4K7XA

Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
314
structure length
314
Chain Sequence
YFQSMMKRIQIIDSHTGGEPTRLVVSGFPSLGSGTMAERRDVLAREYDRYRTACILEPRGSDVLVGALLCEPVSPDAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMGRIGPGVHRIETPVGTVEATLHDDLSVSVRNVLAYRHAKDVALDVPGYGPVRGDIAWGGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAPGAVWRQASVIGSVFHASYVQAEGGIVPTIRGSAHLSAEATLLIEDDDPFRWGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains
rcsb
source organism Burkholderia multivorans
molecule tags Lyase
molecule keywords Proline racemase
total genus 79
structure length 314
sequence length 314
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k7xA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k7xA01
4K7GB 3G7KA 1W62A 4J9XA 4JBDA 4JUUA 5IWEA 2AZPA 1BWZA 2GKJA 1S7JA 1QYAA 4LB0A 4Q2HA 1U0KA 2PVZA 4IK0A 3FVEA 1T6KA 1U1VA 1YM5A 3EDNA 5HA4A 2Q9HA 1W61A 5M47A 2OTNA 2GKEA 4K8LA 4K7XA 1TM0A 4IJZA 4JCIA 2Q9JA 1U1WA 4Q60A 1QY9A 1SDJA 1U1XA 2H9FA 4J9WA 4DUNA 5H2GA 1GQZA 1XUAA 1XUBA 3EKMA 3EJXA 2PW0A 5H2YA 4JD7A
chains in the Genus database with same CATH superfamily
2QB7A 2GKJA 1K23A 2EB0A 4Q2HA 1U1VA 3EDNA 4PY9A 2Q9HA 4IJZA 2Q9JA 4LS9A 2ZXRA 2YMAA 2QB6A 1QY9A 1K20A 1WPPA 3G98A 3PW9A 5H2GA 3WQZA 2MPBA 1XUAA 1IR6A 4JBDA 4J9XA 1QYAA 2KW7A 1T6KA 2KPTA 1W61A 2OTNA 4GL6A 1TM0A 4JCIA 2ZXOA 2ZVFA 1SDJA 1U1XA 4J9WA 2ENXA 3DEVA 3EKMA 4JD7A 2QB8A 4K7GB 3G7KA 1W62A 4JUUA 2AZPA 1S7JA 1U0KA 2PVZA 1YM5A 2IW4A 5HA4A 1WPMA 5M47A 2GKEA 4K7XA 4OA3A 2HAWA 3ICJA 1I74A 2ZXPA 1XUBA 4LB0A 3EJXA 3IGHX 5IWEA 5ANPA 1BWZA 2LT2A 4IK0A 3FVEA 4LG3A 4K8LA 1U1WA 4Q60A 3W5WA 3PTJA 2H9FA 4DUNA 3PVHA 1GQZA 4RPAA 2PW0A 5H2YA
chains in the Genus database with same CATH topology
2QB7A 2GKJA 1K23A 2EB0A 4Q2HA 1U1VA 3EDNA 4PY9A 2Q9HA 4IJZA 2Q9JA 4LS9A 2ZXRA 2YMAA 2QB6A 1QY9A 1K20A 1WPPA 3G98A 3PW9A 5H2GA 3WQZA 2MPBA 1XUAA 1IR6A 4JBDA 4J9XA 1QYAA 2KW7A 1T6KA 2KPTA 1W61A 2OTNA 4GL6A 1TM0A 4JCIA 2ZXOA 2ZVFA 1SDJA 1U1XA 4J9WA 2ENXA 3DEVA 3EKMA 4JD7A 2QB8A 4K7GB 3G7KA 1W62A 4JUUA 2AZPA 1S7JA 1U0KA 2PVZA 1YM5A 2IW4A 5HA4A 1WPMA 5M47A 2GKEA 4K7XA 4OA3A 2HAWA 3ICJA 1I74A 2ZXPA 1XUBA 4LB0A 3EJXA 3IGHX 5IWEA 5ANPA 1BWZA 2LT2A 4IK0A 3FVEA 4LG3A 4K8LA 1U1WA 4Q60A 3W5WA 3PTJA 2H9FA 4DUNA 3PVHA 1GQZA 4RPAA 2PW0A 5H2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7G B;  3G7K A;  1W62 A;  4J9X A;  4JBD A;  4JUU A;  5IWE A;  2AZP A;  1BWZ A;  2GKJ A;  1S7J A;  1QYA A;  4LB0 A;  4Q2H A;  1U0K A;  2PVZ A;  4IK0 A;  3FVE A;  1T6K A;  1U1V A;  1YM5 A;  3EDN A;  5HA4 A;  2Q9H A;  1W61 A;  5M47 A;  2OTN A;  2GKE A;  4K8L A;  4K7X A;  1TM0 A;  4IJZ A;  4JCI A;  2Q9J A;  1U1W A;  4Q60 A;  1QY9 A;  1SDJ A;  1U1X A;  2H9F A;  4J9W A;  4DUN A;  5H2G A;  1GQZ A;  1XUA A;  1XUB A;  3EKM A;  3EJX A;  2PW0 A;  5H2Y A;  4JD7 A; 
#chains in the Genus database with same CATH topology
 2QB7 A;  2GKJ A;  1K23 A;  2EB0 A;  4Q2H A;  1U1V A;  3EDN A;  4PY9 A;  2Q9H A;  4IJZ A;  2Q9J A;  4LS9 A;  2ZXR A;  2YMA A;  2QB6 A;  1QY9 A;  1K20 A;  1WPP A;  3G98 A;  3PW9 A;  5H2G A;  3WQZ A;  2MPB A;  1XUA A;  1IR6 A;  4JBD A;  4J9X A;  1QYA A;  2KW7 A;  1T6K A;  2KPT A;  1W61 A;  2OTN A;  4GL6 A;  1TM0 A;  4JCI A;  2ZXO A;  2ZVF A;  1SDJ A;  1U1X A;  4J9W A;  2ENX A;  3DEV A;  3EKM A;  4JD7 A;  2QB8 A;  4K7G B;  3G7K A;  1W62 A;  4JUU A;  2AZP A;  1S7J A;  1U0K A;  2PVZ A;  1YM5 A;  2IW4 A;  5HA4 A;  1WPM A;  5M47 A;  2GKE A;  4K7X A;  4OA3 A;  2HAW A;  3ICJ A;  1I74 A;  2ZXP A;  1XUB A;  4LB0 A;  3EJX A;  3IGH X;  5IWE A;  5ANP A;  1BWZ A;  2LT2 A;  4IK0 A;  3FVE A;  4LG3 A;  4K8L A;  1U1W A;  4Q60 A;  3W5W A;  3PTJ A;  2H9F A;  4DUN A;  3PVH A;  1GQZ A;  4RPA A;  2PW0 A;  5H2Y A; 
#chains in the Genus database with same CATH homology
 2QB7 A;  2GKJ A;  1K23 A;  2EB0 A;  4Q2H A;  1U1V A;  3EDN A;  4PY9 A;  2Q9H A;  4IJZ A;  2Q9J A;  4LS9 A;  2ZXR A;  2YMA A;  2QB6 A;  1QY9 A;  1K20 A;  1WPP A;  3G98 A;  3PW9 A;  5H2G A;  3WQZ A;  2MPB A;  1XUA A;  1IR6 A;  4JBD A;  4J9X A;  1QYA A;  2KW7 A;  1T6K A;  2KPT A;  1W61 A;  2OTN A;  4GL6 A;  1TM0 A;  4JCI A;  2ZXO A;  2ZVF A;  1SDJ A;  1U1X A;  4J9W A;  2ENX A;  3DEV A;  3EKM A;  4JD7 A;  2QB8 A;  4K7G B;  3G7K A;  1W62 A;  4JUU A;  2AZP A;  1S7J A;  1U0K A;  2PVZ A;  1YM5 A;  2IW4 A;  5HA4 A;  1WPM A;  5M47 A;  2GKE A;  4K7X A;  4OA3 A;  2HAW A;  3ICJ A;  1I74 A;  2ZXP A;  1XUB A;  4LB0 A;  3EJX A;  3IGH X;  5IWE A;  5ANP A;  1BWZ A;  2LT2 A;  4IK0 A;  3FVE A;  4LG3 A;  4K8L A;  1U1W A;  4Q60 A;  3W5W A;  3PTJ A;  2H9F A;  4DUN A;  3PVH A;  1GQZ A;  4RPA A;  2PW0 A;  5H2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...