TLLB 1LGBA 2HA2A 4PONA 4YPFA 4TM7A 3IA2A 1Z2NX 3VKLA 3BRSA 3F1LA 3VBHC 4GLOA 3SZOA 1FDIA 2A6YA 1D6SA 5LD2C 2Y1CA 3RFTA 4GPZA 3T5AA 4NICA 4WBNF 1OF1A 1RUD2 1ALYA 4N7IA 4D6QA 5FZOB 4NYJR 2IXDA 5CH8A 3JD1A 1U7PA 3EIFA 2P1RA 3L0YA 3ZCQA 3AJ9A 3B6IA 3NFRA 4D9BA 2Z42A 1ENZA 4V2VA 1N7IA 2VUTA 3LWZA 4HTFA 1G3IA 1O8SA 2XVKA 1ZONA 1T5SA 4XWAA 3IULA 2G19A 1U65A 2XDYA 3K6KA 5KAMA 3TOZA 4AFAA 1QGUA 4Q00A 4QGAA 4GWKA 3DKQA 4KGDA 2OXEA 1T15A 1V7ZA 1NJ1A 5BSHA 2F1OA 3L7DA 1FBNA 5JSHA 1P74A 2B4AA 4D8UA 3KEFA 1XXNA 2PVSA 4QRDA 2RE9A 1W4AA 3L92A 2ZAGA 3CZJA 2ABWA 2P68A 3CBGA 4GRDA 3TBKA 3CRW1 3HUFA 4GP7A 1DX9A 2QT0A 1GRNA 1XHEA 2OESA 5CCXA 1YMUA 2QM3A 3GDGA 3I9JA 3CMGA 5HKKA 5TMBA 3HV2A 5TB5A 3K9WA 2IHNA 2C5GA 4AMGA 1I2AA 2YS7A 3E7WA 2EJTA 2HWE3 3URFA 5C8XA 1YFJA 4YRFA 3EODA 1RTTA 2RGYA 4KK4A 3KEMA 1KXJA 3O2QB 4JI5B 3DPIA 1A7AA 4QUBA 2H00A 5SYNA 3WDKA 1XNGA 3TNLA 3RFUA 1XNHA 4FXKB 2ZCWA 3ZBPA 3K32A 1UT6A 4FZ5A 1N33B 4OREX 3NRBA 4PG7A 4XPIB 3Q5DA 4AWAA 2XBMA 4FGWA 5FWYB 3E9EA 3EGOA 3ZTWA 4WNAA 3EY9A 2RGUA 3TTTA 3JQ9C 4ZO7A 1K4KA 3NORA 4N9QA 1KFCB 1A04A 3MQ4A 4LBMA 3ODPA 4GLLA 4QYIB 2B99A 5BMVA 3LX6A 3DFIA 1JG3A 4DMUB 4TL8A 2ISQA 1JJAA 1YNAA 3WQRA 1K3FA 4RK4A 3D6NB 3OQJA 1QKQA 3AUAA 1AR71 4AOCA 1I8TA 1GCOA 3BHIA 4HDKA 4LOJA 4Y9TA 5CT5A 5FIXA 4GPTA 3ETQA 3NPMA 1L5LA 5ADWA 1W39A 2R6JA 5KJ1A 4LO5B 1EYZA 4DCMA 1ZNYA 5IVBA 4BRWA 4LRYA 5GZ1A 4JX9A 4JBGA 4ZEWA 3N58A 1GPKA 2R4UA 1RUC1 1ZGGA 2WFLA 4E2GA 3IIIA 5EJIA 3W2TA 3G0GA 5B4TA 1EJ0A 1B3RA 4K9MA 1SBZA 3T99A 1RC1A 5HKOA 3AVTA 1QIIA 5AWFC 2GCPA 2LGJA 3GJAA 4P7KA 2BHLA 4ZZ0A 3VZDA 1N92A 1SBDA 5EVCA 3EDYA 3FJYA 5K8VA 3J7HA 4AVYA 2O0KA 4MUMA 2ODTX 4DUXA 4HDSB 4F7DA 1YRHA 3I58A 1G60A 1N47A 3VD7A 1KK1A 5T8KA 2PAEA 1NCRB 1WUKS 2QQ0A 1IM2A 3OCVA 4ENTA 2IYOA 3EFBA 3K6SA 3S2FA 2K87A 2ACKA 2QG6A 5CD9A 3M5CA 2X86A 4JD5A 4ZVMA 5HIJA 1T1GA 1RUD1 2ZS9A 2BHTA 2DURA 1LVGA 4W1PA 3S7ZA 1XMOB 4FDVA 4J75A 4GAEA 1IE3A 1YZKA 2N9UA 3BTSA 1L4KA 2QV0A 1Q56A 4QGSA 2DWCA 3ZBQA 3CH6A 3PCRB 1SHUX 3GJ0A 4BMSA 2E6KA 4PLOA 2YW9A 3SITA 2EZTA 2ZR9A 2FG6C 2Q1WA 1QKIA 1MX5A 5CGZA 4JX8A 1LU2A 3D54D 1HNWB 2M1ZA 2C00A 4HYYA 2GP3A 1CR7A 3C7OA 4XB2A 3W3AD 4JT4A 4IICA 4UMVA 3SQDA 3PTRB 3VBUC 3UV6A 1C5KA 4NPRA 4MUAA 3OLYA 1ST3A 4GP9A 1ZU5A 4RPJA 5IBRA 1ZMOA 3OT5A 4JT2A 3OA2A 4MINA 5FDBA 4MGQA 5A2GA 1HV0A 4A7YA 3RUHA 4GKYA 3R74A 4LJ7A 1N34B 1KEKA 1R6UA 3ZC3A 5EGSA 3DOCA 1CRPA 1QWSA 4C6RA 1OXKB 1IZ9A 1ISHA 2YYSA 3TBFA 3GLVA 3MD9A 3FBTA 4AVBA 3M4XA 2RMKA 5GALA 2VSOA 3E6BA 4HXEB 1Z5PA 2HAEA 3OTIA 1ZUHA 5FPYA 3T5TA 4QEDA 1ZJZA 4RHFA 3G88A 3S99A 2YWRA 1AB6A 1ETUA 5AW6A 1S2KA 3GCDA 3TYXA 4CIXA 3N36A 4TLFA 4L5AA 1RWPA 2VDPB 3DWFA 2HHCA 1QF6A 4J25A 2OO7A 2NTEA 5FP9A 3ZMNA 1Y1SA 3KB6A 4P54A 4Y9RA 5JH7F 1GCUA 5FFMA 2PRZA 4IETA 3ZN5A 4K2AA 3O92A 2E26A 2DUMA 3DBIA 2QD4A 1YQUA 1RYMA 2WZR3 3QNMA 1F12A 4PTZA 4LF7B 4DTIA 1MPTA 3W05A 2Z4TA 4MWGA 2I74A 4O2RA 5KWRA 5HA5A 2ZZQA 5LIPA 4RHV2 5CX1B 2HX1A 1NSTA 3AY6A 3N35A 1XD9A 4DIDA 2R1DA 1VL5A 3FUTA 2GHTA 3A6FA 2OWDA 2D2FA 5KINB 1IY0A 3A6PC 4OGLA 4X3OA 1FXZA 2PK3A 3EVGA 2PU5A 1LNZA 3DCQA 1XKQA 3PUJA 3LC0A 4M54A 1H6AA 2A6PA 4NXNB 1I3LA 4WFIA 3M3OA 2C83A 1GZDA 2QQNA 1UBEA 2G07A 3CF4G 2LW7A 5APAA 4B34A 4FB5A 3GRAA 1M1UA 5CXUA 2DX7A 4FNOA 1CE8A 4WNYA 2O50A 4KQIA 4MWBA 5HBRA 1WCKA 2W22A 3KOXA 3K6RA 2G4LA 4AEKA 5DLPA 2Y4NA 2IW3A 4O9EA 5IDVA 5CYFA 4QT0A 1EV13 1MX3A 3EPJA 1RMU2 3VN4A 3KEGA 1JUIA 1CZNA 3CL1A 1Z7S3 3VKFC 2XTMA 2BFPA 4CDQB 4G4SO 2D3RA 2Q4SA 5SV8A 1SBYA 1ZSVA 2VZ8A 4I1PA 1QZTA 3USUA 4DLYA 3DKVA 4G0VA 1CPMA 3MTGA 2NYUA 3ZKAA 3I54A 1CAWA 3R7SA 1T26A 2ZEJA 2QMYA 4AJLA 4E4ZA 1T1RA 3T1VA 2XXJA 3OMLA 4AX8A 1C7RA 3I1YA 4AQYB 4GOXA 4R9DA 5BYKA 1JX6A 4CF5A 1E99A 3STHA 1ZZBA 5HMLA 3T95A 3KGZA 3V1KA 2C9DA 5JMOA 4C5AA 5KEIA 4WPGA 3OPQA 1V6JA 5LQKA 3KAQA 3HDYA 4EB6A 2Q8PA 1N5OX 3IOYA 1Q8QA 1PL0A 5JH7B 5JAZA 2PD4A 1YR3A 1GUDA 5I47A 1K0UA 4XEUA 1RXFA 2QLFA 2BMVA 4QXMA 1AK1A 1U7OA 1NATA 1PMHX 4NPLA 5B53A 3KV4A 4S2FA 2GMPA 1M75A 2AWNA 4RGYA 2C5AA 4DR2B 1C3HA 1ST8A 4BNGA 1V5GA 1AVTA 2FPWA 1BNCA 4JGGA 3NFYA 3UV3A 4I01A 2X42A 2X05A 2A6ZA 5JCPA 4B74A 3ZSJA 2WEKA 4RHUA 3J7NA 1G16A 2C6SA 4PDWA 2BFDA 1GAJA 3JARA 1F2NA 1AZDA 4F8JA 1RKBA 1ZD5A 1SUAA 1J49A 3QJ5A 3B3GA 3K3PA 3WDLA 3FZEA 3UKVA 2Y1WA 1AXGA 1NY6A 1JHRA 1IRIA 4FJ0A 1JEDA 5IDXA 4Q3CA 1Z6YA 1F6BA 3D3EA 2LV8A 5CISA 1XZCA 4F21A 2Q5IA 4KAXA 1DKNA 2ZVQX 4GPD1 1RI1A 4FOTA 5D84A 4B7XA 1UAAA 4GYWA 2VOXA 3THYB 4B75A 1QRUA 3UBTA 4YVWA 3PPIA 3THDA 3KQUA 4UNRA 4XCBA 4LOIA 3DXUA 2Q5LA 4WSOA 4XMAA 2RS32 3VNBA 3VTFA 1DWQA 1VHQA 1ZS9A 3A9SA 4IIJA 3F97A 3CZRA 1T8PA 4ERXA 5AJTA 3OCWA 3CN9A 4RUKA 1U0FA 1W2HA 3RYKA 4XJAA 3VDQA 2IUYA 4DLBA 4A8JB 1CAUB 1X7XB 1QF3A 2PBZA 4W9NC 2MHFA 3ZCTA 3UWSA 2VU9A 2ZS8A 1W44A 2D97A 3OZRA 1YI1A 2FD8A 4LHVA 5FZHA 5BRNA 3W0LB 1PVDA 3W5AA 2VULA 1E5RA 3JZAA 1VCIA 3HUEA 3EH1A 1Y9ZA 4UHEA 3NNJA 4Y1VA 1YR6A 2JS7A 3SQWA 1FUKA 5BNFA 1EXVA 2XMLA 3D81A 2OGWA 3HNOA 3L18A 4CMBA 2ZEXA 2QRHA 3Q8MA 1GPYA 4J2OA 3G2JA 2O8OA 2Q7OE 1GZ6A 4YP5A 3ICCA 1CRWG 3CONA 3M1LA 2UZ4A 3OJEA 1YI0A 4F6CA 1HRDA 5L8VA 1RACA 1AN9A 1T2UA 2V7TA 2WD7A 1VRH1 4QYIA 5C3SA 1FX5A 3JR7A 1NKGA 4RTSA 3NRUA 3BXGA 3QEMB 3ILRA 4JLUA 3MCWA 2W95A 2FU5C 3TI9A 5IFPA 5ICCA 3EXHA 5F3RA 2ZSFA 3R0ZA 2RSLA 3KAKA 5D8AA 3VKFA 2JKXA 4W9RA 2YXLA 4BKPA 2HREA 4JB2A 3B7WA 1J1LA 4R4XA 4L08A 4KR9A 2P7IA 1HT3A 2Q6IA 3AB3A 4MITA 3H4TA 3D8BA 4GPAA 1V3QE 1GG9A 6GPBA 1U0HC 1GA1A 3RUCA 3VKNA 1JMVA 1MD9A 4M98A 3SJCA 3OM1A 3TNPB 3P2EA 3STTA 4II7A 6CHYA 3HB7A 3L5OA 1GM5A 2HCFA 1YQGA 1BLZA 5LZ4A 3D9QX 1HXS1 4HN9A 3LFMA 1Z28A 3Q7EA 2I80A 5AVAA 4YJ2A 3TH5A 1QJX3 1C4RA 1QF7A 3KXIA 1HM5A 3LXRA 5ER9A 4OD0A 4XJSA 2BFFB 3COJA 4ZV4A 3RUDA 3PV0A 3EZLA 5LY1A 4BQQA 5KTMA 4IGEA 3IAHA 3ZS8A 5K3AA 1V95A 4IQ8A 2YFUA 2QNIA 1Z6TA 4RLHA 2OCAA 2FP4A 4QRIA 4Y18A 4Y9DA 5JH7A 5FLJA 2A6VA 1PZNA 4DRXA 2AI2A 3VDRA 2LWIA 1GDTA 1KJZA 5TR9A 2C9ZA 3WGOA 4KUGA 5BSRA 4BE3A 3CIFA 4NABA 3MINA 2OV4A 4W4TA 5TS3A 4LRTB 3IDCB 3WJ2A 4JHLA 2QW0X 4QFCA 2PLV2 3G1WA 4EKNB 3RU2A 3VTZA 1G20E 5F4BA 1ZL0A 4LZZA 4U5XA 4EG4A 1WS6A 4CE6A 2A3YA 2DKFA 1HL7A 4K9OA 4URVR 3AO0B 1Y9GA 3RYHA 1ZDMA 2PAFA 4LTMA 2ZRGA 4ZVLA 5IANA 3AVUA 5DGCA 4G37A 2HFJA 3PHBE 5EUCA 1MQAA 1PSWA 1RYNA 4OHBA 1SQ5A 2UYYA 5TV2A 4ITCA 3A11A 3TQTA 1ZRRA 1QO7A 1QGED 2OCKA 2MYTA 2E49A 3KJXA 3BMNB 2AG1A 4NBNA 1EP0A 4L74A 1QGOA 1TVKA 4ZI7A 3EFHA 2CMHA 3V46A 2FR8A 4INPA 4NESA 5LU8A 1JQJC 2H63A 2XHNA 3GN1A 4HLUA 4RA9B 5HW0A 2P3IA 1ZICA 5JOXA 1OKKD 2HT1A 2QF7A 3RU7A 2GCIA 3SXUB 4NZOA 4JDUA 2H0QA 2PSFA 4YRCA 3C8MA 2J3EA 4U9HS 3WL5A 3PU8A 4OVEA 3IVMA 3EUFA 2VYNA 1IY2A 3SYRA 1KAEA 1ZBA1 1KAMA 4I7EA 1DQ1A 3HN3A 2GRAA 5KB3A 4A0FA 1C3OA 3LT0A 3H7AA 2XWBB 5KWVA 1OZFA 2D5AA 3Q7IA 4KXWA 3AL6A 4GICA 5BV0A 2NZUG 2YC2C 2GOYA 2I4OA 4JAAA 5HCBA 1IG0A 1FS6A 5A5FA 2GP5A 5J4LA 2HDWA 3U4SA 5J4VA 5ANRB 4UTVA 5E95A 2HBYA 1UBGA 1HSOA 1Z0DA 1YRBA 3FPHA 3C3BA 3H5IA 1F0NA 5L3SB 2QQIA 3IP1A 2GPYA 4LSWA 4PC6A 1T0HB 2P37A 2A9QA 2MDTA 3H99A 3CC8A 1KBOA 4KXQA 3B94A 3RYPA 1KZ1A 3FROA 1KF0A 4Q1BA 3OE7A 3SBDA 3O1TA 1QG4A 3ZWOA 1PQUA 1NI4B 4DM7A 2IZZA 4DXSA 3WA6A 2PX8A 4AFDA 5E3HA 2J9FA 4BLIA 3ROMA 1KS4A 4KPGA 4BFTA 1OH5A 2BNMA 4IXTA 4G63A 2CVPA 5AHRA 3KYIB 2ASVA 2XWBF 4LBQD 3H2IA 1Z75A 3VR5A 2R1ZA 3WDSA 3F0TA 2JX9A 2RM22 1F9KA 2A9FA 2A0FA 1T6XA 3W6UA 5LIRA 5M7EA 5AH0A 5U1PA 1N5RA 4LJRA 2XGXA 4BB5A 4TRMA 2FEOA 2FPGB 4LF8B 1N9GB 1BTOA 3CZ4A 5FY1A 4GF5A 3SJUA 5JYDA 1QGLA 3ZE2B 3INNA 1MFPA 2BTQA 3GRKA 5BPHA 4QAQA 3H4VA 3PQCA 4J8PA 1J9GA 3UN1A 3Q7RA 5T54A 1ZN2A 5AVWA 1Y98A 3ROQA 4M37A 4ND1A 4G65A 1PWHA 3DEAA 2LR0A 3RIEA 4QE3A 4LJ9A 1JXAA 1FXUA 1TMF1 3CE6A 4JN6B 1Y9DA 1EZ1A 3D1JA 3N2EA 2X0EA 4JUCA 2GZ1A 5AK3A 4CMJA 3AX6A 3JAWB 1FFCA 3CNLA 5B55A 3EIXA 4WM7C 1V4VA 1Z7BA 1HLPA 2GM5A 3LCCA 2BFFA 4BB3A 3G2NA 5A03A 3KTAA 2I2CA 2Q27A 1Q1GA 3H8JA 3HFJA 5BN3B 1K5HA 1NPTO 3G0HA 5IHRA 1H0SA 3U48A 1O03A 4HDKB 3F8WA 4HLDA 4QPYA 1KY4A 4I9UA 4HQ0A 1IKQA 1K68A 4MB6A 2F9LA 2G77B 1DAPA 3A21A 1F2TA 4O4JF 1YJXA 1PWYE 3BE5A 2RC5A 4WKOA 4F3NA 3DPSA 2LP4Y 1S0GA 1W2GA 4LJYA 1WUHS 1YEWA 2ZHKA 1QHHB 4HF7A 5JNVA 3LOPA 2QY9A 5UKDA 2A94A 3TS1A 3ME5A 2ZCUA 5DOVA 3IHTA 3GF6A 3MRXA 1LOGA 4O5AA 2VZUA 1DCMA 4LY9A 3IAEA 1JEEA 3HCRA 1GKYA 2FR8C 5ANNA 1XJ0A 3GBFA 3ZWBA 3VU9B 2ZKLA 4O08A 2RHBA 4QT4A 1E8NA 1J2EA 4I3GA 5BQFA 5C8ZA 1PSDA 3TJMA 2PSJA 3VYUB 1LI4A 5B2FA 4DREA 2PGAA 2BKAA 5C8CB 3GLIA 3WAGA 1SXJC 4OQ8A 4MKXA 2O4CA 2F43B 5LYJA 1P1IA 2W0MA 3RSLA 1XRNA 3N2KB 5EIAA 3RS0A 4CM5A 2X6QA 2QRZA 4CUGA 2WPNA 1KI6A 4IDEA 2V6IA 5FL3A 4N53C 1DC3A 3WG3A 3LF1A 4CM1A 5A3LA 2WYUA 4RA9A 1CT9A 1CAWB 1ZSYA 4P92A 3NAQA 4BEWA 3RSCA 3WUDA 3PUYA 4TKUA 2IYVA 1VLVA 1ZD2P 1AZLA 4QARA 1GRRA 3ITNA 1DO8A 4OK5A 4K6HA 4Q9DA 1EGQA 1LK7A 1WCXA 4U7FA 3DBLA 3QELA 1P4AA 3QH4A 2D7FA 3RWKX 4PLWA 3GRVA 3UVEA 5C5DA 2GNMA 2BVNA 4H59A 2YUTA 1IB0A 2FW1A 1IAVA 2IC5A 1RHUA 5F8PA 3O0TA 1O6UA 3M82A 2Q3LA 1VRVA 3AIMA 1S3IA 1N5LA 2NO0A 1Z4IA 5IXYA 1UOJA 4EYKA 2PT7A 5IARA 5G04L 2Z5GA 3EIQA 3UAXA 4DINB 2J3HA 1ECFA 3DL2A 1YI8A 3WBFA 3ODGA 4PFSA 4UAVA 3F3SA 3PJGA 3VM6A 1A1VA 1J1IA 1C9DB 2WLPA 3G6JB 2OFWA 1W2TA 4ZT7A 4TV9B 4I4NA 4E2FA 3SLIA 4BNFA 4OMDA 3ENZA 2I76A 1P1RA 3SMVA 1XZFA 2ZBDA 4S1WA 3RAFC 3EEBA 1M34B 2JVJA 3OUUA 4JJ7A 1FFGA 4XLZA 3GMTA 1WXEA 2IOHA 3R9XA 1OT3A 3G23A 4XIOA 3NM6B 2YGMA 1M74A 2M6SA 4GOOD 1WSBA 3PK0A 1COZA 3FWEA 1HNNA 3M83A 1XKXA 3RARA 1LI5A 1FAYA 2W6JD 4YMHA 5A6QA 3PNKA 3JU3A 1MS1A 1TQDA 1ZGZA 2Z1DA 4N0DA 1LPSA 4IIYA 5K1ZA 4QPJC 2GC0A 4RIEA 1RAEA 1MJ5A 2YJ4A 2YQZA 1E9CA 5J96B 1POV3 1MEC3 2VZEA 4GL2A 2XBO3 2WK1A 4F84A 4IIJF 4LHLA 1U63A 3VKVA 3NOVA 1ZZ9A 3FTPA 2BV4A 1DF0A 1XNJA 3Q3JB 2D3TA 3FN9A 5IM4F 4W6YA 3R6GA 1GFZA 2IA5A 3ULKA 3IUNA 3EBOA 4JFAA 5KYUA 4P9GA 4IEWA 1W6PA 3N9LA 4RD3A 4DBLE 5IVKA 2QZZA 1TVGA 2F2TA 4DHEA 4HC4A 3Q0EA 2H4FA 1JU4A 2FQPA 4CCSA 3OLXA 4N7BA 2G63A 1YQWA 1YULA 6Q21A 4COZA 2WC1A 4QU0A 1WUIS 3FKJA 4WAUA 2PSHA 1DGWX 3QA9A 2RS31 3UAYA 4HLNA 2AZTA 4C5CA 1L7LA 3T06B 3PX2A 5DTEA 2RG4A 1CC1S 2A7XA 3Q85A 4DBZA 3K4ZA 2I7XA 4X63A 1PZFA 2DUWA 2DVGA 3QY9A 4LYHA 1G1MA 3M6MD 1WP4A 2Y0BA 3I6YA 4G89A 4P7GA 2UZ1A 1H1AA 2WDBA 4XE5A 1AYM3 4AI9A 4IZHA 1PR1A 4NCAA 1REEA 3G6KA 4JFRA 3GH1A 5CIRA 4JQZA 2YJ6A 3TI7A 2JG8A 1YIAA 1G9CA 1Y4WA 5BNNC 4RENA 1TCCA 3AXSA 4FC6A 4DMRA 1L4MA 2PE5A 1ZOLA 1KFKB 1MO5A 1PBNA 4H6WA 1GGJA 1CUVA 1A9PA 2OW4A 3OJLA 4PLMA 4NZ9A 4GB31 4WKNA 2MJLA 5FA8A 4ZS2A 4ATFA 4D98A 3ROTA 1JZ4A 5DTRA 5JASA 3WRXC 3DLIA 2PPVA 2G4CA 2PH1A 2J67A 1RLUA 3LA8A 1VM6A 2Q1UA 4RR3B 2XQVA 1JW9B 3VU9A 3X2EA 2YXPX 4ZA2A 1X1TA 1JN2P 5JUVA 5F9FA 3DXXA 1ADJA 1KYVA 1ASJ2 2R8ZA 4XQDA 1U9YA 2FNAA 4BNHA 2O54A 4PC7A 3GRYA 1CY1A 2XG3A 1NONA 5BYNA 1PNTA 3FGNA 3MEPA 3ZIXA 5AVSA 5CPBA 3VGJA 4ITUA 1SVSA 3Q8XB 1M5TA 3TOSA 1KKMA 4JR1A 3IVGA 2PT5A 4YRGA 3ZOZA 3K0CC 4B9EA 2O1EA 1OPXA 1VBA3 1V6IA 3I37X 3N9OA 4OPMA 4W7IA 2H0VA 5LYYA 4NV0A 2ONKA 3IR7A 4I9GA 1QXJA 1ZMRA 3CJIA 3GH3A 3H11B 2IHJA 1G1AA 3C39A 3LX5A 3SKVA 3SVTA 1XDSA 1MS4A 1BKDR 4R84A 1HDOA 2Y6LA 1DRKA 1JYEA 3B8HA 3R5FA 3OTOB 3KS7A 4QX6A 5KYYB 3HXQA 4GJYA 5CFCA 3AM1A 5CADA 4ARCA 1M1XB 5K0JA 1Z78A 4WM7B 3HMQA 1V8BA 3WWOA 5CB4F 1F4AA 3ZWCA 3RNSA 2JFBA 1SXHA 6PFKA 4URAA 2A71A 1KU6A 4PC1A 4ZQIA 3GJYA 4LWQA 1XRSB 2R073 1QS0B 2YVUA 5I7HA 2BFBA 1T1EA 2OVBA 1OLME 2FEXA 1THZA 1CGPA 3HJUA 3LT4A 2ZPAA 4ENUA 3AMNA 3OG9A 2MINB 1P19A 5IT4A 3O12A 4L8FA 3D5QA 1WW3A 5HZGA 1V25A 5TXGA 3SAJA 2P3LA 5KJFA 1ND2C 3PWKA 3G7NA 1UXXX 2CSGA 3C7FA 4FPXA 3NVDA 3R8XA 1ORDA 2CLSA 4AP5A 2IU4A 2XCLA 2GH8A 4KR0A 5FKCA 3P9IA 3TNYA 4QKNA 1GA6A 4PANA 4Q4Y3 5FZMA 5ALKA 4EFLA 3UC5A 3VKOA 2GI4A 2PRYA 3CV3A 2ARXA 2JLXA 1NR1A 4RS3A 1AKMA 3ET4A 4ITRC 1LU9A 3PIGA 2OM6A 2ZI3A 4MGZE 2QQPA 1UEXC 4MW6A 4WI1A 2J6HA 1E62A 1YKGA 3HCNA 3AP1A 3I1JA 5BSMA 3ONWA 2ZQZA 4BZWA 1LOEA 5J09A 3ZV4A 3OWHA 1ZJJA 2RH5A 1DBVO 3VU1A 2YWCA 4D69A 2ZI4A 2R6HA 2HWB3 1NQTA 4Q2FA 3DD1A 3NDJA 4L0QA 1OPOA 1AVBA 2DC1A 3ZDDA 1K8YB 5FZIA 4B33A 1NF9A 4BKOA 5JMPA 5F1RA 3C8UA 2VT7A 3NTUA 4QB1A 4WCFA 4G81A 2EHJA 3D6AA 4ZYXA 1Y63A 5TJHA 2QSYA 3B2NA 3GLFA 4BO5A 4KXFB 2QTZA 3NM4A 2XUGA 7REQB 1EP1B 2FWJA 3QVGA 3UYKA 3BE8A 5FLKA 3A25A 3CJRA 4B47A 4O8CA 4ZY9A 1ZRCA 3TPCA 3IKWA 2XNDA 3QSGA 2VMFA 5CCDA 1WRBA 5B1EA 1UL9A 5F21A 1Q2XA 3IQZA 3JRXA 3QLEA 3G5AA 1Z2AA 5DNWA 4NIAA 2AJTA 3CUSA 3GFTA 2C4VA 4KWIA 1E59A 4XFCA 1UXGA 1SZCA 4ENQA 4C6TA 4UULA 4BISA 3B5EA 2XBO2 1QLJA 5B3AA 4FQ5A 4IKEA 3H6GA 1NY5A 4TLCA 3JWPA 2HWC2 2XE4A 2P4EA 1JXQA 5CDSA 4B5KA 1H0KA 5DM2A 3ER6A 2GR9A 1NRWA 4Q6BA 5FTJA 1JDZA 4RK5A 3RC1A 5I8SA 4FM9A 3PEWA 2C4WA 1ACCA 3WINE 4UNIA 3SOZA 1FEZA 4EPTA 4GI5A 2P3KA 4Q4V1 1TXGA 3M0EA 4C7MA 5AUQA 4CR7A 4QJIA 2QMUA 3GGOA 5PNTA 1KJ9A 4PIPA 4DRYA 1MQTA 1U2GA 4D4IA 4N5MA 1VE6A 5KAPA 3U11A 1DQPA 5KWEA 1TGYA 1X36A 2FPMA 4U02A 4OYUA 2LTNA 4FQZA 1COWA 3VJKA 5DM70 4HZUA 4C7OA 1IM5A 4HCJA 3OGJA 5CA1A 3EWSA 2XXBA 2TRSB 4EN6B 2OK7A 3MWDB 4JK3A 2R6FA 2WLSA 1QH1B 1ZM3A 3KXKA 3KK0A 2IH2A 1CCWA 3DDOA 5CLIA 4ZU6X 4DV6B 1CUUA 1DWUA 3ZXDA 2IC1A 2PXHA 1JNYA 3ZXFA 3QEOA 3REFA 2GT1A 1NXXA 1AUYA 1UD1A 3MCVA 5M04A 4G6ZA 3UG7A 1G9SA 1V6MA 1QHEA 5DEOA 3CEJA 5E88A 3RJZA 3GGSA 1EI9A 1UKEA 1GOTA 4NDAA 2VTFA 1M34E 3QKTA 3GCZA 1FXWF 4B6RA 1BMDA 2XOEA 1EVQA 1VIMA 1HB1A 2F8TA 5HDBB 2VWGA 3QMPA 5F3CA 2R86A 3WP4A 4EBBA 5CHEA 2OHGA 2DPMA 5TQ2A 1NP3A 3JYNA 1FLVA 1GNSA 1Y5NA 3UJ9A 4QOEA 4LRSB 2O8EB 4BVFA 2E4UA 2DUJA 1TTTA 1HJGA 2ERCA 3T7IA 5GZ3A 4BWVA 1DX6A 3O3OB 2H31A 3WX0A 5BNNB 4BPBA 2HWE1 4RL7A 4KR6A 2O5CA 2QLBA 5C31A 3LQ2A 3RJRA 2I3GA 2VPQA 3NAZA 1BA2A 3M70A 5HKAA 2NTJA 3E9YA 5L4LA 1VE9A 5BYAA 3EVBA 4LVCA 2RGEA 2OG1A 3V8VA 4G0NA 3F5DA 4BBPA 1PEKE 1AUVA 5AW7A 3VYWA 5FI5A 4TUYB 3ETCA 2VZ1A 2PTHA 1D9XA 3WIEA 1O58A 1OURA 3GRUA 4URUR 4E9KA 1JH9A 1HDCA 2PGIA 3NWEA 2DDUA 4FP2A 4PPFA 5EJ9A 1G9XA 1GT91 3O82A 4CEWC 1KC3A 4ZANA 1EFAA 3WMWA 3A0NA 3HU1A 4P5PA 2C8LA 3QVJA 4TMZA 4CNBA 3LUKA 1W0PA 4CKEA 3QV1A 1AR73 3HWJA 4NCIA 4N3GA 1P73A 1ZBA2 2XT0A 1F0YA 2JA1A 4UUOA 4PQEA 3U3JA 1GUBA 1W1IA 5CLQA 5IVDA 1XU7A 1ML3A 4PQRA 2XRMA 2DCJA 3ECQA 3LVRE 3ONDA 1D4OA 1RCFA 2ET6A 2AENA 2I7CA 1V8FA 3PJDA 2O3TA 3H9EO 4LJLA 2C8VA 4G67A 2V3WA 4HX9A 1CHNA 4PSCA 2EP5A 3ZVRA 2IU3A 4YMGA 1RPJA 4AJOA 3CBQA 2FPIB 3RQ0A 3OUTA 3LSYA 4NENA 1WD7A 2FW6A 4BZZA 4L1KA 1AK2A 4Q1FA 4OHWA 5CHYA 4ND3A 4DCJA 1D4VB 4C3ZA 4XQEA 5SICE 2RHJA 1J3RA 1ZHOA 2PA7A 4JJEA 4Y6PA 4BRSA 2C9MA 3IDFA 3DE1X 1KI2A 3DZKA 4IQ0A 1D0GA 2DBNA 1GQQA 3UB4A 4KRGA 3GR6A 1T34A 2ATXA 3UMJA 1XZLA 2CBXA 1VALA 3B52X 5FZ7A 1Y5MA 4X7RA 5AJHA 2OX0A 3FLEA 4E30A 3ZDQA 1PYDA 3O8LA 3L93A 2PLRA 3PDJA 5DPMA 3ZYZA 1YHFA 1ZCBA 2C9OA 2O2EA 1PFKA 3ZDFA 1I2ZA 4Z51A 2V7EA 2EKBA 4UYBA 2G9VA 3WWZA 4M6WA 1TYCA 5K0ZA 3W7VA 4LCEA 4LXUA 3UWMA 2POCA 4DABA 3WYEA 1RIIA 5KWSA 5DGDA 1ZBE3 2NZWA 4BBJA 4MR8B 4HMPA 4UJ5A 3RHZA 3KOYA 2WWUA 4NIMA 2LCIA 5GM2A 4TTAA 1V41E 3EY4A 3I59A 2ARKA 2Z57A 1WSDA 2ZTUA 5E4JA 4FYXA 4MWZA 5BWOA 2II6A 1IHXA 2FSIA 3KT8A 3Q7TA 1DV1A 1NPYA 3EBRA 4NHYA 2GEVA 4TLBA 1CIVA 1XC7A 3KR2A 2DETA 2AZXA 4X44A 5FOVA 5FPUA 1ZNPA 1CUFA 3ZNPA 3AJZA 5ILOA 4Z2AA 4C1WA 4OGFA 3TQCA 4EY7A 1T9BA 4NE7A 2Y1KA 3I0MA 3TJZA 1R12A 2JDPA 4S2GA 3HPNA 2ZGOA 1KNQA 1Y6RA 3QX9A 3S2ZA 4ASLA 3QVTA 1A3KA 3TBHA 5ADUS 3LVQE 3GUHA 3ZCPA 5IWAB 2JIQA 1QCYA 2BL4A 3TIGA 4BTEA 2F8MA 3OBZA 1EQUA 4XUDA 2W92A 3WLEA 1C7QA 2IYAA 1VBKA 3KJEA 4JASB 3SJ7A 2V9ZA 4JQRA 2CWDA 1WB9A 2DUPA 2QRPA 3CLPA 2F17A 3FR7A 4UFJA 4C4AA 4DY3A 1PFUA 3ETEA 3N3HA 2FYTA 3FVRA 2YTZA 3QU5A 4DCPA 4HK9A 5FUWA 4C2TA 4AL4A 1GTMA 5K0UA 1V7QA 4RD4A 3V6LA 2QUAA 3RYHB 1A95A 3X1MA 4MV8A 4XGKA 1ULBA 4MV5A 1O6BA 1T8SA 4ID9A 5K01A 3M3IA 1NZJA 3FHJA 4TKVB 5ISLA 1RUH1 1W8UA 2ATCA 4EFMA 1SUEA 1FV3A 5ALFA 2L0XA 4HFMA 3T7JA 3A27A 2QN9A 4AURA 2I07B 4J2HA 3RAGA 3SC3A 2ID8A 3M3QA 1MJGA 4YR9A 4G0UA 4EJ6A 2W8BB 2OM2A 2VO5A 2IEAA 1KOLA 3GNQA 4X1OA 3VNAA 5G41A 4DY5A 2WM3A 1KTIA 1XXHB 2Y8EA 4Z4GA 3AFHA 2E31A 4J1TC 4MXDA 5ACA2 2H4ZA 3CNBA 3DQPA 3A70A 3ITDA 4JA0A 4RKRA 5JXIA 2D5FA 1GGHA 3JQBA 3GPBA 4H7EA 4MI3A 4QECA 5D01A 3QF4A 2YBPA 3K5WA 5JD3A 2DU8A 2JHFA 3MHTA 4MGTA 3AKYA 4DW8A 4AKIA 1UU4A 3IR5A 3LRPA 4PPGA 5HHTA 2HIAA 3IBTA 3OEED 3KLBA 1XZIA 2D0IA 2JFHA 2ZRDA 1OUXA 1PTJA 3ZQJA 5AI5A 2WYHA 3N8DA 4FD3A 3ECCA 3ZIDA 1C2YA 2J3QA 1TK3A 2R071 4DJTA 5JQGB 2HA3A 4YAIA 2BU9A 1IKPA 2GD1O 3GA0A 1C4KA 4H7JA 1SEVA 3D0JA 4I50F 5A33A 4MS4A 3TZEA 5A6SB 3M5PA 1P0QA 3HM2A 1ECGA 2BHSA 1OLUB 4BPRA 2ISSD 3U19A 4YW6A 1K75A 4WV8A 1X8EA 4SLIA 5DUWA 4DSOA 3PICA 4JI7B 3IC5A 2IUWA 3N6VA 5H0IA 1EQAA 2ZBQA 4WK6A 2A1TS 1IFXA 2C3YA 4DMLA 2QJFA 2Z08A 4LY0A 3AZYA 1E7MA 4C21A 1BJQA 1CQIB 2YPJA 5A70A 2XDWA 2ZIGA 1REFA 1OLXA 3LEKA 3EFOB 4UT5A 3Q0IA 1FS4A 2XUKA 5J5AA 1ENRA 4RH3A 3K8QA 2Y0IA 3IALA 1KFXL 1U0OC 2OKGA 4OAOA 3MYRA 4NVRA 3KLNA 5BMVF 1DLJA 2H11A 3X1ZA 3ADBA 3FI9A 5GMOA 3ROUA 4A03A 4U1RA 1FYDA 3ASZA 4AEDC 4BNNA 1ZESA 1XQ6A 2PANA 5EJ7A 4HJRA 1NUTA 2N1MA 2YV5A 1JQEA 4PRKA 2QPOA 4OMCA 4MVJP 3PVSA 2WJPA 1A9TA 4B2PA 5IFKA 3WK4A 1WLCA 2DQZA 3KVRA 1TZOA 4US1R 1CAUA 1M34A 4DCGA 5AKXA 2G40A 4ZJPA 3NWOA 2QSZA 4K3UA 4AY2A 1PWEA 2YB7A 1GQOA 1V9U3 1G8PA 3P96A 2G5GX 3VA7A 3WZ1A 5JVVA 3TL6A 1DL5A 3RTEA 3WL6A 3RS5A 3E8XA 3P4UA 1WCIA 4NH4A 4UXAA 1CXZA 2IIBA 1HV1A 3E7PA 3V0AB 2QX8A 2R47A 4DIMA 3KV9A 4PCRA 5I93A 1EFVA 1BEZA 1X2EA 2DWQA 4I3PA 2PS1A 1FS5A 3AP4A 2JFNA 3AR8A 3I6ZA 2O6LA 2NGRA 4JJGA 2YASA 1A69A 4PVCA 2XMDA 5I0RA 2DERA 2NP6A 1W2OA 1K6EA 3H3XA 1DKRA 1PR9A 2FKNA 4EYSA 5FYIA 1XZEA 2D6OX 4NNPA 1AR62 5CUQA 1KI7A 3BXFA 2H51A 3PNPA 4KIGA 1NU6A 3TLGB 4AYWA 3SM9A 4A44A 1Z36A 3WNQA 1MBZA 5IKXA 1NLZA 4KNVA 1GCAA 3R09A 2H1IA 3R7NA 3CZQA 4O4IF 3T1QA 2OPKA 1ULOA 2RHLA 2PKQP 2EF1A 1VMIA 5YASA 1FLDA 3ADDA 2YMPA 3LWCA 2IRWA 1H8HD 1H8TA 1RQ7A 2VPVA 3WC4A 2VZPA 1VPEA 4C6SA 1NOIA 5LSAA 3DJYA 2VDVE 1EVYA 4M3NA 3IBCA 5F9HA 3OZWA 4ARBA 4OZXA 1WKBA 3FFQA 4W5NA 3QLQA 5K9YA 2PH7A 2H57A 4B7ZA 3LIGA 4XCQA 1TIKA 3M5DA 4F4UA 1FFHA 4NMXB 2FWRA 3OSZA 3Q3HA 1WD4A 2ZUWA 3S7IA 1NNSA 2WSSD 2RHMA 4I1IA 2XDQB 3RKUA 4OF4A 4TTJA 4CLDA 1BSVA 3H8XA 1WZUA 3BYWA 3VHLB 1WNTA 2JJ1D 1QHFA 4HANA 3O14A 4L3OA 3DAFA 3A1UA 2VUJA 1KEVA 4K2HA 3H9QA 4IGAA 4AJ4A 3IO3A 3FTCA 1RUC3 5F7XA 4MOAA 5DZEA 1P39A 1B00A 3C1AA 4JJZA 4NQZA 3D7KA 2MWMA 1WB4A 2X1LA 3ZZUA 2C2YA 1J8YF 1UFQA 5J5VA 4I81A 4QLOA 2BR5A 2F6RA 2OCLA 1OYVA 2ZI6A 1RHI1 1QKKA 5T8KC 5DZSA 3VDDB 1LRLA 1BYUA 4BMOB 4R68A 1SOUA 2GK3A 1J09A 3BJZA 4CM7A 4A4DA 2R043 3GZ4A 3FSGA 2VUAA 1NTOA 1RI3A 4IYJA 3MJEA 3CLUD 3GBPA 2ZX4A 3GQBA 3AMQA 2EVWX 1U7XA 1VKNA 2CNDA 1R8YA 4W82A 4AY5A 1JPJA 3IUSA 1ZGHA 5ABJB 3QBDA 2Z6AA 3WW4A 1NN3A 5KYYA 4YUYA 1YTUA 3M34A 2E9QA 2DUNA 4WLOA 5FZKA 3CLUC 3MMXA 5C6CA 5LMZA 3FCYA 2JH8A 1NR5A 3GRFA 3IURA 5CKMA 1XMVA 1RQRA 2JFWA 2F9FA 2L42A 4D6YA 4PLZA 3Q8FA 5KXBA 3OY8B 2B8JA 2WU3A 4G24A 1VPWA 3UPUA 1LHWA 4EUFA 4KGVA 2K0GA 4CMGA 4GGPA 2H1LA 5CU7A 1HKHA 1RLOA 3AR5A 4RNDB 1T3HA 3NEJA 2LIVA 3IUPA 4C7XA 1NF2A 3B53X 4FOYA 1OTXA 3IOBA 5E9JA 7ABPA 1BS9A 1SKQA 1C2TA 3AF0A 3LK7A 1VC2A 3VI3B 1CJTC 4DIOA 1UOEA 1C9EA 4PTLA 4HNSA 4RR3C 1H4GA 4ALJA 2DH6A 3L8YA 1RSZA 1JHDA 4HWTA 4II2A 2ZIEA 3QKUA 2C78A 3IOMA 3T6KA 2TBVA 4GB32 3SBOA 1T6NA 5FP8A 4BP1A 2WWTA 3CJQA 4F12A 2J0UB 3WLAA 4BGUA 2QNBA 1QOZA 1XT6A 3JQDA 2GAUA 3MWLA 1Z12A 2WM9B 3RVOA 4G1BA 2HCJB 1ZUWA 5J36A 2AMLA 5ENVA 4RA6A 1PW5A 4TYQA 4OUDA 5HI0A 5AJXA 3QACA 3B60A 1B3BA 3EEYA 3EA0A 2QTLA 3MERA 2B7CA 3FWPA 3ZLBA 5AOAA 3M4YA 1CUZA 2HOQA 1HO3A 5HIIA 1Z4QA 4D02A 1SPXA 3SYTA 4FR5A 2WN3A 2DU0A 4LBLA 2ZIUB 2WFMA 1JZ2A 2JK1A 4EA7A 3R5JA 5JJBA 1Z5OA 1WA5A 2WHRA 3DMRA 3EOZA 5JEEA 3WFIA 2W1UA 4MWEA 3A1WA 4E0BA 3JVEA 1DO2A 3ND8A 3FBYA 5KYVA 2C7VA 4OHOA 4CGYA 3ZXJA 1XRMA 2ZZNA 3BMXA 3GRCA 2YWFA 1V9U2 4DZRA 2RGXA 1VBB3 4HDAA 1MG5A 1UWVA 1XL0A 4BP9A 5CCEA 1DJOA 2QYSA 5AXDA 2NVUA 5GV8A 3ZWMA 5ICFA 1VL6A 1T9AA 1NYQA 4NZMA 3FHTA 5CP8A 3WK5A 3D4LA 1NJ5A 1OZAA 1VKHA 1F8XA 1LBHA 4F7WA 2WJZB 2IXCA 4Q4V3 5HJ5A 1PT7A 1TO6A 5LLDA 3ILVA 3A06A 4IIUA 1UOFA 3SEFA 4P02B 1HURA 2Q29A 3B48A 3DTVD 2NUBA 3H97A 1E3EA 2VRBA 3BX1A 3H8SA 3NNDA 3TOVA 3B12A 3FDFA 2WILA 3KHUA 3PDIB 3P9YA 5B3JC 5CDUA 4AWXA 3B9PA 2PHTA 4XRGA 3GJ7A 4FYJA 5AT1A 4R41A 2ACVA 3UYJA 2OV6A 5DX1A 2FDFA 2X8JA 4JWTA 5D21A 1G8KA 3BKWA 4YV0A 1GDDA 3G02A 5F98A 2FETA 4F04A 5FX2A 2XUZA 4I4IA 3VDNB 3EPLA 1A88A 3G8YA 4LDRA 2A84A 5CFMA 3BD8A 5FO7B 3O93A 3ZI4A 3ISVA 2RFLA 2WS93 1FSZA 2H8KA 4P81A 4D8TA 1TD9A 1H6XA 1UXOA 4FHGA 3GHYA 4GPEA 3Q8LA 5AVYA 3CX4A 4YWHA 2HPHA 1WU8A 4M36A 1SKMA 1X50A 4MLCA 2Q3JA 3P9QA 1XCJA 1P5FA 1LCLA 1TGVA 3GPDG 3TLBA 4BWYA 1M66A 4CKZA 5CIYA 2ZBPA 2IL1A 4X45A 2HQOA 5EQFA 5EWJB 2E1RA 5JATA 3QUBA 3WCSA 3LUGA 2HDHA 4RJIA 3VMMA 5EG5A 1E2IA 1SHWB 1X80B 5KYTA 1L3CA 5KNCH 4I19A 1FTWA 4OZOA 3KQLA 3H13A 1PQYA 3SJZA 3W4IA 4R1NA 3NHZA 3TQFA 3RSSA 3WB2A 1FXWA 3QF4B 2XNKA 3UY4A 4K8OA 1KVTA 1VLZA 2QVZX 5I5EA 4AT1A 5E1DA 4J76A 1YGPA 4OXNA 3PKJA 4UHKA 1X94A 4KMRA 4JJIA 1OLQA 4RQPB 4REQB 3NMBA 1Z2DA 1W88B 1SLLA 1JLLB 3LQ1A 1F06A 1FW6A 1T3GA 5EJEA 4WVMB 5HXAA 5T57A 2G1PA 2OYSA 4QKBA 1W9TA 4ONEA 4OSEA 5HVNA 4N5LA 1FMJA 1C1DB 3GFBA 1B0ZA 1NOVA 3I9V1 1L7VC 3L6RA 4BUZA 3W5IA 1AQ6A 4FFFA 5DM0A 2I6QA 2DTDA 4ZEXA 4ON9A 2X2OA 4OUSA 2DSTA 3F7NA 4P93A 2IPLA 2H1FA 1YFXA 3OX2A 4ZARA 1WL8A 5JAXA 2ZB7A 1RM4A 1PNGA 1O0BA 1Y37A 3EA5A 1D4ZA 1X7WB 4Z3DA 3UEOA 5BXQC 4LNVA 2A3NA 3NOXA 4Z1MD 3SIWA 1RCTE 4FWIB 3B7MA 2JFZA 3VSAA 4IDAA 3O1MA 4XGQA 1YR1A 4TTRA 1FJXA 2QJOA 1DEOA 3GRPA 1X9PA 3WXBA 1FUEA 5TQ0B 2FGKA 4ZI2A 1NE4A 3COSA 4GI3A 1O97C 4OQ4A 5D8AC 1ZOIA 3CVXA 2ZVDA 1SOAA 1O4ZA 4GWLA 2R063 1OXUA 3RDIA 3GD7A 3R3VA 3AZPA 3HRIA 3L6UA 3DLAA 4J03A 4EUKA 3VR6D 4NBLA 4UU1A 3GGGA 2X5KO 1AM4D 2F64A 4LHKA 4CLXA 2M2IA 3V80A 3D5EA 4YW2A 5DNVA 2PGNA 4X1IB 3A3OA 4XXPA 5A1TA 1BX3A 5K3DA 5I9IA 5ITZA 3AP9A 4QHZA 1GA4A 5A3NA 1PK8A 4EY4A 3V9PA 1T2VA 3WX5A 4GBJA 5T4BA 3LB9A 4Q37A 2XTJA 2JK0A 1GPLA 4GEGA 2DOKA 1XROA 5FREA 1C8BA 4HAZA 3A23A 1SD2A 3UMCA 3KZ4C 1QGAA 3TW8B 3S0MA 4XVQA 4LPKA 1MZEA 4AYXA 1QH8B 5E7QA 2AEZA 1JTEA 3E9NA 1FOEB 4BBZA 2R6CA 2RR13 4XUOA 5GINE 5AKLA 1Z62A 1AX1A 2QUIA 2JFVA 4K9RA 1IULA 3GLFE 1MRSA 4O29A 4QU2A 1JB1A 3DVRX 1U3WA 2XTZA 5FXZA 4JCCA 4AHWA 3D6MA 1F48A 2NQYA 5A6ZA 4WLUA 3KHKA 1W8TA 3EQEA 2PUAA 4HGPA 1R091 2WA2A 3AB7A 3T3MB 3BF7A 4KX5A 5DWQA 4YAUA 1W0NA 4BO1A 5EJAA 1RYBA 1AF4A 2QVGA 3RC2A 5IAGA 1LW7A 3DT6A 4YHHB 3DVAB 4AK3A 1IIRA 3PFCA 4P3OA 1PQ4A 1NBAA 1UJBA 1BW9A 3AL3A 3PHCA 3SM3A 1YFYA 4YM2A 4FYWA 1G5RA 4CL8A 1SACA 2OBYA 2ZSEA 2COEA 5EAIA 2QVYX 2PS9A 4A16A 3HYRA 4PYKA 4GUAA 1X1RA 2OZLA 3PVBB 1NI3A 1FMD1 4O2AA 3MMZA 3NUQA 3EXG2 4EG5A 3D0RA 1YB2A 2HEYF 1HB3A 3UH1A 2XDAA 3BCSA 2ORYA 4GPBA 1F51E 3EZ9A 1E2HA 4XEHA 1YFWA 4LKDA 1DKUA 1ZD4A 4PLYA 2FXIA 5K3FA 3MWFA 3POJA 4H4CA 1Y8RB 1RRCA 4AE2A 4ZXPA 4Y24A 2JJ8A 1SZBA 4F3JA 2H2IA 1KMHA 4B79A 2P5BA 2JIGA 2F1RA 5JAMA 1JEOA 4HWGA 1KPHA 4IMIB 2R5NA 1KMMA 4GDMA 3UH0A 1SXJD 3SSAA 4RIFA 1UZAA 1A98A 1WZCA 2HU5A 2NXNA 3NV9A 4YBZA 1HI9A 4OAQA 5C1DA 4G9BA 4TM8A 2GWRA 4G84A 1M54A 3PYXA 1RTKA 4TLMB 2ZUTA 4C91A 4XZUG 1YRYE 1W34A 4HL0A 3HB0A 5KVCA 1PJSA 3Q41A 4X54A 4ES8A 4DLVA 4EI8A 1XU9A 1KDYA 4AM8A 3WFJA 4Q47A 1E5IA 4WXHA 3DKIA 2Q3FA 3RTAA 2FK7A 2FW8A 1I2MA 2CZGA 4Y22B 2X9GA 5EUQB 1CUEA 1K5PA 1DPGA 3TW6A 1BJTA 1AO3A 3G2OA 4ER3A 4A73A 1GNZA 1UPSA 3ESDA 4DFDA 2GCGA 3OIYA 4YPVA 4KWCA 3N76A 4N90A 2XV1A 4MV3A 4P31A 4QXRA 3ANTA 1BQ3A 4AZ0A 3HAGA 1E79D 1G21E 2YZ4A 5JJIA 4PYNA 4AJIA 2PX0A 4Y3UA 2I2AA 4P0PB 2UU8A 2D7DA 1GQYA 3SNMA 1HRV3 3DAPA 1QBGA 1YV9A 1RZUA 4PR0A 4OOEA 3I3OA 2CD9A 4BEJA 1RTVA 2C5SA 3MS4A 3KTOA 3U6KA 2BEKA 3EG5A 2XXAB 2IYYA 2OXIA 4B3XA 4EA8A 1LJUA 4ARSA 3R3XA 5JSPA 3WLJA 1BE8A 2UY9A 3NSTA 4E4TA 4H2AA 2I8CA 3VBSC 1R6TA 1YC5A 4OUMA 4EF6A 3SS8A 4I4TA 4IE4A 1DBNA 3RYCB 1MX1A 1UL1X 5HILA 2IUUA 4AJHA 4UTRA 2ZQ5A 5FYVA 3ET5A 2FN8A 3ZWDA 4IV1B 2XYPA 2HIMA 3MS2A 3EX7C 1TRKA 4DA4A 3DW1X 3CLKA 1J22A 2BUKA 2Y0EA 3IUMA 4QLBA 3RS8A 1JTFA 5JNTA 3OCPA 5IBCA 1I32A 1DTWA 3TVTA 4CM6A 3V4LA 3K1AA 5EXSA 1JU3A 5IS2A 2ZAMA 1UKZA 4LBWA 5J98B 2VDWB 1MS9A 4RQPC 5LW9A 3B2QA 1USIA 4FTWA 4E33A 2J0UA 4UUMA 3BG5A 3OT1B 4HVCA 2O7NA 3PXUA 1BMFD 4Q03A 4CQJA 4EDHA 2CUZA 2VI5A 5GONF 1O91A 2CFSA 4PXAA 3ACLA 3NOOA 3V1NA 3P9PA 4CIDA 3FPLA 3CF2A 3H84A 4IXLA 5C37A 2WSSA 1TI7A 5DSZA 1XHFA 1F2DA 3M9LA 2VBPA 2ZGPA 2HYIC 4AVAA 4DS3A 2QIOA 3MCZA 4L95C 2WE7A 1E1QD 4BQ1A 4OY3A 4FX5A 4XTRA 1QDOA 4IX9A 3PD0A 3C7EA 4JSRA 4K3VA 5ALTA 4H4EA 4CEJB 4DSAA 3OYWA 1KSJA 3QA3E 2VCCA 2WT0A 3CIHA 1H1LB 4IE7A 2GNPA 3H2BA 5BNZA 3NU1A 3MOGA 2PVPA 1W8IA 4CCMA 3BXOA 4O8ZA 1D7AA 4F2WA 1II8A 1GV0A 3DBRB 5TT0A 1NJ8A 3LE8A 2R751 3X1DA 4PXSA 5BQOA 1DHKB 4NV3A 4IGKA 3ZHSA 1UAIA 1ASJ1 5AFBA 1DOAA