4K7XA

Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
314
structure length
314
Chain Sequence
YFQSMMKRIQIIDSHTGGEPTRLVVSGFPSLGSGTMAERRDVLAREYDRYRTACILEPRGSDVLVGALLCEPVSPDAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMGRIGPGVHRIETPVGTVEATLHDDLSVSVRNVLAYRHAKDVALDVPGYGPVRGDIAWGGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAPGAVWRQASVIGSVFHASYVQAEGGIVPTIRGSAHLSAEATLLIEDDDPFRWGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline racemase
publication title Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains
rcsb
source organism Burkholderia multivorans
molecule tags Lyase
total genus 79
structure length 314
sequence length 314
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k7xA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k7xA01
4J9WA 4K8LA 2AZPA 1SDJA 5M47A 1U1VA 4IJZA 1YM5A 4JCIA 3G7KA 1U1WA 4LB0A 1W62A 3FVEA 2PVZA 4Q60A 4Q2HA 1U0KA 1S7JA 4JUUA 5H2GA 4DUNA 1GQZA 1TM0A 1BWZA 2GKEA 1T6KA 5IWEA 1QYAA 1XUBA 4IK0A 4J9XA 4JD7A 4JBDA 1W61A 2OTNA 2H9FA 1U1XA 3EKMA 3EJXA 4K7GB 5HA4A 2Q9HA 2GKJA 2PW0A 3EDNA 5H2YA 1XUAA 1QY9A 4K7XA 2Q9JA
chains in the Genus database with same CATH superfamily
3G7KA 4LB0A 1W62A 3G98A 1TM0A 1BWZA 2GKEA 1T6KA 1QYAA 4JBDA 3EDNA 4K7XA 4PY9A 4JUUA 1S7JA 5H2GA 2EB0A 1GQZA 2ZVFA 4DUNA 3PVHA 1WPMA 4J9XA 2HAWA 4LG3A 1W61A 2LT2A 2H9FA 1U1XA 2QB6A 3EJXA 4K7GB 5HA4A 1K20A 3ICJA 5H2YA 1XUAA 1QY9A 2KW7A 4RPAA 4J9WA 4K8LA 1IR6A 1SDJA 5M47A 1YM5A 2QB8A 4Q60A 2YMAA 4Q2HA 1I74A 1WPPA 4LS9A 3WQZA 5IWEA 4IK0A 4JD7A 3W5WA 1K23A 3IGHX 3PTJA 2Q9HA 2AZPA 2IW4A 5ANPA 1U1VA 4JCIA 2KPTA 1U1WA 3FVEA 2PVZA 1U0KA 2ZXRA 2ZXOA 3DEVA 4GL6A 4OA3A 1XUBA 2ENXA 2OTNA 2QB7A 2Q9JA 2MPBA 3EKMA 2GKJA 2PW0A 3PW9A 4IJZA 2ZXPA
chains in the Genus database with same CATH topology
3G7KA 4LB0A 1W62A 3G98A 1TM0A 1BWZA 2GKEA 1T6KA 1QYAA 4JBDA 3EDNA 4K7XA 4PY9A 4JUUA 1S7JA 5H2GA 2EB0A 1GQZA 2ZVFA 4DUNA 3PVHA 1WPMA 4J9XA 2HAWA 4LG3A 1W61A 2LT2A 2H9FA 1U1XA 2QB6A 3EJXA 4K7GB 5HA4A 1K20A 3ICJA 5H2YA 1XUAA 1QY9A 2KW7A 4RPAA 4J9WA 4K8LA 1IR6A 1SDJA 5M47A 1YM5A 2QB8A 4Q60A 2YMAA 4Q2HA 1I74A 1WPPA 4LS9A 3WQZA 5IWEA 4IK0A 4JD7A 3W5WA 1K23A 3IGHX 3PTJA 2Q9HA 2AZPA 2IW4A 5ANPA 1U1VA 4JCIA 2KPTA 1U1WA 3FVEA 2PVZA 1U0KA 2ZXRA 2ZXOA 3DEVA 4GL6A 4OA3A 1XUBA 2ENXA 2OTNA 2QB7A 2Q9JA 2MPBA 3EKMA 2GKJA 2PW0A 3PW9A 4IJZA 2ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9W A;  4K8L A;  2AZP A;  1SDJ A;  5M47 A;  1U1V A;  4IJZ A;  1YM5 A;  4JCI A;  3G7K A;  1U1W A;  4LB0 A;  1W62 A;  3FVE A;  2PVZ A;  4Q60 A;  4Q2H A;  1U0K A;  1S7J A;  4JUU A;  5H2G A;  4DUN A;  1GQZ A;  1TM0 A;  1BWZ A;  2GKE A;  1T6K A;  5IWE A;  1QYA A;  1XUB A;  4IK0 A;  4J9X A;  4JD7 A;  4JBD A;  1W61 A;  2OTN A;  2H9F A;  1U1X A;  3EKM A;  3EJX A;  4K7G B;  5HA4 A;  2Q9H A;  2GKJ A;  2PW0 A;  3EDN A;  5H2Y A;  1XUA A;  1QY9 A;  4K7X A;  2Q9J A; 
#chains in the Genus database with same CATH topology
 3G7K A;  4LB0 A;  1W62 A;  3G98 A;  1TM0 A;  1BWZ A;  2GKE A;  1T6K A;  1QYA A;  4JBD A;  3EDN A;  4K7X A;  4PY9 A;  4JUU A;  1S7J A;  5H2G A;  2EB0 A;  1GQZ A;  2ZVF A;  4DUN A;  3PVH A;  1WPM A;  4J9X A;  2HAW A;  4LG3 A;  1W61 A;  2LT2 A;  2H9F A;  1U1X A;  2QB6 A;  3EJX A;  4K7G B;  5HA4 A;  1K20 A;  3ICJ A;  5H2Y A;  1XUA A;  1QY9 A;  2KW7 A;  4RPA A;  4J9W A;  4K8L A;  1IR6 A;  1SDJ A;  5M47 A;  1YM5 A;  2QB8 A;  4Q60 A;  2YMA A;  4Q2H A;  1I74 A;  1WPP A;  4LS9 A;  3WQZ A;  5IWE A;  4IK0 A;  4JD7 A;  3W5W A;  1K23 A;  3IGH X;  3PTJ A;  2Q9H A;  2AZP A;  2IW4 A;  5ANP A;  1U1V A;  4JCI A;  2KPT A;  1U1W A;  3FVE A;  2PVZ A;  1U0K A;  2ZXR A;  2ZXO A;  3DEV A;  4GL6 A;  4OA3 A;  1XUB A;  2ENX A;  2OTN A;  2QB7 A;  2Q9J A;  2MPB A;  3EKM A;  2GKJ A;  2PW0 A;  3PW9 A;  4IJZ A;  2ZXP A; 
#chains in the Genus database with same CATH homology
 3G7K A;  4LB0 A;  1W62 A;  3G98 A;  1TM0 A;  1BWZ A;  2GKE A;  1T6K A;  1QYA A;  4JBD A;  3EDN A;  4K7X A;  4PY9 A;  4JUU A;  1S7J A;  5H2G A;  2EB0 A;  1GQZ A;  2ZVF A;  4DUN A;  3PVH A;  1WPM A;  4J9X A;  2HAW A;  4LG3 A;  1W61 A;  2LT2 A;  2H9F A;  1U1X A;  2QB6 A;  3EJX A;  4K7G B;  5HA4 A;  1K20 A;  3ICJ A;  5H2Y A;  1XUA A;  1QY9 A;  2KW7 A;  4RPA A;  4J9W A;  4K8L A;  1IR6 A;  1SDJ A;  5M47 A;  1YM5 A;  2QB8 A;  4Q60 A;  2YMA A;  4Q2H A;  1I74 A;  1WPP A;  4LS9 A;  3WQZ A;  5IWE A;  4IK0 A;  4JD7 A;  3W5W A;  1K23 A;  3IGH X;  3PTJ A;  2Q9H A;  2AZP A;  2IW4 A;  5ANP A;  1U1V A;  4JCI A;  2KPT A;  1U1W A;  3FVE A;  2PVZ A;  1U0K A;  2ZXR A;  2ZXO A;  3DEV A;  4GL6 A;  4OA3 A;  1XUB A;  2ENX A;  2OTN A;  2QB7 A;  2Q9J A;  2MPB A;  3EKM A;  2GKJ A;  2PW0 A;  3PW9 A;  4IJZ A;  2ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...