4K7XA

Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
314
structure length
314
Chain Sequence
YFQSMMKRIQIIDSHTGGEPTRLVVSGFPSLGSGTMAERRDVLAREYDRYRTACILEPRGSDVLVGALLCEPVSPDAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMGRIGPGVHRIETPVGTVEATLHDDLSVSVRNVLAYRHAKDVALDVPGYGPVRGDIAWGGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAPGAVWRQASVIGSVFHASYVQAEGGIVPTIRGSAHLSAEATLLIEDDDPFRWGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains
rcsb
source organism Burkholderia multivorans
molecule tags Lyase
molecule keywords Proline racemase
total genus 79
structure length 314
sequence length 314
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k7xA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k7xA01
1U1WA 3G7KA 5HA4A 1BWZA 5M47A 4JCIA 3EKMA 2Q9HA 4IK0A 1GQZA 2GKJA 1TM0A 2GKEA 4IJZA 1W62A 1QYAA 1SDJA 4JUUA 1XUAA 4LB0A 4Q60A 4J9WA 5H2YA 5IWEA 4DUNA 3EJXA 4K8LA 5H2GA 4JD7A 3EDNA 4Q2HA 1XUBA 2Q9JA 2H9FA 4JBDA 3FVEA 2PW0A 1U1VA 2OTNA 1QY9A 1U1XA 1U0KA 2AZPA 4J9XA 1T6KA 1W61A 4K7GB 4K7XA 1YM5A 1S7JA 2PVZA
chains in the Genus database with same CATH superfamily
1U1WA 1WPMA 4IK0A 2GKJA 1W62A 1QYAA 4JUUA 1XUAA 4RPAA 4Q60A 5H2YA 1I74A 5H2GA 2H9FA 3FVEA 2QB6A 2EB0A 1U1XA 3G7KA 1WPPA 5HA4A 4JCIA 2Q9HA 2GKEA 1SDJA 2IW4A 3IGHX 3EJXA 1IR6A 1XUBA 2HAWA 2QB7A 4PY9A 2KW7A 2YMAA 2OTNA 1QY9A 1K20A 2ZXPA 1K23A 2QB8A 4IJZA 1YM5A 2KPTA 3DEVA 1S7JA 5M47A 1GQZA 2MPBA 4LG3A 3PTJA 4LB0A 4J9WA 3ICJA 4DUNA 4K8LA 4JD7A 2Q9JA 3PVHA 1U1VA 1U0KA 1W61A 3WQZA 1BWZA 3EKMA 2ZVFA 1TM0A 2ZXOA 2LT2A 3W5WA 3PW9A 5IWEA 4OA3A 2ENXA 3EDNA 2ZXRA 4Q2HA 4JBDA 4LS9A 2PW0A 3G98A 4GL6A 2AZPA 4J9XA 1T6KA 4K7GB 4K7XA 5ANPA 2PVZA
chains in the Genus database with same CATH topology
1U1WA 1WPMA 4IK0A 2GKJA 1W62A 1QYAA 4JUUA 1XUAA 4RPAA 4Q60A 5H2YA 1I74A 5H2GA 2H9FA 3FVEA 2QB6A 2EB0A 1U1XA 3G7KA 1WPPA 5HA4A 4JCIA 2Q9HA 2GKEA 1SDJA 2IW4A 3IGHX 3EJXA 1IR6A 1XUBA 2HAWA 2QB7A 4PY9A 2KW7A 2YMAA 2OTNA 1QY9A 1K20A 2ZXPA 1K23A 2QB8A 4IJZA 1YM5A 2KPTA 3DEVA 1S7JA 5M47A 1GQZA 2MPBA 4LG3A 3PTJA 4LB0A 4J9WA 3ICJA 4DUNA 4K8LA 4JD7A 2Q9JA 3PVHA 1U1VA 1U0KA 1W61A 3WQZA 1BWZA 3EKMA 2ZVFA 1TM0A 2ZXOA 2LT2A 3W5WA 3PW9A 5IWEA 4OA3A 2ENXA 3EDNA 2ZXRA 4Q2HA 4JBDA 4LS9A 2PW0A 3G98A 4GL6A 2AZPA 4J9XA 1T6KA 4K7GB 4K7XA 5ANPA 2PVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U1W A;  3G7K A;  5HA4 A;  1BWZ A;  5M47 A;  4JCI A;  3EKM A;  2Q9H A;  4IK0 A;  1GQZ A;  2GKJ A;  1TM0 A;  2GKE A;  4IJZ A;  1W62 A;  1QYA A;  1SDJ A;  4JUU A;  1XUA A;  4LB0 A;  4Q60 A;  4J9W A;  5H2Y A;  5IWE A;  4DUN A;  3EJX A;  4K8L A;  5H2G A;  4JD7 A;  3EDN A;  4Q2H A;  1XUB A;  2Q9J A;  2H9F A;  4JBD A;  3FVE A;  2PW0 A;  1U1V A;  2OTN A;  1QY9 A;  1U1X A;  1U0K A;  2AZP A;  4J9X A;  1T6K A;  1W61 A;  4K7G B;  4K7X A;  1YM5 A;  1S7J A;  2PVZ A; 
#chains in the Genus database with same CATH topology
 1U1W A;  1WPM A;  4IK0 A;  2GKJ A;  1W62 A;  1QYA A;  4JUU A;  1XUA A;  4RPA A;  4Q60 A;  5H2Y A;  1I74 A;  5H2G A;  2H9F A;  3FVE A;  2QB6 A;  2EB0 A;  1U1X A;  3G7K A;  1WPP A;  5HA4 A;  4JCI A;  2Q9H A;  2GKE A;  1SDJ A;  2IW4 A;  3IGH X;  3EJX A;  1IR6 A;  1XUB A;  2HAW A;  2QB7 A;  4PY9 A;  2KW7 A;  2YMA A;  2OTN A;  1QY9 A;  1K20 A;  2ZXP A;  1K23 A;  2QB8 A;  4IJZ A;  1YM5 A;  2KPT A;  3DEV A;  1S7J A;  5M47 A;  1GQZ A;  2MPB A;  4LG3 A;  3PTJ A;  4LB0 A;  4J9W A;  3ICJ A;  4DUN A;  4K8L A;  4JD7 A;  2Q9J A;  3PVH A;  1U1V A;  1U0K A;  1W61 A;  3WQZ A;  1BWZ A;  3EKM A;  2ZVF A;  1TM0 A;  2ZXO A;  2LT2 A;  3W5W A;  3PW9 A;  5IWE A;  4OA3 A;  2ENX A;  3EDN A;  2ZXR A;  4Q2H A;  4JBD A;  4LS9 A;  2PW0 A;  3G98 A;  4GL6 A;  2AZP A;  4J9X A;  1T6K A;  4K7G B;  4K7X A;  5ANP A;  2PVZ A; 
#chains in the Genus database with same CATH homology
 1U1W A;  1WPM A;  4IK0 A;  2GKJ A;  1W62 A;  1QYA A;  4JUU A;  1XUA A;  4RPA A;  4Q60 A;  5H2Y A;  1I74 A;  5H2G A;  2H9F A;  3FVE A;  2QB6 A;  2EB0 A;  1U1X A;  3G7K A;  1WPP A;  5HA4 A;  4JCI A;  2Q9H A;  2GKE A;  1SDJ A;  2IW4 A;  3IGH X;  3EJX A;  1IR6 A;  1XUB A;  2HAW A;  2QB7 A;  4PY9 A;  2KW7 A;  2YMA A;  2OTN A;  1QY9 A;  1K20 A;  2ZXP A;  1K23 A;  2QB8 A;  4IJZ A;  1YM5 A;  2KPT A;  3DEV A;  1S7J A;  5M47 A;  1GQZ A;  2MPB A;  4LG3 A;  3PTJ A;  4LB0 A;  4J9W A;  3ICJ A;  4DUN A;  4K8L A;  4JD7 A;  2Q9J A;  3PVH A;  1U1V A;  1U0K A;  1W61 A;  3WQZ A;  1BWZ A;  3EKM A;  2ZVF A;  1TM0 A;  2ZXO A;  2LT2 A;  3W5W A;  3PW9 A;  5IWE A;  4OA3 A;  2ENX A;  3EDN A;  2ZXR A;  4Q2H A;  4JBD A;  4LS9 A;  2PW0 A;  3G98 A;  4GL6 A;  2AZP A;  4J9X A;  1T6K A;  4K7G B;  4K7X A;  5ANP A;  2PVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...