4K7JA

Peptidoglycan o-acetylesterase in action, 5 min
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
350
structure length
350
Chain Sequence
GLLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 125
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k7jA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k7jA01
4JHLA 4HYQA 2VPTA 3P94A 1IVNA 1WABA 3MILA 3BZWA 3W7VA 3C1UA 2W9XA 4RW0A 1ZMBA 3SLRA 4LHSA 2O14A 1ES9A 1YZFA 4K40A 4H08A 3RJTA 1BWPA 4Q9AA 1Z8HA 2Q0QA 1PP4A 1DEXA 2HSJA 4RSHA 1U8UA 1FXWA 4IYJA 5CD9A 4Q7QA 4K7JA 1J00A 3KVNA 4DEVA 4I8IA 1ESEA 2WAAA 1FXWF 3DT8A 3U37A 5A4AA 1VYHA 2WAOA 4S1PA 4JGGA 1ESDA 4PPYA 1DEOA 4TX1A 1BWQA 3HP4A 3DC7A 1JRLA 2APJA 4OAOA 3DCIA 4K3UA 5B5SA 3DT6A 1K7CA 3SKVA 4M8KA 1ESCA 5JD3A 4OAPA 4NRDA 5BN1A 4HF7A 2Q0SA 3PT5A 5HOEA 4JJ6A 4XVHA 4JKOA 2WABA 1V2GA 1BWRA 4K9SA 4JJ4A 1VJGA 3DT9A
chains in the Genus database with same CATH superfamily
5JW6A 3DM9B 2Z4SA 3CUWA 4LXHA 3O3NB 3AL5A 1V5IA 4Z9AA 3IODA 5EXTA 1XVAA 4CW7A 1RC8A 1IXZA 1H8EA 1Z37A 2HNKA 1LDYA 2FMKA 1C1YA 4HB0A 1ZD1A 1NJFA 4XWKA 4GXNA 5DX0A 2AJCA 3I52A 4M3CA 1OFNA 5BWMA 1DTWB 2ZAAA 1X7WA 5C8ZA 4Q3CA 4OV6B 3DF9A 4UW9A 5F5LA 1WE2A 3X1ZA 4Y20A 3JD4A 1YQTA 3C5WP 5FPTA 2CW5A 4QGLA 3RHZA 4F4IA 4OYLA 3RSCA 4RK1A 2R11A 1FW8A 1W36D 2QE6A 3PRJA 5KIAA 2E33A 1W6OB 1VHQA 4FBLA 1QJ4A 1X77A 3BEOA 4UUBA 3B1KA 4ZI3A 2W2OA 1HNXB 2WYWA 3R9XA 1TME2 4X8NA 2HJIA 2YKGA 4QYMA 3VR0A 4EGFA 3E05A 4AL4A 2P2DA 4MR8A 2D5FA 2LV8A 1QXRA 4D9MA 1N77A 1BU8A 4I5GA 5L3SB 2QU7A 5HKLA 2O0KA 1U8YA 4UASA 1QMJA 3LMKA 1G1MA 2PSHA 5JPMB 4CKEA 3WNPA 3QEKA 4X97A 3H9CA 3L7YA 1FFWA 1JYTA 1C57A 5HUQA 1YK0A 2NO9A 2FW6A 4XBNA 2OOSA 2R0QC 4RSGA 1M6YA 4G09A 3U61B 3OBIA 1I1OA 2IQIA 2D2VA 1W6QA 3IVAA 5ABPA 1USVA 1OFUX 1XXHA 3BX1A 3IIEA 1ILEA 2M98A 1YOVB 2NV6A 4XW2A 5FUXA 2V03A 2DFKB 1BNCA 2FZEA 4FFRA 3S0MA 1I4WA 4TKLA 4Y0AA 2ZJYA 4AVYA 1AK2A 5KZMB 1QF6A 3ZK9A 1PGNA 3RUHA 3ZFGA 2WJVA 2EIHA 2B4KA 5C5UA 4AW9A 1RBMA 3U4QB 2QI9F 3RANA 1JYIA 1ZL0A 4YRGA 2QN8A 5G0UA 1ND3C 2EWWA 2JH9A 3ROMA 1JFTA 3DBOB 3U3OA 5JYEA 3REQA 3UJ3X 2Q4TA 2VJKA 5EJZB 3SDBA 3VKVA 4I4TA 4LXXA 4MV3A 2FU5C 3MILA 1QK3A 1I9GA 3KZKA 3R7WA 1G5QA 2Q07A 3K8OE 1VBC3 2HW8A 2O3QA 3GLSA 3EW9A 1XAHA 3BL8A 1PR6A 4ZA2A 5FXZA 3HEMA 3IUBA 1T8SA 4OTZA 5JUVA 4WOCA 2R6DA 1DP4A 2NVWA 1FSSA 2J3QA 3KYCB 1UAGA 4DBVO 1CJTC 3EVBA 2IYPA 5JARA 1YC61 4GOND 3RC1A 5CTJA 5BUZA 2H1SA 5ICGA 1BGVA 2PFWA 2DZDA 1GGFA 1D0VA 3EYWA 2IZ1A 4YM2A 3FPKA 5J2TF 3GZEA 3P4UA 1X1AA 1HRI2 5A7WB 2C2YA 4PS1A 1MRSA 4EM6A 3P0IA 2I3AA 2ZZMA 3LS2A 4KQ9A 2PUAA 1VE9A 4AMVA 3OBZA 3DMGA 3EX7C 2I34A 2O3RA 5KXCA 3OYWB 2R65A 1VLNA 1QWRA 4GO1A 5KJ6A 5HXVA 4DOUA 2OV6A 2H4JA 4Q16A 5EXPA 2VJDA 3ZY3A 4QDJA 4YUZA 3EXIB 1KI7A 5FZCA 1LPNA 1SR8A 4N5HX 1OMOA 1D2HA 2ZYIA 5KHKA 3O8QA 1AR71 4AXBA 1UD1A 3RYHA 3LIGA 1S5PA 1SK8A 5L4NA 4ZZ8A 1GZHB 2REQB 1U2RA 4D74A 3AY3A 2JGAA 4TGLA 1RWNA 1BE6A 3L8HA 3WLFA 3GRUA 5DN6A 4Y5TA 4MIKA 1MJHA 2BEUA 5JOXA 4R2JA 2JGJA 3WDXA 1OLUA 3T7KA 2FXVA 4PV7A 2EIGA 4JN6B 1ZD5A 1WIWA 1Z4PX 1JZQA 2EXHA 1PTKA 4N3CA 5FK8A 2VZEA 4QEZA 4RJIA 1J8FA 4BLOA 4UCWA 1QPGA 4PLFA 1G3QA 5EOVA 1J0AA 3VMMA 1R50A 1A88A 1ZRSA 4IE7A 3AXSA 1ARZA 3PRHA 3A6ZA 1Q77A 5BY2A 2CBXA 2XZTA 4CQJA 3IR5A 2YBDA 4DMMA 2WT1A 5EZ5A 2YYZA 5DNCA 4G1EB 4W5OA 1URXA 3UK9A 1CLEA 4G37A 5IYZF 10MHA 1VALA 4ZYZA 8MHTA 4C7BA 5A7GA 3G2JA 1CULC 4XRGA 3RZJA 3KHBA 3U26A 1H4HA 3SJZA 4EJRA 2FWPA 3WK7A 4KL1A 2BZGA 3UQYS 1X80A 4BLIA 2AX3A 2JD0A 3JVIA 3NVKI 2CUKA 2P3QA 5DWQA 4ZI5A 3ZWPA 4N0PA 2SCUA 1XOIA 2M9MA 2W1WA 3LU1A 2Y26A 1N9GA 5DK6A 3E2MA 4YIKA 4R9DA 4PIZA 4NUBA 2CDOA 2O1EA 3HOBA 1U2GC 1QYDA 1CAXB 2MU1A 4YT2A 5CLQA 5FYTA 1U2EA 1NTOA 4FHGA 2WDZA 5K01A 2A6WA 5EAIA 5AJZA 3S55A 2XVXA 1DRKA 3D6AA 4IDPA 3E6AA 5FTNA 3RZMA 1FX5A 5KAPA 2WO1A 4RK7A 2ATXA 4REQA 2ZEJA 2RB5A 3UHFA 2VPZA 3MLLA 4QUAA 4AR2A 3FGNA 1M2EA 2C9DA 2XECA 3IQEA 1NG9A 4YV0A 2UUOA 2V54A 4KJXA 5IWCA 3VR1A 3DDCA 4BN5A 1BEV2 4NIMA 1M34B 3NYQA 3ZQJA 4LBWA 9ATCA 2N0SA 2Q2OA 3ZU2A 1ZGHA 3IQWA 2QVXX 4LQRA 3TQOA 3WY9A 1R4NB 1GV0A 2BWJA 1NF2A 3RJ9A 1OXBB 4HVCA 1RC0A 3OOYA 2HM7A 4URVR 2JBWA 4AEMA 2PDAA 2GAUA 1JYEA 1G8JA 2O2HA 2Q1YA 2AG6A 3T7EA 1L6IA 1JN0A 5C3OA 1L8XA 1GXSA 5JCOA 3DTTA 5CD1A 3DCIA 1QKJA 4YRBA 4TYWA 4NJEB 1UR5A 4EQ6A 4RVCA 2BUAA 121PA 1F2VA 1UQUA 3REFA 3CU5A 2MEV2 2RM22 1XZPA 3K46A 4TV9A 1VLLA 3N0VA 3EVAA 1FNDA 1THTA 2NTYC 4G0UA 2AUNA 2R47A 3WV4A 4BXFA 4AQ2A 2VC2B 3EVDA 5FP0A 3U5TA 3PNMA 2MDTA 1LEHA 3T7TA 1ORHA 3A2LA 3CH6A 3U81A 2R8BA 2GGSA 2O2CA 1JDPA 3WGGA 2V0CA 3I9FA 2P5BA 5LUBA 1WUKS 4KG8A 1TO6A 1S2IA 2VYQA 4G1CA 2B9EA 4L97A 4LUKA 2E5FA 5LDHA 1RQ7A 2LTNA 4LDJA 2C82A 5COAA 5JNSA 3DJYA 3BFKA 1AV7A 4MVCA 1ULDA 4E2YA 2C5BA 4AP5A 2R00A 4DWWA 5DZGA 3WXMA 5JBQA 2PX5A 1KE2A 2NU6A 4D96A 1EFLA 2C77A 4AJLA 1IKPA 4JZKA 1SUEA 4GWMA 4FPKA 2RH9B 4MHUA 4N8DA 1ZBDA 5LR6A 5GJVC 2DFCA 3Q8LA 2WQZC 3FHIB 4N3NA 3X2FA 4ROSA 4ZQGA 2ZUBA 3LC2O 2J9YB 3E2IA 3DFMA 4ZKDA 2ZB4A 1NYTA 1R1DA 2QF7A 4PO8A 4L95C 4L8YA 1TVCA 2BHNA 3FZ3A 4PGMA 2B7YA 1EGQA 1E79A 2C3UA 3D7NA 2O19A 2HWB2 1B8UA 3LPCA 3L4BA 3KXPA 5J43A 4FP9A 1G3RA 4RIHA 5KHIA 3N0RA 2ST1A 3FWZA 1PLJA 3ANSA 3A36A 1DMRA 4Q27A 1T43A 1QOPB 4L8LA 4BWYA 1L1QA 1LU9A 3I1JA 3FOEC 3QVGB 5KTRA 1S3GA 2HPZA 4KKXB 2VHJA 4BN0A 3ZIAD 5KEIA 3OTGA 2C1EA 4PSVA 4RORA 4TKUA 4H2AA 3H2YA 4IQPA 4LRXA 1FP7A 5TQ2A 4GQAA 2AK3A 2DULA 1M2WA 2AWOA 4KWEA 1ZAYA 2B8NA 2XADA 2PSEA 1IPSA 4FGWA 2EJWA 2J0UA 3FFAA 2PZMA 2I2DA 4XLLA 1XPUA 4GBJA 4R52A 1KU0A 2KLHA 4PYOA 4W6XA 1F2DA 3M5DA 1N6KA 2IZWA 4KU7A 2HIGA 5FBRB 3E15A 5C34B 1V9CA 2JE9A 4QX7A 1LU1A 4LBYA 2F55A 3DW3X 3NEYA 5FY5A 2R061 5GV8A 4IIDA 1RGSA 2VTVA 3HB5X 4G1VA 2DTDA 4JVAA 3ZNPA 1XZHA 3T9CA 1EQUA 4HAWA 4IHJA 2OY0A 3OD1A 3HCRA 1QKKA 3N7LA 1H0HA 1Z6PA 3BFJA 2GA8A 4XLTA 4Y6OA 3H83A 1PV2A 1TTTA 1LY1A 2G8LA 3HCCA 2ZGSA 4ZT6A 1JU4A 2XMZA 4MVYA 1A4XA 2XLGA 3CXRA 1RUH1 1M73E 4MO2A 4IOLA 2I2WA 1O1YA 4Q93A 4K6FA 2ZKIA 4P08A 2BISA 2JK0A 4D3SA 2BVVA 3AG5A 1SCAA 1XWFA 4OF4A 5KX5F 1HEYA 1OLUB 5HFJA 4C43A 3PVZA 3BGWA 4TLDA 4GX0A 4MRSA 1AUQA 1YR7A 2R25B 2KSQA 3BKXA 1HV0A 4JYPA 1FPN2 1GNRA 2N1BA 5HIAA 3TZKA 3DWFA 1KEKA 1NY71 3I1YA 3LC7O 3VNVA 1TME3 1E5DA 5G4KB 4JZRA 2HK8A 2HN9A 3WOHA 2AQKA 1Y8RB 2IWRA 3C39A 3A58B 3P96A 3D31A 4JJAA 1SIOA 5A9RA 4MR7B 2N9UA 5DNDA 4M01A 2WFMA 4M1ZA 4ZYUA 3P9PA 3M7IA 3B93A 1MA3A 3LX5A 1Z7S3 4B4QA 4RL6A 4MQMA 4YW4A 2QXTA 3MBOA 4A3SA 3O0WA 1XQXA 4BCCA 3RAFC 4I4IA 2FZCA 3WMFA 3F5SA 5EPUA 1SVLA 3WS7A 2WMYA 2YXDA 1IDOA 5DBGA 3UWSA 3AIOA 1VECA 4RD0A 2ES4A 3S3TA 1JZ4A 4ZI2A 3EE6A 3HMQA 1VE3A 2A30A 1PR5A 4MX3A 4GECA 4RH0A 3PNBA 4DMHA 3WHPA 2D06A 1EXDA 3RUEA 5IVIA 5AICA 2IP2A 2HWC2 4L75A 5CIWA 1D2RA 3HYRA 4UTVA 3SX0A 2W9XA 4LO6B 1T4DA 2VYVD 2P77A 4ECEA 1ODFA 4H59A 3SC3A 3D7LA 5I9BA 3I9NA 1D07A 3DYMA 4RIEA 1FTGA 3F90A 3DR5A 1DXOA 2UYHA 3LQKA 2V98A 4F9EA 1JKXA 5JNRA 2RM21 1L4YA 1OU0A 4Y1GA 1XZAA 1SKMA 2HRRA 4YQZA 2G77B 3NBUA 4DJJA 2EG5A 1JPJA 5JPNB 4H7HA 4V0KA 4LWOA 2C2KA 4N7UA 1O3YA 4V2WA 1DOAA 1T9GR 4TWBA 1GDDA 1Q1NA 2VWGA 2C5AA 3SYMA 1BWQA 4ZZIA 3MNFA 4OKNA 4AY2A 4NZNA 5IEJA 3K9GA 4B8EA 2JRCA 3WLKX 1ASJ2 1MMFB 1RS0A 3BTAA 4LDZA 5KC8A 3NO8A 1E4VA 2R7LA 4QPZA 1D0HA 4RXTA 2VBPA 4ZHQF 1BZWA 2Y8EA 2V0GA 4JJ6A 3B1WA 2WU4A 1T0IA 1I4EB 3BRSA 1XQNA 4NAUA 1WZNA 2P8JA 1UT6A 4KDEA 2NPOA 4LC0A 2OT7A 4TTSA 5AC91 3AH8A 5DQ0A 5EHXA 1MQTA 3D4NA 4B73A 1XGKA 1TCAA 1CB7A 4I9NA 5FZAA 4BIIA 3HNOA 4BQPA 1JPUA 1I4OA 5ENVA 1WWYA 5LK5A 3PIIA 3A26A 4UU8A 3F3YA 2ZTMA 4ZYTA 3OX1A 3ED5A 5EMJA 1ZK3A 5F2OA 3R8CA 4LECA 1SKYE 3L4BC 4GA9A 4H9GA 1JN2P 4YM0A 5KPJA 3OLXA 2XB8A 5FXVA 4CKXA 2GVDC 1UWWA 3GYDA 3T12A 1E3WB 1AR92 4AD8A 4KQEA 2PLAA 5KBFA 3PFCA 2KWIA 2A5ZA 2AW5A 3ZHVA 2A5GA 4XFCA 5LP1A 1NSTA 2ZDGA 5JAHA 4MVJI 4U2GA 2JJQA 3AZYA 2BFWA 1LLCA 4CDUC 4PN3A 4E94A 2WUEA 1CQWA 2CLLB 4RSMA 1PW7A 2YC2C 3AZOA 1PJLA 3EWAA 1I3NA 3POBA 1QJX1 1KZYC 4UVDA 3G2MA 3W7VA 4YRQA 4G85A 4AF9A 2MMCA 1A5AB 2QDNA 5AVJA 3Q3CA 5EL0A 2CLMB 4LNHA 4YXWD 3EXUA 3LDGA 4MRAA 3FGZA 1Y3CE 4BLTA 1X7WB 2FPMA 3QVSA 4JP2A 1D0GA 4IEXA 2F1KA 1VQ1A 2RGNA 4MMXB 1AR72 2WF8A 4MIOA 3KAKA 2JVIA 4O08A 3SH3A 4HWGA 3ACGA 1T3HA 1PMJX 1FJXA 2N7GA 5IK2A 1V2HE 1D6JA 3PTAA 2R7NA 3W3AA 5FYCA 1Q1ZA 5CNKA 2CJXA 4YBRA 3ZWNA 3E4DA 2JCYA 4ROTA 4TS1A 2QMHA 4NCHA 1W36B 1YJ5A 3OQJA 2FPPA 1X7HA 4MRPA 1FL9A 1FFGA 1D2SA 2POQX 5AM1A 1LRHA 3N9LA 5K7PA 1E4YA 2XQGA 2PO5A 2Y3IA 2GM4A 5IN5A 1M6HA 1EWTA 3AI3A 1DC3A 1W34A 2JJ2A 4RPKA 4H3HB 4D45A 1OQAA 2EFGA 4QGMA 3C7DB 1CJKC 1BYHA 2JLZA 3VD7A 1PGL2 3R3YA 4JQRA 1LH0A 4ITVA 3GPDG 3OJBA 2A7AA 1CFJA 3UWMA 5JDCA 2Y6LA 4MV2A 2AG5A 3WBJA 4RHFA 4UW3A 5C32A 4K20A 1Y6RA 4RMNA 2D54A 3LEIA 3HHPA 4LVUA 4AMYA 4X65B 3A6EA 3WSOA 1NQOA 2YWEA 2JA2A 2ZTLA 5T4BA 3U75A 5JLVA 2Z5WA 5KOHA 4AB1A 3OLCX 3I2KA 2JGKA 5FUQA 4QBGB 3S2ZA 1YS9A 5GONF 2WAXA 5FL3A 4B29A 1OA4A 3ROPA 1QVRA 4WGGA 2F1IA 2WNEA 2R79A 4Z2WA 2RDSA 1BEV3 3I45A 1N5KA 2WHYA 4LOTA 1EXVA 4JKIA 1J1ZA 4HXGA 3UUEA 1NY72 5ICMA 3SSAA 1E32A 1NJ8A 1DCTA 3ZIUA 3ZVXA 1YIOA 1WU8A 1GNVA 5DGDA 1Z2EA 1I5OA 3F8TA 3PRKE 3WWDA 4OHFA 2ZUCA 3OUZA 2E89A 4ED9A 3K6SB 1T8PA 2H5IA 4LDNA 3DLAA 5A6SB 2NO5A 4IXWA 5E2IA 3JD71 3WF4A 2MEV3 3FZYA 5LCWL 4B6FA 3ZD7A 4C7OB 3NDJA 4Q7EA 4B6OA 3UW1A 1MJGA 5IDWA 1EFUA 1AL0G 3K6JA 1Q0LA 2WQ4A 2VZLA 1MDBA 1T6YA 5HE8A 1U1IA 4GXLA 2HBUA 2QX9A 5IXSA 3PTYA 3KG2A 1INLA 3ZD8A 2XPJA 3V8EA 3S2YA 3H18A 5CDSA 2ZXUA 3I59A 2EZ8A 4FHCA 3SFTA 4MI6A 3OMWA 2Q27A 2WG1A 3ENWA 2G5CA 4C6TA 1CXZA 4O1MA 1BVUA 1N3YA 1L5OA 1JZ6A 4YCMA 1ZI6A 3HCFA 1BMFA 1P33A 1XWIA 4N0QA 1E0DA 2YXNA 3GUCA 3QKIA 4GGOA 4B3GA 2ZAHA 1B15A 3SC2A 4G9GA 3VNSA 4YZ3A 2AR7A 1W75A 4DVGA 3GVIA 1P77A 1Y43B 2EJCA 2BP6A 3D3WB 2W6OA 1FP6A 3TPFA 1XVLA 3VH4A 2E87A 2BCEA 3HKDA 2D5IA 4U3JA 4NLLA 3LA7A 3NV1A 2F48A 3ZCQA 1H05A 1VBA1 4AVVA 2CGNA 1Y1PA 3QRWA 2DWQA 2Q8CA 2C24A 3A25A 1EDZA 1RYFA 4Q9JA 4AMBA 1W8TA 3CWCA 4QPIC 2O5EA 3C1AA 5AOCA 4KGGA 1WW8A 1MB0A 4LI3X 1TIPA 4RVSA 5JXGA 3M9LA 1YASA 4G5XA 3FWEA 1I7DA 2JFXA 1CDEA 1COV2 4XFGA 4TMWA 2XYGA 4O1HA 2F43A 3ZVLA 2HZBA 1IWBB 4FYJA 4JITA 3NHSA 4H0CA 1GUYA 2YY7A 1O4TA 3FJOA 2QNIA 1NVXQ 3UOAB 3IT2A 4DY3A 1Y1LA 2XTAA 2COEA 2QD4A 1X82A 3QLTA 1XVIA 3R20A 5ALPA 2FSFA 2P9EA 3E8MA 4ZALA 4R4JA 4R8LA 3U49A 3L0BA 3Q87B 3EXEB 2H29A 1JYCA 2XUDA 3V6MA 4XE9A 2XCSB 4TOIA 5LATA 1FYWA 5LNK1 1PG0A 2OFPA 3U2QA 4XGIA 3IJRA 2K9ZA 3UXYA 2GHRA 3WL6A 2QM8A 5HA5A 1BZYA 4MV5A 3GHYA 3QFHA 4RPCA 1ZOOA 1HFKA 2WZDA 5EJ7A 1NPYA 2X5NA 3W04A 1ESEA 4YTEA 3OFJA 3VZBA 1XRMA 1MOZA 4F8JA 3K31A 2X9QA 2O8OA 1CUUA 3IEXA 1QTQA 2P4SA 1BH2A 3CX4A 4W6WA 3UA3A 1GZ6A 2YV3A 4RKFA 3ZHYA 2C8VA 2NUAA 2IWGB 4R1SA 3DVRX 3MAGA 2SBAA 5CXSA 3TUJC 1HYEA 4FPYA 4RJKA 3PT5A 3FOWA 3R3UA 3M4ZA 3S30A 3U1VA 2R041 4DR4B 4Y2GA 2JCSA 4INPA 2QHXA 4Z9FA 3EMRA 1QHFA 3AU9A 4JB2A 2Q3EA 2YXEA 4FNGA 9LDBA 1JKFA 3MV11 3SEAA 2BVBA 1ZLXA 2P0AA 5FAXA 3OT1A 1Y4WA 4JELA 3YASA 3HH8A 1GARA 2Z9CA 2ZIVB 4NOMA 3KXLA 4WASA 5FFMA 1CUCA 1E2EA 3ZYIB 3AL6A 4OLBA 2ODEA 1KDTA 5CD9A 1ZSYA 1DG3A 2QVSB 3BJIC 3C7FA 3HXKA 1XCJA 1HE3A 1H6DA 3LCRA 2JF0A 3VZQA 1ATZA 3ZN2A 2UZ1B 4UAUA 1BKSB 4BNTA 3ZYFA 1DQ6A 4GXRA 2IVJA 1A78A 4YB8A 1B7GO 3I04M 4QOHA 4DHEA 2VQSA 1KQRA 2F17A 1VAMA 1G5TA 4D80A 5I9TA 5EMKA 1XVTA 5COQA 5F6LB 5L53A 1SXJB 4D9NA 4GKKB 2JIPA 5DYYA 2HJGA 1S3IA 2PHXA 3TB0A 1XD2B 3C3CA 2RG4A 1FNZA 3JR3A 1BXKA 4HD8A 1T6ZA 4Q7JB 3MXOA 1VDZA 1QOOA 4AW7A 3ZI0A 3JY6A 1IN6A 2ECPA 1E1MA 4CDUA 4DLRA 3NP7A 4NRMA 1F4PA 3W5DA 2WY2D 2WLPA 5HP4A 1DEHA 2E7TA 2IXEA 1MD9A 4I6EA 1UJBA 1FOD1 3DOJA 2R86A 3LHIA 4IGKA 3OQ1A 5IANA 4ND2A 3A1EA 3LYLA 1NG1A 2BI4A 3N05A 2HWC3 1L2TA 3KB2A 1AL22 3A9RA 5K0FA 4NVPA 1NHWA 3EQ9A 4XF4A 4DMUB 1UPXA 5L51A 1EK2A 1RUG2 4P7BA 1OXSC 2ZJBA 2CV0A 3IE0A 1NM5A 1LBEA 3AI2A 5DAWA 4R81A 3DKKA 5H4HA 3OCJA 1S01A 3DDUA 4BCDA 5HJ5A 1IUPA 4NCBA 1OR8A 2BRUC 4HEHA 2R48A 2WJPA 1G20E 3TSOA 2EF1A 2D3SA 3ZUGA 2JHFA 2UWBA 5FP7A 1JDUA 3U62A 2VRCD 5IAKA 3QVMA 2XAAA 4PGGA 3L5OA 4CTOA 3F96A 4EY5A 1NR1A 5FUIA 1YJQA 1SQFA 3VPHA 2ZZJA 3COVA 1EJ6A 4FPXA 1QANA 2AXNA 5KB3A 3JPYA 5J5CA 4BH9A 3SM9A 4YACA 1FW6A 3WOVA 2QTHA 5LVAA 2YZMA 4YRMA 1N0HA 5DOZA 2IP1A 3ZCSA 2J07A 1L5HA 5D00A 2OLEA 1E6LA 1TQ5A 3PNYA 4W99A 3K1AA 3BMOB 2DF7A 2J45A 1HQKA 2NLOA 2P40A 1U3VA 3FPCA 4TQGA 3KQLA 4MR8B 1QRUA 4LBNA 3JZFA 2O2XA 3CF6R 5DIZA 3WZMA 4F5WA 4Y6QA 1F2UA 3FKSA 1F2UB 1L3CA 4KQJA 4QXKA 5A9TA 1YNOA 1KYQA 1A77A 5CDYA 1EFCA 2BEOA 5EQFA 3TDNA 1QYWA 1QTNA 1T2AA 5B55A 3T61A 4ES9A 4XYXA 1L8LA 4B3IA 3Q8XB 1LCLA 2BP7A 1IAVA 3OURA 2DVAA 1DBWA 4H18A 3MMPA 3L84A 3ZQUA 3ILVA 2CLIB 2RFLA 3EF3A 4E07A 1CD3G 1GO2A 3TNDA 4KQFA 4KSCA 1QCCA 4B7UA 1Y3DE 3E9ZA 1W6NB 3A1CA 3JB4C 1WSBA 3BU0A 3JATB 3FF4A 1JE0A 3NJRA 1LUAA 4I3HA 5LZ5A 4MULA 4A82A 4QGHA 4MI1A 4MVXA 1DAEA 4XIKA 1C3LA 4BKUA 1GAJA 4NAMA 2AEFA 4JASB 3Q7TA 1R0YA 3HYLA 1JVSA 4CL8A 3ZY4A 4N03A 2QZZA 4YROA 3E7FA 5JY1A 4DG5A 2XWJI 2Q2WA 5LCXA 1HTTA 3TLJA 5T3NA 4FCTA 5EIBD 2GNTA 3OCXA 3PHGA 3LF1A 5C37A 4GU5A 1FS4A 4X8HA 3PGJA 1EY2A 3V56A 5EZQA 4HXFB 3KZCA 4UOEA 4AWAA 4O4JB 1IM5A 2QRJA 3ZHXA 4DPKA 2ID8A 1ULUA 4L02A 1I24A 2WNUC 2K7FA 1PR9A 2DQYA 4Y1EA 4RELA 4HN0A 4C4XA 3K2EA 1GR0A 5IATA 1EGHA 3I30X 3L1UA 1L6RA 1FXWA 1P45A 3CYFA 5CFNA 5DLQC 4QRIA 5GVSA 4YAFA 4HLCA 2ZBVA 1KHTA 3RVQA 3ZYRA 4HNAB 2IY9A 5E2BA 4K6HA 3A1UA 2D40A 4A2UA 4X8LA 4GMFA 1WULS 1E0AA 4TTRA 1K06A 4J90A 3FIJA 3GP8A 2B83A 1J1UA 4DPLA 1S7GA 1L4MA 3PYXA 3CM0A 3GJQA 4CBVA 4KR7A 1E1QA 3DMRA 3ILSA 5EIFA 1O94C 3S6PA 2XGMA 5BQXA 3EGWA 2ZS6B 3GUVA 1ADFA 2OENG 1RIIA 4KWHA 3HSYA 1B35C 1QP4A 4PF5A 5LYJB 1AR83 4WECA 1KPHA 5HJEA 1LJLA 4FPJA 1WV0A 3RJRA 2C2MA 5AW0A 1B42A 1YRYE 4EHDA 4OLAA 3ZJTA 4DLBA 3SEQA 5LP6A 4HYQA 3OM1A 4TQ9A 4DZZA 1UXXX 5J2UF 4IV0A 1RRCA 3ZM8A 5FKJA 4HDMB 2ONKA 3CJQA 4P82A 4DADA 3I2DA 1JV2B 3ZFEB 3W8DA 3DYIA 3RSFA 4TTPA 4MS3A 4BNGA 2PGIA 4JEMA 1K2VN 4AQ7A 2ZXFA 2IKQA 3KKZA 5EPEA 2Q3FA 3TLEA 4RL4A 3BI3A 2QZ9A 3H65A 2ZTVA 4ZDJA 3FPEA 4ZQHA 2JG8A 3FI9A 3VDNB 4E2GA 4C90A 4U0KA 2J9RA 2WWFA 1XHFA 4QUEA 5AIBA 3K1AB 1P4HA 1TA0A 1XCMA 4BO0A 2PH3A 2WTAA 3OLZA 1XTRA 4NATA 4OI4A 2AL7A 4M7WA 3FHTA 1HZJA 5K8IA 2VWPA 4O4IA 4NC9A 2XJ4A 3DBRB 2A67A 2XEXA 3DS8A 4C06A 3RS9A 2EFDB 2CYAA 2Z2IA 3MSCA 2GF2A 2L9LA 2IYAA 1JKIA 3GUHA 3TZ6A 1OFGA 4WK4B 3PGKA 1WBLA 3TPCA 4MVJP 4CTEA 2ISCA 4DN6A 4DR2B 4A8TA 4WV8A 4W7IA 5DUUA 1P7PA 4LV6A 1P4SA 4IRMA 2VHEA 4TVBA 3PPIA 1XEFA 1EM6A 3LUCA 3VZCA 2NAPA 4L57A 3IDQA 4TT3A 2P9YA 3PR2B 1BVYF 4H7PA 1RXWA 1K7EB 2O20A 5C31A 1MV5A 2PKRA 1R9MA 3JQWA 2HX1A 2I03A 2HMUA 4MDHA 1I32A 4IETA 2HU8A 3GZUC 1N2OA 5FCCA 3THRA 5DASA 3MLJA 3UMBA 4C5BA 1FUEA 1UZZA 3W6OA 3HCNA 1Z83A 2H65A 1ZQ9A 4R8MA 1QGDA 2PGOA 2OA0A 2MOKA 2NG1A 4JLWA 4LEIA 3MT0A 1RXIA 3IQFA 3N7UA 1PQWA 4N49A 2H4ZA 3KV5A 4O4HB 1EYBA 2FNAA 4ZV4A 4FOWA 5CB6A 3BCUA 3BS4A 4II3A 2Y1EA 1X7XB 2H1WA 3T3DA 5H59A 3LGAA 2B8WA 1BS9A 2NW6A 2IP4A 1GTSA 4Z4HA 4HTAA 1JDZA 2AFIA 2H3HA 1HZZC 4IZIA 3DTVA 2E4ZA 3MGAA 2QUZA 2PUBA 1OZHA 1NF3A 3LX6A 4IIXA 2A4KA 4MQFA 2NNWB 1SXJA 3O1IC 3OUHA 2OECA 4ZQBA 4D4HA 2VCYA 2JGEA 4G0YA 1AKWA 1T3ZA 1U7DA 1RUI2 1VR3A 1ENSA 2VA9A 2FQPA 3NGXA 2F1OA 4GP7A 2PHDA 4PNHA 1VFNA 5DHTA 2XIJA 2FSGA 3ZXXA 1M8KA 1SCIA 1Y33E 4DCGA 2VNGA 4HPKA 3SMQA 2AGVA 4J6GA 1FMD1 4LV8B 3CE6A 4BMZA 1OVSA 4RVGA 4U63A 2YIMA 4W8GA 1NNEA 4M88A 1TYBE 4Z0NA 3R4CA 2VVTA 1MAUA 1PT6A 1JEYA 4HQ6A 2XEDA 5AVSA 4A45A 1UMDA 3ADKA 3MGGA 3M81A 3ZXGA 4PTYA 3MDPA 2WWHA 1B2LA 3LGSA 1SBFA 5JMOA 3JARB 4O4LB 1CAVB 4GMHA 3VUEA 5BRNA 5LMZA 1UYYA 2QT1A 1KEWA 4EHLA 4B1LA 3IUEA 3M5WA 2FLWA 2OYCA 1H8VA 2OVBA 4ZGGA 1LS6A 5KC5A 3DWIA 1TEXA 3AZWA 4IIJF 1QCZA 3E3MA 2FX2A 4QTYA 2ATIA 4AXXA 2P6OA 2O7RA 3WW3A 1DWQA 5IDXA 4KVZA 1OX6A 3TRJA 3BPZA 1TEIA 3O95A 2FHPA 4UBJA 3AFHA 4ITCA 3A04A 2BUBA 3L7DA 1DO0A 1XJQA 3M4FA 1PG2A 2XOMA 2KQUA 4MJLA 3V1UA 1DUIA 5HBAA 3C3VA 3QU5A 4F2DA 4N8EA 3RUIA 1ABFA 2RC5A 1YFKA 4RKQA 3BQNB 4AX8A 4IEPA 2W87A 1YRWA 1GDTA 2LDXA 4QG3A 1VJCA 4XD2A 5KUTA 4N7IA 1C9KA 3QEOA 4CDNA 3WUDA 1QSGA 3WGVA 3WLAA 3H4MA 1PV4A 1MEC2 4J25A 2PS9A 2C8KA 2PTHA 4NU5A 2R32A 2XR4A 3ES1A 2J9FB 4EN9B 3R4UA 3EEOA 2VZSA 3HO6A 4IJVA 1UO9A 4Q15A 1F9AA 2JDYA 1ESDA 3M5PA 3HEBA 4B3MB 2WL1A 1JKMA 2ZAYA 4WZFA 1MIHA 2YHUA 4MICA 5A5DA 3D3JA 5MN5A 5KQRA 3AOEC 3LOQA 4LBQD 4GMKA 1ZRNA 3RU2A 3Q7QA 5HOEA 5E9JA 4XJAA 1NOKA 4IIFA 4XQEA 4XGKA 4YHBA 1XZNA 3GLVA 4JB8A 1MPXA 2Y27A 2A3XA 5LMCA 1U81A 1Q0HA 4QKBA 4JLSA 2ZW9A 4GP9A 3V2UA 1JODA 2H9YA 3DBHA 4MAMA 5KX5A 4XCVA 2Q2VA 3KDPA 1JA1A 4PR3A 4X00A 3SFZA 1MOPA 3OJ0A 2D6OX 4RMGA 2ZWIA 3FIUA 4JAAA 4FDMA 3RIEA 2G63A 1O94D 5CK4A 1OLOA 2D13A 1IBLB 5FZLA 4B31A 1NBMA 4WNAB 3UPDA 1HYQA 3QQPA 1C5KA 1M8JA 5JO0A 2O0OA 2OBLA 2F6BA 2Q8PA 4QDSA 1Z0UA 1Q12A 4J0QA 3VISA 1KEEB 2QW1A 3WXPA 1KRWA 3T5MA 2ILMA 2WZR1 5KTOA 4D3ZA 3TR5A 2VXBA 4Q1BA 4D42A 3DC7A 2VATA 2I7TA 3KT3A 1U02A 3U1TA 2PJUA 3GN2A 4NIIA 3BTYA 4Z3OA 2R96A 3E9DA 3GDOA 4D9GA 4IJ5A 1RUF3 1NVEA 2EP5A 2W5UA 5TNXA 2P6UA 1GA6A 3OY8B 1MRZA 3UH1A 2PYZA 5C6CA 2E4UA 4KITB 1KFKB 1OXCA 3GU3A 4DMGA 4EEXA 1ID8A 1R1A3 1VRH1 3K70D 1AE1A 3E5NA 5K3SA 1REQA 4ZVKA 2DU1A 2JLWA 2BHLA 5TIIA 4UNSA 3NOVA 1X6VA 1E3MA 2I2CA 2BBVA 2GUGA 2E9SA 1PT9A 3GVPA 1A9OA 1K8RA 3LBYA 4B8YA 3N70A 3F5MA 3P2OA 3P5SA 5AT1A 2CGOA 3ZDAA 4MKFA 1NLYA 1PRYA 4ERNA 3M3QA 2A9KA 5EIWA 4ENWA 4AQ6A 1GCIA 5JC1A 1J9EA 5FBZA 4FR5A 4GD4A 1UKBA 1ZC4A 1ZBQA 1FNCA 1KAGA 5J4VA 3C3BA 1IN5A 4F5EA 1RJDA 3HUUA 3F98A 2JG8B 1CETA 1FJGB 3GD7A 1JTVA 2DMRA 2I2XB 3DKVA 3LF7A 1ULAA 3PDHA 3QFFA 5A5GA 4TUYA 1W8HA 3HXTA 3B3AA 1ZXBA 5HF8A 4ESVA 1EV12 1XYNA 5DYGA 1CF2O 5C3SA 2EZTA 2BFDA 5KYWB 2HSEA 3ZBQA 1X7ZA 2DSTA 3ISVA 3DT9A 1EV11 1SQGA 2RHDA 4L8QA 1O0CA 4BQNA 5CB4F 3X43A 1BDHA 4ZU4A 3CHYA 3DWEX 4K9DA 4BATA 2W22A 3D2AA 7MHTA 4IHQA 2ZRAA 2P9GA 4JVOA 1VG0B 1GP2A 2HLEA 2WSBA 2IBSA 4YJFA 4MWOA 1RTKA 2R6QA 2AI2A 4A4DA 1J6UA 3VKGA 2J1LA 3LUDA 4LBZA 1PO7A 4DY4A 3FMIA 4P35A 2ZOEB 3BA1A 5JE8A 4DMIA 5KNDD 3DV9A 3TLBA 1C9JA 2JVKA 2DQ4A 2YWDA 2ZSAA 3KSMA 3LW8A 3W8EA 4R3WA 4CMBA 2HBYA 4Q4CA 5BW8A 1FA9A 4XQCA 1SOAA 3HXMA 2DPMA 2PS3A 4LDQA 1UIRA 4JI7B 4HSGA 1OXXK 1EGAA 2WM2A 4ZOEA 1DCFA 2HXSA 3BTOA 1PNRA 1DQ2A 4G9SB 1R15A 4ZU1X 2PWZA 3AUTA 5GZ1A 1OBCA 2XT0A 4YV1A 4GM0A 2A35A 3VBOB 3RODA 3Q3JB 3GFRA 1QR2A 3PEUA 4BS9A 4M1QA 1RJ8A 2X40A 4ZHSA 1FB5A 2YQ4A 1IVNA 1H2FA 3V2IA 5H83A 2G9ZA 2UZ0A 1S0BA 1C8KA 2QV0A 4XCQA 4A2QA 2IYQA 1JJ7A 3KDAA 3IALA 2JI7A 2OUKA 1F8VA 1K6EA 4I3PA 3O26A 4D81A 1ONBA 2GILA 3DH0A 4YCNA 3PPXA 4F04A 2FF5A 3U10A 3OZCA 2YROA 4G0QA 3DOHA 4EENA 2ZAOA 3BXGA 3EXHA 4CKYA 4PQQA 4ZT3A 2AR0A 2UDPA 1QOZA 1RAIA 1VB3A 3ESRA 4AJIA 3IT0A 2NZYA 3TLGA 5AW3A 4FFOA 2ZRQA 2Y4NA 2NTEA 3QUBA 4QJ5A 4NYJR 3NB0A 4HCJA 3RYPA 3LA6A 5HMLA 3RM3A 3DDNA 4G8BA 4JKYA 4O9EA 3NALA 3TRFA 3Q7PA 1RRMA 2R4TA 1SLIA 3W34A 1W44A 3QX8A 3QUTA 1ULSA 5AOAA 1RWBA 2Q8NA 4RZ3A 4UBKA 4DFSA 4IGIA 3AHDA 3JCIA 1WBBA 2YWHA 1PGJA 3MWKA 4W63A 5AVZA 4MUBA 2JFNA 1QIQA 2ODBA 4EAQA 5BP7A 4ZICA 4L0DA 1XDZA 3NM6B 1X9GA 3OQ6A 4PZZA 3ZWKA 3NFYA 3O4IA 1HDXA 3D5TA 1QJY1 2QNBA 3E9YA 4UMDA 4YW7A 1GZUA 2CXOA 4RGAA 5G0SA 3TAHA 2D1TA 1FVXA 2FH5B 2O1XA 2L82A 1EFVB 2BMFA 4IFTA 4EJ0A 1J42A 1NP3A 4FPOB 4FOYA 3EFOA 4RH1A 3LBIA 1Y7TA 4MHRA 4D7YA 1W3VA 3RSLA 2XLFA 3WLUA 3LBHA 4JRLA 3LQ4A 5KYYB 1T9KA 4BC1A 5CLGA 3L7IA 3INAA 5F1PA 1O4WA 3UATA 2V6BA 2YUTA 8ATCA 1OWOA 4E31A 2KX7A 2FP3A 5IT6A 4BRUA 4JU8A 2GN2A 2BLNA 4D0LB 4WJZA 1XCGB 4N9HA 3AJ9A 3OEEA 4N53C 2X5IA 1W6PA 2G40A 1QV6A 4HX5A 3QEAZ 3LWZA 1VDMA 3GBPA 3DE2X 4KNCA 3H0OA 1RXYA 2LKDA 4R9NA 2MTBA 2Z2XA 4E12A 4KMMA 1U1FA 4AP9A 5K4AA 4YMSA 5DKFA 4WKCA 1V3VA 1V39A 5FQ0B 1AQLA 1K5JA 2GH1A 1LLUA 4OXXA 1N1YA 3V1LA 2D5BA 4TVKA 1AX1A 2UU9B 2ERCA 2R0HA 2QTFA 4YDRA 3IIJA 4D3DA 4UJ3A 2VOJA 2P2KA 4OI0A 3BFPA 2GD2A 5BOVA 2VJYA 3BYWA 5HF9A 5KYTA 1T4BA 3USCS 4UF0B 1WBJB 3KNZA 3M6FA 1E2QA 3TL6A 4RXMA 1GGHA 2OCBA 4GWKA 3VOBA 3VU9B 1N6NA 1WQ4A 1HMPA 1OAKA 2FEPA 3MMZA 5K3DA 3PUZA 5TF0A 4UHBA 1IEWA 3I5XA 2JLYA 4C01A 2WFF2 5DN9A 1JOJA 1PLKA 4MVJA 5HZHA 2OSBA 3ES9A 4EHHA 2WZ8A 3CZQA 2RARA 2E0IA 3AUFA 2FMYA 5J2TA 1TMYA 1P9WA 1X1TA 2QR5A 5FYIA 2VP5A 1LOCA 1T0UA 1K5MC 4GFDA 2VNKA 3R3ZA 1XRPA 3DFFA 4PINA 1DC5A 3HCDA 3RCBA 2QN2A 3KOOA 4BNKA 4DA6A 2PZAA 4GKJB 1TI7A 1U0FA 3FTCA 4FSXA 3GOQA 4OJMX 3V4PB 2JFBA 1FTYA 2WD9A 4NPMA 2CVZA 3ZR5A 1LNZA 2ZYUX 4WH0A 1BIFA 4AECA 1Y5LA 1TIKA 4QJBA 4IJ6A 2BQPA 1XTBA 2CB0A 5EKDA 5LIPA 4QJ4A 4NS4A 1WXGA 5IMSA 3TIFA 1PZ9A 5E4JA 2JCBA 1A8IA 2A9JA 3INGA 3VBHA 3OM0A 4A3XA 4HVOA 4FT2A 1UBRS 5PNTA 2IWHA 4BWGA 1RBQA 1OLXA 4YJ3A 1US2A 4IRXA 3FYUB 5JSPA 4RD6A 5BSGA 2I9PA 4GX5A 4LO5B 2XJTA 4RENA 1V11A 5IK4A 3I1FA 4MEBA 2RHHA 3BC1A 5A4JA 1N5DA 1THGA 3S8EA 3G8YA 1GM5A 3G0BA 3CR3C 5JAZA 4X6YA 4GPZA 2W6CX 1DNPA 2Y71A 3EGCA 4QQNA 3MPPG 2XY4A 4XEHA 4XIJA 4M0DA 4X6XA 3ZHCA 4GVPA 3M3PA 2HY7A 3VLBB 4QNMA 4KFRA 5DX1A 2TRSB 3EHDA 1KO8A 4FPCA 1Z4IA 4HZFA 3HJTA 4M7OA 1NCQC 3MF4A 3WNMA 3RSSA 2Y6VA 2QBYB 1B35B 5A7QA 4CPDA 3J9SA 1ZEMA 1TM3E 3IQZA 3B9QA 3TSAA 3QXSA 4HNSA 4K9NA 5FORA 1FATA 5K9YA 5HTKA 4TXJA 3D5EA 5D51S 1WDWB 1S2EA 5BO5A 1ND2A 5D2CA 3SQLA 1VB5A 4OJNA 1GCUA 3A6PC 2EX1A 5TVKA 3ZNOA 2QRQA 5KWSA 4HRAA 4DA7A 2J32A 4MV0A 1N5LA 3ZCXA 3AEUA 1U1EA 3TNPB 2P8SA 3I73A 5B3LA 3FB1A 4B74A 5ALKA 4IOJA 4I3FA 2IYFA 3D0JA 1ZIYA 1DBPA 4M3NA 3QHPA 1OV6A 3PIRA 3KKKA 4MLOA 3U5ZB 4DV2B 3C3WA 1MEC3 3N9NA 4B3NA 1IUNA 4BMSA 4LC9A 3S6JA 3G85A 2CJPA 2VUAA 3EN0A 2PXAA 4MOAA 3CUYA 1J22A 1CAXA 1ULCA 1GITA 3QUCA 4LORA 3QY0A 1OA2A 2BR5A 1USIA 4KFCA 1B4DA 4HJXA 1PZHA 1AHPA 3AC0A 2UYQA 3N8DA 1KSFX 2EAKA 3AHGA 3T4HB 2VCAA 2A5JA 2VTBA 1TUIA 2WQ6A 3W5HA 2FN8A 5FTTC 2FW9A 4HKWA 4FC7A 4LZPA 5CBLA 5LSAA 2VF5X 1E2FA 2HT6A 1JZ8A 4BJ1A 2UZ4A 3UJDA 3R77A 1GPKA 1JEDA 5JXHA 2VUDA 4WACA 1TJ4A 1MHTA 5K05A 2WFLA 2GAJA 4X20A 1CU1A 1HRV2 1IHUA 3UAVA 4HDNA 1AF7A 3IAS6 2WIBA 2CMGA 1FX0B 4R01A 3W5BA 1I94B 1XEXA 2L69A 4YYOA 1GYKA 3EZ2A 2BL4A 4Q4AA 2JEYA 1U4NA 1UOOA 4Y1FA 2VXJA 1DLJA 2G9VA 4B4PA 2UUBB 4FWTA 5CDFA 4UBOA 2VYCA 4NPHA 1CERA 3MSXA 2JXAA 4Y6LA 5F5AA 5ARCA 3ZS8A 4Q00A 2QM0A 1W03A 5FOJB 3TTXA 4FSDA 3S44A 4DLVA 3ZUPA 2CMDA 1FU7A 4HB2A 2QMUA 1SWVA 3T3IA 2MSLA 5C5IA 3H2IA 1RWWA 1CE8A 3KFXA 4E8CA 1YCDA 3LTNC 2A6VA 2XDAA 2YINC 3U4DA 2CLHB 4E3ZA 1PNTA 3IEMA 4CDMA 4CNQA 3NH6A 3KKNA 1F7UA 4JX8A 1EBBA 2IEAA 4BQOA 4U8HA 4ZOQI 1VL0A 1FVFA 3VSEA 4XAAA 2WK1A 2B34A 1NOVA 4EA9A 5HQ3B 5JS8A 3UC5A 4I46A 3FZEA 1OQEA 4BWFB 3BRCA 4YAKA 3NLLA 4XOGA 1GTL1 5FHQA 1GWNA 1IY2A 3PA8A 3HVJA 2AEEA 1IB0A 1JZ2A 2YNMD 4GH4A 4WM8B 3C7HA 1N6IA 3G6WA 3HV2A 2BKAA 1JFVA 1L7NA 4O4JF 2F00A 4UREA 1HT0A 2UY9A 1RHI2 4JR0A 1YFZA 1REEA 1HYHA 3AUXA 5PGMA 2ZX2A 1VRBA 1RAAA 1QQ6A 5F39A 4C03A 4CP9A 4LYGA 1ZNQO 4DY6A 2GYYA 3E5XA 1A8UA 4UU1A 3HNBM 1FZTA 4A91A 2PT5A 3EPJA 1Y9DA 3WIDA 1ZMOA 1UWLA 1HLPA 5KDLA 2BBTA 4FFVA 4Z4GA 1OI6A 3O1RA 1KOFA 2JFPA 4IR7A 2OORC 2XUAA 5L3VA 4X8PA 2R072 4C3UA 2XXAA 2WIDA 1ZGGA 1L4EA 3I2JA 1IATA 1XYYA 2Q1XA 1R0CA 3G0IA 4C4OA 1FIUA 4EG5A 5AKJA 5TARA 1Z6AA 1FUIA 3Q7RA 3C8ZA 2AW3A 3E22B 3MTQA 4RGQA 2DQSA 4CEWC 3X1MA 2NMNA 3OC6A 4WZAE 3KUKA 4FYKA 5KU7A 2NP6A 2QZ4A 4B7ZA 2GPJA 4XAQA 3HV0A 3OE7D 2YHJA 5DI9A 1L5QA 1CR7A 2R7AA 1G9BA 4YZ5A 1PIV1 2VF4X 3KGLA 3MINA 3D7SA 4B84A 3OEED 3EMVA 3TN91 3I62A 4J2OA 4F96A 3EXEA 5B2EA 4QARA 4GKVA 4LULA 1MF7A 3W77A 1I3LA 1ULGA 3ZD6A 3MIZA 2ZGUA 1VSVA 2V09A 1M1YB 3DPRA 4JMLA 2V4AA 2VGDA 1A4IA 4R83A 4R1NA 5FP9A 3QPVA 4CLRB 1TMF3 2OV2A 3PEEA 2Q6KA 4X7PA 2OZLB 2XDQB 1XLTA 1QY4A 5APAA 3KKLA 3C3JA 3RGGA 4S2UA 2FW8A 5DB4A 4FWBA 2WBLC 4LOAA 1DKOA 1K8QA 4QGFA 3H6KA 2GCNA 3W9UA 4G1UC 1US8B 3G9QA 2VPTA 1UJNA 1KYVA 4I66A 5C8YB 1Z18A 1WXIA 3LV8A 4R68A 4P5EA 2OQRA 4IOMA 1ZH0A 1PIWA 1STOA 3UL2A 1Z6ZA 1O0SA 4BV2A 1JWLA 1FP2A 3MOIA 5KYXB 3FUOA 1P0MA 3BXXA 5LUAA 1ZD3A 3KJGA 2Q8QA 2NVUA 3UV6A 4UE3S 4D9CA 3W58A 5J4YA 4AT1A 1VCOA 4MYHA 4L5YA 3ABSB 3ULKA 3HKDB 4GZLA 4C0JA 2PV7A 5MHTA 1GU3A 1BXGA 4OY3A 1G9SA 1C50A 1QDLB 5ALEA 2JFQA 3LQ2A 3FPGA 5FT9A 4E15A 2WR9A 2ONCA 1KP2A 4DMRA 4A7PA 1EHCA 4MGKE 3CVVA 1DFQA 3AP4A 2WWTA 3RG0A 3L41A 1UEIA 5AKZA 3EGXB 2W00A 2DFDA 4B0OA 5CYYA 3DBRA 3IT3A 1YHZA 2GKOA 3QWAA 3MJTA 4MUIA 1K86A 3SSMA 3QELB 2FZ2A 1J2TA 1O7JA 4US1R 3KMHA 1H0RA 4OO3A 4LQDA 5EHGA 1BFDA 5LRSA 1VI2A 5CA1A 3GT3A 3AIIA 1XB9A 3UXMA 3NRJA 5HXAA 1XC7A 5BRAA 4QDKA 2C0CA 1S0EA 1HW5A 3W5MA 3FCSB 3ROFA 5IZCC 2GJ4A 2VG8A 5I48A 1K7SN 1X2EA 4G89A 2ONZA 3K70C 3HA2A 1BYIA 1D1TA 1NN1A 2ZHMA 1KYXA 1SCSA 4EJSC 2HV8A 3UIEA 4LX0A 3VHPA 1KGSA 5K0ZA 2IFRA 3NVMB 1BK1A 4W4TA 3ZW7A 4B46A 2H0QA 5CG1A 2B0JA 3ZJYA 4D9HA 1GICA 2UV8A 1DRWA 1GAEO 1D6MA 4CLDA 1TD1A 2Z6VA 1MB9A 1PNGA 5JEEA 5KTNA 3WLRA 1MTOA 4PYJA 4XFAA 1K5GA 3QPCA 4QXAA 1XVVA 5DHPA 1IS4A 3U0BA 3PX2A 5E1OA 1IJFA 2P11A 4W82A 3TMKA 2B6HA 4B0PA 2HPAA 2WFF3 3QTBA 1YUDA 3G7NA 3P9RA 2V3CC 1E3LA 1ZH2A 1GYRA 2OBMA 2NU9B 2FE4A 4PY2A 1N9KA 4H1WA 4B83A 1M0SA 4K46A 3OOEA 4B7CA 1BKYA 3BKWA 3I8TA 1EX6A 1UX6A 2GF0A 3C24A 1V8FA 2BNNA 4YSFA 2GTIA 5J4LA 2WAAA 3R09A 5LXTB 4HH3C 3VR3A 1J58A 1W90A 4MWBA 2YJ5A 4P93A 1AA6A 3A11A 4G86A 2O3JA 2OPHA 4E5VA 2QLJA 1PAUA 2YRFA 1PO21 2HQOA 1W29A 4SBVA 4BQ5A 1RLUA 4FR2A 2RS33 3FLAA 3H04A 4R6WA 4M1MA 3P45A 3TW0A 2VMIA 1IJBA 2IEZA 1GTJ1 1L4UA 2PMBA 4URUR 4MKRA 1FDWA 1XD9A 4WK2B 2SKCA 1X42A 2ZUVA 3B8HA 1KY4A 4ERXA 4LZJA 3TW6A 5AWFC 1J8YF 2F90A 2JFFA 1SCKA 2PRSA 5EHNA 4NZZA 3ABIA 4DSOA 4OQ9A 3H05A 3BPSA 3POWA 4HONA 4WJLA 4JJGA 1ODIA 4X1YA 3ME2A 2L42A 2ZVDA 1CZSA 4OSPA 2WNVB 1SC3A 2OP1A 5KCMA 5LYYA 2QT9A 3AB7A 4ZYYA 3QA3E 3EZGA 2FDGA 1YVPA 2W0MA 1N57A 2CEKA 2VSNA 4WADA 3LEMA 2FW1A 1UBJS 4Z99A 3F4KA 4MW0A 1G7CA 3Q2OA 1O9GA 3BCSA 4A3ZA 4TZTA 5A05A 1NDUA 4AVBA 2ZX4A 2Q6TA 3QVUA 3OZEA 1R3UA 2P6NA 3OOHA 4DTCA 4D25A 4TLFA 3OPMA 3I92A 2OO3A 3H1BA 1E5VA 1A7UA 4Z54A 2HHAA 2XZDA 1TLTA 2ZTUA 3DLBA 3ZE6A 1XAGA 4RJLA 4HKLA 3PWTA 2X19A 4CFZA 4RDHA 1NMXA 1GTG1 3LT1A 3EOAI 3KZXA 5C4MA 1NT2A 2HA0A 4OHWA 2G67A 2ZSBA 3D43A 3FNQA 1V26A 2F62A 3L8YA 5JVVA 1AX9A 5JS6A 1BMDA 2Q3CA 5I0SA 3I2GA 3KHSA 3T4UA 3WL4A 1OXTA 1KZHA 3S7IA 3SLRA 2ZCJA 3E35A 4DV3B 3DL7A 1U0TA 1MZ5A 1HNWB 4CLXA 3LOIA 5JIBA 3BREA 1I5ZA 2HKIA 5KKCA 3WV6A 3EAGA 4FOQA 3W8NA 1YB5A 3INTA 2XCUA 3A3YA 2FOLA 4PHZA 1LR5A 2MPFA 1HDIA 4A8JA 2E31A 4U2FA 5I93A 1HLCA 5KOHB 1NCQB 1HDKA 6YASA 3LLVA 2X6RA 1ZHHA 4MB6A 2PX4A 1YU6A 3DULA 3SZOA 1T5OA 4PF1A 2EQBA 3V2HA 3TQIA 1EP3B 2VDPB 5JH7B 3VR5A 3Q6MA 5IP5A 5FMBA 4WVFA 3DPSA 4OFXA 5CVJA 4ADSG 5DLYA 5E6UA 5A5FA 3HU1A 4MUMA 1V00A 5BN4A 1ZBE1 3WDMA 2GSYA 2O2ZA 1RXGA 3UAXA 2VBIA 1T34A 2Q1WA 1HRV3 2AQ8A 3ONDA 4EY6A 4CMGA 1LSJA 4CL2A 1EIZA 3ZMOA 1B00A 4OB7A 4M0HA 2ZGMA 2C7OA 4NR1A 2B37A 3N6VA 4AYXA 4B6EA 4YREA 4I55F 3B6JA 3P9IA 3DUFA 4QIHA 3F7TA 5H9VA 4EJSA 4RLHA 2I55A 4G1FA 5IF9A 4LDAA 4XR4A 2D00A 3M1AA 2F1JA 4XGQA 4U6NA 3RVNA 4F3JA 1XF9A 5HX7A 4Y33A 4D7TA 1XZDA 3FUCA 4RCVA 5CIQA 3LKVA 2PWAA 3EBLA 3WV5A 1YQ2A 1X33A 1UFRA 1J9GA 5K8JB 1IM8A 2Z08A 3A05A 1J2EA 2X10A 3DOOA 1R6TA 3LBNA 3SNMA 3JQXA 2I3ZA 3C3PA 1ZJWA 2X2OA 2WFLB 3O1MA 4I9HA 1Q0PA 4M1YA 3WGZA 1OU4A 1OC4A 3T1MA 3NX4A 5FBHA 1DIHA 5EKSA 1EUQA 3D4OA 3O38A 5LXTA 4RZ2A 3PVSA 4DRZA 2WT2A 3N2YA 1UKRA 1Q56A 4CR7A 1FRZA 1K8YB 1EHYA 2B61A 1ZN7A 2D6KA 1T1GA 2FPSA 3JAMA 3Q9SA 2NVUB 4NEQA 3FCAA 2FSIA 2XONA 3RRJA 3C41J 821PA 3O9MA 5A9SA 4RDXA 2OQ7A 3I3EA 4KI5M 4BHTA 1U2QA 4WI1A 1QMPA 2CYCA 3DDHA 2BCJQ 4Y7CA 4OM8A 1CWPA 3TGPA 1BEUB 1W93A 3NOQA 1VA4A 2Q8DA 3BFXA 1AN9A 2CXRA 4G5HA 4JBWA 1XZQA 2O07A 1G7TA 1U7ZA 5HTOA 4E2WA 5EWLB 5BNWA 4N6GA 3B3JA 1VKJA 1WLWA 1XJAA 2N75A 5EE9A 1ULOA 1JTZX 2CY0A 1GWLA 5AKIA 2ZACA 1K5HA 2G4LA 1XTSA 1JE1A 5CFDB 1AKEA 2VUTA 1G8KA 4XJWA 5CA6A 2P79A 3UBMA 1ND6A 3DSRA 2HBQA 2OPWA 3RKRA 1FJ2A 1FMJA 3NUQA 2NO6A 3CLSD 5AXAA 4ABYA 4OUMA 1O6GA 2VEDA 5CA0F 3ZIAA 1GPH1 4R3UC 2W2IA 3D3KA 3STYA 2HO4A 2HWB1 1UMHA 1TYEB 1OI2A 3EGEA 4V0LA 4FNOA 3KFLA 4EUKA 1M1NB 2B99A 3VVLA 3RUAA 3N6RA 3N1UA 3EUWA 5EIBC 4N5IX 3RYFA 3I64A 2C4WA 2J46A 1EWYA 4YLYA 4PBRA 1J21A 3PKZA 1KS5A 2BFBB 3ON7A 2H4HA 4Z4CA 1GYPA 1ZM9A 2ID4A 3B1XA 3TQTA 1KKUA 3CZPA 1XYVA 5A4FS 3B5EA 4MJ3A 3L8EA 5H9WA 1VLMA 4GM1A 4M9XA 1ZCZA 3CH7A 4ZK2A 1C1DA 1DQRA 3K8YA 5IK8A 1GG5A 2BC9A 1D2CA 3BJZA 4LNUA 2IXHA 1KI1A 1QNWA 3BGSA 1KJ8A 2ZBGA 3UGTA 4H17A 2FV8A 2QRUA 4TS3A 5FPHA 3BZBA 3FB4A 4KEAA 3L9WA 3K9WA 1HRKA 4A23A 2H1VA 1TUGA 3DDWA 3A4VA 4NHYA 1RJGA 4ZGWA 3HDJA 4CU7A 3V7WA 1B14A 1LW6E 1MVLA 5IVVA 4IF6A 5JJKA 3I3DA 2X76A 3F3SA 3M3HA 2XB4A 1LKNA 3MYXA 4MLZA 1HDCA 1FDSA 4MUXA 2POCA 2OX0A 1HC7A 2EFYA 3E2PA 2JIQA 3V8PA 1ENXA 2I6GA 3PMEA 2AFHB 1Z88A 2BFNA 4QXPA 2H2HA 3HBAA 4QRHA 4P22A 1BHJA 3FX2A 3NRBA 4MVJM 5CH3A 3D8CA 2H0VA 1PFYA 1T9AA 3CO2A 4BFSA 4EYGA 4NRPA 1CDZA 2VHZA 1OPMA 2Q9UA 4HNVA 3R5JA 4UYBA 2Q3BA 4CEIA 3RWOA 5DAVA 1S02A 3FCEA 1O4YA 1XEWX 1W2UA 3JZMA 1GUZA 3IBTA 4GGPA 1LQUA 1Z13A 1XRUA 3H9UA 2OD2A 1CE8B 4QSHA 3AXTA 5C8YF 1VGVA 3R1IA 3QLVC 4HFRA 5DT9A 1RMU1 3JYPA 1WCUA 2XBO3 3SHFA 1YDGA 3WB1A 1T3SA 2D62A 3WK4A 2AUTA 3QBDA 4D41A 2Q5FA 4B09A 3F7OA 3RPQA 1K6XA 4X7BA 1F4HA 2O7QA 1UP6A 5I3ZA 3RSGA 3KXDA 4FIZA 5A6ZA 5H0IA 3RZLA 1T2XA 1NW8A 5CAEB 4XVUA 4D5GA 5K8LA 3PHMA 1XBFA 2EIEA 3CVWA 4GJYA 4W5RA 3HJCA 1HT2E 4EPWA 3WJ1A 1Q5OA 5H5JA 2BU9A 1QGED 1W48A 2XMRA 2EARA 2C5FA 3E3NA 3AMQA 2V6IA 4C08A 3IXLA 1T36B 1B0AA 4YC7A 3R0VA 4G24A 4XFKA 4DNXA 4KMOA 4I1VA 3FMPB 5HZGA 1ZA2A 2XA2A 3GCDA 4F1WA 3WJ7A 3OF5A 1LQ2A 4KQ6A 1HX7A 3GFBA 1TT7A 3K0CC 5DM60 3UWKA 9ABPA 1ZGZA 1HQCA 1DKPA 1EB9A 4X7MA 2LW8A 3L18A 2PXCA 2Q5EA 2W2KB 2ZWOA 3LOBA 4BGEA 1Q3EA 3DAYA 1X8KA 2QN7A 3JASB 3M3DA 4NIAA 1BYUA 3UYJA 1SXQA 3ELNA 2IUUA 3COZA 3CX6A 2AZ4A 2V4UA 1KI6A 1S2LA 3QYFA 1D2NA 2GM5A 5BV0A 5M5BA 2WM9B 4RD2A 1O96B 1ZFNA 4HDCA 3EPPA 2YXBA 2R8OA 3CISA 4YLEA 2DVGA 3TW8B 2V7QA 4HBGA 1WXQA 5IJXA 1AUXA 3VO9A 4C4YA 5KJ1A 5HV4A 3DKWA 2IK8A 4AKTA 2H48A 3L8MA 1Z62A 3AQ4A 4N5MA 3ZKUA 3WP5A 2PN1A 3CZ5A 5HKKA 1U2GA 1VA5A 2PRYA 5E88A 2DY0A 4C4ZA 2AKAB 2VO1A 4TL9A 2X9VA 2DJIA 3JXSA 1G8MA 1E89A 1FDUA 2XUMA 3JQFC 1O0BA 1CYDA 4GMP1 1IHPA 4Z0TA 1J00A 1SCQA 3MD0A 2D3RA 2Y0DA 3C2QA 4WRRA 1L5KA 4BLRA 2FXIA 2IHKA 2WDPA 3DO6A 5F2SA 3EF0A 2X2FA 4BEBA 1C7IA 3KCNA 1LGBA 1DWOA 3RVJA 4C7KA 2YMPA 3HFJA 2I2FA 2ZUSA 3TH5A 1X7DA 2I87A 5FZHA 5JSZB 4N90A 4LC1A 3G5AA 1G9DA 2X8JA 2ATCA 5A7PA 4TVOA 3GMIA 5E6RB 5A1AA 2WLTA 5LZ8A 1RHI1 2YMZA 3NMBA 2XQVA 2PV0A 4DZRA 3DOCA 3EDRA 4BB5A 3J8F2 1AMUA 4IRUB 4FBMA 3GCGA 3P2MA 3ZE7A 3MBIA 4EHJA 1A4UA 4TPKA 5TPZD 3O9ZA 2EP7A 4I50B 4LFBB 1A1SA 1WDLA 5F52A 2Y1WA 1MVOA 2VS1A 1AUYA 4B1FA 1MABA 3NTQA 2DWOA 3OQNA 1M5RA 2VUJA 3QOFA 3TLKA 5GLWA 4EECA 1U8CB 2OVFA 1TZOA 5E7IA 4IVQA 1V71A 1PHRA 1SPXA 3CCFA 5KXDA 1NRIA 3D6HA 2LNDA 1EZ1A 1AG9A 1OPXA 5EHIA 3TD6A 4X0EA 3QK7A 4MW5A 4KMRA 1ZICA 3O0XA 3FHLA 3PUJA 3FCOA 3KQRA 2GAIA 1R2QA 3RNOA 3AFGA 4OX9B 2VSOA 2Q0XA 3ND5A 3FUTA 4IJQA 1VIDA 4GBED 3THWA 2I8AA 3WLIA 2WZR2 2HWF3 3L8FA 3HUEA 1Y6JA 4GL4A 3NUZA 2BFFA 1QMGA 1YUMA 2I74A 3KYBA 5F12A 1W2TA 5BNOA 4EQZA 3OQIB 3LDBA 1UANA 4RD7A 1SRQA 5P21A 4J49A 3QUSA 2WWUA 3HKEB 1QYRA 3I12A 2PKEA 5KC6A 5DCWA 3VSCA 5MN4A 2D43A 1XMSA 2IEBA 5ALXA 5DZSA 1JEQB 4CCKA 4X8MA 2R62A 3IP6A 5EFOA 2WYHA 1KS2A 2A3RA 2EFCB 2VZ3A 1LDMA 1JIIA 3NTUA 3PE6A 1IZ7A 3DBLA 4BQYA 3ZOKA 1OAOA 4L3WA 3TKLA 4WKGA 3ROTA 4QLOA 3S2FA 4NNOA 1JMVA 3LSEA 5SYNA 1GILA 5IFPA 4MW2A 3VR6A 3CJIC 4XUTA 3C6QA 4MNTA 3U60B 1NVVQ 1XE0A 2LROA 2FWJA 4V0QA 3TAUA 4ZCRA 4DT1A 1CUZA 1H85A 1XI2A 2VXCA 3WYFA 2VIIA 5BYBA 1KXGA 1COWD 1UM9A 5HKOA 5J2UA 3GCZA 4IDFA 2IS2A 1OYWA 1W6PB 2RV9A 4H2DA 2WABA 4AK3A 4RGKA 3W1WA 3P0HA 4JYCA 3NORA 4HB3A 3L1IA 2FPIA 2NSYA 3J7AC 5FKBA 3THWB 1XTPA 1CZOA 2YXSA 5CEEA 1ADJA 2CLEB 1GLGA 3GA5A 4OD0A 1E0KA 2F8TA 1PN3A 3G89A 1TEZA 2DFBA 3SJ7A 1CUDA 4OCTA 3MLAA 4ZU3A 2DH5A 3ZWVA 1EI9A 3O7MA 1YRHA 4L3VA 4DCNA 3NC4A 5H9PA 3KTDA 3RYHB 2FPUA 3KS9A 4KYVA 2AOVA 5JSRA 3PJQA 4GR9A 3DVLA 5D84A 1PJBA 1SNYA 4JBYA 3OE1A 3H2ZA 2RI0A 4L4UA 4UDYX 3WYAA 2QUIA 1ZY2A 2NT4A 1YB7A 1PTJA 2JL1A 1SQ0A 2WYVA 3G02A 4F2PA 3UV3A 5GKAC 4BDTA 1TZCA 4CL0A 2C7BA 4QMAA 1RFLA 2P2GA 1KSJA 3IIKA 4KJZA 4ETWA 4JD5A 4XVQA 3ADPA 2PRZA 3RRZA 4D0QA 3I83A 4DDUA 4F8AA 3SEEA 2E6UX 1CDOA 1DZQA 3OFVA 5IVJA 2A71A 1LWNA 1QQ7A 2HQBA 1BMTA 1EVLA 4PO3X 4JLVA 1G8WA 3WK6A 1DELA 1Y7IA 1S4CA 3FYUC 2WVAA 4Y2TA 3CR8A 4LJ9A 1DX4A 2IOYA 2A6XA 3E4CA 5E9WA 5DFAA 2B1JA 3RYCB 4PYNA 4B1MA 1FSZA 1IS6A 3DNFA 2P27A 4U5QA 4JLPA 3KD2A 5HIMA 1NU6A 3AL3A 1KJNA 3M89A 2GZ2A 3QFRA 8GPBA 3A06A 1FMTA 4Y9SA 3QVWA 3BH0A 1XE7A 2V9PA 1UMKA 3GRYA 1Z7BA 4LXLA 5BXYA 4QYIB 1SUAA 4I5FA 2BH9A 1Q0ZA 4KNYA 2C04A 4KE8A 1G8GA 5K8CA 4RTNA 4R8HA 3VM6A 4AIRA 3SF8A 4HXCA 5HZMA 1M4WA 2VAUA 1J99A 1F0PA 4B33A 1JW9B 4G67A 1CR1A 3REQB 6GPBA 5DG1A 1SCNE 4YCBA 1KDKA 1H4VB 3QSYA 5EJGA 5IW0A 5EJFA 2QR2A 1FFYA 4MPTA 4MQ5A 3MRVA 4Q4DA 3NATA 1GFIA 2DLDA 4YCLA 5AM3A 2RDQA 1N7JA 1OI7A 3GDGA 5FWXB 2WA3A 4YMGA 1JJIA 3RIGA 4FTBA 3ZC3A 3L1KA 4HLUC 5FLHA 5IJZA 4XXHA 1GNSA 5FWDA 2E49A 4TWAA 2MSCB 3V4RA 1HR0B 5AJVB 1X7ZB 4RTRA 5DXJA 4IDOA 2XMSA 5HIJA 3UTCA 4WY8A 5TV2A 4C30A 1J23A 2A1XA 3NH9A 5FUBA 3WL5A 4KRGA 1SUPA 2HHJA 1T8YA 1ZGJA 3SF8B 1SDWA 1ZR4A 1JHJA 3RQSA 1OYOA 3C8HA 3U9TA 1UPBA 2QQLA 3HE3A 2PT9A 5BNOC 2PHLA 1KS9A 3NOOA 2LPMA 3QKUA 1NV9A 3V55A 3C1UA 5JI2E 3NWPA 2VP0A 3IMFA 2JDKA 3ZJ4A 4EO4A 3NV3A 3L0OA 3AKDA 5IKPA 3AL0C 1T2EA 3RUPA 1TMGE 2EQAA 1Z29A 5MGNA 1TKCA 5HBRA 1KZ1A 3TLMA 1OH6A 3IMGA 5I9LA 4BFCA 1GUBA 3VV1A 1I4TD 2WNUA 3CLTC 1AHHA 1Y7LA 5KNCH 3RFFA 4LPLA 1MO6A 3C14C 3LVBA 3W9AA 4TTVA 1RIRA 1V43A 3RKSA 1JZ5A 4AFCA 3W5JA 3U4IA 3L7MA 2MHFA 1WQ3A 2JANA 1HDRA 3UMYA 5A0VA 3R7AA 5BVHB 4DA8A 3OZWA 1ZK2A 2XCRB 2WHPB 3MAAC 2R3SA 2AZ5A 5KYVA 3O8DA 1OLSA 3G88A 3MLKA 2XYVA 3BALA 2XNJA 2ODQA 3GK3A 4KO3S 2PJZA 2XJQA 3STTA 4Q1FA 1BEEA 1EE9A 2YDYA 4PZ9A 3B02A 1KBZA 2RG7A 5FZ9A 3AB0A 4ZCPA 4O4HA 2H85A 3AR4A 1TPYA 1W30A 2YUEA 2Q7XA 4Y22A 3X3HA 4J7UA 4DIEA 4IDQA 1RVF3 1V1RA 1TRHA 4CJXA 3DZCA 4NIDA 2XLBA 4FW8A 2JE8A 1YZQA 1TGYA 3GNLA 3SM3A 4M8IA 4S04A 1DIWA 4ICIA 1P2VA 1OLXB 1JT9A 4RF2A 4LLFA 2VZ0A 1GTVA 3FJ1A 3MUNA 3E9CA 3ANNA 1GZVA 4D46A 2BRTA 1Y3TA 2XNHA 4KAAA 1PFQA 1W0JA 2FN3A 2JD4A 5T5PA 1W3XA 1ZONA 4D69A 5FIUA 2PA7A 3WA7A 1XB2A 4US2R 3COYA 4EI8A 5TQ0A 3G7SA 3I6ZA 5J2UB 3RC2A 4N5LA 5DTRA 1D7OA 3VR4H 1X1DA 1U5ZA 2FK8A 3CCBA 1LPSA 4TXMA 4HL0A 3N3HA 3GEHA 4L76A 4UHFA 1JH9A 3OT1B 2Q28A 5ULLA 2ZVQX 5IXYA 5AK6A 1EWQA 2PWYA 1KVSA 2PNFA 3F78A 3QBQA 1W5FA 1HLDA 3KQMA 3OCZA 4EJ2A 4GAZA 1PYDA 1U7UA 5EJAA 1P2BA 4UXHA 3B7PA 4OQZA 2BKUA 4RHEA 2QRNA 2DV9A 1X8EA 4P4TA 3GM8A 3IZOA 1JHRA 2VT3A 4B35A 16PKA 2DPLA 3JWJA 4RY9A 4MDYA 3WG2A 2YL2A 2XODA 1H94A 1QV7A 4LT5A 5EZYF 4JI4B 3S5AA 5LNK6 3WK8A 4O61A 5L4SA 3BOPA 2OBFA 3VBFB 4Z1VA 2NSJA 1HB2A 2C96A 1Q6ZA 4C20A 1ZMRA 2VDUE 5L6MB 2H63A 3MWFA 2OXIA 1VLVA 5JCJA 3HSSA 1CVNA 4YDSA 3X0DA 1IK4A 4L7QA 3VXKA 2I80A 1YB6A 1CJVC 1Q50A 5FZOA 1A98A 3IAUA 1DQZA 1NLUA 3ZGXA 4ND3A 5CA1B 3GIWA 1LNSA 2QQVA 4XJ9A 1WLSA 3MBWA 4RM2A 3A9TA 1VSUA 3BIEA 2VNAA 3UJ8A 3Q1LA 1GR1A 1LK7A 1GGEA 3N5KA 4CDXA 3ANLA 4QXCA 3V3KA 1UMBB 4OQDA 5CLFA 4UFLA 4NOJA 5L7WA 2B1RA 3M1LA 1RAEA 3B69A 1E5IA 1LJUA 4BB6A 2FA9A 4XWGA 2D59A 1D4AA 2R1BA 3ORFA 3C5VA 4J2TA 3VBRA 4AM8A 2J5XA 5B36A 1PVVA 2Z58A 3J8F3 4DJTA 4DCVA 4MP3A 5I4CA 3H9AA 2PIAA 2NU6B 2DURA 3M3EA 3H0CA 3HLYA 3P1JA 2UXCB 1EFDN 5KOJA 3OUJA 2IZ5A 3I28A 5EJIA 3VSDA 1UKGA 1FVOA 4Q3AA 1P3DA 2VI5A 3PUWA 2ZAGA 4HRYA 4ASLA 5FPAA 3TRSB 4NENA 1NJ1A 2XUGA 3E1SA 1D2AA 4GWIA 3ITDA 4BMDA 1VSBA 4QDXA 2JIGA 3BDIA 3LEKA 5CB7A 1Z4NA 1VPTA 2YH2A 1W5TA 3N4MA 2XMBA 1P60A 4NZPA 2HMVA 2BFMA 1HYGA 1S89A 3T5BA 3QEMB 2O23A 2ATFA 4DSUA 1ISGA 3J7NA 1VRH2 5BSEA 2GP5A 3DZGA 5J98B 1MXHA 4UUAA 4CU5A 1E69A 4UOQA 3G9UA 1V9SA 2GRJA 4CEJA 4YUXA 3ZEIA 4A92A 1M1YE 2B2NA 2XNKA 2A9VA 4QEKA 3MUOA 4L2IA 2PHRA 4BFZA 3GYGA 5AFSA 2RJ3A 3U6KA 1YF3A 3OB8A 2MT9A 1GU0A 4PRZA 2OCDA 2LW7A 4JGZB 1WQ1R 4KO4S 4BVLA 5C8CA 4IEEA 1WO8A 1XMJA 2RH4A 4IDHA 3TN93 4O9GA 1GXSB 1OH4A 4QPDA 4D0NA 1S55A 1P0CA 3CLUC 4L0CA 2W6ID 1BXHA 1K88A 3A4NA 3N9MA 1A8MA 3HWRA 5LKAA 5FY1A 5A7FA 3Q0EA 2X3YA 1RUH3 1Q7GA 3KLMX 1RYZA 4ZVQA 3UKJA 4UBMA 3ZOZA 4RR3B 2RCYA 2EWVA 3B9RA 3RS4A 1XQYA 1A3CA 4CKBB 5LBEA 3SQXA 4MEJA 2Q45A 5CT9A 3A31A 3A9WA 2WA2A 1LBIA 2F8LA 4A73A 1N1MA 1C1FA 1VB2A 4UAGA 4A6PA 1B41A 2PLWA 3DE4X 1N75A 2ZBEA 1A9TA 4CDXB 3DN7A 4WK6A 4Y98A 1TVKB 2GK7A 4PLVA 5B64A 1AKVA 4TX1A 1DRVA 3DV8A 2ZBPA 2CMKA 4NBVA 3NV9A 3ND7A 3BTSA 2DVMA 4MZDA 1OXMA 1C1XA 2PVCA 2DFNA 2JG9B 4FSHA 2W6ZA 2AC2A 2WJIA 4LOHA 1SHLA 1GTRA 1P2GA 1B2RA 3WFIA 1GDHA 3B1YA 5H9SA 3THSA 4M36A 5IC6A 1QIIA 4O4IB 4CMHA 1N1VA 1AXKA 4A8HA 1HWYA 1PWXA 4DGSA 2CJFA 2IQ5A 4HS9A 4N65A 1RXVA 1RJ9B 2O05A 4B47A 1VHDA 3RTBA 2LCIA 4HWRA 4ENSA 2DCJA 2RB4A 5GGYA 5BMVA 4WEOA 3IP7A 3MWJA 4RZQA 3IDFA 2F9FA 3SQWA 4TTAA 3E48A 4MK4A 3AM3A 3RREA 3GGGA 2UU8A 4XUPA 3UZUA 3TSCA 3P52A 1W4RA 1D2QA 1U8TA 3P0EA 4XGRA 3IEVA 4BUJA 1RWMA 4ACAA 1X0VA 4FGLA 3EOBI 4B85A 1W9MA 5CB0A 2EAAA 2VK1A 2J1UA 4DW8A 4K21A 1J25A 2L2QA 4AY3A 1RWOA 3VDCA 2DFLA 4NAHA 4O29A 1SU6A 3ZZMA 3PBKA 1D4ZA 1JNYA 4MPPA 2GDJA 4AURA 2A73B 4WNAA 3OLVA 5JHGB 1IQ0A 2PUFA 1KAEA 2P6RA 1YDWA 1XCPA 5EZSA 3VO8A 2NUTB 1QQAA 4PR0A 2HC9A 4DDMA 4BVEA 4CM8B 2IW3A 2O8BB 5LEJA 3DGEC 3UB2A 2WAYA 3PR1A 4IX1A 4CCWA 4XFHA 4NZMA 4H6VA 5H16A 4NJMA 1GANA 1MCZA 3PRYA 3NHFA 2VPPA 1J5EB 4LK6A 3H13A 3EG5A 3ZPYA 5CYGA 3IBFA 3SZMA 2C2ZA 3MTIA 3OIVA 2BHTA 3U78A 2ZT5A 2QIOA 4G3YC 2WJSA 2ARXA 1GMMA 3QFTA 3L7OA 3BTVA 4GKYA 3L06A 5HCNA 3AF6A 3HB4X 1JBCA 3KELA 3ZKWA 3A4UA 2A0XA 2MINB 1P72A 5CXXA 3B6IA 4JCOA 4Q2FA 2CK3D 4QB1A 1RPJA 4HUTA 1NI4A 4ZXKA 4RADA 3EDMA 3QVTA 3T0FA 2Q5CA 1JAZA 2G72A 1WG8A 5C1BA 4DEXA 1WOMA 3BHIA 5HV0A 3R4SA 5B30A 1W1UA 3ZY5A 1K3TA 2DFPA 3IEKA 2FG5A 2W46A 2WNSA 2WBKA 5JCTA 5CISA 1ZRFA 3KK0A 4OFBA 4X71A 4F3TA 3OOWA 1SKBA 4ND4A 2RE8A 4P0PB 1SPPB 2DCKA 3E9QA 2LS6A 3PXDA 3EIWA 1ZCFA 8ADHA 9MHTA 4MKXA 2W37A 1HDZA 4Y0NA 1Y8AA 1V41E 1CZTA 1DAGA 5JLJA 2C3OA 2YC2A 1HN0A 1FTWA 4HBZA 1OVMA 3HWJA 3L8DA 3GLHE 2C2GA 1H1MA 2G06A 1R74A 4U0JA 1BS2A 5LXTF 3FL7A 4E2ZA 2QTLA 1KY3A 4ZPJA 4PM4A 3M49A 4KQ2A 2CKDA 3L07A 4N7JA 3W9YA 4TWZA 2ZBFA 3K32A 3ZFGB 3SS9X 4L9AA 3FTEA 2AFRA 3LIPA 2A5LA 3FPAA 1M6WA 3OX3A 2RHRA 1JJVA 3WZ1A 2LGJA 3A6GA 1K7FB 3OFNA 4JL6A 3SCHA 5F77A 2OCLA 1JWAB 2DYCA 2JDAA 3S0JA 2EP8A 1Z2NX 3WMWA 1M54A 2DECA 4XJXA 4C7VA 1B74A 2EHJA 1EFHA 2P69A 2K5UA 3H1AA 2R6AA 3KPVA 4QOIA 1EINA 1QHYA 3V1KA 3R75A 1G41A 3PTZA 2X14A 3QWFA 4FHEA 4D9FA 1WXWA 2CVOA 1Z4OA 1EP2B 3OZXA 2O5RA 3HDTA 1I0ZA 2XZPA 1AQJA 2WKQA 3MOGA 3GLIE 3T7RA 1Q84A 3W78A 4C4SA 4Q12A 3SSOA 2HPVA 5F6KA 1WB4A 1VBMA 4OREX 1JZ7A 2FWAA 2IYZA 1N5IA 2UUAB 4K9RA 1IYZA 4Q1CA 4ITUA 1RI5A 1RQLA 1D7PM 4CIXA 5CYOA 2ZMNA 1SKQA 1WM1A 3BRWD 5I8SA 1HLFA 2ZYVX 4Q5OA 1U0JA 4EJ6A 2O2EA 3SMHA 1BJKA 1IZ0A 1Z78A 3P2IA 3P9KA 4EY8A 1M5TA 1MQ9A 4N3GA 4LUCA 3PIDA 1VJGA 5ALTA 3NGLA 1UZNA 1RTVA 1YJLA 3FUQA 1UWCA 2Q4BA 5FL7A 2D2XA 4ZRDA 2JK1A 5DZFA 1FRQA 1K89A 1VBB2 2C95A 2BEJA 5AXBA 5C7YA 5FO0A 2XVAA 4RSHA 2Q5JA 3F46A 3QWHA 3TDKA 3I5UA 2WSSD 5EINA 3NJ8A 1XEWY 1UJ4A 1GQOA 1LCIA 3CRRA 3ANYB 1S8AA 3O93A 4WUVA 2NXJA 7REQB 4CTJA 3L0IB 2I4MA 4QNRA 5CHEA 4ZI7A 1TQHA 1MTZA 2ZI6A 3CPSA 3E9EA 4QZVA 1DT3A 1UOQA 2BWCA 3CPEA 4BKOA 3T2QA 3GRVA 2Y0CA 2HU7A 4RKRA 1W2OA 1C2TA 3U14A 2F4NA 3BE4A 4EHFA 5DSZA 5BN4B 4MH0R 1RNLA 3DAOA 1P91A 1FC0A 3OO1A 1FDRA 3WYGA 3OZUA 2OSVA 1AMOA 1USUA 3JVUA 1T9HA 1WETA 2Q50A 1BMQA 2P9BA 1VPVA 1Z7EA 1ODMA 4MGKR 2QFEA 2XJ9A 1EGMB 4OIFA 4NAOA 4KR6A 3KV4A 1ZNZA 3EGDB 1SAYA 3EMDA 2NPIA 2QR3A 3A28A 2QBXA 1VLQA 1LSUA 4YNBA 5TGZA 1ST8A 1P81A 1QAMA 3R3VA 1L7XA 2FGKA 4IINA 3H8SA 2HK7A 3G49A 2G0NA 2H0AA 3TQCA 3RRXA 4RHXA 4IFBA 2RGBA 5KDOA 1QXSA 2B0CA 2RGCA 1U4SA 3WYBA 1V9U3 4RV5A 4NHMA 1XP8A 1DBNA 5D8AB 2NU8B 1GUDA 4D4LA 4FDUA 4ETMA 1K12A 2EKLA 2YFHA 4DMLA 4TT8A 4WDQA 3F7MA 1QVAA 2I67A 2GD6A 1HOTA 4FJ0A 4L72A 1LJ8A 3RSOA 1W2NA 3ORHA 3HAGA 1N2JA 1MEJA 4CU8A 2UZIR 3USZA 4BFLA 1R12A 1NC1A 2DVDA 1P18A 1CFZA 1OUXA 2C4XA 4AROA 3F5QA 3NWKA 2XGGA 3L0PA 4UDOA 1R0WA 4Q21A 1JDVA 1NBMD 3MO4A 1USKA 2CLCX 4YUAA 5CBPB 1N0UA 4XE5A 3PNPA 5F5CA 3USES 3GJTA 3RI3A 1ZI8A 1EUTA 2RJKA 2Y0PA 4MQUA 3JQAA 2FPPB 1IMOA 2ZGPA 2J3EA 4F38A 4BNHA 5IWFA 1XDSA 2HMAA 2NAFA 2FDRA 2ZSEA 5CW1A 3GRFA 5C4WC 3H1EA 3CS3A 3U7QB 2D8MA 4W5JA 3CUSA 1CIWA 5G40A 2CVPA 1YWKA 2EGHA 5AVOA 4CHTA 1RP7A 3JQRA 4XWYA 2ZR8A 4YO8A 1RWXA 1R1A1 1VRH3 2W1UA 1K9SA 5JZSA 1P2TA 3GGPA 1X2BA 5F4BA 3H4IA 3X1KA 4C04A 1U5AA 3PLAE 2QQEA 4QX1A 2JAOA 4BDVB 2WKRA 4YRKA 1CTQA 2D2EA 3SICE 2QTGA 5K09A 4M1OA 4Y2YA 1H1IA 3QLJA 3FX3A 4WOJA 4EFKA 4YHHB 2YU2A 1MU0A 1H4TA 1UDBA 5JDCC 3H2GA 2VTKA 4ZVPA 4A10A 1AKTA 3C6MA 2G5TA 4G23A 4PSAA 2I4OA 3TOSA 4QHYA 2PA3A 2IY7A