4K7JA

Peptidoglycan o-acetylesterase in action, 5 min
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
350
structure length
350
Chain Sequence
b'GLLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
total genus 125
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k7jA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k7jA01
1BWQA 4JJ6A 1FXWA 1ES9A 2VPTA 4Q7QA 2WAOA 4JKOA 1DEXA 1ESDA 2HSJA 1K7CA 2WAAA 2Q0SA 1WABA 2Q0QA 5A4AA 3RJTA 3HP4A 4DEVA 1JRLA 1BWRA 3DT6A 4JJ4A 4IYJA 4K7JA 4HF7A 3DC7A 1Z8HA 4LHSA 1ESEA 3DT8A 3SLRA 2APJA 1ESCA 1IVNA 3P94A 4M8KA 4OAOA 3W7VA 4TX1A 1J00A 4S1PA 3U37A 5CD9A 3SKVA 4I8IA 1ZMBA 5B5SA 1YZFA 3C1UA 4PPYA 3MILA 4JGGA 2WABA 1FXWF 3KVNA 4H08A 4HYQA 5JD3A 1V2GA 3PT5A 5BN1A 4RW0A 4NRDA 4XVHA 4K40A 4K9SA 4Q9AA 4JHLA 3BZWA 1VYHA 4OAPA 3DCIA 2W9XA 3DT9A 2O14A 1VJGA 5HOEA 1BWPA 1PP4A 1U8UA 4K3UA 1DEOA 4RSHA
chains in the Genus database with same CATH superfamily
1D4M2 1TYCA 2GK3A 2EJUA 5CLQA 1NWCA 2BKVA 5I91A 4N8MA 3L04A 5C9AC 5KNLA 3FGOA 2BFMA 4J75A 3JW8A 2VZ9A 2GXSA 2LALA 4ETNA 1QX4A 5DXAA 3WISA 1NN1A 3TDMA 2XTJA 1AR62 4PLPA 3D3JA 3UV3A 4NZMA 1ITZA 1E3JA 4LF8B 5I0SA 2W0SA 1T36A 1SQ0A 2HIAA 1PK6C 3I12A 2WW8A 2E4YA 1Q7BA 2Y1LA 2CW5A 2WSBA 3CRVA 3ENVA 2Z1DA 1HQYE 2BLNA 1R27A 3MIZA 4JXKA 3JD2A 2FWIA 2IU3A 4WVMA 3LS2A 4P3XA 4YV7A 5JRJA 4MW6A 2YJGA 2H7YA 4XFDA 1V26A 1EG7A 2CWWA 1NVVR 4D6QA 1U2DA 2CLMB 4HAVA 2XA9A 1S3SA 5KQGA 1PGL1 4ZU6X 3C7FA 1RWBA 3TG2A 2MSCB 3E15A 3WQBA 4QPIB 1IKPA 1HFEL 4XF0A 5U9CA 3ND8A 1J9GA 1AX0A 1E9RA 3VOTA 3TLEA 5BR4A 1BQ3A 4JP1A 2ZT7A 1GQSA 2OO5A 1X13A 1ODFA 4DZZA 3Q7PA 3NT5A 3P32A 4JJZA 1RMU1 1SK8A 1XXHA 2GD6A 3MT9A 3WLLA 4O0MA 1EX9A 3U4CA 2ILVA 1MV5A 2FDXA 3TECE 4C6SA 1SKYE 2N3ZA 1A3CA 4W8JA 3A36A 3C48A 1YE3A 1Z6PA 4JGYB 4ADSG 5HFJA 3AJDA 1OPOA 1LA2A 2VXYA 4RPCA 2QQPA 3I9V6 1CZRA 1QK4A 2VUSA 1ELOA 1R8XA 1QORA 1C14A 1DRWA 4YJ2F 3E5HA 2I6TA 1WZ2A 3B7WA 1CSEE 1IQAA 3KEFA 3B6MA 1RMQA 4P36A 3IHLA 4UUAA 1MO6A 1DC8A 4I2OA 1V5GA 1T2XA 3AR6A 1E1QD 4HN2A 4XB2A 5IUNC 4F4HA 4XCVA 4XWGA 1H8TB 3TZLA 2JFUA 4RVGA 1OH7A 3L6OO 2CXPA 5FPAA 1JX6A 3FKJA 5ESWA 1X9GA 4CKBA 3RYRA 3QFFA 2EJTA 1R0ZA 5J36A 4NF2A 2ZGNA 4V0LA 1VI2A 2NP6A 1Z5VA 3A1WA 3V64A 4AJ1A 3V8RA 1QNLA 4N53B 4KQ2A 4DMMA 2D5IA 3HP4A 5FY9A 5CJPA 5L7YA 2ABWA 1O6BA 2QRNA 2J9YB 4KXWA 3FTCA 2ZJYA 3EK2A 5EMKA 2RAVA 3KRTA 2EBWA 1RQ7A 3ZCSA 1Q5OA 3GXOA 4MZDA 4DMHA 3AIIA 5JZGB 1LFDB 5GQSA 2E1PA 5L9AA 4KGXA 3FSRA 1ZVKA 4CU2A 10MHA 4B4DA 2GZAA 4NX2A 3OZUA 2BV3A 3QKRA 2JAOA 4PQGA 1RC6A 3PNMA 2J48A 3R4DB 1OV4A 2HPHA 3GA0A 1AA6A 1SM4A 4U2CA 5B55A 1QF6A 3LUKA 4WBNB 4F8JA 1U65A 1UBFA 4CLHA 1VP6A 3WV4A 4G26A 2C00A 3D8RA 4R69A 1DFQA 1GRRA 1RMU3 3TL2A 1ZZ6A 2Y34A 3AGQA 4IEFB 4PJYA 4WK6A 2R47A 1P1FA 4Y3OA 4ZVTA 1GG2A 4LBWA 3NAPC 3G59A 2CVPA 1GOHA 3U7FB 3K32A 2QM7A 4OQNA 4UUPA 2E55A 3GJ4A 1JMUB 2NP0A 3I58A 3TRJA 3D6MA 3HJCA 2JG8A 2WFAA 2VMIA 2GMMA 4WNCA 4AB1A 4XFAA 3P9QA 5JAXA 1JS1X 4BVLA 1E2JA 2D0IA 3TUJC 3B78A 1FT9A 2ZQ5A 4DMUB 2I78A 3KEQA 2R1ZA 3NJYA 5J3UA 1GNPA 3JARB 4S1VA 2A6YA 1WG8A 1R8JA 5CVUA 1AX9A 4PEVA 2NZ2A 2WR8A 3KPUA 5EP3A 3E4DA 5B1EA 1KGYA 2QQJA 5DU2A 2LCQA 3DAHA 3GR6A 1QS0A 1NW3A 3RKRA 4YGEA 5JPCA 4X1IA 2VZRA 4ZODA 3IE2A 5CB8A 2IDMA 3QTBA 2XNDD 2FKNA 4MJ3A 3SC6A 1OVGA 5JZMA 1B8VA 2Z2JA 3EIHA 5UKDA 3VBSA 2R8PA 2GKSA 5ITVA 1JXAA 3GLHB 5JV5A 3NHMA 2JG9A 2YHUA 2PWPA 2CEAA 1Z47A 3ZE9A 2BHSA 4MR7A 4B83A 4JLUA 5KB3A 3CW8X 4FC7A 3W8NA 2OFOA 2XPCA 5HQJA 4YW4A 2TECE 1UBNA 4FILA 5A7WB 3PNQA 1OPMA 2HJVA 3HJTA 4O4JA 4LORA 2GCOB 4L99A 2QTVA 1SRRA 5CLHA 2OGWA 3VHLB 3VC3A 5AVZA 2QVCA 4KXYA 4XJTA 4Y3UA 2C9YA 1XE3A 1T9CA 1AQIA 2I3ZA 4FMDB 4AG6A 1DGLA 3KX2A 2V4ZA 3HR7A 5F98A 2FDHA 2QSZA 3ZJ5A 4OQFA 4B3BA 4ZVSA 4Q4Y2 3UZUA 5DYGA 4RTPA 3TNJA 1IHMA 1BW9A 4F6LA 2P3LA 2IHYA 4PC7A 2OUIA 3HUDA 1V5EA 3CINA 5HJ7A 1Q7EA 3NJZA 1MT0A 1WSAA 4RGAA 2QF7A 5F5XA 5IDVA 3SZUA 3BWEA 5T52A 4EKYA 5L95A 5AVUA 3S2FA 3N5CA 2XLCA 5M04A 4LA4A 3DFFA 2OQRA 1S96A 3M33A 4O4IA 4JVNA 2C7RA 5JSOA 3BAFA 3LX8A 3OJ0A 2E7ZA 3V2UA 1T8WA 1E3TA 4CCDA 1G5PA 3VZCA 3ESYA 2V7QA 1QB7A 2KMLA 3O1IC 1EFUA 1CLEA 3GAZA 4ED9A 4YXFA 2YQ4A 4YS6A 1O54A 2IEIA 3OEWA 3JU9A 4QTZA 4MQFB 3OQNA 1HKDA 4GWLA 4JYPA 5KOJB 4B6GA 2X09A 3VKLA 3RFVA 4RMGA 1ZL2A 3OZTA 2HV8A 2JJ2A 3NYRA 1BCXA 2NUTB 3VDDA 4YZ1A 4BZZA 1E5IA 3AMMA 1K5MC 5LEKA 3IQHX 4H7PA 1X7XA 4MS3A 3ZVXA 3CY6A 1UAIA 4L78A 3ZUPA 1CR0A 3PEYA 5AH0A 3WLMA 2BGIA 2XUQA 4BTVA 3HJBA 4QUAA 3B48A 1AR61 1UX6A 3KQRA 2TS1A 1E2MA 4DR6B 1AUVA 2LM3A 3ZDQA 2QV0A 3KWLA 4PHGA 3NBZC 3GLTA 3P0EA 1QHYA 2IVJA 4HWGA 1ZESA 3SM3A 2QI9C 2FSSA 3QU4A 1V7ZA 4N12A 3T0BA 4OL9A 1V41E 1JJ7A 5EE5B 4AJEA 1O95D 3JAWB 4L9AA 1ZH0A 4FWIB 4UNRA 2O20A 3N9MA 2QRKA 4MJ7A 4URFA 4CMGA 4OZOA 3KZKA 4G9SB 1G20E 3HB1A 3LFIA 4DDMA 2WD7A 3RBAA 3ESAA 3VTZA 1JJIA 1AKQA 3DZJA 1NBMD 2ENWA 4XABA 4EPXA 5SV5A 4YQFA 1HNXB 4GL4A 2ACVA 1CJTC 1DADA 4CDGA 5EQTA 2CFOA 3GNQA 4IE0A 2DERA 4R2MA 4IEIA 2H7XA 3RUIA 4CQMA 2NYVA 3GUUA 4IOLA 4IIXA 4Z9YA 1MS8A 1QYWA 4EZEA 1F4HA 3SG0A 2XB6A 5FZFA 1DBVO 3BN3A 4LJAA 3KPVA 3JV7A 1QIFA 3AP2A 1KRHA 1Z7BA 3P0RA 3B3AA 3FF1A 1XK7A 3URMA 5K0JA 1LCLA 2YOFA 2JE8A 4CDQB 3NXKA 4XJWA 2NO0A 1C30A 4WOBA 1OJLA 5CITA 1VBKA 5BNNA 1PL7A 2D7DA 2A7AA 4AEJA 4RGKA 2RH5A 3A05A 3D7MA 4O4HA 3FOFC 3HCDA 5EKDA 3LX6A 1OXMA 3AYDA 4GZ3A 3IMGA 5BSHA 1EAH2 3K9BA 3BGOS 1F12A 1I3CA 4LHZA 4DIKA 5AW5A 4BMXA 4BNWA 5CT4A 4RJJA 2BFEB 1X50A 3FWPA 3WE7A 1UYXA 3OQHA 1AR63 4Q26A 4NQZA 4DZRA 4EENA 5J7MA 1DGQA 3V7FA 4KV9A 2PX8A 2W2KB 2ZRNA 1V35A 1DARA 4L8YA 4M6WB 3N3AC 2XOKD 5ITWA 1K6JA 2HHHB 3IVRA 2YBKA 4XQDA 4GGOA 3EMVA 2R1VB 4QDQA 4TTAA 4LZNA 3GLRA 4GNKA 4XAQA 2DLCX 4QC2A 4A1FA 2JVKA 5D3MB 1XBFA 5CP8A 3JQFA 4KI0A 2Q0QA 4LPKA 3TZQA 1YQ5A 3C6YA 4Z99A 4Z9FA 3M5CA 4RC9A 4EE2A 2Q2WA 1RWMA 2EIHA 5H82A 3KJEA 4TTGA 4X6RB 1U04A 2UVDA 4L07A 1GT6A 1Z17A 3B89A 1RYZA 1Y5IA 1LJ8A 1L7XA 2BAGA 1F2VA 3H99A 3NYWA 1VLVA 5EE0A 1NFRA 2I5PO 3O14A 5BY2A 1L7RA 3ZBPA 2RDRA 5L8VA 4P4UA 1H85A 1R74A 2AOTB 4YXWA 3EGEA 2ZI5A 1F4VA 4WCFA 2AQ8A 2Q7OE 2EX1A 3DFUA 3GFTA 4CTMA 2IUFA 1GWNA 4HN0A 4E2GA 2P1RA 4EJSA 4XJXA 3NOQA 2GN8A 4Z53A 3HBKA 5E95A 2OBLA 2BJVA 5G3YA 3PITA 1OD5A 4RHXA 1SQFA 1P7YA 4CUGA 4QFDA 2GFHA 4XIKA 1JQAA 2WJAA 1UWKA 2HHCA 3HGMA 1YFWA 5EE1A 3NHRA 2P2GA 3ZK8A 3ITDA 4YIKA 4Q7QA 4X1YB 3DONA 3RAGA 4HY3A 3JTEA 2BDRA 4JKOA 4JVMA 1KI6B 1YR9A 3O38A 3NQ41 5FTJA 1SZDA 2QQ0A 4DRXA 1RJWA 3WGOA 2R7MA 4U0JA 3WK6A 4MHSA 3JQBA 4HLNA 2PG3A 2YBDA 1VKZA 2IYQA 2GVZC 1RDFA 3WZ2A 1JB9A 4QHBA 3OEHD 1VKHA 1PUIA 3LF2A 3W7VA 3LYHA 1LX6A 4DXSA 2Y0PA 4P4GA 3S2YA 1VRVA 2H1OA 1H1LB 4MXVA 1YU9A 4JLDA 1USKA 1XD9A 1YUBA 3WIBA 2AACA 1J0AA 3GDGA 5CFRA 3BDAA 4ZANA 5LR6A 4M7WA 3OE7A 5K6AA 1GNVA 3JQ7A 2VHQA 4G23A 3EVFA 2QL6A 3VISA 4LBOA 1K27A 2I4MA 1UC4B 1M74A 5T6MA 4QB1A 4D7YA 1LFAA 2JCSA 4D56A 2FE4A 3TEJA 2YS7A 4HK4A 3KEMA 1JYNA 1BN6A 3FNHA 4YDQA 2JIMA 2FSFA 3FLBA 3E9QA 1FBTA 1SG0A 3KVOA 1BDJA 3OO1A 1LRHA 5IVPA 3OX2A 2RS12 1XV5A 1F6BA 2AT1A 3JQGB 3NIDB 2BEOA 1U99A 4ZEOA 4NU6A 3DULA 2WE8A 4ZOQI 2Y6KA 5HDQA 1BJKA 4UBOA 4W4TA 3G8YA 4BPZA 4UFOA 1GITA 3NV4A 1I2MA 2JIGA 1ZD8A 4X71A 2AEMA 5ITZA 3VA7A 3F1LA 3TNFA 5D5QA 4P0QB 4TMTA 5JEDA 4JTOA 3DEYX 3ILSA 3CT4A 3UQZA 3QOPA 4CP9B 3CVYA 4FPCA 3TYXA 5EE9A 2ZYDA 3PDIA 1ENSA 2OCDA 1I4WA 3VSAA 4DEXA 2L17A 4EW6A 4B2LA 4MGKR 3WRWA 5AI0A 2DFDA 4BLUA 4HZUA 1FB5A 2CEKA 4GUDA 2AFIE 2A6XA 2FHSA 5HUQA 3W2GA 4RPJA 2I1VB 1L7OA 2GVNA 1PGW1 3C7EA 5AVTA 3HB9A 5DM2A 3EEYA 2WYOA 4EB0A 1BXKA 4P9IA 3EXEA 3TQFA 1H0HA 5ENZA 2UU9B 5FA5A 4U9IS 5H80A 8ATCA 1W0OA 4LBQA 2IP1A 2O52A 5I8ZA 2IOQA 1AL0G 2ON6A 2XA1A 4JUIA 1L4UA 3QHPA 1G42A 2DEUA 4KQFA 1YHZA 3R7SA 2WDBA 2O5VA 3FNBA 1I10A 4L7VA 2EL9A 5IAJA 1FW6A 3VRHA 3L02A 3HHEA 3ZWAA 3E70C 1KNXA 3E8SA 3VZMA 1D6NA 5C8CC 5J48A 4UFHA 1G4HA 4M1SA 1ECGA 2HLPA 4B8WA 3MLBA 4NAHA 2IYYA 5ICGA 2YRXA 3AZQA 1AXEA 4QYXA 4ABTA 1NA5A 2G40A 1UWCA 5D8AC 3HT2A 3OX4A 4L9BA 3RHZA 5BNPC 3I37X 2QPLA 2XEDA 2VHEA 3IP8A 3U5ZB 1IY8A 3HXTA 3AFGA 2AR9A 1ULSA 3EG9B 3ZO0B 3TLGB 3EIEA 1CR1A 1FL9A 3LA8A 1Q1QA 4Q9DA 1W87A 5CT9A 4LMAA 4KXMA 3DFMA 1NPDA 4HH4A 2QZ4A 4N0EA 5G1NA 521PA 1ORIA 3KSAC 3HXOA 4K8RB 2IU4A 1RAIA 3PR1A 2B8NA 1SXGA 5A32B 3SC3A 2O2JA 1ZITA 3RREA 5DIZA 4HGOA 4UBMA 2DLDA 3T0DA 3NUGA 2DBIA 4LIVA 4PIXA 3H9UA 5HZMA 1SUIA 4DUYB 2J7KA 4HB4A 3TD2A 1BVYF 5CYYA 1QXSA 2DHQA 1ZA4A 4PBPA 3VBUC 1I51A 2WEKA 3BPZA 2B92A 3QMMA 2QLLA 4KE8A 3CNNA 1SPXA 5I4KA 5A9SB 3JB4C 3LMKA 1GP2A 4DADA 5GM2A 1EX7A 4JLNA 1BA3A 4JC1A 3DV8A 2GNTA 1RIIA 2HLHA 4G63A 4RTLA 4KTTE 4NTZA 4KQWA 2TYSB 5EXXA 3PI6A 2XCQA 1O4VA 1XZCA 1I3NA 2C9DA 3F7NA 4AJNA 1DOZA 4DS3A 1XPRA 3V2IA 1M2EA 2WILA 1T6YA 1YJ5A 4DC9A 1NGSA 1RHQA 2PSFA 5ALJA 1W1WA 1ND3B 2RBGA 1VIMA 4X24A 3EARA 4OA5A 4LYHA 4EYQA 2DCKA 1P9LA 4EKEA 2CL6X 2OX0A 1XNAA 5MN5A 3KYDB 2CYCA 5GZGA 1HRDA 4YRFA 2YW9A 3O4GA 1ZOSA 4NJMA 4RZIA 2C8VA 4G0PA 5FV7A 2G83A 3LVQE 5JAHA 5DBGA 4DNPA 1H05A 2VMCA 1XU7A 5FHRA 5JSPA 2OZVA 4Q93A 3ZK9A 5G0UA 5EWSA 4AQDA 1BA2A 3QIAA 3THWB 2Z3VA 3HC7A 3QW4B 1WXGA 2HA4A 1A9OA 2JEOA 2VP4A 1G2PA 2ZT6A 2OFPA 2ACEA 1EGAA 3JVUA 5T5JA 2AG5A 1EH5A 3LPLA 1P33A 3O91A 1X9HA 3B1WA 2QD5A 1W34A 3CZUA 1LHVA 2I2SA 1XZ8A 3H11A 4UXHA 1ONAA 1U7WA 5L9VA 3JQPA 2CLKB 1E96A 5HV4A 1R4MB 3KEGA 1C8NA 4C0SA 3WYFA 1TC2A 3RZZA 2E32A 3LDUA 3ACBA 3BK7A 3ZX5A 1HB2A 4LO6B 2XMGA 3POBA 5HXAA 1XDZA 4EMUA 5B53A 4U2KA 3R7NA 3KXLA 2O48X 3VYRB 4A0SA 3S2IA 2IJGX 1D0IA 3ESDA 4EWDA 4EUFA 1FP1D 3WZLA 3IV7A 4GI7A 5BMVF 5LZ8A 3P45A 1AKTA 1UCFA 2BUAA 4YCNA 4ZVVA 4C05A 1J24A 1J3PA 5BV6A 1U7ZA 5CFCC 2GZ3A 5KQSA 4UAVA 4IV0A 5HBRA 1WRBA 4NG5A 1RYMA 2MSDB 4X54A 4RA9A 1S8FA 1GFIA 3S1SA 1DG9A 5EESA 3RKSA 3HCPA 4BO7A 9MHTA 4AJHA 4NJEB 2RG1A 4R8HA 4JEMA 1XMQB 3O9MA 4KQEA 5GV8A 3U4XA 1OZHA 4GYJA 4R1SA 3G0OA 1S2MA 3CKKA 2H0QA 5L7OA 1ULEA 4B3GA 3ZIUA 2P2YA 4EKNB 5A05A 2YN0A 4XXHA 1C4XA 3QX3A 5SZIA 5J40A 4TVSA 4LKFA 4OL0A 4M8IA 2F59A 1JIXA 2XOEA 3I8XA 5HOQA 1N2CA 5BYKA 4RF2A 3W9SA 3VJLA 2ZSFA 1P2VA 1C81A 4V02A 1P5FA 1S0IA 4INPA 2SHKA 3HPRA 4LC0A 2WIGA 5JD3A 3TEYA 3RBXA 4Z49A 3T09A 3NKLA 5FLIA 3HG7A 1UOFA 1QQAA 3JZVA 3D8UA 5AI9A 2J1AA 2GT1A 4WLEA 4TL9A 5DH9A 5B57C 2BV4A 5JVVA 2DT8A 1OYYA 2RS11 5K0NA 2AJTA 1L3CA 5HF5A 1XDGA 2FWAA 2VHJA 2Z5VA 4GMDA 4AF7A 1Z2EA 3NDIA 3F7OA 1N9ZA 3NP7A 4A3XA 1ZD1A 1KI3A 1RPZA 2P1DA 5FMBA 2X0EA 2DVGA 2FR8C 1EESA 4DEVA 4RY2A 3PTRB 4K5QA 1H69A 1KGDA 4WVFA 4MCIA 4DAOA 3ER8A 1EVJA 4L0QA 2PIDA 3JQAD 3TTXA 3C3JA 3L2HA 2C78A 3QNWA 5A0TA 2Q4SA 5EYXA 3G6JB 1QYRA 4YP0A 2OHVA 3VPGA 2YY1A 4TSFD 4EM6A 2AEEA 4JQYA 3IDEA 1B0ZA 3M5DA 3MK31 4AQ2A 3DNFA 4XASA 2BMJA 2XGJA 4B71A 3RRDA 5IC5A 3RQSA 2ET1A 5EQFA 1HL3A 4C21A 1ZL0A 4V2UA 5C5IA 2O1EA 4WESA 4P4NA 1XZIA 2QRMA 5GWXA 3REQA 3L1UA 4G2NA 4XM2A 3UGGA 4R9NA 1T8TA 1GWKA 3P9YA 4S04A 4EG5A 1HDCA 2WZ8A 4NXNB 5D21A 2VDQB 4L2NA 5JPDA 4BQWA 3PFGA 3QJGA 4ANFA 2QNKA 4QHYA 1MJGA 3ZDEA 4NIDA 4QB2A 5A3TA 1P44A 4KVAA 5DAQA 1URXA 3NORA 1I6WA 1X7YB 3U9TA 4PQEA 3E8XA 1VG9B 4KWTA 1P4HA 3I53A 3WG3A 2CC2A 821PA 2BFUL 3EEFA 4TPKA 3WTCA 3EJWA 2XJSA 1QHEA 3AEUB 1T2VA 5J9FA 5TF0A 4FFIA 1IXKA 2O3SA 2RS13 2JI7A 3I3SR 3DD5A 1VE6A 3AZPA 4CPBA 3SJBA 2HADA 4DSTA 1RHUA 1YBHA 1LF5A 5FTKA 5GZFA 1QNFA 2QEQA 4NYJQ 4I55B 1WMAA 5FMDA 1OD3A 1QWSA 1IBSA 3GEGA 1M4WA 2QE6A 1IY0A 3TIVA 3H3UA 1HYGA 1W9HA 3LM8A 1R081 1TIPA 3WRYA 1LU1A 3ZYJB 2X4IA 1S2OA 3KL2A 1DC3A 1IBKB 5J2TB 3WDWA 5IHPA 3HA2A 1PTJA 1M6VB 1GPBA 4XACA 1OA2A 4L50A 1A4RA 1PQUA 4QU8A 3IE1A 1GPLA 4FDVA 2XOMA 5F6LB 3JYOA 2WWRA 3TZCA 3LP6A 2IPNA 2Y92A 4FQ4A 1XSQA 5KNCD 1NVDA 4WFKA 3DT6A 1NRIA 5BNQA 4B9EA 3QXXA 1IXYA 5EP1A 4Z9XA 2D2VA 5K3FA 3N2LA 3NM6B 5J4YA 3WYBA 1OBCA 1IMJA 1NQOA 5I9MA 2AXNA 2YN2A 3PQFA 1ZMRA 3ZVNA 4X62B 3G3EA 4CF6A 3R0XA 1ZXBA 2ANBA 1GZ4A 4LGMA 1FJXA 2BGGA 4YR7A 1UKAA 1ZM1A 4S05A 4OXQA 2K87A 3ITEA 5JYDA 3DVAA 4JUCA 1XPUA 3U09A 1OZFA 5KC5A 1LNQA 3ZVLA 3KQLA 4J16C 1Q8QA 1V1MA 2W4MA 2Q8OA 3MJ4A 3AWDA 4D74A 2TEPA 1MG5A 2MYPA 4QELA 3LU1A 2CLDX 2D8AA 2NYAA 4YQZA 1HY3A 3ROTA 3T3YA 2YTZA 4AUKA 3TKAA 3GFBA 2VK1A 1UN1A 4XQ4A 1XB2A 3QF7A 3X2EA 1U1IA 4JSTA 3WP4A 3BB4A 1E6KA 1YQUA 3SE0A 3X1WA 1QG6A 2D1RA 2ZRCA 1X9TA 1P72A 3ZGLA 1CEXA 4AULA 1JHPA 3ZU5A 3C6MA 3B6ZA 3BCRA 2V5YA 1MB9A 5TX7A 2A6ZA 4JJFA 1SFPA 4N43C 4LZOA 4KYTA 1QV6A 3ZHCA 3UK7A 1R083 4GZ5A 1H0BA 3KC2A 1NVWQ 1OV6A 3RK4A 2WWWA 3VAZA 5FYQA 2FEPA 1YKSA 3NNLA 4A7YA 1CS0A 1XWFA 2GPNA 5KHJA 3E22B 4MI3A 4DA8A 3D9QX 4LOLA 4L15A 4B80A 4XARA 1E5SA 4FZ3A 4G8DA 1BQ4A 4PZLA 3DGEC 4A91A 1VPTA 4K26A 1K6MA 1UZMA 2JB9A 5DHTA 1JUDA 4QKQA 2WV9A 4E32A 1JBKA 1Y4ZA 1ZZGA 1UOQA 1SHWB 5D85A 2ZJOA 4R68A 5FO1A 1YB1A 1ZNPA 4UC0A 3VPSA 4BUJA 3SKYA 4DCSA 1WA5A 1K4YA 2APJA 4W5OA 3PBKA 4WCDA 3B12A 4RHEA 4JRAA 5K6RA 1ONOA 5ANNA 1SG6A 3HLTA 2FNAA 2LGJA 4PONA 1UDBA 5C5TA 1WP4A 2ORWA 1TD1A 3U1VA 2LP4Y 3V1MA 3ABOB 2X2PA 2IZWA 1GPAA 3MTGA 4EN9B 1SBIA 4Y1YA 1RBYA 3HKEB 2ODPA 4LT5A 1AE1A 4XW2A 2FPIA 2A5JA 3PLRA 2A0FA 1M7HA 2ZTUA 4PNZA 3WV5A 4L5JA 5K0GA 2VYVA 3S2GA 5FUWA 4X9XA 3WA7A 1JYEA 2IE0A 1QFJA 4P4SA 4F4IA 2JATA 3S40A 2X86A 2KI5A 1TNDA 4N3NA 5EQDA 2OQVA 2BVVA 4KBGA 1V0AA 1XCLA 3A8TA 4OG2A 3NASA 1CF2O 2YWHA 1JZ4A 3TH5A 4CT0A 3TLMA 1N0WA 5L40A 5BPXA 3D0SA 3UOAB 5LLTA 4C4XA 2VNVA 3HVJA 1S0UA 3HR4A 4GG1A 1JNYA 2VXCA 3IMEA 1J2UA 5EMNA 1REQA 2AK3A 3PL1A 4PXYA 4FB4A 3PWZA 2PZAA 4MQ4A 3SCGA 3VMFA 4MRRA 2NYYA 2JCYA 2ATIA 3B8HA 2IDJA 1YTLA 5FY8A 2WNVB 1ULHA 2WWFA 4RWZA 3DLIA 1Z4OA 1GNRA 1NW7A 1XZJA 4GD3Q 4S2GA 7ADHA 4MB0A 2KD7A 1ORDA 3P2EA 1KP2A 4JSYA 3T38A 1B4DA 2FZVA 5K05A 1PGL2 1EFDN 3ES1A 1WUKS 5ARCA 3SHWA 2BM8A 1GNSA 3LCUA 3H1AA 3VYUB 1X7WA 3GJXC 5I8PA 1NUQA 3S44A 4I8XA 1VMEA 1DE0A 2GYWA 4KX3A 3AXEA 1U1FA 2R6ZA 3VZQA 1W6NB 3UUFA 5DABA 4ZCTA 3VAAA 2OQ7A 3M3QA 1BE6A 1P2TA 1RZVA 4HAOA 1AV7A 5JC1A 1K3UB 3LKDA 3OZBA 2W6IA 5ALPA 4M0LA 1KMCA 3SYLA 1JHUA 1RMU2 3B7MA 1IHYA 3DOHA 2N7GA 4RACA 4CM8A 1DHRA 3DOFA 3CEHA 3K2BA 2FV8A 1SC9A 5FNVB 4PPNA 4D5GA 4J0DA 4ND8A 4ZVKA 1KYXA 5LIPA 1MQAA 4C5CA 4ES6A 5CD9A 4L2IB 3THOA 5JSQA 4ENWA 4DNYA 4WXMA 2RH8A 5F7ZA 4R7GA 1YUNA 3RVQA 3F8SA 4YAOA 1J58A 4LKDA 4OHOA 1CRQA 5C37A 4LAFA 1V6NA 5HJ5A 3K6SB 1T9GS 1V3QE 3QY9A 1G17A 2XMLA 5HZGA 1T0PA 4H6XA 4ES8A 2DCZA 4JGZB 5ADUS 3AONB 2AC2A 4BYMA 1W05A 2A6WA 1S2IA 4R2WA 4EX6A 2WMOB 3MPOA 4DLVA 3Q98A 1ENOA 3ZU3A 4DGQA 2YNMA 1N5KA 4EUHA 3OBIA 1ZUNB 2F67A 4H55A 1K7SN 1CRZA 2DGDA 3FDJA 2K46A 1FUKA 3MQ4A 1WDMA 1DUSA 1JDSA 1QOZA 5KYGA 3OLVA 4E1AA 1M6HA 4GKXA 3VR3D 4EITA 2ZT5A 5IDXA 4QFBA 1EWTA 4K7JA 4A7ZA 4PLOA 2C8LA 2Q1MA 2PVSA 1H6AA 4AIRA 1H22A 1WXHA 3DMGA 3AZVA 5BV1A 2DBRA 1KVSA 3O1JC 4HSGA 4HGZA 3OBZA 5DMXA 5EWJB 2JCXA 3EXIB 4U9HS 1OBVA 4MROA 2HIMA 3T7IA 1RUC2 1AXZA 3DOEA 3TEMA 2WSLA 1X8EA 4IGPA 4FHFA 3O4FA 4LO5B 1Q3TA 4H0FA 3QKIA 3GZTB 2I4LA 2B8EA 3RUCA 4BFTA 2IYNA 1Y7BA 2P5YA 1IL0A 2VA8A 3OQIA 1IN6A 4IX9A 1EXNA 5KYXB 2VOXA 1FCJA 4EN6B 4D99A 4B7KA 4OLHA 4EX7A 2H2DA 4ZDWA 4PX9A 4EY7A 1KWGA 4BGVA 5CISA 4FZJA 1BGVA 1SIUA 3JVEA 1ZUWA 2DQSA 3PJYA 3DFKA 3TE7A 2X0FA 2AWNA 5BN3A 4PRZA 3UK2A 2QQEA 4OQ4A 1MX9A 4YJKA 5FL7D 4XF1A 1U0LA 1J3RA 4QEZA 3FPJA 2WLPA 2PHLA 4M3NA 2EQ5A 1U8TA 2IZ0A 2OC9A 4X5OA 3C7CB 1ODNA 2UVPA 2H7VA 1NQVA 4YJHA 3I8OA 2ZIWB 2OUHA 1RTKA 5JYBA 4J0IA 5EMJA 2BD0A 4Q3BA 3B3GA 5EWMB 1JLHA 3KKNA 3RU9A 1H1AA 5A6XA 4JLOA 3AFIA 4M9RA 2XKPA 1T26A 1U8ZA 3ZNPA 2IGTA 2VNSA 5ECYA 5EEHA 5HF9A 2D3SA 4Y6SA 4BQRA 3BM5A 3B6JA 1CDOA 5DXFA 4FOQA 3RRNA 2F43A 3SI7A 5FYMA 1WW2A 1E2UA 5K51A 5HF6A 2N1BA 3PL5A 1S6YA 4B45A 1UOGA 4DV0B 4BX3A 5FPBA 4N03A 2ZRKA 1U0AA 3ZI7A 3RHSA 2F4PA 1JIIA 5EEGA 3FPGA 4NHXA 4F85A 1T6BX 3B38A 4N9WA 5D2CA 3R3VA 4I30A 1QAMA 3RVPA 3A27A 2VP5A 3NG1A 1T25A 4EEKA 3ZXGA 2AB0A 1NAIA 3CJQA 8GPBA 4RS5B 4IKPA 3WZ1A 4FT8A 5FY0A 2G3YA 1NJSA 1S0BA 2C5FA 1UK7A 1MLDA 4F71A 4PLVA 1V7QA 1QXJA 3DYOA 3K09A 1P60A 1AXGA 1P9WA 2AEJA 5K8IA 2VP6A 2J9XB 3EC2A 4Y1RA 3VNVA 3RDIA 2QAIA 1X14A 3RRBA 4K3VA 2YZGA 3ZV5A 2DF7A 4KAAA 4XSHA 3O82A 1HV1A 3W0LB 3OJWA 1J2TA 4IV8A 1VL1A 4U7FA 1Z35A 4B1MA 4U9UA 4M1YA 3IIAA 1SC6A 1T9GR 3IEIA 3F3YA 1TT5B 3ROPA 1Y3IA 4B3JA 5TB5A 4NE2A 4B0PA 2FY8A 1HLCA 5FYHA 3M4XA 3A4UA 4MQ5A 4XR9A 4ZZ5A 1OXVA 5TT1A 1S0GA 5DHRA 1CPMA 4NESA 2EXKA 4P5HA 1HRKA 5AHRA 5LZ2A 2VDKB 1P1HA 4FT4A 3AFKA 5T3UA 4HBGA 1QMPA 1M0EA 2KYRA 2C3PA 4YO7A 2YXNA 2BY4A 4LBYA 4L76A 4OGLA 1T2DA 1JQJC 3RQIA 2RJNA 4P83A 3IIKA 1GG9A 1I0ZA 1KK2A 3ZLUA 1LHNA 2VW0A 1UMZA 1X3LA 4DF3A 1Q5PA 4G89A 3KOZA 4JGGA 2A78A 4LNHA 4DC1A 5FY4A 4TKVB 1KI1A 1YQCA 1YULA 3O84A 1ID8A 4K9SA 2B7YA 1G21E 5KYUA 2ZJ8A 4EYOA 4OJNA 2PHTA 2JFHA 2HF7A 4EB6A 1N4DA 2VBDA 2PXHA 1QHHA 5CXQA 1SK9A 4NMMA 2OAP1 4IL7A 3ZR5A 3S5QA 3OZSA 4R1MA 4LXTA 1GKYA 5E1BA 2KSQA 1MACA 1XCBA 3U3RA 1NC3A 3UT5A 4R1LA 4KYVA 5CK5A 4L57A 3BFJA 4QJ5A 3VPBA 1UZLA 1YI8A 2DETA 1EFPA 1YRZA 4MUXA 3N9LA 3RYTC 1AT1A 4XEUA 2XR1A 1IS5A 3EZ2A 4R9BA 3WNOA 5E4FA 1KSHA 1PGQA 5FFNA 1LOFC 4BAUA 4HLTA 2VBBA 2EQBA 4QASA 5LM3A 2JD1A 2J1LA 4M76B 2ZGRA 2FQYA 4JK3A 4YDRA 2F3UA 2IQIA 1LRLA 4WAUA 5C18A 1QYXA 5LBIA 1COWA 3JD4A 4RCVA 1QJZA 4ZK2A 1NY71 3LYAA 1VJ0A 4P84A 4KOEC 4FPHA 3GJ7A 3OCWA 2E1RA 3HEAA 1GFF2 4MIYA 3R20A 4WOCA 4LZLA 1W4RA 3HR9A 3OD0A 4GYKA 1DEOA 4Z7NB 1OX6A 3QBEA 4QXKA 1F8FA 1XEXA 3GEDA 4UBKA 4M7RA 5TNXA 3CJRA 5LEJA 4NCBA 2W4IA 3WR0A 2XDYA 2Q9UA 1RXCA 3B53X 2DVAA 1WSBA 3BKXA 3DM9B 1XK6A 4KV7A 4Y2SA 5FP9A 2W2PA 4QVIA 1EG2A 4NHOA 1IQRA 4PC1A 2JLUA 1FE8A 2OZEA 2OSVA 1FU8A 5IATA 5KXEA 1E58A 4Y6PA 2CXNA 4DILA 2I65A 3H7YA 3KCNA 1HTTA 3GHHA 4IV5A 2GEVA 2JAHA 3ZYFA 4HS4A 1JFLA 4AHYA 4E15A 2QHXA 4IEOA 1JG6A 1RMTA 1YWGO 5F21A 1P1RA 3A7EA 1ZONA 5IYZB 2FSVC 4DBVO 5JE8A 1AN9A 4NVPA 1EPWA 3J8F3 3VR1A 4BOYA 1N3BA 4QFCA 4PLHA 1J1IA 4MYSA 1ULGA 1GPYA 3WY9A 4E03A 2G9RA 5L3SA 4BAGA 3VV3A 2EJVA 4AKGA 4R9DA 1UKVY 1P2BA 2ZPAA 3LF7A 1Y4UA 3RS7A 2E4AA 1XRSB 2QZ2A 3AY6A 1RUC1 1BXHA 1M0SA 3AM1A 1T1EA 1C5HA 2PHDA 3HO8A 2NMNA 4RV4A 5AW0A 4KKVA 4QKNA 4OHCA 1K42A 1A9PA 1RKUA 1XDBA 3L41A 1AZLA 4NAMA 4IDEA 3O1SA 2B7BA 3PFWO 4YCJA 1C7JA 4BLIA 3SF8B 1L7AA 5IZCC 4RFLA 3DYMA 4DIUA 5G0TA 3FWEA 1G1MA 1AOXA 2WHQA 4G9EA 3DVSX 5JPNB 2PWZA 3GYGA 4XSGA 4PZ9A 1JDBC 3OFJA 2O4UX 5AICA 5BWCA 1UBHS 1E2GA 4RYLA 3DEFA 3OEYA 2QMQA 3L77A 4IDDA 4MV5A 4OP3A 4JBYA 3NXSA 3CHXA 2CKDA 2QUZA 1VPEA 3P71T 2BGTA 2DFTA 5DTQA 2BEWA 3CYFA 4EI2A 1KHTA 3A6LA 3E1GA 1WLCA 3EXHB 1OHHD 5DNWA 1X19A 2WWTA 1ZREA 2DMRA 4UM9B 2YZMA 2QRHA 2Q5OA 4HL6A 5D5PA 2ZM6B 3X1KA 3DXUA 4OHVA 3RFUA 4DCVA 5JLAA 3NBKA 1FDSA 1FDIA 5K0ZA 1C1XB 3FGPA 2F9MA 2QRVA 3A4LA 3C7AA 4FINA 1B00A 2GOYA 5ALGA 3LY8A 1P3DA 3LQ1A 1Z3CA 1UDCA 3ED5A 5IAGA 2TBVA 4Z1VA 3HMQA 4A3SA 2W6JA 3H97A 4RSGA 3KTDA 1FIUA 1RUC3 1W0CA 2N75A 2WM2A 3IP6A 2Z1MA 1YKGA 1G20A 4BMZA 3KF3A 4EGAA 2PQ0A 1X15A 4CFSA 3SJCA 2EFGA 2NVUA 3RUFA 3I3QA 4TMFA 4DY6A 5FRDA 4KNCA 4E31A 3PUHA 3L3BA 2RGNA 2R0FA 4WZCA 4JJ4A 1U6JA 5I7FA 1LU9A 2JD4A 2F17A 3KJGA 5D3QA 2G77B 1DWPA 5AHKA 3SX2A 3FMFA 1PKEA 3ETLA 3ME2A 3CMMA 5DM0A 3RLIA 4FKZA 1O6FA 5K01A 3I9LA 3FPBA 3LT4A 2F3RA 1KA9H 3TQRA 3S2EA 1BSVA 1SUPA 5BYAA 1GFWA 1HYBA 2IXBA 1E1YA 4QUJA 1D2GA 2WVJA 3CXUA 2FPOA 1M8GA 2B6NA 5D6OA 2JFGA 2PUJA 4Z5XA 1G5FA 2ZTVA 2VOKA 1TVKB 1RPJA 1UZYA 3N8GA 2YXBA 1PGW2 3GF4A 1JF8A 5GMOA 3ZN6B 3DDCA 1U1GA 5D3ZA 2QV7A 3IAEA 2PZMA 2QE3A 1B16A 2QE7D 4NDNE 4RHYA 9LDBA 4RTSA 2VJCA 2ZMNA 4GOND 4XAEA 4J9VA 5K03A 2BPOA 2XJ4A 4GJYA 2P77A 4HPKB 2YIJA 3T3IA 1O95C 3OLWA 3MJVA 3LHFA 1T2AA 2BRUC 4FYXA 4WNYA 4OFGA 4RVDA 2IF2A 1G19A 1W4AA 5EXDA 2H54A 3L8HA 4GS5A 2YMMA 4KPYA 1ISIA 4MWDA 5K09A 1XTBA 3G5TA 5J1SB 4CJXA 4QM9A 4I4TF 2RCNA 3L4BA 4QPGB 1KDZA 2OZKA 2C99A 3I92A 4WLFA 5B3JC 4X97A 3E7WA 4MS1A 4OGGA 3QVMA 3SBEA 3AM2A 3GB9A 2PRYA 4AJJA 4CDXA 1Z0IA 2OHGA 4GVLA 3GP5A 4B2YA 3PUIA 4IHKA 2B45X 2AYYA 3KKOA 3I83A 1YCFA 3AEYA 3RZJA 4B6FA 3UJAA 3G6KA 1WX1A 4HQRA 3DMDA 1S7CA 3NHKA 4RTOA 4TSRA 1CGPA 3FYUB 5EJ5A 2WFPA 3BS4A 5BY5A 1T0JB 4F3CA 4ALKA 2RAFA 5J2UF 3GU3A 1ZGBA 3WLRA 2XB9A 3O8QA 4D97A 3S2ZA 2SCUB 3VBCA 2D4AA 1T1JA 5BSUA 3N2NA 3GZNB 3D1JA 3R24A 4KBBA 5CVJA 1E79A 1J7KA 4XIOA 4DV6B 3REFA 1NUUA 3FCYA 1QOQB 1OTYA 3PJGA 2A9FA 4KG7A 3K51A 4PYKA 2HL6A 5H59A 5E2IA 3LPNA 2C5SA 4AQYB 1MCZA 3I1YA 1M1UA 3OAAD 3QVTA 2X58A 4RIHA 2LV8A 1DWUA 1L1QA 3I61A 2ZS6B 1IH8A 3JATB 3QW2A 2QJTA 2C2BA 4BWVA 2Y0BA 2JGNA 3TLBA 3DHWC 3O1HB 3RIXA 3V7UA 2KE5A 2ZIZA 1RJ9B 1A50B 4HEJA 2GJ4A 1GQFA 2O8OA 4DLLA 1N32B 2O8DB 1QCDA 1XP8A 1PS8A 3OJLA 4P7FA 3BJIC 3PEVA 3GFFA 4LYYA 3WWOA 1VE7A 1P0IA 2WL1A 4I1OA 4ASUA 3KJFA 5I4CA 4IV3A 2BTQB 2IE8A 4CW7A 2VNOA 1FU4A 3T41A 1QFMA 1TO1E 2O3UA 1FTYA 1X7GA 2FN8A 4FGLA 1VSUA 2HK7A 5AJXA 2CTVA 3LNCA 4KBYA 1V37A 2QZ3A 3C74A 2PQMA 3QI2A 2P2ZA 3ZMNA 3UMRA 5HEKA 3TMAA 5F1KA 1OZGA 2IWHA 4XF9A 2WKQA 2QZ9A 2WU8A 1F3OA 1KI2A 1C8VB 2VTXJ 3KCQA 5CA1B 4EOGA 1AUOA 5K0SA 2GBGA 3J9SA 1G8MA 2VZPA 1LBSA 3U44A 2Q5IA 3JRNA 3WRVA 1KYWA 3D81A 1L7NA 3QENA 1OWNA 1NCRA 2ECKA 4F4FA 3J7NA 4YRTA 1FV3A 4L6AA 1LW6E 2PKQO 3O1UA 4JUAA 3TZKA 3DEIA 3C7TA 1DCKA 2WI8A 5K99A 2HNAA 4UOQA 2G19A 1QKQA 3USCS 3F6EX 4IYRA 4RU1A 2AUMA 3N0VA 1NONA 2AFIA 5A33A 4YT5A 3G8AA 4TT3D 4BP8A 2ZACA 4QG7A 3TFQA 4BNGA 1W6OA 3MYRA 3LZ6A 2HBQA 4JT8A 3VJMA 4QT0A 3BEDA 1SD1A 1CY6A 4RQBA 3CLTD 5KTYA 4K20A 5ELMA 4A2UA 5I7UA 2UYOA 1RBZA 2YRWA 3MV01 4AEMA 2A0UA 4IQFA 2ZULA 4BN0A 2OLJA 3OGRA 3R4VA 3CMGA 3O95A 4EJRA 3RWMB 2ZS9A 2I74A 4F83A 1XXLA 3GFOA 3RK1A 1ZM7A 3WKBA 4C01A 4BTEA 2YJNA 2HJ9A 1NSFA 2RI6A 3IAQA 3DPRB 4QDUA 4PC6A 5E3JA 2VTKA 2E2WA 4F92B 1DELA 4WZBB 2CXHA 3P19A 1FS4A 4FCVA 1N9GA 1JZ7A 2BTOA 4IGIA 4URHA 5C1OA 3B5LB 3PGA1 4FFRA 3TR5A 3KJIA 4MUGA 4BMBA 5IJRA 1XI2A 4XQ0A 5ECDA 1I4EB 4KR0A 1H6BA 2W52A 4AZSA 5BRAA 4D82A 3PPXA 2JWPA 3ZFFA 2WSSD 2FOIA 3BFPA 3J26N 3TLKA 1E98A 4EWEA 1DVRA 5C3OA 4P8RA 1HFJA 5CGZA 2P9EA 2P3JA 4JQTA 3MIGA 4ZYZA 1TVMA 4M36A 4GXRA 2VPQA 4IGKA 4PIYA 2XMBA 5EV7A 1GQHA 2W2XA 4B4PA 4GLJA 5KWEA 2P3SA 3WYGA 3G2NA 5JR7B 1E3LA 2CMDA 4B8ZA 3N8HA 4AFBA 1IHOA 5EIYB 2YJ4A 4L0PA 3P9ZA 2VCMA 4CU6A 3AEXA 2GC2A 4NRPA 2ZEXA 2RGYA 3KP1A 1POV0 1H5QA 1Z34A 4KQ7A 3AVYA 5DUXA 1HNWB 4Y26A 3R7AA 1AB5A 1EE2A 4IO0A 2GPWA 1F48A 4CDMA 1Q8OA 2HF8A 3RSCA 4H77A 5FYYA 4AQ6A 4TUYF 2QJRA 5LOVF 1NZCA 1TM1E 3AERB 3L7MA 1W76A 4I1IA 4MRPA 1ZGJA 3JZAA 3WWDA 4PI2A 3WUCA 4TQ9A 2C9OA 2J59A 2YZKA 4OHUA 1WL8A 1SBYA 2PX0A 2XODA 1EUDB 3HS3A 3G02A 2P9JA 2FZ1A 1SXPA 4PM4A 3I6BA 3JS5A 3KV1A 5CADA 2AN9A 3TRSB 4GULA 4D9KA 5FQOA 3BFKA 5BSVA 4JN6B 3V0BB 2NQ8A 2Q4RA 2DWUA 4X93A 4PPGA 3GYDA 2GAOA 4DUVA 3DZ8A 2OZ6A 3EXUA 1NU6A 3GZAA 4RL7A 4Q1DA 2B35A 1AGXA 4RFSB 1PFQA 4QD3A 1AGRA 4IZIA 3E2MA 5K45A 2BGKA 1YA8A 5BNWA 5C81A 1SH7A 3NHFA 4YLGA 4G0UA 2X8WA 4KH9A 2ID7A 4XIYA 3ETGA 2D5HA 5FZEA 1TOAA 4JVAA 4H4CA 2BONA 3EHDA 4JB3A 3QH7A 2Y0OA 1CUDA 3RLFA 4XQ9A 2B82A 2IUEA 2Q07A 4G5QA 3U3XA 3SKXA 1OXXK 1EVQA 2I4TA 5EQUA 3MZ0A 5C1IA 4HN9A 3VBHB 4PC3A 1X1CA 4WUVA 3THRA 3ER9A 5K2MA 4OXNA 4KDFA 4BJ1A 2D5BA 5T6BA 2HU8A 4D9MA 3BWVA 4FPJA 5LQDA 1UKBA 3U7QB 1FF9A 5HILA 4IUYA 4AJKA 2I62A 4LISA 4JT9A 4MQUA 5HP4A 9ABPA 1RJ8A 1ZBA3 1DT5A 5MDHA 2V7PA 3FI0A 3RODA 4HQ0A 2QQVA 1KDTA 3Q5DA 1Y8AA 2G76A 1R082 3UY4A 1QMJA 3RVSA 4UTXA 2UUBB 1UMBA 4JP5A 2D2IA 1QSGA 4QDXA 5LJIA 1QONA 3INYA 2JIPA 1A78A 4JI0B 5AKYA 3BB1A 1C1LA 4LLFA 3N28A 5LU9A 3PVZA 4MUYA 2EKPA 4JXZA 5KYVA 3BL6A 2PBLA 1W46A 2OV2A 1HE4A 1J8MF 3SOZA 1BE8A 5L9RA 1PLKA 3LWZA 3MW3A 4CZSA 2J3DA 1QRTA 2JXAA 4IICA 3LP5A 4UM5A 3VR5A 4AYXA 5KMGA 3ESBA 3L8GA 5E7JA 3DTVA 4B1FA 5BSEA 3RMYA 3INTA 3LKJA 1U7TA 3AKPA 2HSDA 3SNKA 4CVUA 2ZJ3A 4E2SA 4JWTA 3PTZA 1WA4A 1F9EA 3A9VA 4DM7A 4CU9A 1X94A 4UU0A 2AOVA 1TM2A 1JG7A 2Q6TA 1EVYA 1QIIA 1SHTX 5JYCA 5KWVA 4KFTA 2YV4A 3WQQA 1BMV2 1ZHFA 2Y1CA 2GD2A 3RTAA 4RAQA 2PO7A 1UMDB 4DXAA 4W8OA 3SICE 3GLFA 3S4YA 4V2VA 4Z6KA 4M1ZA 5FBVB 1JG2A 3O74A 5GGXA 1Z0ZA 5HMLA 1KMHB 4DINB 4ZEMA 3Q9OA 3K1TA 1YS4A 3EUFA 3I9JA 3HUEA 2ZX0A 2CAUA 2VHUA 2QY6A 1LK0A 3IPYA 2JGFA 3IBMA 2J41A 3USUA 3ZBQA 2P6PA 3RM3A 4EB8A 3AT1A 3TEFA 4LXYA 2J31A 4GICA 5KTPA 3WC4A 1YJKA 4EHNA 4FHEA 4ZJPA 3UK0A 5CFZA 4H7IA 3FTFA 2AUYA 3FPEA 1NMSA 1YB4A 3K16A 3H3XA 3H2BA 4C7VA 5IBRA 1JBEA 2QTNA 3PVSA 1F2UA 3SYRA 3B7GA 4YT2A 4NPLA 4EYKA 1GN9A 2ESRA 3IFSA 2J22A 1PJ4A 1W5BA 1NUKA 1W28A 1DZIA 1KDMA 1GZWB 2Z5LA 2B8WA 4XFHA 2BWAA 2ILMA 3ROMA 1WBDA 3GLQA 4M8SA 4IJUA 1H8ED 2PXCA 4OHMA 2HPVA 5DNEA 2PL1A 3EA0A 4A45A 3VBSC 1B14A 1J97A 4TLEA 5AVKA 2RHMA 4BX0A 1H5UA 1SQ6A 3MN1A 1SKMA 3AXDA 3OJCA 3AW9A 3Q3JB 4PTYA 2VUHB 3NPMA 2HWB2 4MGYR 2OAQ1 1GLNA 3TAYA 1P9NA 2EIGA 1WVGA 2QN1A 4Z54A 3VR4H 1JFVA 2VYQA 3R3YA 4PLYA 5IYYA 4EG0A 2R062 1VL2A 3W04A 1OLQA 1QZZA 2EWVA 1M2VB 3SS7X 1SJ9A 3R6WA 4KITB 2JFYA 3M4FA 4WN9B 4KEAA 3PIRA 3GLHE 1SKAA 2H3EA 2OORC 4QXBA 4HN1A 4F3KA 3U49A 3LUJA 4YJ3A 4BZWA 1PV2A 3FUQA 5LK5A 4UEQA 3TRDA 4FYVA 3T5BA 5BR8B 1QKJA 2I4RA 3D4BA 1N33B 1KO4A 3GH1A 2DFLA 4IVRA 4AMUA 4Q01A 5EZYF 1LQTA 4PANA 4GOXA 1DSSG 1QKKA 3F73A 3NEAA 3QQ5A 2AD1A 2PPLA 1KL7A 4N3AA 2CNDA 2J7PA 4L3VA 1R8YA 1SA0B 5FUPA 4KIFA 5D8DA 5EGNA 5CHYA 5C8DA 1U98A 3UH1A 3ZQUA 3TNDA 1KOFA 4P4LA 3ZDXB 4C4OA 3H13A 4FGKA 3ZCXA 5EOVA 4BNLA 2B4YA 3EMRA 5DCLA 4EIWA 4TN1A 1KFJB 3BSWA 3L6RA 4Y1FA 4IGFA 4X20A 3ZYGA 2L69A 1T9DA 2FN7A 4P0TA 1A5AB 4IKOA 3NAMA 4EPTA 1G5QA 3RVRA 1ULCA 3VBOC 1MZPA 3UJ8A 3F0TA 1S3FA 3V1LA 3VUEA 5THKA 2VT2A 4YZ2A 3HK2A 4I08A 1NQTA 2H4FA 1FXZA 2WQ7A 2P2SA 3C14C 2FPGB 2IZ7A 3N39C 1C0PA 4M3CF 5TY0A 2JB4A 3R40A 2KBFA 1I2BA 4LQCA 1DRKA 3PXDA 2VECA 5EC8A 2IHKA 4CR8A 1PFUA 5A7QA 1NYTA 2NYUA 3S70A 1QPGA 2IS4A 3NNJA 1VJ2A 2HRBA 2V7QD 1KRIA 3JAKB 5GINE 1ZVJA 4JQSA 1YRAA 2WDPA 3VL9A 3G2IA 2WJ3A 3C8UA 1G8AA 3O83A 1HM5A 1X9IA 3SMHA 3MSCA 2QGFA 1CUVA 4CDWB 4RR3A 1W85B 4KC0A 1RAHA 3SS8A 4UREA 5KNBA 3N59A 3TIFA 1N5OX 6AT1A 4MI6A 3BFXA 1EUCA 4FE3A 3WMRA 1QTNA 4RK4A 3NSTA 1IOZA 1O94A 3LA2A 1YAHA 1FDWA 2QMHA 3EIWA 3LOIA 4PAMA 1WB9A 5EXOA 4R3WA 2I3AA 2P4QA 2ZEJA 4O08A 1AGYA 1E5HA 2VS1A 4E4RA 2IYTA 3DZBA 2V0CA 1UFKA 4WA8A 1T3LA 4R1PA 2JCBA 4C29A 5I9NA 4FDMA 4ND2A 3MUFA 4DO0A 4MGZE 2JHFA 2ZXQA 1XHLA 3DUFB 4FI3C 3G7DA 4HTAA 2BCJQ 1J1ZA 1K5HA 3HQRA 4E4ZA 1IPSA 2HT1A 4NV0A 3GJ8A 2WBLC 2ZANA 4IX1A 1Y89A 1Z07A 2VVFA 3L7JA 3WWYA 4Q0PA 3RKUA 2JL1A 2PHWA 5CM8B 5AVPA 1DDIA 2A8YA 3ZQJA 1WWKA 2NUPA 3GEIA 1T2EA 3VX3A 3I3OA 5K1ZA 3TIXB 1K6XA 3A9WA 5DAXA 2W00A 3EC7A 1XA3A 3O9ZA 4ZVRA 2JLQA 4HAYA 3WGGA 2V6BA 5LP6C 4JP2A 4QGNA 2YMZA 3DWIA 3HAGA 4OQQA 1ZBE2 4CQMD 3O5AA 4JJKA 1OVPA 1ACMA 2IEYA 4KYUA 1SLTA 3I2OA 4D8MA 4CTJA 1WBBA 3AJZA 4OP1A 3WL6A 4EBFA 1PGNA 3O7MA 5KVSA 2X5IA 5J98B 1KMMA 1J1LA 3ZYPA 3DFIA 4CQLA 5EG5A 1E9AA 3MBIA 2A4KA 5IFTA 2UZAA 4PSKA 4JA0A 3U14A 2QAGB 4FGWA 3W5VA 1PZGA 4IJVA 4OXIA 3VDXA 3I04A 3A1SA 3CBGA 5IFKA 1A9XA 3D8SA 5FADA 2VXRA 2VDNB 4JLPA 2QUOA 5HQTA 3W8EA 3PVBB 3BKZA 4DYHA 2HWE2 5IJ0A 5LVAA 1UEXC 3TGPA 2J8ZA 4WXRA 1IZ8A 4AO6A 5LDDC 1HDKA 1Y1LA 1YZKA 2C54A 3FAZA 1BMV1 3SCHA 2GCEA 5F1RA 1HDEA 3UJ9A 3U1XA 2IIPA 3ATGA 2IYVA 1MOQA 5CHEA 1Y3CE 1QGED 2J07A 2BLLA 1JEEA 1VJGA 2HAEA 1HTWA 2PSSA 4YALA 2GSYA 1OY1A 1ZMTA 1JHZA 3U31A 2NZUG 4HDKA 1ABFA 3I05A 2GARA 1H1MA 3OZIA 4J0HA 3I09A 1KEPA 2IODA 1B26A 1FP2A 4TQAA 2GM4A 4HXCA 3VC1A 4YAUA 1SURA 2P9QA 3VH4A 1WO8A 4BKQA 2I80A 1LVHA 4O61A 4ZT2A 5HYVA 1PE0A 3STYA 4BRWA 4C07A 1OI2A 3GVPA 4Q1FA 1K7XB 2YFKA 3H1TA 1FDRA 1WQ1R 3ZDVA 1H5NA 3JQBC 4RGVA 4LKRA 4DJDC 1MTZA 2X3FA 3LSYA 2FZCA 1ENZA 3AVUA 4RULA 5HKKA 1O5OA 4JLJA 1ABBA 3TZEA 4XQEA 1WPRA 2JKXA 2WF8A 2WU4A 4C7KA 3G0HA 4B3SB 2PWYA 2YWGA 3ONEA 5F5QA 4QD2A 1TYBE 2NZXA 1BD3A 4RQPC 4EGQA 4LVOA 4JZKA 1JFFA 4TTVA 3DB1A 2I6UA 3H19A 1WPXA 4B6EA 2D3WA 1KK3A 1IK6A 1DAHA 3DV0B 3A0NA 3OT1A 1CERA 3HU1A 2QVYX 4G3XA 1GBGA 2HWB1 2QR5A 1NIPA 5HW0A 2A6PA 3RIHA 1F8XA 3COWA 3RJTA 5KHIA 3C3DA 3MNFA 1RXWA 3JQ9C 4MZXA 1IZYA 4R2KA 2YX1A 2R061 3Q4GA 3OWOA 2V9CA 3T35A 5E2BA 5F3WB 4XWWA 3KQTA 4Z9AA 2WFLA 5FQNA 2Q4TA 2PXXA 1R9NA 4QTYA 2SLIA 1KZ9A 4G25A 1TU4A 1HZZA 2PNFA 1U2ZA 4W5WA 4R01A 4GPBA 5FMOL 2DUUA 2WO7A 3U3MA 1VJRA 3A37A 5JBIA 2QY9A 2KS6A 4BPBA 5K3BA 5DQ0A 3L6DA 3T7SA 3LBNA 3DF7A 2ZS8A 3I9FA 4RV5A 3OE7D 4ZT5A 1THGA 4ZO8A 3LDFA 5FZOA 3RYCA 1VE9A 1CKEA 2QTZA 2P9TA 3MMZA 3GG2A 2AXPA 5FKBA 4K86A 4JL5A 5IJWA 4M9XA 5FUYA 1PIV1 3WMEA 1TVEA 1GYPA 1B35C 2XTAA 1RCUA 3QTTA 4ZMSA 3ZPYA 2R5NA 5AR1A 2J3KA 1C9NA 2ZIUB 3HFGA 4MW0A 1ICEA 1EZ4A 3EXFA 3J8F2 5A70A 3THDA 3N9PA 2X5NA 3W58A 1GTZA 1AVBA 1P2SA 3QV1A 2VZTA 4HYEA 1PS0A 2QVGA 4U02A 3HI6A 4IV1A 5FZAA 3HCBA 1NZFA 4W8GA 2YHSA 1SCDA 5M5BA 4L4SA 3NC0C 1LS1A 3PNYA 1UEJA 3IIEA 4FE4A 1NY72 2Q30A 1RXSA 5CFDA 4OLLA 4AEDA 2JE7A 2HWB3 4CCLA 3MYYA 5LDGA 3R7WA 4H3SA 3A4VA 4RD0A 5FIUA 1X1BA 4YRCA 2WNSA 5E3IA 4RVHA 2R063 4DB2A 2I0FA 2JRLA 2YV5A 1AQ6A 1ONBA 3JPWA 1PYOA 4M86A 1W59A 4R8SA 4XFJA 2P2CA 4BQXA 4GB32 2ZPTX 3L9WA 4NOJA 1IU9A 2I71A 1HX7A 4PI0A 1J2RA 2RS52 4LBQD 5IEBA 3IDAA 4NMLA 3EIOA 1E57A 3LX5A 2Q6KA 3FGZA 1DCSA 2GTPA 3PVOA 2YY5A 1M8KA 3VPDA 5F9FA 5JWHA 1YAJA 3LNTA 4U3JB 3TB6A 1PIV3 5EYPB 1JBCA 3IILA 4RZUA 1LY1A 1KJIA 1M6NA 3LPFA 4WZFA 3I6YA 1XRUA 3VHPA 3IDQA 4ECAA 2FBEA 4ZOLF 2WLQA 1EA7A 2VPVA 4MQEA 4FFDA 2XI4A 3BH6A 3PMSA 1TKBA 1OFNA 2K2SA 3ADCA 1DQ2A 4YW6A 4X84A 1X7HA 1GU7A 5TF4A 1QC5B 2MEV2 2YWXA 3ZWDA 1MZEA 3M9WA 4MVJF 1YFUA 1HK7A 1L4MA 1LLCA 3HU2A 3WIOA 1JYSA 1H42A 3APBA 3INNA 3FETA 1N6LA 1VA4A 3C3PA 4E3ZA 3D7SA 1AKMA 2I76A 3FZEA 3DZCA 4P5EA 4UKDA 3T30A 3EZ9A 3TN7A 2DFNA 3JYLA 4YFZA 4Q3NA 2GJAA 1MXHA 1IUNA 3H18A 4BMNA 1RVV1 4RD4A 1CDZA 3RSQA 2IEDA 5CYOA 1P81A 1VIAA 3AVOA 2IHVA 4FVTA 1ND2A 1PJCA 1QLHA 5HX7A 3QFHA 3ZHSA 2WP8J 3A4IA 2H1LA 1LK5A 3IKLA 3GT7A 1P19A 5EUCA 5HM6A 2KX7A 4JB2A 4B32A 2ZSIA 1T3GA 4WOKA 3ZXXA 4BFCA 4ZIRB 4WM7A 4GKVA 5JQGB 1ZBE1 5DNAA 1FMTA 4AZ0B 3C3XA 1XGKA 3KT0A 2P3IA 3VR2D 1WPGA 1C1YA 2PAFA 4OLAA 4WDRA 2WYWA 4KUHA 5EIBC 5C4WB 1S2LA 5JD6A 1TCCA 1MVLA 5C33A 1DLLA 3VLBB 3GGJA 4REQA 3DTYA 5EIAA 4B4OA 4O4LA 3NBYC 1UBRS 4XIGS 4ZO9A 2H18A 3I8SA 3DHNA 3OZEA 3ZD6A 3UHFA 3E35A 3IVGA 2G28A 1FFDA 3WBFA 4YNIA 4I99A 2A9PA 1PW5A 4C6HA 1G21A 1QQTA 2COEA 1IN4A 1YJLA 3QJ5A 4Q15A 3QX8A 3TTUA 4HP8A 621PA 2HWE1 1VPDA 4HMQA 2DBVO 1KY4A 1WXWA 3RNOA 4IMPA 2A0KA 3K9WA 3CEMA 4YI5A 5TQVA 4P34A 4KFUA 2PS1A 3IQEA 3GT3A 3RF7A 1GKIA 1MOZA 3HB7A 4KK4A 1PEDA 1ILWA 3G2LA 2ZW9A 2UY9A 1C7ZA 1YRHA 1S7GA 5EIBD 1US8B 2ZU0C 4OUSA 3POFA 3BZWA 5EKXA 4A8JC 3ZGVA 3C7KA 3NCTA 1E5DA 1HXS2 4CEHA 4KWHA 3EIFA 4NR0A 4CE6A 1KJJA 1K3FA 4HX2A 1T4CB 5CTAA 4ZTBA 4PHZA 3VPXA 3WK5A 2PUVA 2VF8A 3FL7A 4FQ7A 3UM9A 3I0NA 3JTMA 2WJYA 5DCUA 4ISRA 3ZGZA 1YB2A 2Q2QA 1JA9A 5LZ4A 5C7LO 3BALA 5AVJA 4K8FA 3DZHA 1THZA 3JPYA 3LDAA 5JVDF 3AV0B 5AKGA 4AX8A 5DO9A 1CIYA 1GZUA 1XYGA 4F45A 4GZ9A 1ZBE3 4CNBA 5BVHA 4NS4A 2VTFA 4CKZA 3QF4B 3B52X 2GCNA 4LN1A 1ZLXA 3TYJA 4NCHA 4AO7A 5U4QA 2C84A 1JT9A 1YZYA 4FFGA 1BXRA 5TVGA 3NVCA 1TXGA 1SC4A 1UJ5A 4G1FA 3U9SA 1JH9A 3K75B 4WEQA 4URUR 5KBFA 3IWZA 1SBCA 3BWBA 3VD5A 5AOCA 3EPRA 5CA0F 1D8AA 4YVSA 2WS91 2X3UA 2IXGA 4U8GA 5DZEA 2W9XA 3FPFA 3A14A 2W47A 1UU4A 2A33A 2PSHA 1LI4A 4HEA1 2JS7A 4XUEA 2QLFA 3LQCA 3DWGA 3DMRA 4LJ9A 2V97A 1U0SY 3Q6IA 1OFIA 3WBKA 3M3EA 1SC3A 2HWE3 4ZK6A 3QEOA 4WHMA 3W5CA 5FWXA 4JQCA 5JH7B 3LPMA 4BCDA 2J1UA 4FPGA 1CZSA 1OWPA 3DYVA 1DTEA 3V8MA 4H3KB 2FCRA 5IVHA 5DSXA 1NSYA 1YI0A 2HUNA 2JARA 3OHMA 4QREA 1EA5A 3BQMB 3U19A 4RVSA 3OY8B 3VDCA 1LDMA 5IJ9B 5L3QB 1U0FA 4LZPA 3ZFEB 1A2OA 1VCOA 1GZ9A 3EJ6A 2WHEA 4FONA 2Z42A 3IMNA 2OKGA 3L0DA 1JHDA 3ESXA 3MWDA 1TJNA 3Q15C 3GQBB 4MV2A 4UAPA 1PYGA 4YRQA 2IXTA 2Q8QA 3K2OA 1A96A 1O58A 5BMVB 2GPAA 4ARBA 1U3GA 2ZJ1A 4C87A 3KQPA 1GR0A 1YIPA 2QPAA 3HJUA 4U00A 3PUKA 1TPYA 3R5TA 4G09A 4NFSA 1WKYA 3X2FA 4PDWB 3EGDA 3HNOA 3J8F1 1XJAA 1YH3A 3GIDA 2C9MA 1TMF2 3ZE1B 5LA6A 3AKRA 1AKEA 1G8JA 2JFNA 3VVCA 4CM4B 5CDFE 4PX2A 1PJ3A 2HLNA 3PVNA 3HXPA 5JCOA 4F91B 4HGYA 3VZJA 4BJHB 3B51X 3LEMA 3C5WP 4HLDA 3K53A 3RMXA 3PHIA 2MYNA 2WS93 2V09A 4X00A 1BYUA 1LWNA 4OBEA 3LDHA 3FB4A 3GLVA 4D0GA 5FZ1A 5GALA 4NBSA 1XCJA 2JKZA 5ALTA 2ZUVA 1IUKA 5CVDA 2W6MA 3UAVA 2ZWOA 3F71A 1KOGA 1W3VA 1IAVA 5BN4A 1XZAA 4QNRA 4XGQA 2FMKA 3D5QA 3CZ5A 4DUGD 3QBQA 5L4LA 2JDZA 1TCAA 3LUHA 5B36A 3CLVA 4JH0A 4CEIA 1E61A 2V7VA 4J43A 1KKMA 4CWAA 2Q9BA 5ALNA 3AF6A 1Y3AA 5DAVA 2B9EA 5AVVA 3WFIA 1UY1A 5FV4A 3E0XA 5LBEA 1KPHA 4OX9Y 3SLIA 1JEJA 2YPJA 2ZBJA 2OP0A 3CF6R 4R83A 3NV2A 4FCTA 5FOVA 3OU7A 4GB31 2PJDA 4EJ0A 1E3IA 5KTNA 2R86A 3BH0A 3ZYBA 3GCGA 4BZXA 4RQTA 5HCHA 1FYUA 4QQ8A 4IW3A 2Y71A 2QTGA 2RS51 5F76A 5ALXA 1P2DA 1OUXA 4CYDA 2C3UA 2VTDA 5HS4A 5FZLA 3WLOA 5EUQB 4QX7A 1W581 2EAUA 1ADCA 5ALEA 2B4RO 3IQIX 2WF9A 1KFUL 3JASA 3ZE0B 4EEXA 1K9SA 4CZ2A 2RJKA 2WM8A 2EP5A 1D2QA 2V74B 3BD6A 3OA2A 1MC8A 5F64A 5C53B 1S0JA 2ODBA 3BF7A 2W39A 3DEKA 2XVKA 1WSWA 3A10A 1JALA 2FOXA 3W90A 1Z26A 4KHZA 3H5NA 4YM0A 2MEV1 3KR0A 1CB0A 4H59A 5E4TA 2R8YA 3K94A 1VMKA 2RFLA 4B3RB 1NJGA 4QGHA 2XYVA 3INAA 3SHFA 2VXJA 3BH7A 3TW8B 3NJXA 3NYIA 1C7FA 1Q57A 5IU6A 2DJIA 4J03A 2J5XA 2OK7A 3PQ5A 5T64A 2WTBA 2X9GA 5LYJA 4TLCA 1VLQA 3MW2A 2IWRA 3AL6A 1G60A 2I54A 4FYJA 4WEOA 3LEGA 2NPFA 4MX3A 3Q8CA 1GJRA 4HGPA 4CG3A 1JLMA 2A5GA 1CUCA 5KHAA 3RJZA 2R7KA 3AKSA 4UNIA 3R3SA 2GBPA 1OE0A 3BQNB 5CFOA 3LPDA 3OCCA 4ERNA 2BGUA 3OY7A 5JCXA 2JZCA 5JDCA 4IDAA 3LY5A 3ZFGA 1N77A 1ZD5A 1J0XO 2HV9A 4YY3B 4GB33 3AB7A 4HWTA 4P98A 3PHHA 3BD9A 3W8RA 2FDRA 1GAQA 4P33A 4XVHA 4FFBB 1A27A 1JI6A 2RS53 5HM8A 1WLYA 2ZBDA 3DDHA 3WOGA 1NWHA 2UYBA 2CBZA 3AP3A 3R7FA 3H4TA 4MAFA 4UTRA 1MVOA 1OBHA 1UU5A 3DYBA 1Z33A 4JDMA 5B4UA 4KCGA 2MTBA 1RRMA 3AEKA 2ORED 3P9NA 2XUMA 5LBUA 1RI3A 4N48A 1G6KA 1EX6A 2I6XA 3KQHA 2PLV2 3TFWA 3O73A 1BJRE 3ENNA 1G9BA 2OLEA 3ALQA 2X6RA 2MEV3 1HT2E 5B4TA 3HU5A 3A0UA 1AJOA 1KEUA 4HSLA 4HNSA 3WA6A 2AL7A 4UU1A 5BWNA 2OVFA 2BFCA 1JWLA 1XNRB 2CVZA 2HM7A 3Q87B 2P90A 4N8DA 2JDPA 3COVA 5A1JA 4MPDA 3KVNA 3CX4A 1HXS1 3IPAA 1Z6GA 3LVFO 1OFSA 3C1TA 3NYQA 1SHLA 2FRXA 4LECA 4QWWA 1UXKA 4P9XA 2B4TO 1P1KA 3LRXA 1WXXA 1W44A 1E69A 4Y6OA 2KR2A 4PZYA 3COJA 3T1MA 3R0VA 1NN5A 2AUNA 4EK9A 3JWJA 4IHQA 3ZCQA 5LXTA 1ZBA2 3PYLA 2TSYB 2P6NA 2VM9A 3ZKWB 4LE0A 1NA1C 4MP6A 3V8EA 1TIBA 3GL9A 4IE4A 3AP9A 2FPPB 4Y98A 5CBPA 2ZRPA 4N5LA 3BREA 3IDFA 3AF1A 4CTNA 1X80B 2AW5A 3M6IA 2V7GA 5FTWA 1UM9A 3UMFA 4W9NA 3ZIAD 4HKOA 1DZ3A 4FMPA 5KQPA 1RACA 3AHGA 3AVSA 3ELYA 2BJWA 3TBHA 4NPMA 5A3JA 1YB5A 3PD7A 5KO2A 5LQNA 1RUE2 1UFOA 4E5UA 5FCDA 5FXZA 3NVMB 3AM4A 4OQLA 4QBIA 3D0RA 1WUIS 5CX1A 2A9OA 2PSJA 4LRQA 3SXUA 1VLLA 5AM4A 3UGQA 1YVDA 2D62A 4G01B 5I0TA 4ATFA 2VYVD 4G56A 3PDQA 1M2HA 1M7GA 2OENG 1SFRA 4QOSA 3RWKX 3BWDD 1B41A 3V1KA 4NVRA 2ZAGA 3VHOA 3MV11 4TQUS 3AP1A 4V2IA 3CLRD 3RUDA 4YRZA 3I4IA 3NHJA 3C8DA 2I2AA 4HR7A 3UAGA 1LPPA 3L5KA 4OFXA 3ZDFA 3NDBB 4D26A 1SUEA 1RPNA 1R0XA 1HXS3 4G0YA 3UGFA 2XBUA 4RKFA 1NBAA 1K1EA 4LZAA 3LUCA 1U8CB 4BYGA 3L4EA 3UMSA 2JIRA 5SYAA 1J8YF 3AJEA 2G7MC 1GQPA 2J5BA 3DB2A 1E0DA 5EJAA 3AOGA 4COVA 5D87A 1TU0A 1D9ZA 4N0DA 4ZGWA 3OIFA 5TQJA 4EF4A 1EVEA 3RRYA 4AF6A 4I1SA 4CL3A 2OCLA 5A6YA 4IWYA 3BMNA 2PA7A 5EWLA 1TMF1 3B9PA 1RINA 1M1ZA 3DP7A 1AV6A 2GPTA 1G1AA 4R6WA 2VEDA 3K3NA 1WTAA 3QNMA 4P3YA 5KX5B 3MLJA 3EWNA 3NBMA 3F47A 3T95A 1EFAA 2O3QA 3Q3EA 4NCXA 4KLRA 2JLRA 5IXYA 3RS6A 5KJEA 1T6XA 1V39A 4NDAA 2OMKA 1RRKA 1KI9A 2ODAA 1L9XA 1Z4MA 1M2KA 1XQ6A 1H93A 2W2MA 4IXNA 2JIDA 2AEYA 4MLOA 4Y2VA 4LX0A 4A0RA 4F7ZA 4EHIA 1B8OA 2HZBA 4N3BA 1YVPA 4W5NA 1UBEA 2HQSA 2QYOA 2ANCA 5BSTA 3AXTA 4ZO6A 3A7DA 4C1WA 1TEIA 2D2XA 3TBDA 5IPFA 2AENA 2OCAA 1NXSA 2PN1A 1T5TA 3NTLA 3P4UA 2VWPA 5NLLA 2YHBA 3BWXA 2JI9A 3VBFB 4DT1A 2Y1XA 4KODA 4YCBA 5HHTA 2C7GA 2EAAA 1CZTA 4G0OA 3R6TA 3RC2A 4RL6A 5JSZB 4DKJA 3QU2A 5AM0A 5D01A 1STMA 2D7JA 3A11A 1IZ7A 3PXUA 3TLAA 1F8VA 4YZ5A 3GW8A 1P1BA 3M83A 4E6EA 1TI7A 3AY0A 2VCCA 5B1DA 1X1SA 5AIAA 1GGHA 4B4VA 4G5HA 4G5YA 4LWOA 4NG4A 1EK2A 1GEEA 1G6NA 2PSDA 3EZ6A 2WAOA 3FOBA 1EYZA 3AYZB 1TW3A 1JR3D 4CMIA 4QU0A 2YNMD 1DBPA 2PGAA 3GEEA 3HB5X 4C2AA 3FCEA 4QECA 1FUIA 1X36A 3UH0A 3LEIA 4AY2A 2XTNA 2ZAOA 4ZHQA 1MA3A 2AMJA 4EKGA 5FYSA 5CYFA 4BY9E 2PU5A 3FFQA 2WTNA 1QF3A 4B7EA 2GYVA 3LRPA 2VKQA 4ESHA 5CCBA 4ZAYA 3CLTC 3V4ZA 1DL5A 1U2TA 1VHLA 1FOD2 4L92A 1TMF3 5GGYA 1GHTA 3MJDA 5IC6A 5IT5A 3M4JA 1AHSA 3H8OA 3EXG1 2P3KA 3P9CA 4YW7A 1FXWF 4K9KA 5F32A 3IAFA 1P45A 3RROA 2DUQA 1BKDR 2QM0A 2B5WA 3FG9A 1OMOA 5DZSA 4ND5A 1G8PA 3LQKA 4OATA 1S8OA 2HN9A 1HE3A 1YQXA 3JQXA 5AOVA 2D2FA 4J2OA 4RZHA 1CTQA 4CM3A 1O4ZA 1BH2A 4W82A 4YLEA 2VNHA 4I4IA 3G2OA 2V3WA 2I2WA 2QKYA 1UZVA 1QKIA 2B1JA 4ZI7B 4FIDA 4Y2PA 4WNIA 1Z4PX 4ETWA 1KK0A 4YRGA 5H9PA 1U2GC 1NKGA 4MLPA 2G4IA 2RI0A 2RHPA 5GJ6A 2E51A 2Q28A 3JYHA 2ASEA 4BV2A 2XLFA 1NN3A 2NQYA 1B0AA 5KJ6A 1SPBS 2XXBA 3MMXA 5KINB 4M8NE 1AX1A 3MIDA 5J63A 2FX2A 1A71A 2JVIA 2R0QC 2CY6A 5BWBA 4EV0A 3OSDA 2ZZQA 2GNPA 2KQUA 2ZGLA 4YFWA 4R98A 4LNUB 4BN5A 3F5DA 1JU9A 1W04A 2WWVD 1NG9A 4A10A 1KFKB 3HNBM 4ZZ1A 2A0WA 3RTBA 2C59A 4RH3A 4HGRA 3EMDA 3ZY3A 4KDCA 1XZKA 4XIJA 4QHSA 2ERXA 1E2EA 4DLKA 3FE5A 5AVAA 2ATCA 1CJCA 4J9UE 4X66B 4IQPA 4UDOA 4AF9A 3V8NA 2RHDA 3AHDA 3LBFA 1E9EA 3C4QA 1OBFO 2J5KA 2WN3A 1MRNA 3LOQA 4RTQA 3FWHA 1BHQ1 5HGJA 2PLV1 1U8AA 1UY3A 5SYNA 3FRIA 3KYIB 3MMPA 1A7AA 4V03A 3U0VA 4MV9A 5GJCA 1NV9A 2Y9MB 4N54A 4QPIA 3FCOA 4FK8A 4GZMA 5DYWA 3VH3A 4MH0R 1W47A 3Q2IA 3IAXA 3NAZA 8MHTA 4N39A 2JFZA 3LWDA 4J1SA 2HJIA 4RE5A 4BQOA 4WWHA 2PV0A 2W1SA 5GPBA 2BZSA 4OLJA 4BO5A 5MGBA 2UXCB 5D1HA 2L2QA 5I7VA 4M4PA 3C3VA 3JALB 4JGYA 3MUNA 4TYMA 3LP8A 5DGTA 2H5LA 4XPZA 1ZBA1 4N9HA 1XZNA 4LITA 3Q0EA 2LS6A 1I7DA 3W1WA 1FV2A 2A1IA 3EDYA 5BR1A 1TGVA 3HRKA 2MINB 1IVSA 3RWNA 4UXJA 1W9WA 3VDMA 5CVVA 4BA6A 2Q3MA 3GA7A 4UEWA 2NNLD 1XU9A 2QQWA 1PT8A 3KYBA 1H8TA 1XNQB 3EGIA 3EIXA 2GD1O 4WKPA 3ADPA 2CF6A 3A28A 1YC2A 2PD4A 3RFTA 1HA3A 4FU0A 4XJ9A 2CLHB 5CNMA 4DWWA 1VA5A 4G8BA 5BOSB 5GIOE 1UIRA 1JVNA 2QD4A 1XEWY 2PMBA 5K3OA 4N53A 5FXWA 1G7CA 1SBNE 3V2HA 1UZAA 2E9QA 2Q6IA 1RUE1 3HWRA 3T52A 2F3PA 1KDKA 4MIKA 1L0BA 4GKYA 2GJ9A 2Y1KA 2B78A 5LWQA 3W34A 4BX8A 5DG2A 3G85A 2PT7A 4AUMA 5HKLA 2PLV3 5JZGA 5TVKA 3L0SA 4CUCA 4GWGA 5KYTA 4ZI2A 1U2DC 5FXMA 1LEMA 2VQ6A 2GERA 4OCTA 3GIWA 1QGZA 1U1CA 1ZK2A 1T6ZA 4YAJA 3MLLA 3IYLW 4L0MA 2B25A 4FHZA 2P34A 5CDHA 2VHWA 4K6FA 4QQPA 2OD2A 1DQRA 1REEA 1KH1A 1I6XA 2V55B 4UE6A 1KMNA 1WE2A 4WBNA 2ZWVA 3X1DA 2ZGVA 5IT4A 4JI3B 3KDPA 5LN1A 2OO5C 4Z2YA 2NXWA 1T1RA 1FEZA 4DLSA 4N7UA 3M6LA 1JYFA 3ZWKA 3T12A 1WY5A 5B1YA 2F9LA 1JQDA 2P27A 3UXHA 2BI8A 2Z5WA 1JNXX 3UICA 1NI3A 3WKCA 3Q1LA 3RBZA 2PE5A 2CE2X 3AVWA 2HMYB 3AUSA 1DBNA 4OQEA 2IC1A 4HK8A 1V6AA 5FDBA 3MT8A 3MJRA 3DPUA 2ONZA 3TR6A 3CUWA 1YUDA 3SQWA 3ND6A 1Z56C 1COWD 1G55A 2HB6A 1UL1X 1UKYA 3JARA 4E51A 4BLQA 2JDKA 1BHGA 3GJ6A 4QM7A 4BBJA 3HA3A 2E18A 1JYTA 3UMCA 3OBBA 5AJWA 1P61B 5C34B 3BWMA 2QBYB 4G24A 1RUE3 5A9RA 5A7FA 1G41A 2JIBA 2XTZA 4H1HA 3OLCX 3GLHA 5IAAA 1BX0A 5FY5A 1RR6A 5DLDA 2E4ZA 1XC7A 2CMKA 4AS1A 1WP9A 3QU7A 3LXUX 4HDNB 3KPYA 3ULKA 4ZCQA 3LCMA 4XDYA 5FBJA 5A7WA 3PA6A 1TAGA 3INGA 5FWAA 1RHJA 4AQTA 2XQXA 2JLYA 2ZTHA 1QP0A 2YOGA 3ES4A 4Z4FA 3WB2A 1Z2CA 3EVBA 5FPXA 1MJNA 4CA9A 1Z0UA 2HYXA 1DAEA 2RIPA 1GG5A 4MGIR 3BL5A 4YPVA 3K1ZA 4Q4DA 3U4IA 4UDYX 5FPLA 5FZ7A 4F0JA 3W6PA 1M34B 3FN4A 2ISSD 2J3JA 2IIQA 3T3MB 3O3CA 4YLZA 1JAHA 1XKLA 4G0MA 4ZYLA 2YU2A 3B9IA 2XNSA 3U3KA 4EKDA 4N47A 4MGEA 3THXB 2JG8C 4XBNA 2Q0SA 2LRHA 3QU5A 4E88A 3ZV3A 1LENA 4ITRC 3WXMA 2MYUA 4O33A 4BMCA 2GD0A 1FOD1 2X23A 2RGXA 2A75A 3ANMA 3BDIA 3HZOA 2R11A 2WQZA 4JR1A 2C82A 1AF7A 4IDZA 1FFSA 4DQ0A 3GHYA 1KYIA 5FZ8A 4DDTA 3W6UA 2TNFA 2R7AA 5KYNA 4MQFA 2RC5A 3CRRA 4XA8A 4URWR 3OHSX 4G5GA 4YJ2B 4P9GA 1BFKA 4CIBA 3H8SA 5DHSA 1O3TA 4X0EA 5KOJA 3T34A 4HDQB 3ML1A 3E5XA 3UNXA 1DAOA 1ISFA 4BO4A 1IPJA 2H63A 3NU1A 5I51A 4J25A 3IR7A 2UZ4A 1TAUA 1R091 4F7DA 2PUGA 4ENTA 2NUTA 3L93A 4DB5A 2JG9C 2QSYA 3K8ZA 4QPJC 3EZYA 1BEEA 5CGQB 1C4OA 2CXQA 1TUBB 3GJZA 4MO9A 1DJOA 3H04A 4QAWA 1CX1A 1W5FA 2ZM5A 4X61A 3ZXJA 1DZQA 4GALA 4IJQA 2G25A 2RBEA 1PRYA 1Y7TA 1NMEA 4P7KA 1TTQB 1S0CA 2O06A 5HG0A 3ZWXA 2Q5HA 4Q1CA 5D1IA 3KSBC 1Z28A 5T4EA 4B4WA 1XDUA 2IWGB 2ZRAA 1Q7RA 4P7GA 4BJ3A 2DG2A 4KO4S 2RGNC 3UUGA 5IWCA 2UWAA 3ASUA 1K89A 1N4AA 5HXVA 2OV1A 4AY4A 5CR9A 1JR2A 5FUBA 4KAXA 4X64B 5JIUA 2GNMA 1WW6A 3IQGX 2VUCA 4IF6A 4ARVA 5KTTA 5BW8A 3OBRA 2EHDA 3N6VA 4Z0TA 5IVIA 3JAWA 2J08A 2NU8B 4LRUA 2OBYA 3EJKA 1PNOA 3N7MA 1YBMA 2QFEA 1ORRA 4RHCA 2QPOA 4K1XA 1K88A 1JBQA 5DWDA 3FUTA 3Q9UA 5FIXA 4DJEC 1FOD3 1PIV2 4HJRA 1PTKA 4GKKB 1OWMA 3IT8A 1KQGA 1NXVA 2XQIA 3MZHA 2W6JD 3FOZA 2AR6A 4CF3A 3NHUA 1US2A 4F9EA 3HEBA 2R8RA 2QQOA 5ERGB 4EO7A 1YZGA 3DQZA 2Y6UA 4RIEA 4FZRA 2CY0A 3UKNA 3I59B 2ZIAA 2JW5A 4BKUA 4NAVA 2Q5TA 1V1JA 5THXA 2E5WA 5LB4A 3CIHA 3MINB 1YJAA 1IJFA 3AXSA 3J7MA 3Q3VA 3VKVA 2FD8A 1V5IA 4LYDA 4X7MA 1DO0A 4CDQA 3LLUA 1R093 2X0NA 3DR5A 2Z4TA 2BEVB 5BWLA 2Y0DA 1MENA