4K7JA

Peptidoglycan o-acetylesterase in action, 5 min
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
350
structure length
350
Chain Sequence
GLLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 125
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k7jA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k7jA01
1VYHA 1FXWF 4JJ4A 4Q7QA 1BWQA 4OAPA 3PT5A 1DEXA 1VJGA 1K7CA 5CD9A 1J00A 1U8UA 3DCIA 4JGGA 1WABA 3SKVA 1BWPA 3SLRA 4DEVA 2WABA 4OAOA 4JJ6A 5B5SA 4HF7A 2O14A 4I8IA 4JKOA 4IYJA 4RSHA 5HOEA 2W9XA 1DEOA 1BWRA 2WAAA 4K7JA 3P94A 1ESEA 1PP4A 3DT9A 5A4AA 3W7VA 4NRDA 3C1UA 1FXWA 5BN1A 3U37A 1ZMBA 2APJA 1V2GA 3RJTA 4S1PA 4XVHA 1ESDA 3HP4A 1ESCA 1IVNA 5JD3A 4PPYA 4K3UA 3KVNA 4JHLA 4H08A 3DT8A 2HSJA 2VPTA 3MILA 4RW0A 3BZWA 4K9SA 3DT6A 4TX1A 1Z8HA 1ES9A 1YZFA 3DC7A 2Q0QA 1JRLA 4M8KA 4K40A 4LHSA 2Q0SA 4Q9AA 4HYQA 2WAOA
chains in the Genus database with same CATH superfamily
4N40A 4DCVA 4AJLA 2JVJA 3PQ6A 4QQHA 1L1FA 1FP6A 1SY7A 3H3LA 1W8OA 2GPNA 3OJCA 1EJ0A 4C7MA 5LA6B 2EG9A 2HI0A 3AJYA 3RC8A 3C7GA 4KLAA 3EVZA 4DR6B 1D1SA 2P77A 2WYIA 4ASUA 4FE3A 3ZQKA 4DUVA 1ZH8A 4GMGA 4D8YA 1B7GO 4AHZA 4FFNA 2IBSA 1D0IA 1GA1A 1SPPB 5CBPB 1YUNA 2ZYGA 4AAPA 2ZSUA 4G5GA 1JLLA 3OOYA 4OHRA 3FTQA 2ZJ1A 5DJ5A 3EIQA 3L06A 3NOVA 3GRFA 1QAOA 1RWVA 1WLWA 4AF9A 1FRZA 5TT1A 1LSUA 3Q4GA 3RG2A 1XLWA 1AUQA 1FFGA 4JLSA 3ZLUA 1OVPA 2XVZA 5K3AA 1NBHA 4MV6A 1M8JA 4TXJA 4OX9Y 3PPXA 2HPZA 4WL0A 5AFSA 1OX4A 5MN5A 1Q0PA 3DKWA 4LY3A 4LHSA 3UT5A 2FPIA 3KV5A 1O9GA 1U0RA 2BBOA 3WRVA 3FWHA 1RM0A 3OE4A 4YCCA 3AERA 3NH6A 3E1F1 3O84A 1WZNA 2F1JA 4FPEA 4BTLA 5T5OA 2FWMX 2Q2NA 1FL9A 4EEZA 3BS4A 5AJZA 2V3CC 5TPWB 4Q02A 4NYMR 1VE7A 2AV6A 1UDBA 2QD3A 2F7SA 4IRXA 3USES 2BOVA 3HI4A 1FE8A 2ZSKA 3IPRA 1WAMA 2R25B 4RL7A 4M38A 5ANNA 1X7XA 2JRLA 5JHHB 3F95A 4ND7A 2B4YA 4JFAA 1HDKA 3MYXA 4H15A 4LXHA 2X5IC 1FNZA 2IEYA 3ZDZB 1BHQ1 4HYTA 4C21A 5B2GB 1CTQA 2UYQA 4E70A 2OCKA 1JXQA 4RPGA 4JA2A 1P7PA 1ID1A 2UZ3A 3OPXA 3GA0A 1O77A 1JZ3A 2VAPA 3BG5A 4G5SA 3S1LA 3FHLA 2R072 4ZYTA 3I8XA 3R6TA 4FZRA 5HZKA 3SBEA 1GGJA 1JJAA 2PLRA 3VBUC 2O1SA 4HNVA 3UCEA 4DV0B 1X2EA 2GPWA 2CF5A 2NPOA 3BMNB 3ZXUB 3WRYC 3O31A 3TB4A 2GAJA 2WJ4A 2QM3A 1S3IA 3PXEA 3HWJA 2JDYA 2RD2A 4LO7A 4Q6BA 4L5CA 4KQ1A 3CRVA 2J22A 1L9KA 4F72A 2O2CA 4LJ7A 1B35B 3Q8BA 3GUVA 2IEBA 2DFDA 3AFOA 3UKVA 1RE1A 1N2CE 4GVLA 3ORHA 1AC5A 5JAUA 1VMAA 4UARA 3B94A 2E4YA 5B64A 4NAHA 1CYEA 2H3EA 1FX0A 1NCRC 3T4EA 2R7MA 4KUHA 2WYUA 5L4NA 2IXCA 1LA2A 1ESZA 1FNNA 4RD0A 3NHPA 2F4PA 3ZZUA 3DFZA 2MSEB 4K0RA 4ORFA 1DTWB 2ZRAA 2XLGA 3MIGA 3KAJA 4ROTA 3A4MA 3MUFA 5F1YA 2ZTVA 1HSOA 3OPYI 4BVLA 3I34X 5U1PA 5P21A 2ZROA 4D3SA 1N0HA 3DP9A 4K05A 2NQ2C 4PQEA 3X2FA 3HN6A 2NV6A 4D6XA 1I5OA 4BNDB 5FI0B 5J2TF 3OP4A 4EWAA 1TZBA 5CG9A 4AZ0A 2W58A 4NXNB 3COWA 4O59O 1YQWA 3K2IA 4I81A 1XZBA 4D42A 5K9ZA 5BNTA 3TL3A 3B7GA 4TWTA 4BQRA 1R88A 1H6BA 1GYRA 3SKXA 2C54A 1UJ5A 2AEFA 1RUG2 2AC1A 5EQDA 5CG2A 4J3NA 2IEZA 2FPMA 4ZO6A 4BEWA 5JPDA 5AW5A 3FOWA 4CUAA 1LJ8A 1CGPA 1FP4B 2ZYHA 1DBPA 3T3MB 1BROA 2GKOA 3GMIA 1IEQA 1WW2A 3ANTA 4L95C 4Y9TA 3AXSA 1Y5MA 4UQPA 1AIPA 1T0JB 2AN9A 3IP8A 1KIAA 4QO8A 5FPAA 4MW5A 4MPPA 4MGIE 1KS2A 2ZIXB 4I50A 3ZW8A 4PAWA 4EDFA 2CHEA 3FL7A 4IWXA 5A32B 1ZM1A 4N01A 2I7VA 1ENOA 4OH7A 2QQVA 1E2IA 3FIUA 3KLBA 2G1UA 4F4HA 2UYBA 1RUF2 5T54A 4JUDX 4G01B 4NBLA 4MGSA 4AQ6A 4DG9A 3WLLA 3N8IA 4W8JA 2REQB 2F3PA 3U5TA 3ADDA 1C28A 1GPMA 2PSDA 1HRI2 3W4JA 3EEBA 1UDXA 1P17A 2WNVB 3FZ3A 3E7DA 4YRRA 2YIDA 2WAXA 1A9RA 3AR6A 4KQXA 3TOZA 5BURA 2VP5A 4TSFA 1H69A 3OF3A 1I1NA 3ZOZA 2I7DA 2XQXA 1E9BA 3PDHA 3VZRA 2C2ZA 2UVDA 3OZ7A 5KVAA 3AETB 2G9FA 2BGJA 1YR6A 3GJYA 4WA7A 3EOAI 1M1UA 4DA4A 4ABYA 3NJZA 1A9ZA 1W4RA 1PJ3A 1RJFA 2X53S 2CUKA 4PZDA 5JWOA 3TTXA 1A1VA 4V0MA 2V7EA 4JKLA 4C0BA 1R4NA 3FF4A 3TLKA 3E18A 2CNKA 1UM8A 2H5IA 5C46F 3OYWB 3F4BA 2H5EA 2HNBA 2Q2VA 1TM3E 2WABA 4NRQA 4EBFA 1SG6A 4L76A 1SU8A 1A77A 4C7VA 5KQRA 3DFKA 3D6VA 2CFTA 3HUEA 2DJ5A 4FXKB 2ZRHA 1RMYA 1SMVA 3DGTA 2D7CA 4YTEA 3BWCA 1M67A 4A7ZA 5JIAA 1I3MA 3LG2A 3HB4X 3WHIA 5KOIA 4RY8A 4IEFB 5F64A 4BO5A 1UOFA 4DIFA 1MAHA 5B2EA 1USGA 4M0FA 1JXMA 4OUMA 1OF4A 3MD0A 4LRQA 1BTOA 3WV5A 4E4RA 4OHKA 1VJTA 2HBTA 2DKOA 4OHFA 5FJHA 3M3PA 4O4JB 2IU3A 2JBAB 3CLRD 2QLTA 5EMMA 3TTYA 2WFLA 1Z18A 2PGAA 3ME5A 3S7TA 4FX2A 3EZGA 2GZ2A 3DCJA 5FBKA 5HRAA 3QOXA 4N4AA 3QHQA 3A1NA 2XGGA 4XQCA 5A04A 2YDYA 4YW6A 3OIUA 2HIAA 4UBJA 4BJ5A 3JD0A 5EMNA 1CUFA 1SQ6A 1PO23 1QJU2 1YR7A 3ORQA 2K46A 2P9YA 4NOTA 4CIYA 4IKEA 3AYCA 1KBQA 2QSZA 3GYGA 1OMOA 2YVUA 4PIPA 3WHKA 3GALA 4Y5TA 3OBIA 1N1TA 1YKGA 4TTGA 1NQTA 4RUKA 2ZJ6A 3VKHA 1NNLA 3OCWA 2C3MA 2Q8NA 4M4PA 4EHJA 1GUDA 1BXZA 4MX8A 5C34B 4TTPA 4NYMQ 4K0KB 2WYSA 4MGIR 1YZ3A 5BQFA 3CB2A 3JARA 5D5PA 4HZGA 4J1TC 1DXOA 2W11A 2BWCA 3FGOA 1GR0A 1OOPC 3WNZA 8ATCA 3L7NA 1VLLA 4UHEA 2DUPA 2J8ZA 4OVKA 4B4DA 2BFMA 3BOSA 4F8JA 4YJGB 2C97A 1QPBA 1BJKA 3EIFA 1Y42X 4I6JA 5ERYA 1DSSG 4U6QA 4GMKA 3QE2A 5LEKA 1F4VA 3R0RA 1MLDA 2PN1A 2FPGA 2PHWA 2VUSA 1HDYA 3GBWA 5GLUA 1JHMA 2FP4B 3BH7A 2OO5A 3Q5GA 2WP8J 4X65B 1JX6A 1PVDA 2RGAA 3JRNA 3F71A 1OA2A 4BXFA 2H1SA 3N74A 5KO2A 1O54A 1SHTX 4NR1A 1VIVA 3E23A 5AW3A 1U7OA 4LKSA 3OFNA 3OECA 1PL8A 1B00A 1OU4A 2BGLA 4O63O 3AJZA 5LBTA 3Q40A 1R0RE 3GVIA 2H29A 3ZTTA 3DDZX 4EFLA 4ACAA 3OEWA 4DZZA 5A71A 5IK2A 3KB5A 2HWYA 2V6IA 1WEHA 4IIJF 1K63A 2XKBA 4DDKA 3G9TA 4X71A 1U99A 2R1DA 3D1LA 4NQZA 2ZSHA 3NT2A 5LNK1 4YJGA 1H2YA 5AIBA 1E2DA 4UQOA 4CM3A 2Y8EA 4K20A 1OT5A 4WM7C 2I4MA 1J2UA 4YRAA 2HF2A 3FSJX 1Y7HA 1EY2A 2ES3A 3FRJA 2ODQA 4WBBA 2CLEB 4LIVA 4BQEA 3H9QA 1SUEA 4E5VA 5JC8A 4HQ6A 5BT9A 3WNNA 3ZYFA 2UZ1B 4XJAA 1SG9A 4P33A 1MVEA 1CVLA 2OXFA 1R64A 1EVQA 2RS32 2C4MA 5IVCA 4OMDA 1EI9A 1NP7A 3T9AA 2Q0AA 2W9XA 1XRJA 1H3EA 3G6KA 1FYXA 1H05A 4U9UA 1IS5A 3BXOA 4RA9A 4R2XA 5CNJA 3UPTA 2PR2A 3H7YA 2R6R1 4I6EA 2IXLA 1QRUA 4QOGA 4ZCSA 1Q7EA 4QOEA 4DARA 3THYA 3RDIA 1LD3A 4JIMA 4ZD6A 4DA0A 4MXVA 2XMDA 4G5RA 4IUCS 2O2DA 4TLAA 3IVRA 4XTPA 2WD8A 2G9UA 4K5QA 1XVUA 1PZ9A 2CD7A 4C01A 1A5TA 1HFWA 1VL8A 2P75A 3ROFA 3NJYA 2CV0A 4HD8A 4LC9A 1MQTC 4Y6LA 1Z56C 4GL2A 3G3EA 4EE2A 3E82A 3B9RA 2DR0A 2MU1A 2I91A 4RFSB 3PIGA 5JHGB 5BN5A 4HANA 4B48A 5CADA 1SUBA 5HIIA 5DI3A 3WYEA 2EF0A 1Y9MA 4YJFB 2YXBA 5AH0A 3QSYA 3RF7A 1PR5A 3ZG6A 2ZIUB 1ISFA 2PH5A 5JMOA 2VFAA 4KK3A 3HZHA 3WMGA 4LVCA 4YNBA 3SG0A 3QCWA 3MJTA 4IM7A 1WCQA 1NXQA 4UEQA 2XMLA 4N8SA 4ARZB 3ZD7A 3F9CA 4HJXA 4QAQA 1CU1A 1TA4A 2JFOA 4W5JA 4RIIA 5BUSA 1V9U2 1U0JA 4URTA 4EHAA 3CZQA 2CEAA 4RQPB 3HLYA 1PFKA 2QSYA 2W6JA 1KQNA 3WLEA 4GKVA 3TSYA 4CUJA 2I2BA 1QRAA 3CZ5A 3VMMA 3W2FA 3ZHBA 4JGYA 2AOUA 4XIFA 4FXPA 4FPGA 2GM4A 1KKMA 3AF4A 4FDVA 4QQOA 3GO4A 3IPLA 3I5MA 3U81A 4ZYLA 3ZWAA 1CQIA 2QYOA 3DVLA 1FUUA 3WLRA 1W04A 3DWGA 2ZHNA 3ZE7A 1SPPA 4G23A 3OEHA 3QLVC 2Y1WA 1T5TA 1PBNA 2ZZNA 3ABZA 5AK6A 3RROA 1JG4A 2MYTA 4K3VA 1MTOA 1K7EB 2V6GA 3ZFGB 4WHMA 1ODCA 1V6MA 3PI7A 5C18A 4C1XA 4DQLA 2PGXA 4ONUA 1VKNA 2QQUA 2YVQA 2HWE3 1G5RA 3FRIA 3KSBC 4BE3A 3CSDA 2JG9A 4RJJA 5FAXA 4E4YA 3U7EB 1UNBA 3VYVA 3OJBA 4Q66C 1L7OA 2W6NA 5SICE 3KVAA 2EHDA 1MEC2 1DJPA 4C0SA 1ZD4A 4NCBA 1WD3A 1PX4A 3J7HA 3QEOA 2NMNA 2CJYA 2NXCA 5B1SA 4BKMA 2R1UA 1RUE2 4NBNA 3K0HA 1SM4A 1JBQA 3TDNA 3E1GA 1IDN1 1RWOA 3LQKA 1E2LA 3GT7A 5J1XA 4HOYA 3EUWA 2VP9A 2R96A 3BALA 1WS6A 3O1TA 2G19A 3RC1A 4CVUA 2PHRA 2B2NA 4DRZA 4IHJA 1M6WA 2BI4A 4RNDB 1HDZA 1GT91 4JMPA 3RIYA 3WQQA 2J3MA 1T8TA 4QHTA 2ZAHA 4KQ6A 1NXPA 5HKAA 1X80B 1AYN3 1MHTA 3KR9A 5AM5A 1RPNA 5LZ8A 3RVRA 3M8KA 3IEIA 2XRFA 1XXHA 3WQ1A 3SJBA 4Y2HA 3UUFA 4KQGA 2W70A 4CEWA 4C5CA 1NR1A 3CCBA 4V0LA 4DBZA 3D1VA 4ZT3A 1NPTO 4CPDA 3EBLA 2JGAA 5EJ4A 2CYAA 3VBFB 2N0SA 1UP7A 1B6TA 3DEZA 2Z1NA 2DUUA 3V4OA 1U31A 2ZCVA 4G9GA 1L7AA 2CLSA 2XUDA 1JPVA 1R092 1LHWA 2J41A 2VH5R 3LVRE 2WD7B 1O94A 1LRJA 2BM9A 4EHDA 5KSPA 4N0DA 2Y38A 1QOTA 2R9VA 1O8PA 1IAQA 3L8CA 1X42A 3M6LA 2LW8A 3QF4A 5BWOA 2UY9A 3FBGA 3TUZC 1QO0D 4RORA 4ZCRA 3AR5A 3RRDA 1G2OA 4BQQA 3A1FA 3A3NA 3QE0A 2GEBA 5J7MA 4MB0A 3FFWA 1NCQB 1OFUX 3WF3A 5LP6C 4B7CA 2YJZA 3U4XA 1P0CA 1F60A 4K2HA 5AK3A 3U40A 3QXGA 4RFRB 2WV9A 1FMFA 4WKGA 1WXHA 3EMKA 3ESXA 2GA8A 3CPSA 2OPHA 5T55A 1V45E 1T5LA 3LT4A 1DG1G 1MVQA 3C6MA 4CDUA 1QONA 2RHTA 4URWR 1OXKB 3BOPA 4TXLA 2C2GA 3CHYA 1W0OA 5EXPA 5JAHA 1D4OA 5BVGB 3PG5A 3O03A 2EF6A 1NXTA 1R8YA 4ENTA 3VDNB 3DO5A 1PO13 2YHIB 3HP4A 3AL0C 5CIQA 1JEEA 1S55A 4W50A 1STOA 3EF1A 1VG1A 3GHYA 3GGSA 3WDTA 2WINI 2B4RO 1H1MA 2C4XA 2X6QA 2I7TA 3AMMA 2Q1WA 1CUAA 1WUIS 1I9RA 2IP4A 3WKBA 3INNA 3UGKA 1PHPA 2EHJA 3QKRA 5H3CA 3I6IA 3KWMA 4QREA 5A32A 3I9LA 5JEDA 1II8A 2EXXA 2HJVA 1YKFA 2JG9C 2BVVA 4UW3A 3BUSA 3OF2A 1OA1A 2D6KA 2KE5A 4V2IA 5GZ1A 1EFDN 3WGHA 3HDGA 4LXLA 1ZRFA 1T26A 5DYGA 4EZEA 3O3OB 1COV1 3PHCA 4ZTBA 3C7AA 2IV3A 3U26A 4ES6A 2QBYB 5FAKA 4RY0A 4DCJA 5LZ9A 3PGA1 5EMLA 4CR7A 3GFTA 1FBTA 5ANQA 4NONA 1MC5A 3WL6A 2IJGX 4XB1A 4EB6A 5JBQA 3QVSA 3A9TA 5JS1A 3TEMA 3BWYA 3C8DA 3K5HA 5IAJA 3EWNA 1FEZA 5GJWC 1YE5A 1DAOA 4JWKA 4LUKA 4MVJI 1IOWA 2EALA 5EXTA 2PJDA 3CEMA 3DO8A 4QJ5A 5LA2A 3OLZA 4S24A 1U63A 4K9SA 3KEQA 5ABJA 4XYBA 3M6WA 4AJOA 3G2NA 2E7AA 3KZMA 4OREX 1C50A 2GJSA 4Q7EA 1UM9B 2PLAA 3U14A 2WIBA 1LC3A 5MGBA 1P7VA 3PEEA 3LB9A 1E5DA 2P0AA 2O07A 2DPXA 1C8VB 2WE8A 3C7OA 4RMIA 4O2AB 3Q7TA 5K2MA 5DOZA 4J1WA 1K68A 4JUFA 5KYKA 1CD3G 4CQMB 2ZMLA 4EJFA 1SOMA 2JAPA 1E0DA 2WK1A 5CXQA 1NSFA 3M9WA 4J03A 5CBKA 4PFKA 2WL1A 4NVPA 3VZPA 3HDJA 5EGNA 3ZVLA 4JLUA 2VG9A 4AEDB 3ZY5A 1UMCB 4HLNA 4RA9B 2WR8A 2Y92A 1I80A 3L40A 1NONA 5IU6A 1L2TA 3BFVA 4EUHA 1SRQA 4H08A 3CZPA 4N53C 5FUYA 3ACFA 4G5OA 1L5HA 1BCSA 4U5XA 3KCYA 3T15A 3T1QA 4LRUA 4UFKA 1JLKA 3K6SB 1YLLA 3SX2A 4GOLD 1U7PA 2PLWA 2PUGA 1P4JA 2OQIA 1BKZA 2H0BA 1SUDA 4I6GA 1ZRDA 1V8OA 1MA0A 1K3TA 4FX5A 3WRXA 1AQUA 2BUBA 4EFNA 4M9ZA 2A58A 1PJSA 1DKLA 3TD2A 5AKZA 4P02B 2ZEWA 2YFZA 1JYEA 4GPTA 4DWWA 2VTBB 4BM8A 3CF6E 3N7UA 5C1DA 1OI6A 3LDFA 4MI1A 3RKRA 1TMYA 4FOYA 1U8EA 2PUEA 2GYYA 4HUTA 1E4VA 2FETA 1NJFA 3CRQA 4O2BA 5NLLA 3GFRA 2W6PA 4GOOD 3I30X 2AMYA 4G1VA 4EROA 1XR3A 2BGRA 1E69A 2FR8C 2VLIA 1EM6A 5JLJA 2HA7A 4ZDIA 3CVVA 5IT0A 4H3WA 1O96A 3DC7A 5DE3A 2B20A 4B5KA 1B2LA 5H4HA 4NIGA 3GJQA 4OFBA 3E5RA 2J0UA 3B3GA 1J0XO 2B94A 4C5BA 1OE0A 4F45A 4C7OA 3ND7A 4YP1A 1KVSA 4H4EA 3BORA 3BSSA 4BDTA 3WNCA 2RDRA 1WPGA 2W2IA 4B34A 1PNTA 2ZSDA 1EX1A 2CL2A 2PHUA 3WRYA 2XOEA 3LYLA 2IYWA 1VG8A 4ZO8A 3GELA 3EZNA 3RYCB 2OBBA 2DC1A 2WMYA 3VBSB 1N3BA 1XQ6A 4MHSA 3AEYA 4YAFA 4CCKA 4YT4A 2C58A 5J9FA 3LL4A 2F90A 4H6VA 2ZB3A 3AZOA 3AEQB 1ZMTA 4AWAA 3N9OA 2R8EA 3BTZA 2VJMB 2JB4A 2QTLA 4KDEA 4ERNA 1US8B 1A5AB 2W2OA 3LUFA 2HPHA 1RU3A 5EWMA 2EFYA 5LQUA 4CVNA 1TMF1 4LBJA 2WWVD 4NPCA 4WMLA 1DO0A 2QRMA 4MR8A 1KZ6A 2LPMA 4XAQA 4QM8A 3N2NA 4OFWA 3ZOIA 3M4JA 2HF8A 4KWHA 2DB3A 1Y9JA 4RU1A 4FONA 3VQTA 2BBWA 4TZDA 4GL4A 16PKA 4LV8B 2V74B 3WYNA 2ADOA 5AVRA 2ZRCA 1GP2A 3EGEA 4CV1A 3BTOA 5B57C 4PLCA 4INJA 1RWBA 2GBCA 3OQPA 5IYZB 2VXJA 2V03A 4O5OA 4L5IA 1RFLA 3TJRA 2PLV1 4ZANA 3SOPA 3I3QA 1GV9A 1L7DA 1E2BA 3IE2A 3KXLA 2CN1A 4QU1A 3JQ9A 3VJKA 1XTTA 1MJGM 1I5EA 4E1AA 2IEGA 1YWGO 2PMKA 1ZJJA 4KAJA 1JDBB 5T8KC 2A88A 5T7BA 3WB0A 1H66A 2VTVA 3FB1A 3WXMA 5FKBA 3H8XA 3AFMA 3BKXA 5DXAA 2NWQA 2DU1A 5IWAB 5FUPA 4LIPD 4ITCA 3VDMA 2GRAA 1X7NA 1WXIA 2F1KA 5IN5A 3KR1A 1RWQA 2BFEA 2AQIA 2QP3A 5CDUA 3RFVA 3QE9Y 4GNKA 4MQEA 5J47A 2L19A 5I4BA 8ABPA 1CUWA 3W5BA 4KG7A 1H4HA 5DTRA 4NAVA 4JDPA 2IU0A 2WG0A 4S1VA 5FPTA 2J42A 3CJIB 3BL8A 2GH2A 4BTVA 2OO7A 3GLUA 4DOMA 2PX4A 2J46A 2CHGA 3LPMA 4WKNA 2IW1A 3T5MA 2QRPA 5K8JB 2XA9A 4X91A 1VI5A 4QUJA 1REQB 1C41A 1PWEA 4IH4A 4BVBA 1N0WA 4PC6A 3BHNA 3QFCA 1HMYA 3MS7A 3I83A 3C14C 2O20A 1TYAE 1HN0A 1IK4A 2XZPA 1LPAB 3JD72 2D98A 5EP1A 4CL2A 2P4EA 3P9YA 3VZSA 5FCDA 3UC9A 1GXSB 5C8XA 4I5EA 1T1RA 5TXGA 2WUVA 3HRIA 1KVRA 4LCBA 4IYJA 4YW5A 4BNNA 3ER8A 2RGGA 4PVDA 1FSFA 1FRFS 3LQCA 1VBB1 3UHPA 4AVYA 3UGJA 3ZSLA 4R8VA 3C7DB 2A3RA 5EUBA 3RJRA 1WOYA 4FPLA 4MQ4A 1Q5OA 5DLYA 4AZTA 1P7WA 4AF7A 5I8TA 3IQZA 3RS6A 2GC0A 4B4WA 5F1KA 1DC5A 1G1AA 3OBZA 3LQ1A 2DHCA 3C4QA 1BE1A 2VDWB 3PUZA 4MB6A 2V7XA 5DAWA 3OFSA 2GF2A 4WGFA 4KSYA 1YULA 3UXHA 4EM6A 1SHZA 1R1A3 3TNDA 4C6TA 2XLAA 1C8LA 2A5YB 3WIUA 3K8ZA 1NC3A 3PL5A 2PYZA 4JJAA 3SZRA 1D5CA 4UTXA 3BWDD 3I1FA 4TQ9A 4AJHA 2FQWA 4RD7A 1IJKA 3TB6A 1X33A 3V7WA 3NX4A 4BLUA 2J67A 2IC1A 2NW6A 2ORYA 3USUB 4BV8A 1PT8A 4R8HA 1ECLA 1AB6A 2O7VA 2NU7B 4PCVA 3P2EA 1OLXA 5DDJ1 3LS2A 3PGLA 4KKVA 1T91A 3JZIA 1FX0B 5ENDA 5FR2A 2DSNA 4OXYA 2OAEA 3OY2A 3PQFA 3PGMA 1N25A 1KOFA 1ZZBA 4E88A 4EA8A 4Y2QA 4BZQA 1NVTA 1P2UA 1XF1A 4B7AA 4KRGA 3VC2A 2ONKA 4BP3A 4E33A 4L73A 5EESA 3IPCA 3FFXA 5IVKA 5H70A 2G7MC 2IXBA 3WO1A 5IATA 1L1EA 2YDXA 4PPNA 3L92A 4YSFA 4FSJA 3O1LA 5FYCA 4XDZA 3DHEA 4O2BB 1PR1A 1R9GA 3PSHA 4WH0A 1GPBA 5JROA 3TM4A 1KKUA 3O1VA 3TLJA 1XQWA 4XUOA 2AOVA 4F9TA 4ZOCA 3W2TA 5JRJA 5JCPA 5FY9A 1KYVA 1FAYA 2LS6A 2R043 3U1XA 2XQRA 4UUMA 4CR6A 4Q15A 2QXYA 4ER7A 2JIZD 1YA8A 2GN3A 2WAYA 3BCWA 2QLMA 3AJRA 5HCUA 4PGFA 4F46A 3ILXA 3QEBZ 4WM8A 1NJ1A 2D1SA 4RZUA 4ZRNA 1Z15A 4NBTA 3HU2A 4DCNA 4BCCA 2BMWA 3HUUA 3OKCA 4ZTZB 3TBFA 3MWEA 4OU4A 2MSNA 3IAFA 3RREA 4A7KA 1Z5VA 2WFF3 4OOEA 3ZIAA 2V58A 2YZMA 1BC5A 4AI9A 1OF1A 3JW8A 5C4WB 5E4TA 4TKMA 4URFA 4GZ9A 4LXIA 5C7LO 2H51A 1RVF2 1ISGA 3S4YA 5DTJA 2CLHB 2BEUA 1FY2A 4Q9HA 4NCKA 3LT1A 2BEWA 4K40A 4P14A 5TSWA 1IAVA 4MPJA 1JHRA 2O54A 1N2CB 4AQSA 3LY5A 2FZ4A 5LDGA 4E22A 1HY3A 1QH9A 5AFBA 3KTAA 4Q3LA 5AVSA 3RI9A 4TT8A 4N3BA 1JU9A 4TN7A 2ORXA 2WZQA 1H2AS 2GYVA 5HUHA 3USUA 3IO3A 1OFNA 3ZHQA 4JBGA 2QPOA 5LYJB 2ERCA 4GKJB 3H2KA 1L6RA 5KX5F 3Q6MA 4EW1A 5BNPB 2XDWA 2GXAA 1WMSA 3EGWA 4HKOA 1W85A 4BFZA 4Y98A 3DAFA 2JD2A 2FSHA 2RS13 2FFAA 3VB9A 3PGKA 3R3VA 3M6AA 4JV4A 1T9GR 1QTNA 3HY4A 3MHZA 4C5AA 4RR3A 1JU4A 4CPBD 3JZAA 1JAXA 1Y1LA 4M3CF 2YWBA 4EVRA 1TA0A 3KKLA 2R4TA 1GJRA 1DELA 1AX0A 4NYIR 1NP6A 4NP6A 4TWRA 4Q4LA 5AW4A 3EXHA 2PHZA 2Q3HA 2AJDA 4FFVA 3ZVRA 2FR0A 4CUGA 3I49A 4HN4B 1OLSB 1WIWA 3TFWA 3IVGA 1NW5A 3MS4A 4MZUA 3WKCA 5AW8A 3HUFA 2AFHE 1I6WA 3OPZA 4FS8A 5JOZA 1OFIA 1WCV1 3VYUB 1E1NA 4EI2A 3GFQA 2C2YA 5FBWB 3IKTA 1JMKC 3K9GA 3S70A 2YXSA 2LW7A 1CY7A 3B3AA 1NQAO 1VQ1A 1GQ2A 4EJSA 1IN6A 3LQYA 1F9KA 2XUEA 5DG2A 3IHTA 1NKTA 1UP6A 4QPCA 1PK6B 4J1NA 3LP5A 1M75A 1EYBA 1YQXA 4R41A 2WSMA 3PWZA 4GYYA 2CY0A 3ORRA 3FUTA 3FF1A 1G7RA 4AX8A 2DVGA 4G8JA 4K26A 1TAUA 4B8YA 4X62B 1SA0B 4B6RA 1VIYA 1RPAA 4RW0A 2P5YA 1KY4A 2J3EA 5G02A 1TQ5A 3SJUA 4KMQA 3EISA 3HCAA 4AKGA 5THXA 3SM9A 4MQFB 3GVCA 4J16C 3CUKA 1JALA 1E20A 2NIPA 5DX1A 1VRBA 1THTA 3IILA 1TEVA 1SFPA 4GIQA 3CZCA 5LD2B 4N5NA 1EPZA 1BD3A 1UYYA 1W2GA 4BX9A 2BFAA 4ZC8A 1E5LA 4MVJA 2FQ1A 2Y99A 4IXMA 3TQSA 2XCIA 3AP5A 3CDZB 3T7CA 1L5MA 5LA6F 5KXCA 1TCUA 1OXSC 1O5IA 1E9RA 4KAXA 1SELA 1JS9A 3CNAA 5BY2A 4HDOB 3E1SA 5KAPA 3L6DA 4CM9D 1CUHA 4DNPA 2D5IA 5A6YA 2UZ1A 1J8VA 1BZYA 4OUEA 3K8OE 1GQQA 2WSLA 1RQXA 5CP8A 3F46A 4XFBA 4HB4A 4BLTA 1NLFA 1E0JA 4AVBA 2ZCUA 5E7JA 3ER9A 1QFZA 1Y8AA 5BNOA 4IHAA 4FIDA 4NBVA 4PGGA 5A5FA 1HLDA 1JSXA 2CE7A 3LLUA 2VATA 4IZHA 5H82A 1W7AA 1EUCA 2R32A 5KIAA 4QULA 1B93A 2GKGA 2JHFA 3JQCA 3H1EA 3N0RA 3I3OA 2AMVA 2EU8A 1BWQA 4Q05A 1Q1ZA 2XUKA 5JDCC 4PI2A 4C43A 2QN2A 2RHLA 2EOAA 2R60A 2X8WA 1WL8A 5HEKA 2IBTA 2FLKA 4G1MB 3K77A 1IQ0A 4FHGA 4LOIA 2OP0A 3HDVA 2I87A 3CX6A 3ZDBA 1CUGA 4NKRA 2D6OX 1G5QA 4M37A 1I7PA 2H85A 5JRDS 1USVA 4QASA 4EFMA 1Q8OA 5IC4A 1G86A 4NZMA 1V48A 2B34A 3RYIA 3TN91 4HEA1 4BAUA 1PGQA 3BXHA 1JZQA 2PN5A 2AYXA 2CWDA 5IVIA 1RKUA 1QHSA 1GEEA 5HRUA 1JXNA 4X84A 1G21B 3RTBA 3PZBA 4C78A 3H2GA 1DHRA 2QFEA 4IMIB 4TTRA 1WCWA 2FZ5A 3V9AA 4PYLA 3VZCA 4XWKA 3M3IA 1KI1A 2ZPUA 3QPCA 5JZGB 1NCRA 3OKAA 1XT6A 1NZDA 2UU8A 4IUDS 4TV9A 2V3VA 1JAZA 2Y3IA 3L4KA 2XYQA 1L7BA 2HN9A 5E9AA 2DVFA 1EBUA 3UT5B 1KPHA 1R66A 3C0KA 1OQDA 1GNPA 4BK4A 2JHCA 5JIBA 4CLXA 4C6SA 3T7TA 1P5RA 4MINA 2YBSA 1LPSA 3IQFA 4ZAFA 3FCCA 2AD5A 5IHXA 4DS3A 4AE2A 1E66A 1PMHX 2ZIGA 4TSFD 3HKDA 2VHTA 3T9CA 5FLXA 1WSBA 1RQNA 3K0AB 1ZI6A 1K92A 2O8FA 4WEOA 1HYBA 5A7SA 3VX4A 1X94A 3C41J 3R05A 4FHFA 4QDZA 1SHLA 4PLWA 3C74A 3B3QA 3Q8MA 1Y1PA 3ND5A 3D59A 3G8DA 1WXWA 2FJ0A 2JDKA 2FN9A 2IZ6A 4MI3A 4ZPIA 2JH9A 3ADPA 2Y6HA 1QQTA 3C3YA 2ZZJA 1TM4E 2P11A 1CAXA 4YG6A 4IEUA 4R40A 2JDZA 3U1BA 4CQNA 4ZODA 4P92A 3WDUA 1RKQA 4BJHB 4E4HA 3B8EA 4TZTA 2Q5FA 5JLVA 4UBGA 2WO7A 4IIHA 2EEZA 2B9EA 1CB0A 2C7BA 2BKLA 4RXUA 4YBRA 4JY7A 2HSGA 1UBJS 4MCAA 1PFQA 5IDVA 2DCUA 1TVEA 2EYQA 4OO3A 3PWKA 1U8UA 4IQPA 1UXXX 1D2EA 1KS9A 2QL7A 2ZXEA 3C8ZA 1DC8A 3HT1A 2Q1YA 1HRV3 3ZMOA 1JR2A 3N9PA 2C20A 1R6BX 4BBPA 3PEVA 4C4XA 2QZJA 2I2DA 2NN8A 3UFXA 4UEOA 4XBNA 4J1TA 4WFQA 1A3CA 2AQHA 1EDDA 2JIGA 4B3RB 5M5BA 1LJ7A 4HGZA 5DX8A 3I2IA 2DBIA 4DAEA 2ZAMA 4PFSA 3PJGA 2KBEA 1AYM1 3NONA 4GP6A 2QTVB 5I7FA 1VB3A 2OBFA 1ODSA 4BQWA 3FNIA 5IT4A 2YYOA 1UKEA 2J1SA 1H9PA 3FVWA 4WFKA 4C3ZA 2AFIB 4GP7A 3O8CA 2GZMA 1BN6A 3HWRA 4CWAA 4DUGD 4XYEA 1CYDA 4PIMA 2B98A 5FWYA 3OGJA 3I3EA 4FVVA 1XRQA 1WXXA 5K0UC 4OCTA 1BCXA 1ZAYA 3OEHD 2WZDA 5REQB 1NYTA 1M1ZA 5J37A 2DF8A 1PO11 5LSAA 2FNAA 1R0ZA 5E0OA 1XRSB 5I9SA 3OTIA 1L6IA 3H8WA 2V9CA 5JOYA 4XQWA 1SCRA 3U17A 7ADHA 3C4VA 2IXJA 3P94A 4DYVA 1WVMA 2XJSA 2FZCA 5ICFA 1CB7A 3IQGX 4LDRA 3BTYA 5L9RA 4AX4A 3RTGA 4R54A 2E7QA 4AZZA 3DWIA 4BCDA 1Y4WA 2BDTA 1W6OA 2YVLA 4X44A 5I3CA 3EXHC 4CTJA 1UO9A 4GPIB 1TZCA 3LNTA 4JUIA 1W49A 2X15A 4IF6A 3AKCA 3B2QA 2VPVA 3EG9B 1XRPA 5BNPC 2O7RA 2XBLA 1X8LA 2EAUA 3DYIA 1L5YA 4MGEA 4F04A 2FXVA 1BHGA 2ZAGA 1XFDA 2HMWA 3K05A 4NK4A 5MF6A 2QUHA 1JSZA 3JATA 2GNOA 3ZV6A 2X23A 3E9ZA 4YO7A 1ZR2A 1FQJA 3C8MA 2I6UA 1P31A 4A4AA 1G4AE 4CDQC 4BMVA 1L4UA 3S2SA 1UU4A 4EGJA 3CZMA 2VJDA 2QVBA 4NY1A 3I2YX 4CCOA 1G8HA 4TTAA 3A27A 4N7IA 1JJVA 3MMSA 2ATEA 3Q8FA 4X3PA 1NN5A 3HXQA 5L6MB 4LJ4A 3ZGZA 1W0JD 4JDMA 3ES9A 1VRH3 4A8TA 4R4JA 3UGQA 3BFKA 1U2GC 1L7QA 3I76A 1BS2A 1JDPA 2ZUEA 1MEC3 4WZCA 1OIVA 1ODKA 2RJOA 2H9AA 4M9UA 4D4GA 5BY5A 3FDJA 3V8BA 2D3RA 5FYYA 4BKPA 3QLJA 4MR7A 1MENA 3LGAA 4WXRA 2X5OA 4TV9B 1R6AA 4Z1VA 1MEOA 1SDDB 3PDUA 4LHZA 3NWEA 3FYHA 4JRLA 1G0OA 1RJGA 1C14A 4FBLA 4TL6A 4C4ZA 1WHSB 2YXDA 5JR2A 1G0NA 2BMEA 4FVTA 4WVZA 5HR5A 2HWKA 4LZAA 1YSCA 3P3NA 2I55A 4AQ2A 1WB5A 3ZSMA 3ONVA 3RBVA 2DG2A 1NT4A 2GK6A 4CXMA 2YBDA 2ALJA 4K9QA 1Q2XA 3T7IA 5H8WA 2QXTA 2ZM5A 3UJNA 1NE6A 1U80A 1JR3D 3E8XA 3V55A 1H2FA 5ADHA 1Y82A 3OLYA 3PD1A 2Y0OA 1XEWX 1N2HA 3TLAA 4CQMA 2NYAA 5HOEA 3H13A 4GG1A 1NXXA 4XIYA 1VRWA 2A9PA 3EW9A 4IXNA 2KJQA 4KBYA 1E3LA 3K35A 5KTOA 1NR5A 2V4UA 4PC2A 4BWOA 1IBMB 1T8RA 3IXMA 2R5NA 3ILVA 3I59B 1C9EA 1AR82 3DVAA 1KXJA 2XGMA 5DMYA 3DL7A 3TVDA 1DJNA 3F5MA 3I9OA 4MW7A 2FRXA 3AW9A 5CFPA 5DUXA 3PVOA 4FYPA 1UDWA 3ZJUA 3DMTC 3ZIAD 3P1JA 2IPNA 3U44A 3HN3A 3H04A 3TCKA 5KJCA 3ZXXA 2GCOB 3ZY2A 3TPFA 2K9ZA 4L50A 2I4NA 3RVNA 1JN0A 5FZKA 2HA2A 1TGYA 4BQ4A 4KZKA 3NALA 2I2AA 3T0IA 3W0LB 1DMSA 2PK3A 4IDNA 3EX7C 1WCKA 1CJDA 1RPJA 1MZ5A 1MRNA 4I46A 1GUAA 1A2QA 1ZWLA 4IEYA 4M3NA 2HSZA 1IVSA 4FOPA 5I7EA 2FMKA 3R6DA 4PRZA 5DAQA 4MVJE 1KI4A 3RV4A 4AEMA 1IMOA 2JGFA 2X29A 4QU5A 4Y0AA 3AP9A 3NEPX 1WF6A 1FJ2A 3FZYA 1RZRA 5C31A 5IX8A 4RZ3A 4JOQA 5FLKA 3MM4A 5D5QA 3MJCA 3NDRA 1KL7A 3NHUA 3EULA 1I5ZA 2D0IA 1LDNA 621PA 4WESB 3SSNA 1XE7A 3NRBA 4DN6A 5LWQA 1BFKA 3ZWBA 4WAUA 4QX2A 5CW2A 2O2SA 2VJKA 5CIRA 1OXMA 3FOFC 4RE5A 3OB8A 3V7FA 1SD2A 4IIBA 3LHFA 3SKJE 5IC6A 1AR61 2P3JA 3RIGA 1PSWA 5T4FA 2GNTA 2I3GA 4L3VA 5LR6A 1J0DA 1XZHA 1AOXA 4L2NA 3KAPA 3HXTA 4E4TA 5CURA 1TF2A 1EZZA 1JXAA 1JFFA 1E1QA 5KOYA 4NV3A 5LKAA 2FQPA 2G5CA 3WK8A 1QWRA 5IVBA 4TVBA 2Y6FA 3FLMA 2X2FA 2JHPA 2WT9A 5KTPA 2V5YA 3F6EX 2QRGA 3MXTA 1S5PA 3VBCA 3W5CA 4ZT4A 5LCWL 1P39A 1SBDA 3SYLA 1VJDA 4A4DA 3PDWA 4BXSV 3BD9A 4QGSA 2YIVX 1E1RA 2H1CA 3DDHA 2BMVA 1N9ZA 1AQ6A 3WADA 1QV9A 3RS5A 5JO9A 2EBWA 1GO2A 1P6UA 1NM5C 1BJTA 3AZWA 1SR8A 2PGIA 3L8MA 1YI1A 4ANFA 4IDHA 2Z2IA 2YQ4A 1NV9A 2D3SA 5AR1A 2JGLA 2G1KA 3K7EA 1X1SA 3WYGA 2ZRJA 1T6ZA 5GY7A 2H1RA 4QEKA 3O5SA 1C3EA 4TQUS 2FGKA 3PNSA 3K5PA 1UFQA 5MHTA 1KO7A 4YRGA 4JJ8A 1JYIA 1QU3A 4N76A 2EW1A 4YW3A 4RVCA 1PT6A 3DOIA 2XITA 2QYSA 2L0XA 3ZHXA 1A8PA 4AN0A 5FYQA 4AYWA 1K5HA 4HWKA 3HE3A 4NBWA 1J1IA 4OPMA 1K8QA 3QX7A 3UK2A 2IEDA 3TIFA 4GULA 3BXZA 1R8QA 2BN4A 3K6SA 1FIUA 4Z9FA 1GQHA 3F73A 2YG0A 1N8NA 1AK1A 3ZXLA 1HN1A 5IS2A 3ZLBA 2E5FA 3TZKA 3GNEA 4ESOA 4JHLA 4NO4A 3OTQA 2A6WA 3D4OA 3RSHA 1UJNA 4I3PA 5K45A 3PL1A 1WW4A 4RYLA 2BR3A 2DWOA 1OUSA 1JKIA 1VKJA 4EY8A 4KV7A 1QH7A 1F5SA 5IVYA 4Z7QB 3CRMA 4FOVA 3EZ9A 1Z16A 4L57A 1O57A 2ZYDA 3AVYA 1CK4A 3SR3A 3GLHB 1FVXA 1G5PA 1H8VA 4DZGA 2ID4A 4M60A 4JBNA 4I8IA 2GNMA 1N32B 3KX2A 3Q85A 2QNBA 5B3AA 1QE5A 1O94C 4AZWA 3VSAA 3I0NA 2EYUA 1S2LA 4MAFA 5KHJA 1QHGA 4DQXA 3TR6A 2D74A 1K3FA 4LJSA 2J7KA 4EMBA 2PX8A 2HWD1 1DAEA 1J56A 3ICPA 5LASA 2WWJA 4LVOA 2QR3A 5FMOS 4C0HA 2ESRA 3O73A 3DV2A 4CPBA 4D44A 4K9PA 4HPJB 1HRDA 3EE6A 1D5WA 4MWEA 2I80A 3ZWQA 1NPYA 3UPDA 4F3CA 4M86A 3FR7A 1SURA 2V7GA 3UW1A 3VOTA 2P41A 2QMQA 1X1AA 1SNYA 1G9FA 2BFUL 3H84A 3FBWA 1BX1A 3CUUA 4PC7A 2P6NA 1YBFA 1GZWA 2ZZMA 2J09A 3M1HA 2J07A 2XRZA 4XGQA 2IYFA 4FR2A 4Z8XA 2DPYA 3RYTC 4UTNA 1PHMA 2DJIA 5ESWA 1UZNA 2C88A 1ZZ6A 2BL4A 5A5EA 1JDTA 2Q9UA 2DWPA 4XFKA 3UV7A 4URVR 3EDMA 1U5CA 5JSRA 1H8TC 3ET4A 4RVDA 1MV5A 1ULUA 5IVEA 4M0UA 1L5LA 3G8CA 1A8QA 4LPLA 3WF1A 3ACIA 4JROA 4FR5A 2R48A 1W28A 3OX1A 3QXJA 3FSGD 4X8LA 2XOXA 2JHGA 3DPRC 3MYYA 1W9YA 1GRVA 4E09A 2EKLA 2RHRA 1JKJA 2NVOA 1KGDA 3C5CA 3AKTA 4ZCLA 2BBVA 3BN6A 4O29A 4E5NA 1ZR4A 2O0MA 4HN1A 1TE2A 2IWGB 1Y1TA 1RABA 3I52A 2FCVA 2C5GA 3QI7A 3LUCA 2IWHA 1S02A 1LLDA 2CMHA 4BXOA 3PXXA 2ZUVA 1WY7A 4KYUA 3EXFA 4M0HA 4F71A 2NVWA 1NASA 2GCGA 5EPAA 4PY2A 1OQAA 4HGOA 3KTAB 2JLZA 2GH8A 4RVSA 2R751 2A3XA 5A9SB 4R1UA 1GITA 2WA3A 1Z5OA 5I7UA 4TKVB 4A82A 1F17A 1XCOA 2FYTA 2ASVA 2OPBA 4MYSA 4ZAVA 4EN9B 3DUIA 3WGVA 3TNQA 3DE7X 5LP6F 2JDUA 1YIAA 3E7FA 4MYCA 4EB0A 4M0PA 2JIRA 1WMDA 2VMHA 2OM2A 3NDPA 1I94B 3H2JA 2E32A 2LCFA 4EQVA 1AB5A 1NMQA 3U0VA 4UMVA 1BQ3A 2Z4TA 3TL2A 3GFVA 3QWAA 4B47A 1TZ2A 2WRZA 4OJKA 3ONWA 5C35A 2PVPA 1ORIA 4MVJF 1OX4B 2ZGVA 2PAEA 4XCQA 4GKKB 1LX6A 3GLGB 5L3RA 5F7UA 3NW9A 3M1IA 4I4TF 5DN6A 4CEHA 2IC5A 3W6OA 1MKYA 2B69A 3W2GA 1PT7A 3KV1A 1CAVB 4RGBA 1JAYA 3KL2A 4GI5A 3B69A 3TLXA 1QO7A 1N3IA 1ZMXA 1KEZA 3T3GA 1XU2A 5IJXA 1EHIA 1MQ8B 3E3OA 3FNGA 1LRKA 5DRYA 4D8UA 3AIOA 2JGEA 1BEV1 4MS4A 2GK3A 4YNIA 1SO8A 3U09A 4HH1A 1Z38A 2ANBA 4WKBA 3OT5A 5IYZF 4ZZIA 1Z0AA 3SYNA 3ZEAA 1NVXQ 5FP4A 1GM5A 1JEYB 3PUHA 3ETEA 1B35C 4MDEA 5C3OA 3NVCA 1E79D 3E4DA 3QITA 1ZJ6A 4FBMA 1N6KA 4J0KA 3MBWA 3E2PA 4MXWA 4LG1A 1REFA 5IM4F 2W6JD 1JPUA 1B73A 1I3HA 4OB8A 1NAHA 2P5UA 2NU9A 1XU7A 4WADA 5H16A 2GETA 3GEPA 4ECEA 1TZKA 1ZS9A 5DNAA 2WNHA 1H2KA 4PLGA 2JFFA 1POXA 3C1TA 3ZDXB 1Y3DE 4O9EA 2QT9A 3TLEA 2VTDA 2QN6A 1ZZEA 1GTJ1 1KIMA 1TT5A 4R9DA 5KWSA 3ECSA 3H5VA 4QGFA 2W48A 2JVKA 1EK0A 1XL0A 4XDGA 1KZGB 4COYA 2BCGY 3U3MA 4PTLA 3VL9A 4HQNA 4FTSA 2EAAA 3PQEA 4M3CE 3WMXA 1D2MA 5BWMA 3CZJA 2Z6QA 2Q6OA 2CKDA 5AP9A 3OI7A 4C2BA 2H48A 1Z28A 4GH4C 1JT2A 5D2CA 2W71A 2PBRA 4P80A 1I2MA 1H94A 1CZOA 2Z57A 2P0EA 1LKNA 1G20B 1K9SA 2AWOA 1OFVA 2W0MA 3C43A 1M73E 4UDNA 4EW2A 4R2MA 2Q27A 4Q1DA 1US2A 4Q1FA 2OC4A 4QOHA 2BKAA 3O95A 4EDHA 1T3LA 3E7PA 2Q5IA 3ZD6A 2Q5CA 2ADFA 1QJEA 3CW2A 1AS2A 3ZBPA 1HYHA 3RBZA 2QRZA 4D0NA 4IQFA 1TNFA 4C1WA 5MN6A 2JAQA 4QDSA 3ZBUA 5CB6A 3OF1A 3CKLA 3FR8A 4CFZA 2GPJA 3HQ4O 2X7HA 4MPDA 3DF0A 2Y4OA 1DLCA 4XVRA 3T5CA 2B1GA 3LC7O 4QTUB 2IXGA 5KYYB 4WK0B 4AFMA 1ZI8A 1B6GA 1FPN2 3RNOA 1JW6A 3THTA 3PUWA 4QE3A 4KJXA 1R6VA 5ALIA 4QJBA 2H2FA 3LC1O 1Q1BA 2JD1A 3VZQA 3SLIA 5BNZA 5GGXA 4LK2A 1KH1A 5LMNB 1CW2B 1KMHB 4UZFA 3O1JC 2AG1A 1FXWF 3ZQUA 1QO0A 1HETA 4B4UA 3ZFFC 1VRCA 5GOTA 4XUTA 1RRVA 4JL8A 3HNBM 2P2ZA 2ODNA 4BNFA 4CL0A 4I1VA 1OWLA 3AR3A 3H5NA 1NIJA 4P5DA 1GZ3A 1E32A 2R8PA 1KXGA 3A36A 1C3LA 4CDWA 1UJ4A 3EZYA 4YZ1A 4FNOA 2CNLA 3KWVA 4DR1B 3AEXA 3CV3A 1HXHA 5BV1A 4E0BA 2VJAA 1ABFA 2VXRA 4K9NA 3VR0A 4RGGA 5FPBA 5CA0B 1IZ3A 3OFKA 1YHFA 2C7GA 2K2SA 1YTLA 4MS1B 1JVBA 2A5LA 4WY8A 1GUYA 4KQ9A 5F3IA 4BMCA 4N53B 3LF2A 4KQ7A 3W06A 3QLUA 4E14A 3I8SA 4YAKA 1D04A 4C4YA 1UF2C 2VOJA 3VI4B 1Y9ZA 4B31A 4Q9JA 1EBFA 3ZY3A 2P37A 1SLLA 3KZKA 3OTGA 1PEAA 2PXHA 2RCYA 5HV4A 5EWSA 3TAYA 1C1XA 1UCXA 3VTAA 1CC1S 5IT9A 4B3XA 3EK2A 3VNAA 4Q21A 2IOQA 3UFXB 1RIIA 1DG9A 3EJ6A 4Z49A 1G3QA 1ZXXA 2C7OA 1OB5A 4BHTA 4Y1UA 3J8F2 1AURA 1E9FA 1PL6A 3PUQA 5LMCA 2OGTA 1PJ4A 1US3A 1GGNA 4DLSA 2R84A 2RHHA 2BMFA 3VZMA 1UY4A 4IWNA 2C4TA 1NVDA 2JZNA 3DAHA 1QHXA 1EUDA 1GTL1 1RINA 4MS3A 4PHZA 3A21A 3DOJA 3O4HA 4ZO9A 3CNQS 1S0IA 4JC4A 1VKRA 3KF5A 1RUH2 4INDA 1XMQB 4DEVA 4AZ0B 4EYUA 2BOJA 3QUCA 1IK6A 3EPJA 4S1WA 2VNRA 1HB4A 3AV3A 5EPUA 3JVVA 1L4EA 5IVDA 1VCNA 4A2CA 3BHIA 1BXGA 4R01A 5LK7B 1AUOA 4ER5A 5DNEA 2CZQA 1UXIA 4EVIA 4D9GA 4WBNF 1YRAA 3LZZA 2ZE8A 3AZQA 2EKZA 5DCYA 3FYUB 5EIXA 5I9IA 3WQ0A 3K0FB 1ISJA 4ES9A 1ULAA 4CTOA 3AI7A 3O3MB 5HK9A 3A23A 1RUI1 4I9FA 2VJLA 3ND6A 2HWF3 1IPKA 4FGZA 4LYEA 2YOGA 1Q0SA 2IOFA 1SLCA 3CVUA 4L16A 1VL2A 1GG9A 5E2BA 2R47A 1CUEA 5DO9A 4ZOQI 2QV0A 1SZJG 2VUIB 3FSGA 5EJFA 1ANKA 3A26A 2GZWA 2ZEJA 5DP1A 3LQ2A 3K1AB 4WM8C 2BPA2 3W77A 3B60A 4Z9AA 4YRIA 4INZA 4XI9A 2Q3FA 2VUUA 1QGOA 1WZXA 4UCQA 2WUFA 1ULTA 5C9AC 2HKIA 1ADBA 2ZGRA 5KXDA 1EEHA 4RHV3 1NE4A 2ZK7A 2ZUUA 2WLQA 2PZMA 3IC5A 4HWGA 2W52A 1H3FA 1OLXB 1HG0A 4XD7D 4NYIQ 2A2ZA 1IYZA 4EK9A 3B5EA 4ZGGA 5F6LB 4LBWA 1FFXA 1SC1A 4K3UA 1HNXB 4JSTA 1WBDA 4BGEA 5TPZA 3LPDA 1OC4A 4RADA 3R09A 2AFHB 4BC1A 1BGVA 2ECQA 2IZ0A 4C90A 3BICA 1TO1E 3I28A 4GFDA 4EHKA 5KPJA 5AKYA 4A8JA 4N03A 1RUD2 4NQRA 3PP8A 4BBAA 2ZTSA 2HQSA 3HCNA 1XVTA 3GBPA 5B4XA 3DZDA 3WP1B 3UK9A 2MR6A 2VWHA 4ND8A 1E7SA 1CERA 1PR0A 4AG3A 2DR3A 4W7HA 2W68A 3BXFA 3CF6R 3H5RA 2PMEA 4QXCA 5TPZD 4YPJA 4H7IA 2ZHKA 4K6KA 3H99A 4R16A 3M9LA 3O2QB 1MVNA 2V7QA 1GPAA 3OSUA 3DEKA 2E82A 2J0SA 5ITZB 5AKHA 4FOQA 4QX7A 1QVVA 4AI1A 2B30A 2VRCA 3AKYA 1L5SA 1RMU2 2ZRPA 2CL5A 5LB2A 2ZJ0A 2Y67A 3BREA 2Q5QA 4PSCA 4QODA 2I33A 1UJBA 1JOBA 4BIIA 2FDRA 2PAAA 1JEYA 1V3TA 1NXSA 4KITB 3ANYB 5IFLA 3PEWA 2AE2A 1FMD2 4ATFA 4R6WA 4JLAA 3FNEA 3ZHVA 5KDDA 4M7WA 2UAGA 3RYRA 4WJZA 2BFBA 3PU8A 2ISQA 4MAAA 5BV8A 1H4GA 3VZKA 3RHTA 3MLKA 4BFTA 1U2DA 1B14A 2FMDA 3EIXA 4EPTA 2WZEA 5J2UB 1JKFA 3H1FA 2XTZA 2Q4OA 2HA0A 3N2ZB 2R3SA 3JQEA 4C08A 4UC0A 1ZSYA 5J09A 5M04A 3SD7A 5IVFA 3WOVA 4DCSA 3R3HA 2QZSA 5LZ6A 1CXZA 2ONYA 2XQIA 3ORJA 1QCDA 2B1RA 1RKVA 5CU1A 3U61B 1RUNA 4YCMA 3M6XA 1IUOA 3DB2A 4NCNA 3ZI4A 4MMZB 4Z9XA 1P19A 5ALQA 4GLOA 1RZVA 1J8YF 1EB9A 4J9VA 2F62A 3Q3EA 3I97A 2ATCA 3QW4B 3GUHA 3Q98A 1XRNA 3EQEA 4GWNA 1TJPB 3OZDA 4BNXA 4Q4AB 4O4IA 2P62A 2IOYA 4XDYA 5AVJA 4HQKA 2ZBPA 1D03A 1E2PA 3SI7A 2ZSEA 3DHVA 3G0HA 5I7VA 2O3QA 1UZLA 3IP5A 4O2LA 1W0NA 3WG4A 2VF7A 4Q4Y1 2WKRA 3HCWA 1ZNXA 4O9GA 3VKMA 2NT4A 2QM7A 5AMXA 2H9IA 4MW2A 5AUQA 1NR7A 3EA5A 1UIRA 2OIIA 2FDGA 3D31A 5LQDA 3F1LA 4AFBA 4Z3DA 1Q7TA 1HF3A 4COKA 1QY4A 5BNFA 4V2WA 3Q7SA 3BCUA 4F12A 2FPGB 5BXXA 5DNYB 1LLUA 2F67A 2PEYA 3T8YA 4GGOA 1DCMA 3U19A 4QYMA 1N2IA 1LWNA 1WLCA 1ZW6A 2C61A 1MG5A 5HFJA 1SCBA 3F7OA 1LOGA 1Z83A 1WCUA 4XWOA 4UMEA 1N1EA 1JNYA 3L7BA 4MVWA 3H17A 5AKEA 3EEFA 3R0VA 2FMUA 2OFPA 4TMXA 3IOBA 1U9IC 1WBLA 3TTTA 3ZR4B 1D1TA 3K31A 4NL4H 1EG7A 3QTBA 3VO9A 3PFBA 4LGMA 1SWWA 4JQCA 4PR0A 5J1SB 3NTOA 5JDCA 2ADEA 5DUVA 1SBQA 5LPNA 3KQRA 5C81A 5KNCA 5JAQA 3VJLA 2TYSB 4KWIA 4ZHSA 1OHHD 2X9GA 4JS0A 4D82A 4B7KA 5I4KA 3D7LA 2VTFA 2YU1A 3LY7A 2WSSA 5KOJA 1E59A 2WSYB 4HWTA 1PG0A 2AMLA 4CM6A 3C7CB 2H6EA 4BNZA 4GWJA 1TRHA 3VBSA 3WR0A 3OIYA 2WEKA 1LNZA 3CUSA 1N6RA 3OCCA 5E9JA 1QIKA 1P7YA 3JYLA 3TXAA 1IGOA 1R3UA 2VC9A 2F9LA 3H1TA 3RG0A 1PD1A 1G63A 3QXCA 4P5PA 5FB3A 3FUXA 2WTMA 5AW6A 3X1ZA 1XN4A 3IEKA 4NPAA 3VPFA 2HLDA 1W99A 4N54A 1N0IA 4U00A 3IGFA 2MEV1 3VVLA 1RRGA 4GO1A 4H3VA 3N9IA 4YRDA 3H5LA 1PUXA 1VAKA 4XRRA 2AXEA 1COWA 1JFVA 5FBRB 4EI7A 3WBKA 3C3CA 2W2KB 1TCAA 3KJHA 4M0MA 1Q74A 4C6HA 4P53A 5D3MB 5BNOC 1IPFA 1LVHA 1UC5B 2A86A 5F5IA 4QD2A 4MUAA 2OXTA 1W9MA 3VDDC 1VBA1 1GOGA 1UEIA 2FQXA 3RVPA 2A6YA 5G05L 1SKQA 1XKLA 5FP0A 2XLFA 2Y0DA 1M9NA 3T3DA 1CV2A 1OA4A 4HV4A 4XSHA 3PUKA 3HG7A 4WBXC 5B5SA 1D2QA 3HQRA 2WBLC 3M70A 3LA7A 2X9VA 4NHXA 1EP1B 3KZNA 1S8FA 3QMPA 4AS3A 5HXVA 4PGAA 4IE4A 1KARA 4PHTA 1Z4QA 1MB9A 1T1EA 1N57A 1Y6ZA 4EWEA 1JMYA 4ARUA 1DP4A 2IDZA 1HI9A 4L85A 4TN5A 3KT4A 4AEDA 3QV2A 1TTPB 1W87A 2HV9A 3CRW1 1I7QB 3IURA 1GQGA 5IP5A 1EQ2A 4QICA 6AT1A 1IBRA 3FVTA 3R5KA 3KRTA 1N3LA 2ATFA 1WO8A 4RZ2A 3COPA 3BIWE 4U0KA 3HNOA 3PUSA 2OT7A 4JKIA 1OI3A 4LF9B 2KB0A 3IAS1 1GQFA 3ZTYA 4EMSA 3GDBA 2Y4NA 3ND9A 5IABA 1WXDA 4E2ZA 4D6PA 3A9UA 1RI3A 3RVBA 4GH4B 1E2UA 4L8YA 2FI1A 5DW3A 1JS1X 5DLDA 1K4MA 1IQUA 4GD3Q 4KQIA 1R10A 3MRXA 2YWCA 1YI7A 1KF0A 1T4GA 5H9SA 1XXLA 3FMFA 5CDHA 2J9YB 3GFSA 5IK2D 3GEBA 2P2YA 2PWPA 1DQNA 4AXXA 4JTOA 1VOTA 4CCYB 1T3SA 3WNLA 3MUOA 4NSNA 5EI5A 4KGGA 1W48A 2HSEA 4ALJA 1WEKA 1PFYA 2RGBA 2X14A 1SBCA 3AHFA 4O0MA 1W1UA 1C7IA 2Y1CA 3KEOA 2D5BA 1LPPA 3MTJA 4JI3B 1BVRA 1T36A 1PFGA 1KEUA 4CEYB 3SFZA 3R7NA 4P35A 4DV4B 2OK8A 4QELA 3JCZA 3RBAA 1J99A 5GADl 1X7XB 1RUF3 5B30A 2OV1A 3IMFA 4ZV7A 1GRRA 4OGLA 2QVLA 3R7LA 3PQDA 1Z6ZA 2ZI9A 4CTMA 3LQRA 2DH6A 1Z0JA 3OQVA 3MF4A 4PQQA 1C3JA 1QK5A 2R30A 3D4IA 5EMJA 4AMUA 5FLEX 1MQ9A 3A1WA 1T15A 3EVCA 4K81B 3I3SR 3YASA 4HATA 3M7AA 3ON5A 3QKSA 4I4NA 3AR9A 4WZZA 2WO1A 2A5JA 1NSYA 5LQAA 3O4VA 2QD1A 1EK6A 5ED4A 4Q4Y2 4QDUA 2HMAA 4B82A 3SXJA 4Z4EA 3IOYA 5C51B 4ALIA 4CLHA 2GGSA 4HB3A 3SNKA 3ZJ5A 1GKYA 3CMGA 1ZRHA 3BAFA 1M2VB 1K5MC 2IVJA 9LDBA 3V2IA 3P9RA 4LMAA 5EKTA 5FL7A 4QDKA 4HB0A 5FX2A 1U0EA 3DN7A 3DMRA 1T29A 1LPBB 3RYIB 5C3MA 4UEKA 5A6ZA 2VPXA 1TMGE 5HILA 5JOQA 5A3QA 1E1CB 3IDEA 1EVYA 1F1JA 2CYBA 3W1EA 3H9GA 4JA0A 1GTSA 5JDBA 3WZMA 5DSXA 4P9GA 3HC7A 3T95A 1Q22A 3GEIA 3CL1A 3AONB 4G0PA 5C5DA 1FNCA 2ZWPA 2C57A 2F6RA 1XZGA 5JISA 1IUPA 3AL5A 2COKA 3FOZA 2E7ZA 3E5UA 4QHBA 2YXLA 3B6IA 4HUQA 1Z74A 4ZI7A 5HCAA 4CM8B 1ZPDA 4G3YC 3CE9A 2CK3A 4A0QA 5CDGA 1PO21 5HF9A 5C7IO 1UZZA 1IQPA 5EE1A 3SDSA 1PG5A 5EJZB 2DQKA 3VNUA 1E7YA 1BQEA 4D9FA 1KORA 2DYKA 2FMIA 3LPAA 5FXXA 2XVGA 1MB0A 2VYNA 5CLLA 1FP2A 2X58A 4XJ8A 2F4NA 4L0PA 1AGXA 3ENNA 4QLOA 3IVCA 3SXUA 3M1YA 3TDMA 5J1TB 4KRYA 5J4KA 1BDIA 4FP9A 2ZIFA 3BA1A 1G6OA 3GMTA 1XUOA 2IHBA 1AY0A 1HNNA 1JN2P 4GR4A 2M6LA 1G4UR 3WJ7A 4C89A 3HYCA 4RK1A 2PFWA 5JJLA 4JBHA 2XJRA 1UADA 2XB9A 1EVZA 1UU5A 3PNKA 2I07B 5FZIA 2BYTA 2WNVC 3BF8A 1UBEA 3OOEA 3V9PA 3TTVA 1RLOA 2F17A 2Z5LA 2GCPA 4D7SA 3C3PA 4XAEA 2C03A 2CB0A 1XDZA 3PC8C 1E1LA 1OLME 2FLVA 3KOYA 2XG3A 3K0AA 3IT3A 2ZRFA 1U28C 1THZA 2ZIWB 3C1UA 4TYMA 1J33A 5DW0A 2VRWA 3OG9A 2VHWA 4Q29A 4ZS2A 4XIJA 2EFEB 4TMKA 2R6QA 2H7CA 4F92B 3JQFC 3INTA 2E6VA 4HXYA 5TARA 1E4EA 3DZIA 1QP0A 1UN1A 5CJ2A 1HLCA 1NP3A 5HF5A 3RUFA 3VD3A 3CIFA 3QXXA 3T0BA 4MQFA 1O96B 2JDPA 1P5JA 4Y9SA 1GFIA 3KKNA 1CJBA 3LWDA 5FEMA 4CXXA 4D1YA 3KAKA 1NY71 3ZLVA 1JFTA 3N0WA 4UFHA 4FKZA 3RSLA 4UHCA 1MQTA 2ZBQA 3GRVA 1HZJA 3ESAA 3Q8KA 4YR7A 5D1IA 4GR5A 4HKWA 1S7GA 3JVUA 1EUZA 4YMGA 5FPVA 1K97A 3OICA 4P36A 3HBKA 1OH3A 1HT3A 5KPDA 1ZBE1 3ETQA 2PAMA 3CKMA 3O1HB 3H9UA 5FIUA 2X05A 4HGPA 3U75A 2DHQA 1S89A 3QACA 3ELWA 4KC0A 3VD4A 3RS9A 2GEUA 4YONB 3W9UA 4DJTA 4ZOEA 4MG2A 3GJXC 3WYBA 4YUZA 1UBFA 2PHLA 2IYLD 5T3NA 3OQHA 4MWGA 4GMFA 3RGWS 4CKBA 4WUVA 5BSKA 4PNHA 4KNYA 2PMCA 4I55A 5BWBA 3ABSB 4QGBA 3I0MA 3AVPA 3TJZA 1N2JA 2DT5A 4RGYA 1YJXA 2CLLB 4FLFA 5JZGA 1K6IA 3ZLJA 4ZO4A 3LYUA 2KLBA 4DNFA 2ADDA 1CJPA 3WAGA 5LZ2A 4L8WB 3TGLA 4RTLA 4HSGA 4TQAA 1PVC1 1AR91 1GPNA 1S2OA 1DQ2A 1FP1D 3DMDA 3G8YA 3I8OA 1PNGA 3LL7A 2WZR2 5DM1A 2RHOA 1OWNA 2YVKA 3BBPA 5EJ6A 2C2OA 1VLVA 5ESRA 4H1VA 4M9CA 1L7MA 2C8JA 1FFHA 5LU8A 2ZX0A 3LPGA 1WDLA 2QLNA 4J94A 4MUJA 3GJ8A 1UQXA 3I61A 3JWGA 4IEZA 5DGHA 1OH4A 4I66A 1WLSA 2A9FA 4DPMA 4O4JF 1PJCA 1N33B 2YS7A 4X8MA 2BP7A 5D85A 2ZGQA 1BXKA 3EEYA 4M1ZA 3ZHOA 1ODIA 3LLMA 3ZH9B 3ZCUA 3OG2A 2OORC 1DT3A 5IZCA 2XBUA 2WWRA 1ZZ7A 4IMPA 2PUBA 1SFNA 1PP4A 3DBLB 1I13A 3QWFA 2ORIA 1H2RS 3D0RA 1G21A 1B43A 4C2AA 2WI8A 4RIGA 2Q6KA 3H9CA 3K51A 1HJGA 4PSDA 3P45A 4JAAA 1CFJA 2EQAA 1WCYA 4B3IA 2DBQA 5JALA 4PLVA 1T6BY 5BYAA 3BK1A 1RWMA 1GADO 2GFIA 1UT6A 1YVUA 4RK4A 3DXXA 4QPJC 1QQ5A 1O7JA 3VTZA 3GXBA 3WP4A 5F1RA 4IXLA 1ZDMA 1VHJA 4UOZA 3KPUA 1M6HA 3DG9A 5FQNA 5HWSA 4NBKA 3I2JA 2HADA 3ASUA 1ZH0A 2QY6A 3PPYA 4LJ5A 4TWZA 5AI4A 4DRXA 4IDOA 3LK6A 5ADUS 1F5NA 2IZ1A 1NSTA 3EIUA 521PA 5TB5A 2HC9A 1W2NA 3J7NA 4ZDKA 2Q8DA 3B5IA 4B45A 3SF8A 1DGWA 1F8GA 1HEUA 1PZEA 3TOSA 5HK8A 2C1ZA 1LLQA 4AKEA 4OJNA 3AF0A 3UMGA 2DLNA 3HJTA 3QI2A 2GC3A 2CV6A 4IE6A 3AGQA 1G21E 2A0WA 2NO5A 3QYFA 3QPAA 3VDCA 4NU8X 2O8BA 2B36A 5FJIA 3ZIUA 5IANA 3NRUA 3RYPA 2ZXFA 1WDKA 2H7XA 1VE5A 1KK3A 1ML4A 4YJ3F 2QNRA 2X1HA 3G9QA 2D3TA 2R063 4MV1A 3P0EA 4B4RA 1MAVA 4LJ9A 2BSXA 3M3EA 4UNNA 1CR0A 4YDSA 5JCTA 2LBPA 5L3QB 4GYJA 4OHPA 3U07A 2C5DA 5C1BA 1AKNA 3BK2A 5G3YA 1XTIA 4XVCA 2QLBA 2J6IA 2H4ZA 3IERA 1A9SA 4A36A 5K3CA 3W21A 3X1JA 1KEXA 2C98A 1RDFA 2V97A 4QYXA 3BGIA 3UA4A 3NI2A 1MIOA 1SQ5A 1YRLA 1W46A 3G2JA 2RHGB 4CU8A 1CJSA 5HUJA 2I9PA 2WOOA 4IV8A 1JHYA 5AOAA 3WNKA 4DC0A 1IONA 1JYTA 3FA2A 1O0BA 2O2YA 2N75A 1G17A 5J5CA 4L92A 4RACA 2PUWA 2ZX2A 1IN7A 2OZLA 4FMCB 1XZEA 1M6VA 2J3HA 4US2R 3BGWA 1IZZA 4M9QA 1ND5A 4IPTA 4R9VA 1IXSB 4HDNB 2VZVA 3WGZA 4MLCA 4V0SA 4MUKA 2XNKA 5AK0A 4Y9DA 3WMFA 2R6CA 2WHPB 1USIA 2B4TO 1Z0HA 1ES9A 3BJMA 1YH3A 2QD5A 2XUHA 2JKYA 2C3YA 2VT2A 4FDAA 4FEGA 5HQTA 3IT1A 3GH3A 5FR1A 1RJ9A 3JQ8A 1P9OA 1GGFA 1C4OA 3S57A 1LW7A 3MF9A 1AF7A 1J00A 3IP3A 1EK1A 2X1MA 4BFUA 5EJ8A 3U0ZA 1Y7TA 2NO9A 3F7TA 1Z2DA 3I2GA 3JUUA 3BDAA 3CPEA 3R23A 3R3YA 3TR5A 1Y5RA 2BGCA 1KNXA 4PG5A 4NH0A 4LF4B 3DV0B 4TMVA 3PXAA 4F38A 1TCBA 2CXHA 5SZHB 1J7JA 1PX3A 3RRMA 3CF4G 3HPQA 5ADVA 4EI9A 4HPXB 5AXAA 4EA7A 4X8OA 3TRIA 4KGQA 2VWGA 1UMKA 2ZIEA 2JI9A 5I5GA 2OLEA 1GLNA 4RKFA 3GUUA 3OT4A 3V0BB 4KO8A 1ND6A 1GGVA 3CKKA 5KVQA 3EJKA 3SZLA 2EGUA 4HSEA 5B3JC 4H0NA 3K46A 3NWBA 1KQOA 4M46A 3WSTA 2UWAA 2VNVA 4QARA 8OHMA 2CAVA 1Y5LA 1J97A 2Y64A 2C4NA 5IVHA 2N47A 2J9ZB 1GCOA 4O6VA 4BE7B 3S7EA 3KM0A 2ZGNA 3A0KA 4HH0A 5AVZA 4E2YA 5T67A 4DMKA 1QYIA 1UL9A 4KI7A 1CUUA 1P1RA 3EHDA 1AR93 5DTIA 4DIKA 5JAIA 5GAJA 4YALA 2KM2A 3JSAA 4EKNB 3ZE0B 2G77B 5HSGA 4Q47A 2WJHA 3T2OA 2FG6C 4Q1CA 3KHKA 4DPLA 4QM7A 4MRVA 4YROA 3DO6A 1NUTA 2OVFA 5IYYA 4K1XA 1G8JA 1RUD1 3WSWA 2GBIA 3NNJA 2SNIE 3SXUB 1GOTA 3KS9A 1LHOA 4I1IA 1Z73A 4M1MA 2H4JA 2HWC3 1XL1A 3JWHA 4Z51A 3W5IA 3MWDB 3COYA 3MWFA 1R8SA 3WL5A 3ZXDA 2JD9A 1ACLA 4TGLA 3WK9A 4WZBE 5ABJC 4K9RA 4IP0A 1ASJ2 5BSEA 3SHOA 2A5DA 1X0XA 2FOXA 4PG8A 1YL7A 3MOSA 4QBIA 4ACBA 2A6PA 2XL7A 4DZRA 2O7SA 4DVGA 1KJLA 4YAJA 3HT2A 2ORVA 1ZK2A 2BTQB 2Y1DA 4N18A 2E4ZA 1MEC1 4YLYA 2VP2A 2AG8A 3G0OA 1VBC2 2WWTA 1OOPB 1UXKA 4OSEA 1NQXA 2BELA 2GM9A 1N3OA 3I39X 4O8ZA 3IP9A 5IXSA 4GKXA 3P2JA 4JI1B 3MICA 4KDFA 4IEXA 1O4WA 4PWZA 4DV1B 3ACGA 1RAEA 4PO3X 1I6XA 3NL1A 4NEHB 2DZDA 3F8TA 2M98A 2CEKA 5AKKA 4TRMA 5CGQB 2DF7A 3WK4A 1GN8A 3LBAA 3WDLA 1P73A 1HLFA 5BUZA 1FTYA 2WO3A 2RHJA 5ARCA 3LE0A 3RBXA 5AVOA 5BQ3A 1N9GB 4RS4A 1GDTA 3ZUGA 1Y63A 2D0PB 1N1YA 2JKVA 4IDZA 4YHHB 1MCZA 4LZJA 3TOJA 5BOSB 4FQ7A 3AKSA 4LRXA 1KMMA 2GXUA 2P3QA 2NZWA 1GQRA 2HU8A 2IGBA 4UVHA 3D3AA 5CDFE 4AJKA 1T9GS 3AEQA 2X0FA 1YZFA 4NATA 5ALYA 1MVOA 2FUNB 3K0FA 4NF2A 1QJCA 4OZOA 3GFFA 4P6VF 3AF3A 1F0KA 1U3GA 3P2MA 1O58A 3ZYPA 4EHHA 3L6CA 2X41A 4PYOA 2TMYA 2I4LA 3LT0A 3K1TA 3Q7QA 4II3A 2AYZA 5JXJA 2X6RA 5G4KA 4BUJA 4GC5A 3BMQB 1NLQA 1RHI2 5G4LA 1TT5B 4KTTE 3RUDA 3W5UA 2D4AA 3E8SA 4A0FA 3WINE 2CDAA 5GM0A 5TNXA 2PXCA 3KQTA 3WAJA 2QA5A 3REOA 1D7AA 2FF5A 3HDYA 5F77A 1WP4A 3OU7A 1SCAA 1P1CA 3HWSA 2AUMA 4URUR 4Z4IA 2DCMA 4IZIA 1P1JA 3ZE1B 2IY7A 4NPLA 3PB3A 2JE9A 2ISCA 1FXZA 1WE2A 5TEWA 2IGTA 4RD2A 4O33A 3RJ5A 2C0PA 1X7WB 2YOHA 1RXGA 3CLRC 2L2QA 2GRJA 1U1EA 4AF6A 2Z6VA 3LDHA 1UYPA 1AYM2 1C7EA 5A9SA 3FMOB 1PE0A 3BCSA 4HS9A 4JR1A 4KX5A 3REQA 1AMNA 1MZPA 1TUIA 4TL7A 3AJAA 5E6UB 1NA1A 4AKSA 2O5RA 1XE3A 3W20A 4P5YA 2JFYA 4DXDA 1UL1X 4OL9A 3PTYA 3FUCA 2PXAA 3HFGA 3GLTA 2CJWA 4OHZA 2P9HA 2VTBA 1G2IA 5LJIA 1C3VA 5DTEA 4B76A 1SLTA 3L4BA 4YBZA 2JK1A 1O59A 1YE8A 4PCRA 2CL6X 2YV4A 4NEGA 4YLZA 2V54A 5IBRA 4Q3AA 2WZCA 1Q3HA 4WCFA 1RLIA 4SBVA 1F9AA 1OA3A 1UXOA 4QUHA 1DBNA 1BN7A 1E3SA 1NW9B 1QDUA 5LA6A 1MP0A 2FRVA 1UBHS 2VDQB 4ZOBA 1CRPA 5FORA 3GYDA 1ULPA 2QSJA 3CJTA 3U60B 2O2EA 2BGPA 2JHAA 2XT0A 5I7SA 1IZ8A 4W6WA 3T12A 1I36A 2XL9A 1U8ZA 4TMYA 1ZREA 3S8YA 3ONNA 1ETHA 1D2HA 3O4RA 1PZHA 1DRJA 1AJEA 4BQYA 4BNYA 3SMHA 3NTRA 1BS1A 1CAUA 1TTQB 4F93B 2D00A 3T4UA 1KY2A 4NV0A 3DFIA 2PU5A 5HUQA 2MSDB 4NZPA 1VLHA 4ISQA 2CZGA 4XCBA 4Q82A 1G9BA 2ADMA 5CEHA 4GPBA 4V1CI 3KF3A 5AUPB 5IG2A 4DXRA 5A62A 4LQCA 1QMPA 3IAM6 4HH3C 2YCBA 3T35A 1S0JA 3PEYA 4O4JA 6NULA 3D2CA 5EL0A 5K7PA 2K2WA 4LJ8A 2WKSA 3ZFFB 5KHGA 3ZWCA 1UOEA 1QZUA 3K20A 3EYWA 1DG6A 2Q1MA 2Q3JA 4Q1BA 3K8YA 1XA0A 1FDRA 4HPKB 3MT0A 1U0TA 4RD4A 4QUBA 1UJ2A 4AY2A 1TYEB 3DV8A 1CJMA 1EFHA 4BYMA 3IPVA 3DYOA 3PFFA 4FLMA 1DUVG 1MEJA 3E0QA 1KO8A 4MARA 4IE7A 4R0MA 2V1UA 1PG2A 4OMFG 3H50A 1OVGA 3EFOA 3PICA 3CXRA 4QUKA 2PJZA 2GYUA 2VNJA 4GT1A 4G1CA 1QHEA 2X13A 2QAGB 5K6RA 4PICA 4XVHA 3C5EA 3C3DA 2FN3A 5AKLA 4R8LA 1RVV1 3SITA 4P9JA 3U0BA 4BVAA 4JJFA 1SULA 5JQGA 1V8PA 5DPMA 2FA9A 3CNEA 3GJ7A 1EFPA 3UG6A 1HRKA 1MRZA 1QTQA 3EPRA 3C4JA 1W1IA 5HKKD 1L7LA 2PT6A 3E22A 1OZ0A 2D1QA 4BX0A 4JBIA 3WG9A 3N76A 3KAQA 1MXFA 1VE6A 1FP4A 4GXLA 2QYTA 3L1HA 3L3BA 1SQFA 2FPSA 2UYYA 4J0QA 3M89A 3G7UA 1ENZA 1WV1A 5FZAA 2B92A 1ENQA 1PR6A 2A5FA 4U2EA 1V9SA 3O0TA 4K7JA 4DG8A 5T5JA 3UB2A 1C8M2 4GLJA 4H4CA 1PQPA 5AKIA 1Z3CA 3IYLW 3CY6A 4LOTA 5IK5A 1SB8A 4JJIA 3NWKA 2C2BA 2VSXA 3FLTA 3ILYA 3E5HA 4PPQA 2C1FA 5K3EA 5D3ZA 3UAZA 2J87A 3BMCA 3PHJA 2ZQ5A 1ETUA 2X8JB 5FUNA 5I8WA 3SEEA 3DVQX 3MRVA 1HSZA 2RBGA 3DT8A 3S44A 3USSA 4DINB 3Q9UA 3DZBA 3PVZA 4GZ3A 3PEUA 3TNYA 3ASVA 4A6EA 2CXSA 3VD7A 3CF4A 3POBA 3QMMA 1JQJC 2FEAA 5IKEA 1K7XB 3E2MA 2VQ6A 1EWKA 1WABA 1LX7A 1W8UA 4WSOA 2P78A 4NU5A 3QELB 5DHFA 2VTEA 4JN6B 1XK7A 3NH9A 2C82A 4DIMA 2C99A 1D07A 3FI0A 3UWPA 2PWBA 3QU4A 2Z30A 3QU9A 4GSKA 1NBEA 4P0QB 1RHUA 2Y6JA 4X1IA 3KTFA 2JGRA 1N2BA 3SK0A 3VDDA 1EV11 2VHYA 1O5OA 3IKVA 1VPLA 2KXLA 3QVXA 1OLMA 4HUJA 1U4SA 1V6CA 2ZJ3A 1TJ5A 1U2SA 4EKEA 1C8KA 1U0SY 421PA 1Z2NX 2V6MA 4QWNA 3GEMA 2IXFA 5EZYF 3IMGA 3WZ2A 1WWKA 3L0DA 4D3WA 1ML3A 3HJNA 3G2LA 1OFTA 1FYDA 4QL3A 4OJMX 3L9XA 4DS0A 3HM2A 2Q0HA 1V5FA 3RSOA 5CVVA 1H2NA 5J3UA 2L9LA 4ZVQA 4GS5A 5K0NA 1ORDA 1XZAA 1RIFA 4Z7JA 4C30A 1D6JA 1BXRA 4YASA 2CHQA 1MPXA 2ZI4A 1XQVA 4N5IX 5DLQC 3ZNPA 2NZ8A 2WG1A 4NAOA 5F7OA 2BV3A 5DT9A 4BMXA 4FMDF 2Y9MB 1ZRNA 1BWRA 3GRPA 3L2HA 2IKQA 1M3SA 2HRBA 3JQ7A 1AF9A 4KODA 4QUDA 3E7XA 3O8LA 4XX1A 4F9EA 4GM4A 2ZKIA 4Z99A 2ZWIA 4HBNA 2Q3BA 1Z2PX 4P8RA 3IA7A 4OIMA 3B9BA 1W8IA 3EHKA 3MIHA 3POSA 2QBYA 1GZ6A 3MLAA 2D1TA 4XUQA 5L9AA 3LWZA 2RI1A 2QDXA 5KYUA 5KNBH 3GNSA 2CHHA 5ARDA 4OHOA 3K53A 1MQSA 1GT6A 1ST8A 5FQ0A 3SCHA 2F3UA 4AVTA 1KOGA 4QMAA 2DCYA 5AFEA 3S0MA 3OCYA 2CFRA 2Y93A 4BFSA 3PI6A 4WKOA 2Q7XA 1HEIA 1P5ZB 3M3DA 3WGYA 5IWCA 5JCOA 4DQKA 7REQB 1LRHA 4S2EA 1BQPA 2ZBUA 3RD5A 4GP9A 1BKYA 4F2PA 2WNVA 3KWFA 3IXQA 2OA2A 5CLFA 2XVMA 1UEXC 1Y9AA 4CL8A 1CT9A 4M53A 4R9NA 4ETWA 4AF8A 1HH4A 4M0NA 4WD3A 4QGNA 4YMUA 5BSFA 4YVWA 5B55A 4DLAA 4ITUA 2VDMB 1TL7C 1O8SA 3QLTA 1V25A 1JZ8A 2ETXA 2YC4C 4YVSA 3R8CA 4MJLA 4YS6A 1FU8A 4CEHB 1D6NA 4MAMA 2Q7OE 3V6MA 2HBZA 3C6YA 1NQ5A 4FT8A 3NAGA 4GECA 1W3VA 3PFHA 4K9OA 3T3PB 1I2ZA 1DIOB 1KDZA 4YM2A 4O4IB 1Z9BA 4LQ4A 2Y60A 5FZMA 1Z4NA 4IW3A 4DLPA 2BHNA 2R4QA 3AIKA 3VPDA 1JYWA 4E5YA 2CUZA 4JYZA 4HDQB 3PDQA 3KOOA 4WVVA 1A5SB 3AH8A 2JI6A 3VHXA 5ALVA 3P1IA 3ITEA 3MTBA 4MUBA 4RIFA 4RVHA 2J4DA 1YFLA 3R7DA 4QBHA 5E7IA 3INGA 2DLDA 1BWPA 5EYYA 5EEGA 1WU7A 3UYJA 1I3LA 4IV3C 3LUJA 1YFWA 1LFDB 2WJYA 2GN6A 1NMZA 1ZCAA 5EHDA 4TKVA 1JLSA 1M2FA 1M0SA 1YVDA 4JP8A 2WD9A 1WA6X 5CFMA 3OLVA 4HLCA 4OGFA 5COBA 2BP6A 2OD7A 4H7MA 2VCCA 2CLCX 4K9MA 4PBSA 3SZGA 1TAGA 3DTVA 1YWKA 4MGKR 4ESHA 1XJCA 4DA8A 1E5HA 1QJFA 3OCZA 2WDZA 1A96A 1RUOA 2P4SA 4IFTA 3Q6IA 1ICEA 1TUBB 1NXD1 5DYWA 2HJGA 4LYFA 1EZ4A 2H5LA 5DXJA 3E5XA 1NVVR 3H5AA 2BKVA 1OTXA 3K3NA 3IQEA 3R44A 5GGYA 2C5EA 1CQJA 1QVAA 4AGGA 3AETA 1J1LA 4CYDA 4PX5A 4JLVA 3FCUB 3VN4A 2NSHA 4Z92B 2CFSA 1ZYUA 3UH1A 1JHZA 4DBLC 1H1TA 3GW8A 1Q17A 4YAIA 4M1YA 2OLKA 2QQNA 4PLPA 1XCPA 2QZPA 1KI9A 3FCYA 1N7HA 1TZOA 1I2CA 3RPEA 3U62A 4LTNA 1W76A 3SGLA 2BNMA 5M0TA 4R84A 3NYWA 3GG2A 1D4AA 2QQWA 5F21A 1XD8A 3ZCPA 4EG4A 4TZ6A 1EK2A 5IN4A 4UDYX 2D8AA 4YW7A 2FSSA 3CVYA 4IDEA 2OO5C 3IDZA 4C04A 2GLUA 4KR2A 3R5XA 3AF2A 2BEJA 2RJNA 1KP9A 2W2PA 1SVIA 2ZGTA 5FZ4A 2ZJ7A 4MV5A 4JL6A 2G06A 3HAGA 5FA5A 1E9CA 1E8DA 4LMFA