4K81A

Crystal structure of the grb14 ra and ph domains in complex with gtp-loaded h-ras
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
251
structure length
244
Chain Sequence
KKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSAAPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 14
publication title Structural basis for the interaction of the adaptor protein grb14 with activated ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 244
sequence length 251
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4k81A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4k81A01
1WYWB 1ZGUB 4M8NA 1U5FA 3QIJA 3RCZA 1P98A 5DPTA 2N1WA 3QC8B 4I6LB 4F7UP 2DKPA 4BKSA 2Z0DB 3BJIA 2YS1A 3WA0A 4A6HA 2M1MA 2ZEQA 5J17A 4KV2A 2OTXA 5D94A 4B95A 4HCNB 3NHEB 1YQBA 4WVFB 4XX5A 4IWPA 2FCMA 5DHAB 2RLOA 2NCNA 2LVOA 3QK0A 1EAZA 2IFSA 2D11A 3PVWA 4W9FA 4BKGA 4KVGB 1PFJA 3UQBA 1DDVA 2IO2B 3ODWA 1FOEA 5JHGA 2LULA 3PLUA 1LM8B 3W1SA 3DXDA 4WWPA 2KDBA 5DPRA 4GDKA 2W9NA 4MGYE 2O2VB 2ZZPB 2DZKA 2KUPA 3NS8A 4FHJA 3PHXB 1M7RA 1Q67A 1MIZB 2JP2A 1WGRA 1IPGA 1WM2A 2KVRA 3DVGY 4Z2NA 4DXAB 1X86A 3IBEA 1P9DU 1V2YA 3X0WA 1V5TA 2CHXA 2IO0B 1UH6A 1V5OA 2LASA 2L2IA 3SNHA 1E7VA 4OVUA 1RRPB 4II3B 4GOCA 1RLFA 4LDTD 2MBHA 2KLGA 3SYXA 2ZPNA 3IFWB 4IUMB 2BYVE 1I7AA 4G0NB 4MJSB 3TVVA 1V80A 2LRUA 1KI1B 3QQ8B 2AEHA 2BWFA 5LXHA 2EJ8A 4EJNA 3M95A 1GNUA 1WXSA 4W9EA 2MBBB 2BYEA 2Z0PA 3APDA 3DBSA 3K9OB 3SD5A 5EDSA 1MK9B 3PSEB 3ZW3A 1QZEA 2C7HA 3UINB 1ZC3B 4Y94A 3RUIB 4BOZB 2DHKA 3N7CA 1NTYA 1VCBA 1EUVB 4GB9A 4BBNC 3TCAA 2Y7BA 3ML9A 2ZNVB 1EGXA 4PQ0A 2AWTA 2IY0B 2COAA 3A1QA 3KYCD 1FAOA 3B1LX 4A6KA 2J0MA 5KCVA 4BVUC 4HLEA 2XBBC 3EECA 4GGQA 3H9DA 1AARA 1J0GA 3DBLI 4CHMA 3R7QA 4KHOA 4YL8A 3VAWA 2N9EB 3N3KB 1GG3A 2JT4B 5DI9B 5D3XA 2KMAA 5IA7A 4HCPB 4GN1A 2RR9A 4E74A 2ZCBA 5L81A 4G3XB 2RVBB 2JXXA 2K6DB 5KHQA 4TQ0A 5E6PA 3WAMA 1Y19B 4HDOA 1UGMA 1IYFA 5HE2A 2LJ5A 3KSYA 1KJTA 2O2VA 1CMXB 4N9F4 1L2NA 4KZ0A 4RM9A 3VVWB 1E8YA 2EKEC 1ZKHA 4K7WA 2JRIB 2WWZA 2V3SA 3ENEA 4JQWC 5HKHA 4KHBB 1ZVRA 1H8CA 2DHJA 2VKIA 1V5PA 3A9KB 1UNQA 2RGNB 2YRYA 1QC6A 4DWFA 3I3TB 1I2HA 2JF5A 4KDLB 3DCGA 1UD7A 2XQNM 5JHAA 3L08A 3KH0A 4BFRA 4W9GA 5G55A 1EO6A 4JL9A 1U5EA 4M8MA 2N7DA 3JW0X 5L83A 2CY5A 2LOXA 1WGUA 2CS4A 1U5DA 2ROVA 3O96A 2LOZA 4ZYNA 3ALBA 3ZVVA 3WANA 2MBEA 4AP4C 3CMMB 1NBFC 1J8CA 2RSGA 2FJLA 4HJKA 1LW3A 2RD0A 4A20A 3RYTA 3VXWA 4W9JA 4PYUA 2LYDA 3RCPA 4ANVA 3IG3A 2WX0A 2MRPA 2M4NA 3PS6A 5GMVA 4EZKA 3DXEA 3PV1A 1T0YA 2LVPA 2NVUI 4ZDVA 2RSUA 1P3RA 1WI0A 4DK5A 2K2JA 3X23A 2FCSA 1V9JA 5L95C 1WMHB 1ZW7A 2L76A 3SO6A 5AEKB 4GXBA 2VSZA 2COCA 3NZUA 3T06A 2KTRB 2E2XA 3V61A 2Q13A 3MDBC 1V5MA 2LG1A 2UYZB 2G3QB 1V86A 4MSQB 2MSED 3ULCA 2GMIC 4LDTB 4TQ1A 4PYZA 2N0YA 3KUCB 2KDEB 4ICVA 4HHVA 1MAIA 2D9ZA 4HVBA 2CAYA 1E7UA 3AU4A 2CY4A 4BOSC 5DH9B 1AWEA 4I6PA 4LJOB 1GC7A 2KJHB 1M94A 2L1CA 4ICUA 2N7EA 5LLIA 2MX2A 2QHOA 3QX1A 3FSSA 1TBEA 4IM3A 1OQYA 1N3HA 2KFJA 2G45B 4GU2A 4NPNA 3PSCA 3L0WB 1UZXB 2VRRB 4WJ7A 2CU1A 4MH0E 3PLVA 1PQSA 1W1HA 2CHZA 4W9HA 3VH4B 1RFAA 3ZVRA 2J0JA 3RULA 2C7NB 3H7PA 3A9KA 1Y5OA 3VQIA 1AQCA 3WIMA 4ANUA 2LVQA 4GDLA 3TIXA 2MLBA 3T8MA 2KDIA 4GZUA 4RMAA 2BYFA 5LXIB 1XKEA 5TR5A 1KOTA 4MSMB 2K6QA 1RRBA 2J0KA 3WAOA 4WQOB 4DX90 2H7DA 4FJVB 1KM7A 1J19A 2ZCCA 5C6RA 2P8VA 4B6HA 1SGHA 5J3QA 2MWNB 2KK8A 4ZRJA 3VTVA 3PRZA 4I6NB 3ZDMC 2KX3A 4L6EA 1UBQA 3SHQA 3HM3A 1MIXA 4K81A 4F7ZA 3QCAA 3B08A 4TKNA 4EFOA 5FR6A 2D07B 1WXAA 1OEYA 2JY6A 2MKRA 2JUOA 3ZKJC 5CHWA 4II2B 1R4NI 3TJPA 3OAWA 2KC1A 2DFKA 3VDZA 3ZNZB 4MY6A 3GZNI 3OJ4B 2AYOB 5BO4B 1KLVA 1WJ6A 1WMHA 3NOBA 2L0TA 3TMPB 2DYNA 3VFKA 2I1KA 2BKRB 3HM6X 1UPQA 3D32A 1P3QU 1IRSA 2KTRA 2VRWB 2JZ3B 5C5BA 4NAWB 2GS0A 2MWSB 2NPTB 2ZNVC 2HE7A 2R2OA 3RD2A 1WJ1A 4BBKA 3KUDB 4NQLB 2L8JA 4W9CA 2L05A 2KOXA 1OMWA 2FUHB 3SDLC 3H6NA 2DYQA 2PE9A 2G4SA 2KO3A 4K7SA 1WF9A 1U27A 4NSWA 2ELBA 1K8RB 4DHJD 3DPDA 1R4MI 2IYDB 2BCJA 3D8DA 1WGYA 1L7YA 3F5RA 1S3SG 2I5CA 2D9YA 1XD4A 2DAFA 3ODXA 2YS3A 1V88A 3DVNU 4GMVA 2HJ8A 3ZRFA 5HE0A 5KQ4A 1WIAA 4FJZA 3ZUNA 2M17A 4W9KA 1U29A 1BAKA 3ZTCA 3EFUA 4B9KA 2ZPYA 2DZJA 4G50A 2K2UA 1UELA 2NZ8B 2KCJA 1Z5SB 2GBNA 2D4QA 3ZNGC 3FM8C 2M38A 2R09A 5DHFB 2H7EA 4IW0A 1U5GA 1W1GA 2LXCA 3IVFA 3PVLA 1WG7A 4AJYB 3P7ZA 1TZ1A 3CXBB 3S2AA 4AJWA 2C5LC 4TV3A 2JRHA 3VOQA 1E8ZA 2KN5A 3NZSA 3V62A 3LJUX 4K1RB 1JRUA 1E90A 1RAXA 1V81A 5LONB 3A9JB 2K25A 4HAYB 5J2RA 4FHKA 2Z0QA 2DKQA 3VHTC 1WGQA 2M14A 3VUXA 2YSZA 5D3WA 2RNRB 2ASQA 1E8XA 2FIFA 2DHIA 1WXVA 1X1MA 2CRFA 1BTKA 5AZFA 3VUYA 1FB8A 1WE6A 4KZCA 1WGHA 3P2BA 1FHWA 1GUAB 3R7RA 2DX5B 2YT0A 1WX7A 2D10A 1WRDB 5J3TA 4M0WB 3V60A 1Y8RC 2N1VA 4HAWB 4JLCA 4W9DA 3F0WA 4P7IA 3TW1A 2W2XD 2FCNA 2NR2A 4WJPA 2OQBA 2WYQA 5KQ1A 2LGXA 2M8SA 4NAWA 2OOBB 5JHHA 1X1FA 3JVZX 2ELAA 1YD8U 2D9XA 2L7RA 2NPTA 2FAZA 2KWVB 3FEHA 2DAJA 2P0HA 2DYMA 1UPRA 3W1YA 2JVCA 3H7PB 2MBOA 1P5TA 1ZC4B 2KX0A 2HTHB 5D6JB 3PVUA 2G4DB 4GDLB 4EOYA 4NQKE 1WGGA 3SUZA 2R0DA 2J59M 3ZNHB 4IM0A 4XWXA 2WDTB 1EF1A 3L17A 1G6JA 1DROA 4FADA 2I1JA 4IC7B 4KSLC 3N30A 2UZRA 2QKLA 3P6AA 2BKFA 4HB2B 5CLQB 4DBGA 5D2MB 5G2NA 2LUEA 2CODA 4J6IA 3PG7A 2KGXB 1VD2A 3TL5A 3QA8A 4F7HA 2PE6B 1NTVA 2UVMA 1PMSA 2P0FA 4EKUA 4W9LA 1X05A 4JIOU 1K5DB 5CX3A 1Z2MA 4GPTB 3MJWA 5FI0A 5D3VA 2Z59B 2O6VD 4B6WA 2BPSA 3RZFA 2GJYA 2AL3A 3HIZA 1WZ0A 3QJZA 3DBHI 3VUWA 4A5KA 1V61A 4WWNA 2LWPA 1Q1OA 3U7DA 2L3ZA 3ZDTA 4XZ4A 5D3YA 4F7GA 2BGFA 2I5FA 1MK7B 4HATB 3HHMA 3A9JA 4MGIE 4PNKA 3MTNB 2N4FA 4IWQA 3QBVB 3Q3FA 1WJNA 3D8EA 2YF0A 1P0RA 5C5BB 2DHZA 4DHJB 2AL6A 2PPHA 1M7EA 1V89A 3D8FA 2IO3B 4EEWA 2D2QA 2IY1B 3AJ4A 1FGYA 2X18A 2KFKB 3AXCA 1WFYA 2CKHB 3ML8A 1HE8A 3EC8A 2HD5B 2KNBA 3ML4A 3ZIMA 2DX5A 2CR5A 5JH5C 1FGZA 1WM3A 1WJ4A 1TTNA 2DA0A 3PRMB 5DPSA 3M63B 1GC6A 1NI2A 2Z0OA 4E3CA 3PEGA 3Q3JA 2EC1A 1B55A 2CHWA 1J0WA 4OVVA 4FJYA 4DDGD 1EVHA 1WY8A 2LXAA 4RM8A 3KYDD 4WJQA 4IWOA 4KHAA 5HE3A 2XK5B 2D9WA 3ULBA 5J3YA 2KLCA 2W2XC 4FULA 4KSKC 2D3GA 4ZRKA 4K2PA 2HTHA 2A5UA 1P1AA 4KDIC 2ROZB 1H4RA 2MQJA 3UGBB 5DPWA 2ZJDA 4E71A 1QQGA 5C16A 2V1YA 3QAQA 4K7UA 3VTWA 2ADZA 2ZVNA 3OANA 1OQNA 1TQZA 3KW5B 4LJPB 2R2QA 3DXCA 1DDMA 4MK0A 3H7SA 1TGZB 4X57B 2RPQA 2MCNB 3M3JA 4MGZE 4CHJA 2J7QB 2DX1A 2COFA 3PREA 5E6NA 1MPHA 3HW2B 2JZZA 2PJHA 1H10A 3G9WA 2K39A 3M62B 4TYZA 4URKA 2EMTA 1PLSA 1FHXA 2MDXA 2YLMA 2LKOA 1W1DA 3U8ZA 3CSFA 3A8QA 2KD0A 2RGFA 4DHZB 2JPHA 4BKSD 4HAZB 4K2OA 2KQ7A 4DBBA 2RUKB 2KANA 3BINA 1OEYJ 2UWQA 2YT1A 3O65B 2DN6A 3TFMA 3APCA 3PRPB 3MPXA 3GOEA 2LGDA 2QKMA 3R66C 3OLMD 4IAPA 3OJ3A 4JGHB 2KJRA 3CF6E 1WE7A 4HB0B 3UF8A 3QHTA 1YIWA 1LFDA 4EUTA 1YX5B 4HK2A 4WSFA 5J18A 2DTCA 4CHKA 3A33B 4WJOA 2KFKA 4FN2A 2LRWA 2XEWA 3KRXA 3PT2B 3ODOA 3WYFB 1OY2A 1OTRB 1D3ZA 2BF8B 2L0FA 3C0RB 3CIKA 5C79A 1MKEA 3PGEA 4AUQC 3KUZA 1TXDA 4H8SA 4HB4B 1XCGA 3ONSA 2LD9A 4WAAA 5JLJB 3H1UA 3QWZB 3UIOB 5HE1A 4WWOA 1V5UA 2XK5A 4IG7B 2C7MB 2O6VB 2V76A 3DDCB 2Y8FA 4NJ7A 3PPAA 3VH3B 2DYOA 1WI1A 1E5WA 4MELA 1UNRA 4ANXA 3ZO5B 5EFXA 4G11A 3DQVA 3GYPA 3BY4B 3AI5A 3A98B 5CHVC 2D9VA 1U4AA 4GSWA 4XC2A 2IO1B 1LB1A 2NBVB 5DCNA 1S1QB 3VTUA 4KIKB 4C0AA 4PS3A 3UQAA 3LDZE 3QARA 2IYBA 5CHFA 1WX8A 3M1IB 3JSVA 4A6FB 1WR1A 2FIDA 3IHPC 4PS8A 1YJ1A 2C9WB 5CLLB 5JHBA 2MW5A 2KDFB 1WR6E 1WGDA 2KC2A 1V6EA 4YONA 2GBRA 3KZ1A 1E8WA 3RZWC 1X11A 1FHOA 2K8BA 2KHWB 1BWNA 3B0AA 1WJUA 1K5GB 3KY9A 4MEMA 2K00A 4HAVB 2A4ZA 3PHWB 2UZSA 4HXDA 1UNPA 1I35A 5D7GA 3HK0A 3PTFC 4MM3A 3KRWA 5AZHA 5LOPB 4KAXB 1F9JA 4F1SA 3GYOA 1U2BA 3A4RA 4FLHA 1WJMA 2MBQA 3A4SC 1Z87A 3MHSD 4EMOA 2DZIA 1IP9A 3UIPB 4DHZE 4NY0A 1WX9A 5E6OA 2KMCA 2NS5A 2Y5BB 3V6EB 4FBJB 2MP2B 1GJZA 4K17A 5DIFB 3L54A 1X1GA 2KJ6A 1KZ7A 3HQCA 4HB3B 1XX0A 3DBRI 3ZTDA 3A8PA 1XODA 2KTFA 1ISNA 1DBHA 2PZ1A 3R3MA 1SE9A 2MA9B 4HPMB 3SU8X 4A3OA 2IZVB 5FI1A 3ECIA 4IM2A 1KZGA 3APFA 2Y8GA 3WAPA 2PEAA 4NNJB 2K8CA 1SIFA 2JWZA 3V5WA 1EF5A 1WXMA 3W1SC 2KXJA 4BBNF 2OJRA 1NU2A 4DX8A 1P6SA 4DDID 3L13A 2GBKA 1XD3B 4MJSA 1FXTB 2DLWA 3DVGX 2O6VA 1C1YB 2Z0EB 3AULA 4CO7A 2KWUB 2K8HA 2EMSA 3ZRCA 3JYUA 3L10B 1OGWA 3QWMA 2KWCA 2DYBA 2MFQA 2K1FA 1ZSQA 5D27A 1Q5WB 2BWES 1UBIA 2IBIB 4KIKA 2WX1A 1XT9B 4MT7A 1MG8A 2V4LA 2N9PC 2REXA 1BT0A 2GBMA 1Q0WB 5JZEB 2G35A 2FNJB 1LXDA 4A6FA 4Z2MB 4HDQA 2YS5A 4GMXB 4W9IA 2W2WA 4HPLB 1NDDA 1XR0B 1RJ2A 1SHCA 2M0XA 1LQBA 4HAUB 4CYEA 4EZJA 4D0NB 3N32A 3U30A 4BKTA 2NMBA 4ANWA 4GDKB 1YX6B 4IFSA 4FA6A 1V49A 2NBWB 1WH3A 3K9PB 2L00B 4PS7A 2C60A 4A3PA 3L16A 1ZM0A 3PZDA 2B3AA 1WVHA 4HWIB 4IOYX 3AU5A 1I42A 2LI5A 2LZ6A 4TUUA 2P0DA 2GCLA 3NY5A 3PP2A 2N9XA 5JP4A 4EZLA 2DZMA 3TBLD 4LCDE 1DYNA 1UEFA 4AWJA 2YVCA 1A5RA 3ZNID 3T9LA 5CTRC 1BTNA 3WALA 2GOWA 2MP2A 3KVFB 3NSUA 2DENB 3DOWA 5AZGA 5KHOA 2KQSA 4NJ6A 3DVNV 4AOFA 2NBUA 3VIAA 4WJNA 4ZRIA 2GBJA 4F8CB 1C3TA 2LGYA 1WZ3A 3EHVA 5C1ZA 2KZRA 3UZTA 2KKCA 5C23A 2N23A 1DDWA 2FCQA 5GOWB 3TO1A 3CSTA 4GIVA 3SV1A 1XQQA 3ZLZA 5IAAC 1TJ6A 3V6CB 2ZVOA 4ASWC 4HAXB 4MGKE 4MDKE 3RT3B 2GCJA 3LJ3A 3JSVB 3A1QB
chains in the Genus database with same CATH superfamily
1WYWB 1ZGUB 4M8NA 1U5FA 3QIJA 3RCZA 1P98A 4LNKA 5DPTA 2D5GA 2IJ0A 2N1WA 3QC8B 4I6LB 2SAKA 4F7UP 2DKPA 4BKSA 2Z0DB 3BJIA 1ZPSA 2WDRB 2YS1A 1N62A 3WA0A 4NZLB 4A6HA 2M1MA 2N9LA 2ZEQA 5J17A 3Q8AA 2MEKA 1XCQL 4KV2A 2OTXA 5D94A 4B95A 1IGCA 4A6QA 3N9YC 5IKCM 4HCNB 3NHEB 5T8IA 1YQBA 2M56B 1YJIA 4WVFB 4XX5A 4IWPA 2FCMA 4YWGG 1JWSD 5DHAB 1TY2A 2RLOA 2NCNA 2LVOA 3QK0A 1EAZA 1VZ7A 2IFSA 2D11A 5MPOA 1MG4A 3PVWA 4W9FA 4BKGA 4KVGB 1PFJA 1YN4A 1L0VB 1FO4A 3UQBA 1DDVA 2IO2B 3IT4B 3ODWA 1FOEA 2EELA 5JHGA 1XLPA 1VRAB 4N6EB 1ZDVA 2LULA 1ZP0B 1KH0A 3NVZA 3PLUA 1ZYIA 1LM8B 3AEAB 3W1SA 3DXDA 3RNAC 4WWPA 2KDBA 5DPRA 4GDKA 2K9XA 2W9NA 4MGYE 2O2VB 2ZZPB 2D3AA 2DZKA 3NS1A 2KUPA 3NS8A 1D5MC 4FHJA 3PHXB 2RDGA 2K8EA 1M7RA 3SR6A 3GP7A 1Q67A 2MH7A 4YSXB 1WYGA 1MIZB 2JP2A 4S17A 1WGRA 1IPGA 2INPE 4OVZA 1K50A 1WM2A 2KVRA 3DVGY 3Q69A 4Z2NA 4DXAB 1X86A 3IBEA 1P9DU 1V2YA 4C4VB 5HHDG 1ET6A 3X0WA 1P7FA 1V5TA 2CHXA 1STEA 3MC0B 1M4VA 3H8HA 1FEHA 2IO0B 1UH6A 1YN3A 3MJ5A 1V5OA 2LASA 2L2IA 3SNHA 3B9JA 1E7VA 4OVUA 1RRPB 2BT6A 4II3B 4GOCA 2QSDA 1RLFA 4LDTD 2MBHA 2KLGA 3SYXA 2LHEA 2ZPNA 3AB5A 3IFWB 4IUMB 2BYVE 1I7AA 1A70A 2K3UA 4G0NB 2Q5WD 4MJSB 3TVVA 1V80A 2BW2A 2LRUA 1KI1B 4WWMA 3KQ4A 3QQ8B 2AEHA 2BWFA 4ARIA 5LXHA 2EJ8A 4EJNA 3M95A 1GNUA 1WXSA 4W9EA 2MBBB 2BYEA 2Z0PA 3APDA 3DBSA 2OJWA 1QOBA 3K9OB 4WH4A 3SD5A 1ZUD2 5EDSA 1MK9B 3PSEB 1MHXA 1ZDXA 2FJUB 3ZW3A 2G9HD 4ZHPA 1QZEA 2C7HA 3UINB 1ZC3B 4Y94A 1L6UA 3RUIB 4JE3B 4BOZB 2DHKA 3N7CA 2Z14A 1NTYA 3RMKC 1VCBA 1EUVB 4GB9A 4BBNC 3TCAA 2Y7BA 2NTTA 3ML9A 2ZNVB 1EGXA 1I4QA 3ZXRA 4PQ0A 2AWTA 2IY0B 2COAA 3A1QA 3KYCD 1FAOA 3B1LX 3B2GA 4A6KA 2J0MA 3OHMB 5KCVA 2WXPA 3VR9B 4BVUC 4HLEA 4P16A 2XBBC 3EECA 3BWUD 4GGQA 3H9DA 2GUMA 1DYQA 3MFGA 2PIAA 1AARA 1J0GA 3DBLI 4CHMA 3R7QA 4KHOA 4YL8A 1C77A 1D5ZC 3VAWA 1YMHE 2KIGA 1L4DB 2N9EB 3T3OA 3N3KB 2Z13A 3FAHA 1GG3A 2JT4B 5DI9B 3GZNB 5D3XA 2KMAA 4TMAB 5IA7A 4AS1A 4HCPB 4XWTA 4GN1A 2V3PA 2MHJA 2RR9A 2ZW1A 4E74A 2ZCBA 5L81A 4G3XB 2RVBB 2JXXA 2K6DB 5TSSA 5I2SA 1VR9A 5KHQA 4TQ0A 2Z4DA 3RFZB 2BS4B 1ZE3D 4K3CA 4L1BA 5E6PA 2VH1A 3WAMA 1UWXA 1Y19B 3NVVA 4LNFA 4B0EA 1UGMA 4HDOA 1IYFA 5HE2A 2LJ5A 1OFFA 4XE0A 4JWSC 5G5GA 2X8XX 5H92C 2KT7A 3KSYA 1KJTA 2O2VA 5HI1A 2LJIA 1CMXB 3DWMA 4N9F4 1L2NA 5H8YE 1V8CA 1T77A 3AE9B 4KZ0A 3NRZA 4RM9A 1R4MB 3VVWB 1E8YA 2EKEC 1ZKHA 1XLNA 2JRIB 4K7WA 2WWZA 2V3SA 4QJ5B 1MHHE 2WXFA 4KKJA 3ENEA 3DHGC 4JQWC 1C4PA 1FNUA 2LGSA 3BIID 5HKHA 1JQ4A 3R8BA 1Y56A 4Q2JA 4KHBB 1ZVRA 3AECB 4JWUC 1H8CA 3W9CB 2W55A 2DHJA 2WQYB 1SE2A 2VKIA 1V5PA 3A9KB 2HJ1A 3P4QB 4HJGE 1HTOA 1UNQA 2RGNB 2YRYA 1QC6A 1DOIA 4DWFA 2GB1A 3I3TB 3RNGC 1I2HA 4D2KA 2JF5A 4KDLB 3DCGA 2ONQA 2QEJC 1UD7A 4OHJA 2XQNM 2WLBA 5JHAA 1FIQA 3L08A 4LNOA 1IGDA 3KH0A 4BFRA 4W9GA 1LGRA 5G55A 1EO6A 4JL9A 3V3XA 1DOXA 3ZJTA 1U5EA 3RNFC 4M8MA 4RFBA 3Q8FA 4QJ3B 2I38A 2N7DA 2V9HA 3JW0X 5L83A 2CY5A 3P42A 2LOXA 1WGUA 2AQ1B 4ACFA 2XN9C 1SBBB 2W3SA 2CS4A 1U5DA 2ROVA 3O96A 2LOZA 4ZYNA 2JXTA 3ALBA 3ZVVA 3WANA 2MBEA 2AQ2B 4AP4C 3CMMB 3DBLB 1NBFC 2TSSA 1T0SC 1J8CA 1SE4A 3Q8CA 2RSGA 4MT5A 3RI7C 2FJLA 4HJKA 1XO3A 1LW3A 3B2FA 2RD0A 4A20A 3SFEB 3RYTA 3VXWA 3NZ3A 4W9JA 4PYUA 2LYDA 2V3NA 3C8YA 3GE3C 1TS5A 4WURA 3RCPA 2CJNA 4IOIE 2INNE 3IG3A 4ANVA 2WX0A 1XEEA 2MRPA 2QCZA 2M4NA 2PMVA 3MC8A 1TKEA 3PS6A 4L1RA 5GMVA 1B9RA 4EZKA 3DXEA 3LB8C 3PV1A 1T0YA 2LVPA 2NVUI 4HEA1 2WXKA 4ZDVA 2RSUA 1P3RA 1WI0A 4DK5A 2K2JA 1TKGA 2G1EA 3X23A 3P63A 3EGRA 2FCSA 1V9JA 1FM0D 5L95C 1WMHB 1E9MA 1ZW7A 2L76A 3SO6A 5AEKB 4GXBA 2VSZA 2COCA 3NZUA 2YEPB 1C4CA 1N61A 3T06A 2KTRB 2E2XA 3V61A 2Q13A 3MDBC 1J7AA 1V5MA 1Q10A 2LG1A 2UYZB 2G3QB 3UI3A 1V86A 4MSQB 2IGGA 2MSED 3IT6B 4OZCA 4ARCA 3RN9C 2ACZB 3ULCA 1UUPA 2GMIC 4LDTB 4TQ1A 4PYZA 2N0YA 4A90A 3KUCB 2KDEB 2K5PA 4ICVA 4HHVA 4ITKA 1MAIA 5IO9A 2D9ZA 2IPKD 4HVBA 2CAYA 1E7UA 3AU4A 1UF0A 2CY4A 4BOSC 2N7JA 5DH9B 1AWEA 4I6PA 4LJOB 1GC7A 2KJHB 4LK0M 1M94A 2L1CA 4QXAB 2N0SB 2M19A 4ICUA 2N7EA 3AEBB 1XLQA 5LLIA 2MX2A 1VDVA 3AEGB 2QHOA 3DHIC 4L2YA 2QIEB 3QX1A 1ROEA 3AE7B 3FSSA 5IN7A 1MVKA 3Q8BA 1TBEA 4IM3A 1OQYA 3SFDB 1N3HA 2KFJA 2G45B 4GU2A 4NPNA 3PSCA 3L0WB 1SIJA 1UZXB 3BYYB 1PFDA 2VRRB 4WJ7A 1T3QA 1FCCC 2CU1A 3P4SB 3VR8B 5FK9C 4MH0E 2WU5B 3PLVA 1JRPA 4HROA 1PQSA 1W1HA 2CHZA 2PLPA 2KWDA 4W9HA 3VH4B 4KHBA 1RFAA 1JMLA 3ZVRA 3NWDA 2J0JA 3FVCA 3RULA 2C7NB 1BUIC 3H7PA 2WU2B 3A9KA 4XDDA 4BZAA 1Y5OA 4N59A 3VQIA 3I63C 1AQCA 3WIMA 1WRIA 3J9CA 4HPPA 4ANUA 2LVQA 4GDLA 3P1MA 5G5HA 2MLBA 3TIXA 3T8MA 2MJDA 2RRFA 2KDIA 4JPSA 3PZ7A 4GZUA 2ICIA 4RMAA 2BYFA 4GLSC 5LXIB 1XKEA 5TR5A 1KOTA 4RGMA 1V1PA 4MSMB 1BMLC 2K6QA 1RRBA 1PGBA 2J0KA 3WAOA 4WQOB 4DX90 2H7DA 4FJVB 1QT9A 1KM7A 1J19A 2ZCCA 5C6RA 5FKAC 3PO0A 2P8VA 4B6HA 3ZQ4A 3CIRB 1SGHA 5J3QA 1D5XC 1ZXIA 2MWNB 2KK8A 1VJKA 4ZRJA 5E6JA 3BK2A 3VTVA 2PKOA 3PRZA 4I6NB 3ZDMC 2KX3A 4L6EA 1UBQA 1WXQA 1JROA 3GS2A 3SHQA 1YNTE 3HM3A 1MIXA 4K81A 4F7ZA 2WXRA 3QCAA 5M4YB 3B08A 4TKNA 4EFOA 2WXOA 3BVGA 5FR6A 2D07B 1WXAA 2JX5A 1OEYA 2JY6A 2MKRA 2JSVX 2JUOA 3ZKJC 3Q8EA 5CHWA 4II2B 1R4NI 3TJPA 4NAMA 3OAWA 2KC1A 4XDCA 2DFKA 2AQ3B 3VDZA 3W2DA 3ZNZB 4MY6A 3GZNI 1MI1A 3OJ4B 2AYOB 5BO4B 1KLVA 1WJ6A 1WMHA 5I4DA 3NOBA 2L0TA 3TMPB 3ETRA 2KQ4X 2Z8LA 2DYNA 3VFKA 2I1KA 1T5XD 2BKRB 3HM6X 1UPQA 1ACCA 3D32A 2D3CA 1P3QU 1K53A 3FILB 1TZOA 1IRSA 2KTRA 3BZDB 4KX6B 2VRWB 2JZ3B 5C5BA 4NAWB 4KGSA 2GS0A 2MWSB 2NPTB 2ZNVC 2HE7A 2R2OA 3RD2A 1WJ1A 4BBKA 2JYTA 3KUDB 3W5UB 4J3OD 1OQQA 4NQLB 1SB3C 5BMGA 2FBWB 2L8JA 4W9CA 5EE1A 2L05A 2LEKA 2KOXA 2ZW0A 1OMWA 3E9SA 2FUHB 3SDLC 3C19A 3H6NA 2DYQA 4ZOHC 5LG4B 2PE9A 2HDEA 2VZKD 2G4SA 1N5WA 2KO3A 2V4IB 4K7SA 1WF9A 1U27A 1YOVB 4NSWA 1I4PA 2ELBA 1K8RB 5IRSA 4DHJD 3DPDA 1R4MI 2IYDB 3D8DA 2BCJA 1WGYA 1L7YA 4M02A 2MJEA 3F5RA 3BVMA 1S3SG 2I5CA 2D9YA 1XD4A 2DAFA 3ODXA 4WQMA 2YS3A 1V88A 3DVNU 4GMVA 2LMCA 3TUOA 4KKIA 1KRHA 2HJ8A 2QILA 3ZRFA 1GB4A 5HE0A 5KQ4A 1WIAA 4FJZA 1NVID 4CQNA 3Q3OC 3ZUNA 5EE3A 2M17A 4ZRPA 1NEKB 4W9KA 1U29A 1V1OA 2GI9A 1BAKA 3HSAA 3ZTCA 3EFUA 4B9KA 2ZPYA 2DZJA 4G50A 2K2UA 3E56A 1UELA 2NZ8B 2KCJA 5AUKA 1Z5SB 2GBNA 2D4QA 3ZNGC 1I4XA 4PK1A 3AEDB 3FM8C 3P4RB 3EUB2 2M38A 1RM6C 1MFWA 4OSNA 2R09A 1FNWA 1KLGD 5DHFB 2H7EA 1HTQA 4IW0A 1U5GA 1W1GA 1NYRA 2LGIA 1JCKB 2LXCA 3IVFA 3PVLA 4M01A 2WXQA 1WG7A 3GB1A 4AJYB 1N6ZA 2N9KA 4YT0B 3N1YC 3AE5B 3P7ZA 1TZ1A 3CXBB 3S2AA 3MC9A 4AJWA 2J52A 2C5LC 2KMMA 2KDMA 4TV3A 1VZ8A 2JRHA 3VOQA 1E8ZA 2KN5A 3NZSA 3RNCC 3V62A 1R4NB 3LJUX 4BAXA 4K1RB 1JRUA 1E90A 1RAXA 2WXIA 1V81A 4ZHOA 4HSIA 2DNFA 2PTLA 5LONB 4RF0A 5C3JB 3A9JB 2K25A 4HAYB 5J2RA 1HXYD 4FHKA 1YQ4B 2GLSA 2Z0QA 2DKQA 3VHTC 1WGQA 2M14A 2X38A 1I7HA 3VUXA 2YSZA 2J42A 1SE3A 5D3WA 1R7SA 2RNRB 1RYJA 2ASQA 1E8XA 2FIFA 2FE8A 2DHIA 1EU4A 1WXVA 1X1MA 2CRFA 1BTKA 5AZFA 3VUYA 1FB8A 1WE6A 4KZCA 3BYTB 1RWSA 3NVYA 1WGHA 3P2BA 5BMHA 1FHWA 3N1ZC 1GUAB 3R7RA 2DX5B 2H88B 2W3RA 2YT0A 1WX7A 2D10A 1WRDB 2WDQB 5J3TA 1J7BA 4M0WB 2QJLA 3V60A 3O13A 1MJDA 4XWWA 4FXCA 1Y8RC 2N1VA 4HAWB 2PVOD 3FC4A 3HVDA 3FKYA 4JLCA 4W9DA 3F0WA 4P7IA 3FILA 3TW1A 2W2XD 2FCNA 2NR2A 4WJPA 2OQBA 2WYQA 1C78A 1GB1A 5KQ1A 1GAQB 2LGXA 2M8SA 5GXGB 4NAWA 2OOBB 5JHHA 1X1FA 3JVZX 2ELAA 1YD8U 2D9XA 2BS2B 2D3BA 2L7RA 2NPTA 2FAZA 2KWVB 4MH8A 3FEHA 2XNAC 5HFYA 1EM7A 2DAJA 4OZBA 4RNAA 2P0HA 3U12A 1FFUA 2DYMA 1MPEA 2K22A 4US8A 1UPRA 3W1YA 2JVCA 3H7PB 2MBOA 1GPXA 1P5TA 2BTEA 5LNK1 1ZC4B 2KX0A 1YJJA 2HTHB 1IBXB 3NUHB 4LTUA 1TY0A 5D6JB 3PVUA 1KLUD 2G4DB 4GDLB 2LUMA 4EOYA 1HA5A 4NQKE 1WGGA 5I2MA 3SUZA 2R0DA 1E7PB 2J59M 3ZNHB 1JWMD 4IM0A 1V1PB 4XWXA 1T6BX 2WDTB 1EF1A 2Y3AA 2KAJA 2J53A 2BVCA 3L17A 1G6JA 1DROA 2SEBD 2HTME 4FADA 2I1JA 1N63A 4IC7B 1YQ3B 4A9AA 4KSLC 3N30A 4DQOC 2UZRA 2QKLA 4ZRQA 1C9FA 3P6AA 2BKFA 3IXSA 4HB2B 5CLQB 4DBGA 5D2MB 3DCXA 5G2NA 4AQ7A 4R3DA 2LUEA 2JQRB 3TEWA 2CODA 4J6IA 3LXFA 4YTPB 3PG7A 4QAYA 1L6VA 3HRDD 2KGXB 3NWAA 1VD2A 2QMTA 3TL5A 3QA8A 2KR0A 4F7HA 2PE6B 1NTVA 1ZXHA 3ABVB 1E10A 2UVMA 1PMSA 2P0FA 4EKUA 4W9LA 3URYA 3V05A 1X05A 4JIOU 2OEDA 1K5DB 5CX3A 3ZJUA 1XF5L 2JZPA 1Z2MA 4GPTB 3MJWA 5FI0A 5D3VA 2Z59B 2O6VD 5BMIA 1D4BA 4B6WA 2BPSA 3RZFA 5FR3A 2GJYA 2AL3A 3ZJVA 3HIZA 5BYSA 1WZ0A 3QJZA 2DBYA 3DBHI 3VUWA 4A5KA 5EE9A 1V61A 4WWNA 1FRRA 2LWPA 1Q1OA 3U7DA 2L3ZA 1B1ZA 2NTSA 3ZDTA 3N20C 5D3YA 4XZ4A 4F7GA 1ET9A 2BGFA 2I5FA 1MK7B 4HATB 3HHMA 3A9JA 2LHDA 4MGIE 4PNKA 3MTNB 2N4FA 2BB5A 1V97A 4IWQA 3QBVB 2VZKB 1F77A 3Q3FA 3U7ZA 1WJNA 3D8EA 2YF0A 1P0RA 4GOUA 5C5BB 2DHZA 4DHJB 2AL6A 2PPHA 1M7EA 1V89A 1CZPA 4O1NA 3D8FA 2IO3B 4RH6A 4EEWA 3RNEC 2D2QA 1SXTA 2IY1B 3AJ4A 2H89B 2WHIA 1FGYA 2X18A 2E6XA 2KACA 1L4ZB 2KFKB 3AXCA 1WFYA 2CKHB 3ML8A 1HE8A 3EC8A 2HD5B 2KNBA 3ML4A 3ZIMA 2R2YA 2DX5A 2CR5A 5JH5C 1FPYA 1FGZA 2BB6A 1WM3A 3DBRB 2WXHA 1WJ4A 4HKQA 2BS3B 1TTNA 4ZYSA 1TS4A 4M0WA 2DA0A 3OWEB 4MACA 3PRMB 5DPSA 1XXGA 3ZYYX 2RDHA 3M63B 1GC6A 1NI2A 1DGJA 2Z0OA 4E3CA 3PEGA 3Q3JA 2BBCA 2L52A 3AEFB 2EC1A 3BK1A 1B55A 3R2TA 2CHWA 2E3TA 1J0WA 4M00A 4OVVA 4FJYA 4DDGD 1EVHA 1HZ5A 1WY8A 2LXAA 4L23A 4RM8A 3KYDD 4WJQA 4IWOA 4KHAA 5HE3A 2XK5B 2D9WA 3ULBA 4YSZB 5J3YA 4CSQA 1I4HA 2KLCA 2W2XC 4H2AA 4FULA 5IP4D 3Q2AC 4KSKC 2D3GA 4C56C 1K51A 4ZRKA 4K2PA 2HTHA 1IBXA 1WSPA 3HUIA 1PGXA 2BYTA 2KVZA 3SEBA 2A5UA 3IAS1 1P1AA 4KDIC 2ROZB 1UGJA 2Y5PA 1H4RA 2PVGC 2W54A 2MQJA 3UGBB 3ZXVA 5DPWA 2ZJDA 4E71A 1QQGA 5C16A 2V1YA 3QAQA 4REZA 4K7UA 3VTWA 2ADZA 2ZVNA 1FRDA 3OANA 1OQNA 1TQZA 3P4PB 3KW5B 2GRIA 4LJPB 4TSSA 1AWDA 2R2QA 3DXCA 4C80A 2MJ3A 3OG5A 1DDMA 2VH2A 5HG2A 4HKZE 2NMQA 4MK0A 3H7SA 1TGZB 3RPFC 1ZOYB 4X57B 2RPQA 2MCNB 1BXTA 3DBHB 3M3JA 4MGZE 1FD6A 1QQRA 3NG0A 2WXGA 3AEEB 4CHJA 2J7QB 2DX1A 2COFA 5D3IB 3PREA 5E6NA 1D6EC 1MPHA 2K49A 4HRSA 1TJEA 3HW2B 2JZZA 3A58A 2PJHA 1H10A 4DXGA 1PGAA 3G9WA 2K39A 1OQRA 3M62B 1E6EB 4TYZA 4URKA 1NENB 3I5JC 2EMTA 1PLSA 1FHXA 2MDXA 2YLMA 1I4GA 2Z59A 1QOFA 2LKOA 2J4XA 1XLOA 1W1DA 3U8ZA 2IGDA 3CSFA 3A8QA 2KD0A 2RGFA 4DHZB 2JPHA 4BKSD 2W82A 4HAZB 4K2OA 2KQ7A 4DBBA 2RUKB 2KANA 4MM3B 3BINA 1OEYJ 2UWQA 2YT1A 3KWVA 3O65B 2DN6A 3TFMA 3NJTA 3APCA 3PRPB 3MPXA 3GOEA 2LGDA 1AN8A 2QKMA 3R66C 3OLMD 5EE0A 2IDYA 4IAPA 3OJ3A 1DOYA 3TSSA 4JGHB 2KJRA 4OT1A 3KWLA 3CF6E 1WE7A 4HB0B 4IDIA 3UF8A 3QHTA 1QOGA 1HZ6A 2DLBA 1YIWA 4B0MA 1KF6B 3AH7A 1LFDA 3WCQA 1YX5B 4EUTA 4HK2A 4WSFA 5J18A 2DTCA 4CHKA 3A33B 4WJOA 2KFKA 4FN2A 1T0QC 2LRWA 2XEWA 5JXVA 3KRXA 3PT2B 3ODOA 3WYFB 1OY2A 1TS3A 3AE8B 1OTRB 1D3ZA 2R61A 2BF8B 2L0FA 3C0RB 3CIKA 2I2YA 2KN4A 5C79A 2WNMA 4US9A 4IKGA 1VZ6A 1MKEA 3PGEA 4AUQC 1FMAD 3KUZA 1TXDA 4H8SA 4HB4B 1C4AA 1WGKA 3LYYA 3VRAB 1XCGA 3ONSA 2LD9A 3DWGC 4RGNA 4YXDB 3Q14C 4WAAA 5JLJB 3H1UA 3QWZB 3U4EG 1QLBB 2AX5A 3TEYA 3UIOB 5HE1A 4WWOA 1V5UA 2XK5A 4IG7B 3IAM1 4RGOS 2C7MB 2O6VB 2V76A 3DDCB 2Y8FA 4NJ7A 3PPAA 3VH3B 1HEZE 4RGTA 2DYOA 3N1XC 1WI1A 1E5WA 4N58A 4MELA 1UNRA 4P1CC 4ANXA 3AE1B 1T0RC 2JYEA 2WDVB 2EKIA 5EFXA 2INCC 4G11A 3DQVA 4QJ4B 3ZO5B 1N5XA 3GYPA 1QILA 1FXAA 3BY4B 3CWIA 3AI5A 3A98B 5CHVC 1L5PA 2CJOA 1YN5A 2D9VA 1U4AA 4GSWA 4P6VF 4XC2A 2IO1B 1LB1A 2NBVB 4YSYB 1CK1A 2Y5CA 2RDBC 5DCNA 1ENFA 1S1QB 3VTUA 4KIKB 4C0AA 4PS3A 3UQAA 3LDZE 3W5VB 3QARA 2IYBA 5CHFA 1SF0A 1WX8A 3M1IB 3JSVA 4A6FB 3TEZA 1WR1A 2FIDA 4DIXA 1UNSA 3IHPC 3BVZA 4PS8A 1YJ1A 4OW0A 1L0YB 3ZGZA 3AV8A 2C9WB 5CLLB 3U2SC 5JHBA 1PDXA 2MW5A 4LLGM 2KDFB 1WR6E 1WGDA 2IGHA 2B76B 2KC2A 1V6EA 4YONA 2GBRA 3KZ1A 1E8WA 4C7YA 1F0ZA 3RZWC 2RMMA 1X11A 1FHOA 2K8BA 2KHWB 1BWNA 1JWAD 3B0AA 1RFKA 2ZKMX 1WJUA 1XCTL 1K5GB 3KY9A 2BQQA 1F1HA 4PT5A 4MEMA 3PZ8A 2K00A 4HAVB 2A4ZA 3PHWB 2UZSA 4HXDA 1AW7A 1UNPA 1I35A 5D7GA 3HK0A 2WXLA 3PTFC 4MM3A 3KRWA 1EWCA 3NVWA 1F2RI 5AZHA 4GNKB 5LOPB 2K0PA 2PW9A 4KAXB 1F9JA 4F1SA 3GYOA 1U2BA 5BYRA 3Q3MC 3AN1A 3A4RA 4FLHA 1WJMA 2MBQA 3A4SC 1Z87A 3MHSD 4EMOA 2V0GA 2DZIA 1IP9A 3UIPB 4DHZE 4NY0A 1SJED 1WX9A 5E6OA 2KMCA 2NS5A 2Y5BB 1JWUD 3V6EB 2KIEA 4FBJB 2MP2B 2OHFA 4K17A 1GJZA 5DIFB 1IUEA 3L54A 1X1GA 2KJ6A 1KZ7A 3HQCA 4HB3B 1XX0A 4LNIA 1SJHD 3DBRI 3ZTDA 3A8PA 1K52A 1XODA 1ESFA 3AE2B 2KTFA 4D6WA 1ISNA 1QKZA 1DBHA 1PYWD 2FUG1 2PZ1A 3R3MA 1SE9A 5BYQA 2MA9B 1CQVA 4HPMB 1TT5B 4P1BC 4A55A 3SU8X 4A3OA 2IZVB 4C4VA 2WXJA 5FI1A 3ECIA 1MI0A 3VRBB 1UWMA 4IM2A 4YTNB 3U52E 1F2RC 1KZGA 1I4RA 3APFA 4RF1A 2Y8GA 3WAPA 2PEAA 4NNJB 1FNVA 3TEXA 1NI3A 1KFYB 2K8CA 2ON8A 1C76A 1SIFA 2JWZA 3V5WA 1EF5A 1WXMA 3W1SC 2KXJA 1FCLA 4BBNF 2OJRA 2YT2A 4JX1C 1AYFA 1NU2A 4DX8A 4WAFA 1P6SA 4DDID 3L13A 2GBKA 4EE2A 1XD3B 4MJSA 1FXTB 2DLWA 1HQRD 3DVGX 3Q6BA 2WP9B 2LFIA 2O6VA 2UU7A 3NW8A 3DHHC 1C1YB 1QOAA 2Z0EB 3AULA 1JALA 4CO7A 2KWUB 2RPVA 3EA6A 1GOZA 2K8HA 2EMSA 3ZRCA 3JYUA 3L10B 1OGWA 1WWTA 3QWMA 4RCOA 2KWCA 2DYBA 2MFQA 2QC8A 3Q3NC 2K1FA 2WXNA 1ZSQA 5D27A 2NBVA 1Q5WB 1FFVA 2BWES 1UBIA 1NYQA 2IBIB 4KIKA 2WX1A 1XT9B 4MT7A 1KTKA 1MG8A 2V4LA 2N9PC 2REXA 1BT0A 2GBMA 3GE8C 1Q0WB 5JZEB 2G35A 2FNJB 1LXDA 2DWQA 4A6FA 4Z2MB 4HDQA 2YS5A 1TIFA 4GMXB 4W9IA 2W2WA 4HPLB 1NDDA 3MP9A 4XGAB 1XR0B 3AE6B 1RJ2A 1SHCA 1CJEA 2M0XA 1LQBA 4HAUB 2WGSA 4CYEA 3KLSX 4EZJA 1P7EA 4D0NB 3N32A 3U30A 4BKTA 4YTMB 2NMBA 3L4PA 4ANWA 4GDKB 1C79A 4IFSA 1YX6B 4FA6A 1J7CA 1V49A 2NBWB 1WH3A 1JW9D 3K9PB 1QF6A 2L00B 4PS7A 2C60A 4A3PA 3L16A 1ZM0A 3PZDA 1E0ZA 1TYGB 2B3AA 1WVHA 4K3BA 4HWIB 4IOYX 3AU5A 1I42A 4XYCA 3T3NA 2LI5A 2LZ6A 4A8XC 4TUUA 2P0DA 2GCLA 3NY5A 1TKYA 2M0AA 1PUTA 3PP2A 2N9XA 4C7ZA 5JP4A 1JWBD 4EZLA 1LO5D 2DZMA 3TBLD 4LCDE 1DYNA 1UEFA 4AWJA 3AMZA 1L0XB 1F52A 1TS2A 5AUIA 2YVCA 3HVZA 1A5RA 1VLBA 4USAA 3ZNID 3T9LA 5CTRC 3AE4B 4S0RA 3RNBC 1BTNA 2L83A 3WALA 2GOWA 2MP2A 3KVFB 3NSUA 3AE3B 2DENB 4LNNA 3R2IA 2QDFA 3B77A 3DOWA 2YEPF 3EFCA 1N60A 5AZGA 5KHOA 2KQSA 4NJ6A 3DVNV 5IOIA 3NWFA 4AOFA 2NBUA 4OZAA 2KYWA 3VIAA 4WJNA 4ZRIA 2GBJA 2L32A 1EWYC 4F8CB 1C3TA 2LGYA 5D3DA 1WZ3A 3EHVA 5C1ZA 2KZRA 3UZTA 4UDUC 2KKCA 3MHZA 2CU3A 1SEBD 2WS3B 5C23A 2N23A 1DDWA 2FCQA 5GOWB 3TO1A 2L1AA 3CSTA 4GIVA 3SV1A 2KUQA 2JWUA 1XQQA 3AM9A 3I57A 3ZLZA 4C00A 5IAAC 1FXIA 2WXMA 1TJ6A 4DXFA 1EU3A 4KGRA 5C2TB 3V6CB 2ZVOA 4ASWC 4KGTA 4HAXB 4MGKE 4MDKE 2JU6X 3RT3B 4NJCA 2GCJA 2INDC 1SSNA 3I9V1 3LJ3A 3JSVB 3HIEA 3A1QB 4WIPA
chains in the Genus database with same CATH topology
1WYWB 1ZGUB 4M8NA 1U5FA 3QIJA 3RCZA 1P98A 5DPTA 2N1WA 3QC8B 4I6LB 4F7UP 2DKPA 4BKSA 2Z0DB 3BJIA 2YS1A 3WA0A 4A6HA 2M1MA 2ZEQA 5J17A 4KV2A 2OTXA 5D94A 4B95A 4HCNB 3NHEB 1YQBA 4WVFB 4XX5A 4IWPA 2FCMA 5DHAB 2RLOA 2NCNA 2LVOA 3QK0A 1EAZA 2IFSA 2D11A 3PVWA 4W9FA 4BKGA 4KVGB 1PFJA 3UQBA 1DDVA 2IO2B 3ODWA 1FOEA 5JHGA 2LULA 3PLUA 1LM8B 3W1SA 3DXDA 4WWPA 2KDBA 5DPRA 4GDKA 2W9NA 4MGYE 2O2VB 2ZZPB 2DZKA 2KUPA 3NS8A 4FHJA 3PHXB 1M7RA 1Q67A 1MIZB 2JP2A 1WGRA 1IPGA 1WM2A 2KVRA 3DVGY 4Z2NA 4DXAB 1X86A 3IBEA 1P9DU 1V2YA 3X0WA 1V5TA 2CHXA 2IO0B 1UH6A 1V5OA 2LASA 2L2IA 3SNHA 1E7VA 4OVUA 1RRPB 4II3B 4GOCA 1RLFA 4LDTD 2MBHA 2KLGA 3SYXA 2ZPNA 3IFWB 4IUMB 2BYVE 1I7AA 4G0NB 4MJSB 3TVVA 1V80A 2LRUA 1KI1B 3QQ8B 2AEHA 2BWFA 5LXHA 2EJ8A 4EJNA 3M95A 1GNUA 1WXSA 4W9EA 2MBBB 2BYEA 2Z0PA 3APDA 3DBSA 3K9OB 3SD5A 5EDSA 1MK9B 3PSEB 3ZW3A 1QZEA 2C7HA 3UINB 1ZC3B 4Y94A 3RUIB 4BOZB 2DHKA 3N7CA 1NTYA 1VCBA 1EUVB 4GB9A 4BBNC 3TCAA 2Y7BA 3ML9A 2ZNVB 1EGXA 4PQ0A 2AWTA 2IY0B 2COAA 3A1QA 3KYCD 1FAOA 3B1LX 4A6KA 2J0MA 5KCVA 4BVUC 4HLEA 2XBBC 3EECA 4GGQA 3H9DA 1AARA 1J0GA 3DBLI 4CHMA 3R7QA 4KHOA 4YL8A 3VAWA 2N9EB 3N3KB 1GG3A 2JT4B 5DI9B 5D3XA 2KMAA 5IA7A 4HCPB 4GN1A 2RR9A 4E74A 2ZCBA 5L81A 4G3XB 2RVBB 2JXXA 2K6DB 5KHQA 4TQ0A 5E6PA 3WAMA 1Y19B 4HDOA 1UGMA 1IYFA 5HE2A 2LJ5A 3KSYA 1KJTA 2O2VA 1CMXB 4N9F4 1L2NA 4KZ0A 4RM9A 3VVWB 1E8YA 2EKEC 1ZKHA 4K7WA 2JRIB 2WWZA 2V3SA 3ENEA 4JQWC 5HKHA 4KHBB 1ZVRA 1H8CA 2DHJA 2VKIA 1V5PA 3A9KB 1UNQA 2RGNB 2YRYA 1QC6A 4DWFA 3I3TB 1I2HA 2JF5A 4KDLB 3DCGA 1UD7A 2XQNM 5JHAA 3L08A 3KH0A 4BFRA 4W9GA 5G55A 1EO6A 4JL9A 1U5EA 4M8MA 2N7DA 3JW0X 5L83A 2CY5A 2LOXA 1WGUA 2CS4A 1U5DA 2ROVA 3O96A 2LOZA 4ZYNA 3ALBA 3ZVVA 3WANA 2MBEA 4AP4C 3CMMB 1NBFC 1J8CA 2RSGA 2FJLA 4HJKA 1LW3A 2RD0A 4A20A 3RYTA 3VXWA 4W9JA 4PYUA 2LYDA 3RCPA 4ANVA 3IG3A 2WX0A 2MRPA 2M4NA 3PS6A 5GMVA 4EZKA 3DXEA 3PV1A 1T0YA 2LVPA 2NVUI 4ZDVA 2RSUA 1P3RA 1WI0A 4DK5A 2K2JA 3X23A 2FCSA 1V9JA 5L95C 1WMHB 1ZW7A 2L76A 3SO6A 5AEKB 4GXBA 2VSZA 2COCA 3NZUA 3T06A 2KTRB 2E2XA 3V61A 2Q13A 3MDBC 1V5MA 2LG1A 2UYZB 2G3QB 1V86A 4MSQB 2MSED 3ULCA 2GMIC 4LDTB 4TQ1A 4PYZA 2N0YA 3KUCB 2KDEB 4ICVA 4HHVA 1MAIA 2D9ZA 4HVBA 2CAYA 1E7UA 3AU4A 2CY4A 4BOSC 5DH9B 1AWEA 4I6PA 4LJOB 1GC7A 2KJHB 1M94A 2L1CA 4ICUA 2N7EA 5LLIA 2MX2A 2QHOA 3QX1A 3FSSA 1TBEA 4IM3A 1OQYA 1N3HA 2KFJA 2G45B 4GU2A 4NPNA 3PSCA 3L0WB 1UZXB 2VRRB 4WJ7A 2CU1A 4MH0E 3PLVA 1PQSA 1W1HA 2CHZA 4W9HA 3VH4B 1RFAA 3ZVRA 2J0JA 3RULA 2C7NB 3H7PA 3A9KA 1Y5OA 3VQIA 1AQCA 3WIMA 4ANUA 2LVQA 4GDLA 3TIXA 2MLBA 3T8MA 2KDIA 4GZUA 4RMAA 2BYFA 5LXIB 1XKEA 5TR5A 1KOTA 4MSMB 2K6QA 1RRBA 2J0KA 3WAOA 4WQOB 4DX90 2H7DA 4FJVB 1KM7A 1J19A 2ZCCA 5C6RA 2P8VA 4B6HA 1SGHA 5J3QA 2MWNB 2KK8A 4ZRJA 3VTVA 3PRZA 4I6NB 3ZDMC 2KX3A 4L6EA 1UBQA 3SHQA 3HM3A 1MIXA 4K81A 4F7ZA 3QCAA 3B08A 4TKNA 4EFOA 5FR6A 2D07B 1WXAA 1OEYA 2JY6A 2MKRA 2JUOA 3ZKJC 5CHWA 4II2B 1R4NI 3TJPA 3OAWA 2KC1A 2DFKA 3VDZA 3ZNZB 4MY6A 3GZNI 3OJ4B 2AYOB 5BO4B 1KLVA 1WJ6A 1WMHA 3NOBA 2L0TA 3TMPB 2DYNA 3VFKA 2I1KA 2BKRB 3HM6X 1UPQA 3D32A 1P3QU 1IRSA 2KTRA 2VRWB 2JZ3B 5C5BA 4NAWB 2GS0A 2MWSB 2NPTB 2ZNVC 2HE7A 2R2OA 3RD2A 1WJ1A 4BBKA 3KUDB 4NQLB 2L8JA 4W9CA 2L05A 2KOXA 1OMWA 2FUHB 3SDLC 3H6NA 2DYQA 2PE9A 2G4SA 2KO3A 4K7SA 1WF9A 1U27A 4NSWA 2ELBA 1K8RB 4DHJD 3DPDA 1R4MI 2IYDB 2BCJA 3D8DA 1WGYA 1L7YA 3F5RA 1S3SG 2I5CA 2D9YA 1XD4A 2DAFA 3ODXA 2YS3A 1V88A 3DVNU 4GMVA 2HJ8A 3ZRFA 5HE0A 5KQ4A 1WIAA 4FJZA 3ZUNA 2M17A 4W9KA 1U29A 1BAKA 3ZTCA 3EFUA 4B9KA 2ZPYA 2DZJA 4G50A 2K2UA 1UELA 2NZ8B 2KCJA 1Z5SB 2GBNA 2D4QA 3ZNGC 3FM8C 2M38A 2R09A 5DHFB 2H7EA 4IW0A 1U5GA 1W1GA 2LXCA 3IVFA 3PVLA 1WG7A 4AJYB 3P7ZA 1TZ1A 3CXBB 3S2AA 4AJWA 2C5LC 4TV3A 2JRHA 3VOQA 1E8ZA 2KN5A 3NZSA 3V62A 3LJUX 4K1RB 1JRUA 1E90A 1RAXA 1V81A 5LONB 3A9JB 2K25A 4HAYB 5J2RA 4FHKA 2Z0QA 2DKQA 3VHTC 1WGQA 2M14A 3VUXA 2YSZA 5D3WA 2RNRB 2ASQA 1E8XA 2FIFA 2DHIA 1WXVA 1X1MA 2CRFA 1BTKA 5AZFA 3VUYA 1FB8A 1WE6A 4KZCA 1WGHA 3P2BA 1FHWA 1GUAB 3R7RA 2DX5B 2YT0A 1WX7A 2D10A 1WRDB 5J3TA 4M0WB 3V60A 1Y8RC 2N1VA 4HAWB 4JLCA 4W9DA 3F0WA 4P7IA 3TW1A 2W2XD 2FCNA 2NR2A 4WJPA 2OQBA 2WYQA 5KQ1A 2LGXA 2M8SA 4NAWA 2OOBB 5JHHA 1X1FA 3JVZX 2ELAA 1YD8U 2D9XA 2L7RA 2NPTA 2FAZA 2KWVB 3FEHA 2DAJA 2P0HA 2DYMA 1UPRA 3W1YA 2JVCA 3H7PB 2MBOA 1P5TA 1ZC4B 2KX0A 2HTHB 5D6JB 3PVUA 2G4DB 4GDLB 4EOYA 4NQKE 1WGGA 3SUZA 2R0DA 2J59M 3ZNHB 4IM0A 4XWXA 2WDTB 1EF1A 3L17A 1G6JA 1DROA 4FADA 2I1JA 4IC7B 4KSLC 3N30A 2UZRA 2QKLA 3P6AA 2BKFA 4HB2B 5CLQB 4DBGA 5D2MB 5G2NA 2LUEA 2CODA 4J6IA 3PG7A 2KGXB 1VD2A 3TL5A 3QA8A 4F7HA 2PE6B 1NTVA 2UVMA 1PMSA 2P0FA 4EKUA 4W9LA 1X05A 4JIOU 1K5DB 5CX3A 1Z2MA 4GPTB 3MJWA 5FI0A 5D3VA 2Z59B 2O6VD 4B6WA 2BPSA 3RZFA 2GJYA 2AL3A 3HIZA 1WZ0A 3QJZA 3DBHI 3VUWA 4A5KA 1V61A 4WWNA 2LWPA 1Q1OA 3U7DA 2L3ZA 3ZDTA 4XZ4A 5D3YA 4F7GA 2BGFA 2I5FA 1MK7B 4HATB 3HHMA 3A9JA 4MGIE 4PNKA 3MTNB 2N4FA 4IWQA 3QBVB 3Q3FA 1WJNA 3D8EA 2YF0A 1P0RA 5C5BB 2DHZA 4DHJB 2AL6A 2PPHA 1M7EA 1V89A 3D8FA 2IO3B 4EEWA 2D2QA 2IY1B 3AJ4A 1FGYA 2X18A 2KFKB 3AXCA 1WFYA 2CKHB 3ML8A 1HE8A 3EC8A 2HD5B 2KNBA 3ML4A 3ZIMA 2DX5A 2CR5A 5JH5C 1FGZA 1WM3A 1WJ4A 1TTNA 2DA0A 3PRMB 5DPSA 3M63B 1GC6A 1NI2A 2Z0OA 4E3CA 3PEGA 3Q3JA 2EC1A 1B55A 2CHWA 1J0WA 4OVVA 4FJYA 4DDGD 1EVHA 1WY8A 2LXAA 4RM8A 3KYDD 4WJQA 4IWOA 4KHAA 5HE3A 2XK5B 2D9WA 3ULBA 5J3YA 2KLCA 2W2XC 4FULA 4KSKC 2D3GA 4ZRKA 4K2PA 2HTHA 2A5UA 1P1AA 4KDIC 2ROZB 1H4RA 2MQJA 3UGBB 5DPWA 2ZJDA 4E71A 1QQGA 5C16A 2V1YA 3QAQA 4K7UA 3VTWA 2ADZA 2ZVNA 3OANA 1OQNA 1TQZA 3KW5B 4LJPB 2R2QA 3DXCA 1DDMA 4MK0A 3H7SA 1TGZB 4X57B 2RPQA 2MCNB 3M3JA 4MGZE 4CHJA 2J7QB 2DX1A 2COFA 3PREA 5E6NA 1MPHA 3HW2B 2JZZA 2PJHA 1H10A 3G9WA 2K39A 3M62B 4TYZA 4URKA 2EMTA 1PLSA 1FHXA 2MDXA 2YLMA 2LKOA 1W1DA 3U8ZA 3CSFA 3A8QA 2KD0A 2RGFA 4DHZB 2JPHA 4BKSD 4HAZB 4K2OA 2KQ7A 4DBBA 2RUKB 2KANA 3BINA 1OEYJ 2UWQA 2YT1A 3O65B 2DN6A 3TFMA 3APCA 3PRPB 3MPXA 3GOEA 2LGDA 2QKMA 3R66C 3OLMD 4IAPA 3OJ3A 4JGHB 2KJRA 3CF6E 1WE7A 4HB0B 3UF8A 3QHTA 1YIWA 1LFDA 4EUTA 1YX5B 4HK2A 4WSFA 5J18A 2DTCA 4CHKA 3A33B 4WJOA 2KFKA 4FN2A 2LRWA 2XEWA 3KRXA 3PT2B 3ODOA 3WYFB 1OY2A 1OTRB 1D3ZA 2BF8B 2L0FA 3C0RB 3CIKA 5C79A 1MKEA 3PGEA 4AUQC 3KUZA 1TXDA 4H8SA 4HB4B 1XCGA 3ONSA 2LD9A 4WAAA 5JLJB 3H1UA 3QWZB 3UIOB 5HE1A 4WWOA 1V5UA 2XK5A 4IG7B 2C7MB 2O6VB 2V76A 3DDCB 2Y8FA 4NJ7A 3PPAA 3VH3B 2DYOA 1WI1A 1E5WA 4MELA 1UNRA 4ANXA 3ZO5B 5EFXA 4G11A 3DQVA 3GYPA 3BY4B 3AI5A 3A98B 5CHVC 2D9VA 1U4AA 4GSWA 4XC2A 2IO1B 1LB1A 2NBVB 5DCNA 1S1QB 3VTUA 4KIKB 4C0AA 4PS3A 3UQAA 3LDZE 3QARA 2IYBA 5CHFA 1WX8A 3M1IB 3JSVA 4A6FB 1WR1A 2FIDA 3IHPC 4PS8A 1YJ1A 2C9WB 5CLLB 5JHBA 2MW5A 2KDFB 1WR6E 1WGDA 2KC2A 1V6EA 4YONA 2GBRA 3KZ1A 1E8WA 3RZWC 1X11A 1FHOA 2K8BA 2KHWB 1BWNA 3B0AA 1WJUA 1K5GB 3KY9A 4MEMA 2K00A 4HAVB 2A4ZA 3PHWB 2UZSA 4HXDA 1UNPA 1I35A 5D7GA 3HK0A 3PTFC 4MM3A 3KRWA 5AZHA 5LOPB 4KAXB 1F9JA 4F1SA 3GYOA 1U2BA 3A4RA 4FLHA 1WJMA 2MBQA 3A4SC 1Z87A 3MHSD 4EMOA 2DZIA 1IP9A 3UIPB 4DHZE 4NY0A 1WX9A 5E6OA 2KMCA 2NS5A 2Y5BB 3V6EB 4FBJB 2MP2B 1GJZA 4K17A 5DIFB 3L54A 1X1GA 2KJ6A 1KZ7A 3HQCA 4HB3B 1XX0A 3DBRI 3ZTDA 3A8PA 1XODA 2KTFA 1ISNA 1DBHA 2PZ1A 3R3MA 1SE9A 2MA9B 4HPMB 3SU8X 4A3OA 2IZVB 5FI1A 3ECIA 4IM2A 1KZGA 3APFA 2Y8GA 3WAPA 2PEAA 4NNJB 2K8CA 1SIFA 2JWZA 3V5WA 1EF5A 1WXMA 3W1SC 2KXJA 4BBNF 2OJRA 1NU2A 4DX8A 1P6SA 4DDID 3L13A 2GBKA 1XD3B 4MJSA 1FXTB 2DLWA 3DVGX 2O6VA 1C1YB 2Z0EB 3AULA 4CO7A 2KWUB 2K8HA 2EMSA 3ZRCA 3JYUA 3L10B 1OGWA 3QWMA 2KWCA 2DYBA 2MFQA 2K1FA 1ZSQA 5D27A 1Q5WB 2BWES 1UBIA 2IBIB 4KIKA 2WX1A 1XT9B 4MT7A 1MG8A 2V4LA 2N9PC 2REXA 1BT0A 2GBMA 1Q0WB 5JZEB 2G35A 2FNJB 1LXDA 4A6FA 4Z2MB 4HDQA 2YS5A 4GMXB 4W9IA 2W2WA 4HPLB 1NDDA 1XR0B 1RJ2A 1SHCA 2M0XA 1LQBA 4HAUB 4CYEA 4EZJA 4D0NB 3N32A 3U30A 4BKTA 2NMBA 4ANWA 4GDKB 1YX6B 4IFSA 4FA6A 1V49A 2NBWB 1WH3A 3K9PB 2L00B 4PS7A 2C60A 4A3PA 3L16A 1ZM0A 3PZDA 2B3AA 1WVHA 4HWIB 4IOYX 3AU5A 1I42A 2LI5A 2LZ6A 4TUUA 2P0DA 2GCLA 3NY5A 3PP2A 2N9XA 5JP4A 4EZLA 2DZMA 3TBLD 4LCDE 1DYNA 1UEFA 4AWJA 2YVCA 1A5RA 3ZNID 3T9LA 5CTRC 1BTNA 3WALA 2GOWA 2MP2A 3KVFB 3NSUA 2DENB 3DOWA 5AZGA 5KHOA 2KQSA 4NJ6A 3DVNV 4AOFA 2NBUA 3VIAA 4WJNA 4ZRIA 2GBJA 4F8CB 1C3TA 2LGYA 1WZ3A 3EHVA 5C1ZA 2KZRA 3UZTA 2KKCA 5C23A 2N23A 1DDWA 2FCQA 5GOWB 3TO1A 3CSTA 4GIVA 3SV1A 1XQQA 3ZLZA 5IAAC 1TJ6A 3V6CB 2ZVOA 4ASWC 4HAXB 4MGKE 4MDKE 3RT3B 2GCJA 3LJ3A 3JSVB 3A1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYW B;  1ZGU B;  4M8N A;  1U5F A;  3QIJ A;  3RCZ A;  1P98 A;  5DPT A;  2N1W A;  3QC8 B;  4I6L B;  4F7U P;  2DKP A;  4BKS A;  2Z0D B;  3BJI A;  2YS1 A;  3WA0 A;  4A6H A;  2M1M A;  2ZEQ A;  5J17 A;  4KV2 A;  2OTX A;  5D94 A;  4B95 A;  4HCN B;  3NHE B;  1YQB A;  4WVF B;  4XX5 A;  4IWP A;  2FCM A;  5DHA B;  2RLO A;  2NCN A;  2LVO A;  3QK0 A;  1EAZ A;  2IFS A;  2D11 A;  3PVW A;  4W9F A;  4BKG A;  4KVG B;  1PFJ A;  3UQB A;  1DDV A;  2IO2 B;  3ODW A;  1FOE A;  5JHG A;  2LUL A;  3PLU A;  1LM8 B;  3W1S A;  3DXD A;  4WWP A;  2KDB A;  5DPR A;  4GDK A;  2W9N A;  4MGY E;  2O2V B;  2ZZP B;  2DZK A;  2KUP A;  3NS8 A;  4FHJ A;  3PHX B;  1M7R A;  1Q67 A;  1MIZ B;  2JP2 A;  1WGR A;  1IPG A;  1WM2 A;  2KVR A;  3DVG Y;  4Z2N A;  4DXA B;  1X86 A;  3IBE A;  1P9D U;  1V2Y A;  3X0W A;  1V5T A;  2CHX A;  2IO0 B;  1UH6 A;  1V5O A;  2LAS A;  2L2I A;  3SNH A;  1E7V A;  4OVU A;  1RRP B;  4II3 B;  4GOC A;  1RLF A;  4LDT D;  2MBH A;  2KLG A;  3SYX A;  2ZPN A;  3IFW B;  4IUM B;  2BYV E;  1I7A A;  4G0N B;  4MJS B;  3TVV A;  1V80 A;  2LRU A;  1KI1 B;  3QQ8 B;  2AEH A;  2BWF A;  5LXH A;  2EJ8 A;  4EJN A;  3M95 A;  1GNU A;  1WXS A;  4W9E A;  2MBB B;  2BYE A;  2Z0P A;  3APD A;  3DBS A;  3K9O B;  3SD5 A;  5EDS A;  1MK9 B;  3PSE B;  3ZW3 A;  1QZE A;  2C7H A;  3UIN B;  1ZC3 B;  4Y94 A;  3RUI B;  4BOZ B;  2DHK A;  3N7C A;  1NTY A;  1VCB A;  1EUV B;  4GB9 A;  4BBN C;  3TCA A;  2Y7B A;  3ML9 A;  2ZNV B;  1EGX A;  4PQ0 A;  2AWT A;  2IY0 B;  2COA A;  3A1Q A;  3KYC D;  1FAO A;  3B1L X;  4A6K A;  2J0M A;  5KCV A;  4BVU C;  4HLE A;  2XBB C;  3EEC A;  4GGQ A;  3H9D A;  1AAR A;  1J0G A;  3DBL I;  4CHM A;  3R7Q A;  4KHO A;  4YL8 A;  3VAW A;  2N9E B;  3N3K B;  1GG3 A;  2JT4 B;  5DI9 B;  5D3X A;  2KMA A;  5IA7 A;  4HCP B;  4GN1 A;  2RR9 A;  4E74 A;  2ZCB A;  5L81 A;  4G3X B;  2RVB B;  2JXX A;  2K6D B;  5KHQ A;  4TQ0 A;  5E6P A;  3WAM A;  1Y19 B;  4HDO A;  1UGM A;  1IYF A;  5HE2 A;  2LJ5 A;  3KSY A;  1KJT A;  2O2V A;  1CMX B;  4N9F 4;  1L2N A;  4KZ0 A;  4RM9 A;  3VVW B;  1E8Y A;  2EKE C;  1ZKH A;  4K7W A;  2JRI B;  2WWZ A;  2V3S A;  3ENE A;  4JQW C;  5HKH A;  4KHB B;  1ZVR A;  1H8C A;  2DHJ A;  2VKI A;  1V5P A;  3A9K B;  1UNQ A;  2RGN B;  2YRY A;  1QC6 A;  4DWF A;  3I3T B;  1I2H A;  2JF5 A;  4KDL B;  3DCG A;  1UD7 A;  2XQN M;  5JHA A;  3L08 A;  3KH0 A;  4BFR A;  4W9G A;  5G55 A;  1EO6 A;  4JL9 A;  1U5E A;  4M8M A;  2N7D A;  3JW0 X;  5L83 A;  2CY5 A;  2LOX A;  1WGU A;  2CS4 A;  1U5D A;  2ROV A;  3O96 A;  2LOZ A;  4ZYN A;  3ALB A;  3ZVV A;  3WAN A;  2MBE A;  4AP4 C;  3CMM B;  1NBF C;  1J8C A;  2RSG A;  2FJL A;  4HJK A;  1LW3 A;  2RD0 A;  4A20 A;  3RYT A;  3VXW A;  4W9J A;  4PYU A;  2LYD A;  3RCP A;  4ANV A;  3IG3 A;  2WX0 A;  2MRP A;  2M4N A;  3PS6 A;  5GMV A;  4EZK A;  3DXE A;  3PV1 A;  1T0Y A;  2LVP A;  2NVU I;  4ZDV A;  2RSU A;  1P3R A;  1WI0 A;  4DK5 A;  2K2J A;  3X23 A;  2FCS A;  1V9J A;  5L95 C;  1WMH B;  1ZW7 A;  2L76 A;  3SO6 A;  5AEK B;  4GXB A;  2VSZ A;  2COC A;  3NZU A;  3T06 A;  2KTR B;  2E2X A;  3V61 A;  2Q13 A;  3MDB C;  1V5M A;  2LG1 A;  2UYZ B;  2G3Q B;  1V86 A;  4MSQ B;  2MSE D;  3ULC A;  2GMI C;  4LDT B;  4TQ1 A;  4PYZ A;  2N0Y A;  3KUC B;  2KDE B;  4ICV A;  4HHV A;  1MAI A;  2D9Z A;  4HVB A;  2CAY A;  1E7U A;  3AU4 A;  2CY4 A;  4BOS C;  5DH9 B;  1AWE A;  4I6P A;  4LJO B;  1GC7 A;  2KJH B;  1M94 A;  2L1C A;  4ICU A;  2N7E A;  5LLI A;  2MX2 A;  2QHO A;  3QX1 A;  3FSS A;  1TBE A;  4IM3 A;  1OQY A;  1N3H A;  2KFJ A;  2G45 B;  4GU2 A;  4NPN A;  3PSC A;  3L0W B;  1UZX B;  2VRR B;  4WJ7 A;  2CU1 A;  4MH0 E;  3PLV A;  1PQS A;  1W1H A;  2CHZ A;  4W9H A;  3VH4 B;  1RFA A;  3ZVR A;  2J0J A;  3RUL A;  2C7N B;  3H7P A;  3A9K A;  1Y5O A;  3VQI A;  1AQC A;  3WIM A;  4ANU A;  2LVQ A;  4GDL A;  3TIX A;  2MLB A;  3T8M A;  2KDI A;  4GZU A;  4RMA A;  2BYF A;  5LXI B;  1XKE A;  5TR5 A;  1KOT A;  4MSM B;  2K6Q A;  1RRB A;  2J0K A;  3WAO A;  4WQO B;  4DX9 0;  2H7D A;  4FJV B;  1KM7 A;  1J19 A;  2ZCC A;  5C6R A;  2P8V A;  4B6H A;  1SGH A;  5J3Q A;  2MWN B;  2KK8 A;  4ZRJ A;  3VTV A;  3PRZ A;  4I6N B;  3ZDM C;  2KX3 A;  4L6E A;  1UBQ A;  3SHQ A;  3HM3 A;  1MIX A;  4K81 A;  4F7Z A;  3QCA A;  3B08 A;  4TKN A;  4EFO A;  5FR6 A;  2D07 B;  1WXA A;  1OEY A;  2JY6 A;  2MKR A;  2JUO A;  3ZKJ C;  5CHW A;  4II2 B;  1R4N I;  3TJP A;  3OAW A;  2KC1 A;  2DFK A;  3VDZ A;  3ZNZ B;  4MY6 A;  3GZN I;  3OJ4 B;  2AYO B;  5BO4 B;  1KLV A;  1WJ6 A;  1WMH A;  3NOB A;  2L0T A;  3TMP B;  2DYN A;  3VFK A;  2I1K A;  2BKR B;  3HM6 X;  1UPQ A;  3D32 A;  1P3Q U;  1IRS A;  2KTR A;  2VRW B;  2JZ3 B;  5C5B A;  4NAW B;  2GS0 A;  2MWS B;  2NPT B;  2ZNV C;  2HE7 A;  2R2O A;  3RD2 A;  1WJ1 A;  4BBK A;  3KUD B;  4NQL B;  2L8J A;  4W9C A;  2L05 A;  2KOX A;  1OMW A;  2FUH B;  3SDL C;  3H6N A;  2DYQ A;  2PE9 A;  2G4S A;  2KO3 A;  4K7S A;  1WF9 A;  1U27 A;  4NSW A;  2ELB A;  1K8R B;  4DHJ D;  3DPD A;  1R4M I;  2IYD B;  2BCJ A;  3D8D A;  1WGY A;  1L7Y A;  3F5R A;  1S3S G;  2I5C A;  2D9Y A;  1XD4 A;  2DAF A;  3ODX A;  2YS3 A;  1V88 A;  3DVN U;  4GMV A;  2HJ8 A;  3ZRF A;  5HE0 A;  5KQ4 A;  1WIA A;  4FJZ A;  3ZUN A;  2M17 A;  4W9K A;  1U29 A;  1BAK A;  3ZTC A;  3EFU A;  4B9K A;  2ZPY A;  2DZJ A;  4G50 A;  2K2U A;  1UEL A;  2NZ8 B;  2KCJ A;  1Z5S B;  2GBN A;  2D4Q A;  3ZNG C;  3FM8 C;  2M38 A;  2R09 A;  5DHF B;  2H7E A;  4IW0 A;  1U5G A;  1W1G A;  2LXC A;  3IVF A;  3PVL A;  1WG7 A;  4AJY B;  3P7Z A;  1TZ1 A;  3CXB B;  3S2A A;  4AJW A;  2C5L C;  4TV3 A;  2JRH A;  3VOQ A;  1E8Z A;  2KN5 A;  3NZS A;  3V62 A;  3LJU X;  4K1R B;  1JRU A;  1E90 A;  1RAX A;  1V81 A;  5LON B;  3A9J B;  2K25 A;  4HAY B;  5J2R A;  4FHK A;  2Z0Q A;  2DKQ A;  3VHT C;  1WGQ A;  2M14 A;  3VUX A;  2YSZ A;  5D3W A;  2RNR B;  2ASQ A;  1E8X A;  2FIF A;  2DHI A;  1WXV A;  1X1M A;  2CRF A;  1BTK A;  5AZF A;  3VUY A;  1FB8 A;  1WE6 A;  4KZC A;  1WGH A;  3P2B A;  1FHW A;  1GUA B;  3R7R A;  2DX5 B;  2YT0 A;  1WX7 A;  2D10 A;  1WRD B;  5J3T A;  4M0W B;  3V60 A;  1Y8R C;  2N1V A;  4HAW B;  4JLC A;  4W9D A;  3F0W A;  4P7I A;  3TW1 A;  2W2X D;  2FCN A;  2NR2 A;  4WJP A;  2OQB A;  2WYQ A;  5KQ1 A;  2LGX A;  2M8S A;  4NAW A;  2OOB B;  5JHH A;  1X1F A;  3JVZ X;  2ELA A;  1YD8 U;  2D9X A;  2L7R A;  2NPT A;  2FAZ A;  2KWV B;  3FEH A;  2DAJ A;  2P0H A;  2DYM A;  1UPR A;  3W1Y A;  2JVC A;  3H7P B;  2MBO A;  1P5T A;  1ZC4 B;  2KX0 A;  2HTH B;  5D6J B;  3PVU A;  2G4D B;  4GDL B;  4EOY A;  4NQK E;  1WGG A;  3SUZ A;  2R0D A;  2J59 M;  3ZNH B;  4IM0 A;  4XWX A;  2WDT B;  1EF1 A;  3L17 A;  1G6J A;  1DRO A;  4FAD A;  2I1J A;  4IC7 B;  4KSL C;  3N30 A;  2UZR A;  2QKL A;  3P6A A;  2BKF A;  4HB2 B;  5CLQ B;  4DBG A;  5D2M B;  5G2N A;  2LUE A;  2COD A;  4J6I A;  3PG7 A;  2KGX B;  1VD2 A;  3TL5 A;  3QA8 A;  4F7H A;  2PE6 B;  1NTV A;  2UVM A;  1PMS A;  2P0F A;  4EKU A;  4W9L A;  1X05 A;  4JIO U;  1K5D B;  5CX3 A;  1Z2M A;  4GPT B;  3MJW A;  5FI0 A;  5D3V A;  2Z59 B;  2O6V D;  4B6W A;  2BPS A;  3RZF A;  2GJY A;  2AL3 A;  3HIZ A;  1WZ0 A;  3QJZ A;  3DBH I;  3VUW A;  4A5K A;  1V61 A;  4WWN A;  2LWP A;  1Q1O A;  3U7D A;  2L3Z A;  3ZDT A;  4XZ4 A;  5D3Y A;  4F7G A;  2BGF A;  2I5F A;  1MK7 B;  4HAT B;  3HHM A;  3A9J A;  4MGI E;  4PNK A;  3MTN B;  2N4F A;  4IWQ A;  3QBV B;  3Q3F A;  1WJN A;  3D8E A;  2YF0 A;  1P0R A;  5C5B B;  2DHZ A;  4DHJ B;  2AL6 A;  2PPH A;  1M7E A;  1V89 A;  3D8F A;  2IO3 B;  4EEW A;  2D2Q A;  2IY1 B;  3AJ4 A;  1FGY A;  2X18 A;  2KFK B;  3AXC A;  1WFY A;  2CKH B;  3ML8 A;  1HE8 A;  3EC8 A;  2HD5 B;  2KNB A;  3ML4 A;  3ZIM A;  2DX5 A;  2CR5 A;  5JH5 C;  1FGZ A;  1WM3 A;  1WJ4 A;  1TTN A;  2DA0 A;  3PRM B;  5DPS A;  3M63 B;  1GC6 A;  1NI2 A;  2Z0O A;  4E3C A;  3PEG A;  3Q3J A;  2EC1 A;  1B55 A;  2CHW A;  1J0W A;  4OVV A;  4FJY A;  4DDG D;  1EVH A;  1WY8 A;  2LXA A;  4RM8 A;  3KYD D;  4WJQ A;  4IWO A;  4KHA A;  5HE3 A;  2XK5 B;  2D9W A;  3ULB A;  5J3Y A;  2KLC A;  2W2X C;  4FUL A;  4KSK C;  2D3G A;  4ZRK A;  4K2P A;  2HTH A;  2A5U A;  1P1A A;  4KDI C;  2ROZ B;  1H4R A;  2MQJ A;  3UGB B;  5DPW A;  2ZJD A;  4E71 A;  1QQG A;  5C16 A;  2V1Y A;  3QAQ A;  4K7U A;  3VTW A;  2ADZ A;  2ZVN A;  3OAN A;  1OQN A;  1TQZ A;  3KW5 B;  4LJP B;  2R2Q A;  3DXC A;  1DDM A;  4MK0 A;  3H7S A;  1TGZ B;  4X57 B;  2RPQ A;  2MCN B;  3M3J A;  4MGZ E;  4CHJ A;  2J7Q B;  2DX1 A;  2COF A;  3PRE A;  5E6N A;  1MPH A;  3HW2 B;  2JZZ A;  2PJH A;  1H10 A;  3G9W A;  2K39 A;  3M62 B;  4TYZ A;  4URK A;  2EMT A;  1PLS A;  1FHX A;  2MDX A;  2YLM A;  2LKO A;  1W1D A;  3U8Z A;  3CSF A;  3A8Q A;  2KD0 A;  2RGF A;  4DHZ B;  2JPH A;  4BKS D;  4HAZ B;  4K2O A;  2KQ7 A;  4DBB A;  2RUK B;  2KAN A;  3BIN A;  1OEY J;  2UWQ A;  2YT1 A;  3O65 B;  2DN6 A;  3TFM A;  3APC A;  3PRP B;  3MPX A;  3GOE A;  2LGD A;  2QKM A;  3R66 C;  3OLM D;  4IAP A;  3OJ3 A;  4JGH B;  2KJR A;  3CF6 E;  1WE7 A;  4HB0 B;  3UF8 A;  3QHT A;  1YIW A;  1LFD A;  4EUT A;  1YX5 B;  4HK2 A;  4WSF A;  5J18 A;  2DTC A;  4CHK A;  3A33 B;  4WJO A;  2KFK A;  4FN2 A;  2LRW A;  2XEW A;  3KRX A;  3PT2 B;  3ODO A;  3WYF B;  1OY2 A;  1OTR B;  1D3Z A;  2BF8 B;  2L0F A;  3C0R B;  3CIK A;  5C79 A;  1MKE A;  3PGE A;  4AUQ C;  3KUZ A;  1TXD A;  4H8S A;  4HB4 B;  1XCG A;  3ONS A;  2LD9 A;  4WAA A;  5JLJ B;  3H1U A;  3QWZ B;  3UIO B;  5HE1 A;  4WWO A;  1V5U A;  2XK5 A;  4IG7 B;  2C7M B;  2O6V B;  2V76 A;  3DDC B;  2Y8F A;  4NJ7 A;  3PPA A;  3VH3 B;  2DYO A;  1WI1 A;  1E5W A;  4MEL A;  1UNR A;  4ANX A;  3ZO5 B;  5EFX A;  4G11 A;  3DQV A;  3GYP A;  3BY4 B;  3AI5 A;  3A98 B;  5CHV C;  2D9V A;  1U4A A;  4GSW A;  4XC2 A;  2IO1 B;  1LB1 A;  2NBV B;  5DCN A;  1S1Q B;  3VTU A;  4KIK B;  4C0A A;  4PS3 A;  3UQA A;  3LDZ E;  3QAR A;  2IYB A;  5CHF A;  1WX8 A;  3M1I B;  3JSV A;  4A6F B;  1WR1 A;  2FID A;  3IHP C;  4PS8 A;  1YJ1 A;  2C9W B;  5CLL B;  5JHB A;  2MW5 A;  2KDF B;  1WR6 E;  1WGD A;  2KC2 A;  1V6E A;  4YON A;  2GBR A;  3KZ1 A;  1E8W A;  3RZW C;  1X11 A;  1FHO A;  2K8B A;  2KHW B;  1BWN A;  3B0A A;  1WJU A;  1K5G B;  3KY9 A;  4MEM A;  2K00 A;  4HAV B;  2A4Z A;  3PHW B;  2UZS A;  4HXD A;  1UNP A;  1I35 A;  5D7G A;  3HK0 A;  3PTF C;  4MM3 A;  3KRW A;  5AZH A;  5LOP B;  4KAX B;  1F9J A;  4F1S A;  3GYO A;  1U2B A;  3A4R A;  4FLH A;  1WJM A;  2MBQ A;  3A4S C;  1Z87 A;  3MHS D;  4EMO A;  2DZI A;  1IP9 A;  3UIP B;  4DHZ E;  4NY0 A;  1WX9 A;  5E6O A;  2KMC A;  2NS5 A;  2Y5B B;  3V6E B;  4FBJ B;  2MP2 B;  1GJZ A;  4K17 A;  5DIF B;  3L54 A;  1X1G A;  2KJ6 A;  1KZ7 A;  3HQC A;  4HB3 B;  1XX0 A;  3DBR I;  3ZTD A;  3A8P A;  1XOD A;  2KTF A;  1ISN A;  1DBH A;  2PZ1 A;  3R3M A;  1SE9 A;  2MA9 B;  4HPM B;  3SU8 X;  4A3O A;  2IZV B;  5FI1 A;  3ECI A;  4IM2 A;  1KZG A;  3APF A;  2Y8G A;  3WAP A;  2PEA A;  4NNJ B;  2K8C A;  1SIF A;  2JWZ A;  3V5W A;  1EF5 A;  1WXM A;  3W1S C;  2KXJ A;  4BBN F;  2OJR A;  1NU2 A;  4DX8 A;  1P6S A;  4DDI D;  3L13 A;  2GBK A;  1XD3 B;  4MJS A;  1FXT B;  2DLW A;  3DVG X;  2O6V A;  1C1Y B;  2Z0E B;  3AUL A;  4CO7 A;  2KWU B;  2K8H A;  2EMS A;  3ZRC A;  3JYU A;  3L10 B;  1OGW A;  3QWM A;  2KWC A;  2DYB A;  2MFQ A;  2K1F A;  1ZSQ A;  5D27 A;  1Q5W B;  2BWE S;  1UBI A;  2IBI B;  4KIK A;  2WX1 A;  1XT9 B;  4MT7 A;  1MG8 A;  2V4L A;  2N9P C;  2REX A;  1BT0 A;  2GBM A;  1Q0W B;  5JZE B;  2G35 A;  2FNJ B;  1LXD A;  4A6F A;  4Z2M B;  4HDQ A;  2YS5 A;  4GMX B;  4W9I A;  2W2W A;  4HPL B;  1NDD A;  1XR0 B;  1RJ2 A;  1SHC A;  2M0X A;  1LQB A;  4HAU B;  4CYE A;  4EZJ A;  4D0N B;  3N32 A;  3U30 A;  4BKT A;  2NMB A;  4ANW A;  4GDK B;  1YX6 B;  4IFS A;  4FA6 A;  1V49 A;  2NBW B;  1WH3 A;  3K9P B;  2L00 B;  4PS7 A;  2C60 A;  4A3P A;  3L16 A;  1ZM0 A;  3PZD A;  2B3A A;  1WVH A;  4HWI B;  4IOY X;  3AU5 A;  1I42 A;  2LI5 A;  2LZ6 A;  4TUU A;  2P0D A;  2GCL A;  3NY5 A;  3PP2 A;  2N9X A;  5JP4 A;  4EZL A;  2DZM A;  3TBL D;  4LCD E;  1DYN A;  1UEF A;  4AWJ A;  2YVC A;  1A5R A;  3ZNI D;  3T9L A;  5CTR C;  1BTN A;  3WAL A;  2GOW A;  2MP2 A;  3KVF B;  3NSU A;  2DEN B;  3DOW A;  5AZG A;  5KHO A;  2KQS A;  4NJ6 A;  3DVN V;  4AOF A;  2NBU A;  3VIA A;  4WJN A;  4ZRI A;  2GBJ A;  4F8C B;  1C3T A;  2LGY A;  1WZ3 A;  3EHV A;  5C1Z A;  2KZR A;  3UZT A;  2KKC A;  5C23 A;  2N23 A;  1DDW A;  2FCQ A;  5GOW B;  3TO1 A;  3CST A;  4GIV A;  3SV1 A;  1XQQ A;  3ZLZ A;  5IAA C;  1TJ6 A;  3V6C B;  2ZVO A;  4ASW C;  4HAX B;  4MGK E;  4MDK E;  3RT3 B;  2GCJ A;  3LJ3 A;  3JSV B;  3A1Q B; 
#chains in the Genus database with same CATH topology
 1WYW B;  1ZGU B;  4M8N A;  1U5F A;  3QIJ A;  3RCZ A;  1P98 A;  4LNK A;  5DPT A;  2D5G A;  2IJ0 A;  2N1W A;  3QC8 B;  4I6L B;  2SAK A;  4F7U P;  2DKP A;  4BKS A;  2Z0D B;  3BJI A;  1ZPS A;  2WDR B;  2YS1 A;  1N62 A;  3WA0 A;  4NZL B;  4A6H A;  2M1M A;  2N9L A;  2ZEQ A;  5J17 A;  3Q8A A;  2MEK A;  1XCQ L;  4KV2 A;  2OTX A;  5D94 A;  4B95 A;  1IGC A;  4A6Q A;  3N9Y C;  5IKC M;  4HCN B;  3NHE B;  5T8I A;  1YQB A;  2M56 B;  1YJI A;  4WVF B;  4XX5 A;  4IWP A;  2FCM A;  4YWG G;  1JWS D;  5DHA B;  1TY2 A;  2RLO A;  2NCN A;  2LVO A;  3QK0 A;  1EAZ A;  1VZ7 A;  2IFS A;  2D11 A;  5MPO A;  1MG4 A;  3PVW A;  4W9F A;  4BKG A;  4KVG B;  1PFJ A;  1YN4 A;  1L0V B;  1FO4 A;  3UQB A;  1DDV A;  2IO2 B;  3IT4 B;  3ODW A;  1FOE A;  2EEL A;  5JHG A;  1XLP A;  1VRA B;  4N6E B;  1ZDV A;  2LUL A;  1ZP0 B;  1KH0 A;  3NVZ A;  3PLU A;  1ZYI A;  1LM8 B;  3AEA B;  3W1S A;  3DXD A;  3RNA C;  4WWP A;  2KDB A;  5DPR A;  4GDK A;  2K9X A;  2W9N A;  4MGY E;  2O2V B;  2ZZP B;  2D3A A;  2DZK A;  3NS1 A;  2KUP A;  3NS8 A;  1D5M C;  4FHJ A;  3PHX B;  2RDG A;  2K8E A;  1M7R A;  3SR6 A;  3GP7 A;  1Q67 A;  2MH7 A;  4YSX B;  1WYG A;  1MIZ B;  2JP2 A;  4S17 A;  1WGR A;  1IPG A;  2INP E;  4OVZ A;  1K50 A;  1WM2 A;  2KVR A;  3DVG Y;  3Q69 A;  4Z2N A;  4DXA B;  1X86 A;  3IBE A;  1P9D U;  1V2Y A;  4C4V B;  5HHD G;  1ET6 A;  3X0W A;  1P7F A;  1V5T A;  2CHX A;  1STE A;  3MC0 B;  1M4V A;  3H8H A;  1FEH A;  2IO0 B;  1UH6 A;  1YN3 A;  3MJ5 A;  1V5O A;  2LAS A;  2L2I A;  3SNH A;  3B9J A;  1E7V A;  4OVU A;  1RRP B;  2BT6 A;  4II3 B;  4GOC A;  2QSD A;  1RLF A;  4LDT D;  2MBH A;  2KLG A;  3SYX A;  2LHE A;  2ZPN A;  3AB5 A;  3IFW B;  4IUM B;  2BYV E;  1I7A A;  1A70 A;  2K3U A;  4G0N B;  2Q5W D;  4MJS B;  3TVV A;  1V80 A;  2BW2 A;  2LRU A;  1KI1 B;  4WWM A;  3KQ4 A;  3QQ8 B;  2AEH A;  2BWF A;  4ARI A;  5LXH A;  2EJ8 A;  4EJN A;  3M95 A;  1GNU A;  1WXS A;  4W9E A;  2MBB B;  2BYE A;  2Z0P A;  3APD A;  3DBS A;  2OJW A;  1QOB A;  3K9O B;  4WH4 A;  3SD5 A;  1ZUD 2;  5EDS A;  1MK9 B;  3PSE B;  1MHX A;  1ZDX A;  2FJU B;  3ZW3 A;  2G9H D;  4ZHP A;  1QZE A;  2C7H A;  3UIN B;  1ZC3 B;  4Y94 A;  1L6U A;  3RUI B;  4JE3 B;  4BOZ B;  2DHK A;  3N7C A;  2Z14 A;  1NTY A;  3RMK C;  1VCB A;  1EUV B;  4GB9 A;  4BBN C;  3TCA A;  2Y7B A;  2NTT A;  3ML9 A;  2ZNV B;  1EGX A;  1I4Q A;  3ZXR A;  4PQ0 A;  2AWT A;  2IY0 B;  2COA A;  3A1Q A;  3KYC D;  1FAO A;  3B1L X;  3B2G A;  4A6K A;  2J0M A;  3OHM B;  5KCV A;  2WXP A;  3VR9 B;  4BVU C;  4HLE A;  4P16 A;  2XBB C;  3EEC A;  3BWU D;  4GGQ A;  3H9D A;  2GUM A;  1DYQ A;  3MFG A;  2PIA A;  1AAR A;  1J0G A;  3DBL I;  4CHM A;  3R7Q A;  4KHO A;  4YL8 A;  1C77 A;  1D5Z C;  3VAW A;  1YMH E;  2KIG A;  1L4D B;  2N9E B;  3T3O A;  3N3K B;  2Z13 A;  3FAH A;  1GG3 A;  2JT4 B;  5DI9 B;  3GZN B;  5D3X A;  2KMA A;  4TMA B;  5IA7 A;  4AS1 A;  4HCP B;  4XWT A;  4GN1 A;  2V3P A;  2MHJ A;  2RR9 A;  2ZW1 A;  4E74 A;  2ZCB A;  5L81 A;  4G3X B;  2RVB B;  2JXX A;  2K6D B;  5TSS A;  5I2S A;  1VR9 A;  5KHQ A;  4TQ0 A;  2Z4D A;  3RFZ B;  2BS4 B;  1ZE3 D;  4K3C A;  4L1B A;  5E6P A;  2VH1 A;  3WAM A;  1UWX A;  1Y19 B;  3NVV A;  4LNF A;  4B0E A;  1UGM A;  4HDO A;  1IYF A;  5HE2 A;  2LJ5 A;  1OFF A;  4XE0 A;  4JWS C;  5G5G A;  2X8X X;  5H92 C;  2KT7 A;  3KSY A;  1KJT A;  2O2V A;  5HI1 A;  2LJI A;  1CMX B;  3DWM A;  4N9F 4;  1L2N A;  5H8Y E;  1V8C A;  1T77 A;  3AE9 B;  4KZ0 A;  3NRZ A;  4RM9 A;  1R4M B;  3VVW B;  1E8Y A;  2EKE C;  1ZKH A;  1XLN A;  2JRI B;  4K7W A;  2WWZ A;  2V3S A;  4QJ5 B;  1MHH E;  2WXF A;  4KKJ A;  3ENE A;  3DHG C;  4JQW C;  1C4P A;  1FNU A;  2LGS A;  3BII D;  5HKH A;  1JQ4 A;  3R8B A;  1Y56 A;  4Q2J A;  4KHB B;  1ZVR A;  3AEC B;  4JWU C;  1H8C A;  3W9C B;  2W55 A;  2DHJ A;  2WQY B;  1SE2 A;  2VKI A;  1V5P A;  3A9K B;  2HJ1 A;  3P4Q B;  4HJG E;  1HTO A;  1UNQ A;  2RGN B;  2YRY A;  1QC6 A;  1DOI A;  4DWF A;  2GB1 A;  3I3T B;  3RNG C;  1I2H A;  4D2K A;  2JF5 A;  4KDL B;  3DCG A;  2ONQ A;  2QEJ C;  1UD7 A;  4OHJ A;  2XQN M;  2WLB A;  5JHA A;  1FIQ A;  3L08 A;  4LNO A;  1IGD A;  3KH0 A;  4BFR A;  4W9G A;  1LGR A;  5G55 A;  1EO6 A;  4JL9 A;  3V3X A;  1DOX A;  3ZJT A;  1U5E A;  3RNF C;  4M8M A;  4RFB A;  3Q8F A;  4QJ3 B;  2I38 A;  2N7D A;  2V9H A;  3JW0 X;  5L83 A;  2CY5 A;  3P42 A;  2LOX A;  1WGU A;  2AQ1 B;  4ACF A;  2XN9 C;  1SBB B;  2W3S A;  2CS4 A;  1U5D A;  2ROV A;  3O96 A;  2LOZ A;  4ZYN A;  2JXT A;  3ALB A;  3ZVV A;  3WAN A;  2MBE A;  2AQ2 B;  4AP4 C;  3CMM B;  3DBL B;  1NBF C;  2TSS A;  1T0S C;  1J8C A;  1SE4 A;  3Q8C A;  2RSG A;  4MT5 A;  3RI7 C;  2FJL A;  4HJK A;  1XO3 A;  1LW3 A;  3B2F A;  2RD0 A;  4A20 A;  3SFE B;  3RYT A;  3VXW A;  3NZ3 A;  4W9J A;  4PYU A;  2LYD A;  2V3N A;  3C8Y A;  3GE3 C;  1TS5 A;  4WUR A;  3RCP A;  2CJN A;  4IOI E;  2INN E;  3IG3 A;  4ANV A;  2WX0 A;  1XEE A;  2MRP A;  2QCZ A;  2M4N A;  2PMV A;  3MC8 A;  1TKE A;  3PS6 A;  4L1R A;  5GMV A;  1B9R A;  4EZK A;  3DXE A;  3LB8 C;  3PV1 A;  1T0Y A;  2LVP A;  2NVU I;  4HEA 1;  2WXK A;  4ZDV A;  2RSU A;  1P3R A;  1WI0 A;  4DK5 A;  2K2J A;  1TKG A;  2G1E A;  3X23 A;  3P63 A;  3EGR A;  2FCS A;  1V9J A;  1FM0 D;  5L95 C;  1WMH B;  1E9M A;  1ZW7 A;  2L76 A;  3SO6 A;  5AEK B;  4GXB A;  2VSZ A;  2COC A;  3NZU A;  2YEP B;  1C4C A;  1N61 A;  3T06 A;  2KTR B;  2E2X A;  3V61 A;  2Q13 A;  3MDB C;  1J7A A;  1V5M A;  1Q10 A;  2LG1 A;  2UYZ B;  2G3Q B;  3UI3 A;  1V86 A;  4MSQ B;  2IGG A;  2MSE D;  3IT6 B;  4OZC A;  4ARC A;  3RN9 C;  2ACZ B;  3ULC A;  1UUP A;  2GMI C;  4LDT B;  4TQ1 A;  4PYZ A;  2N0Y A;  4A90 A;  3KUC B;  2KDE B;  2K5P A;  4ICV A;  4HHV A;  4ITK A;  1MAI A;  5IO9 A;  2D9Z A;  2IPK D;  4HVB A;  2CAY A;  1E7U A;  3AU4 A;  1UF0 A;  2CY4 A;  4BOS C;  2N7J A;  5DH9 B;  1AWE A;  4I6P A;  4LJO B;  1GC7 A;  2KJH B;  4LK0 M;  1M94 A;  2L1C A;  4QXA B;  2N0S B;  2M19 A;  4ICU A;  2N7E A;  3AEB B;  1XLQ A;  5LLI A;  2MX2 A;  1VDV A;  3AEG B;  2QHO A;  3DHI C;  4L2Y A;  2QIE B;  3QX1 A;  1ROE A;  3AE7 B;  3FSS A;  5IN7 A;  1MVK A;  3Q8B A;  1TBE A;  4IM3 A;  1OQY A;  3SFD B;  1N3H A;  2KFJ A;  2G45 B;  4GU2 A;  4NPN A;  3PSC A;  3L0W B;  1SIJ A;  1UZX B;  3BYY B;  1PFD A;  2VRR B;  4WJ7 A;  1T3Q A;  1FCC C;  2CU1 A;  3P4S B;  3VR8 B;  5FK9 C;  4MH0 E;  2WU5 B;  3PLV A;  1JRP A;  4HRO A;  1PQS A;  1W1H A;  2CHZ A;  2PLP A;  2KWD A;  4W9H A;  3VH4 B;  4KHB A;  1RFA A;  1JML A;  3ZVR A;  3NWD A;  2J0J A;  3FVC A;  3RUL A;  2C7N B;  1BUI C;  3H7P A;  2WU2 B;  3A9K A;  4XDD A;  4BZA A;  1Y5O A;  4N59 A;  3VQI A;  3I63 C;  1AQC A;  3WIM A;  1WRI A;  3J9C A;  4HPP A;  4ANU A;  2LVQ A;  4GDL A;  3P1M A;  5G5H A;  2MLB A;  3TIX A;  3T8M A;  2MJD A;  2RRF A;  2KDI A;  4JPS A;  3PZ7 A;  4GZU A;  2ICI A;  4RMA A;  2BYF A;  4GLS C;  5LXI B;  1XKE A;  5TR5 A;  1KOT A;  4RGM A;  1V1P A;  4MSM B;  1BML C;  2K6Q A;  1RRB A;  1PGB A;  2J0K A;  3WAO A;  4WQO B;  4DX9 0;  2H7D A;  4FJV B;  1QT9 A;  1KM7 A;  1J19 A;  2ZCC A;  5C6R A;  5FKA C;  3PO0 A;  2P8V A;  4B6H A;  3ZQ4 A;  3CIR B;  1SGH A;  5J3Q A;  1D5X C;  1ZXI A;  2MWN B;  2KK8 A;  1VJK A;  4ZRJ A;  5E6J A;  3BK2 A;  3VTV A;  2PKO A;  3PRZ A;  4I6N B;  3ZDM C;  2KX3 A;  4L6E A;  1UBQ A;  1WXQ A;  1JRO A;  3GS2 A;  3SHQ A;  1YNT E;  3HM3 A;  1MIX A;  4K81 A;  4F7Z A;  2WXR A;  3QCA A;  5M4Y B;  3B08 A;  4TKN A;  4EFO A;  2WXO A;  3BVG A;  5FR6 A;  2D07 B;  1WXA A;  2JX5 A;  1OEY A;  2JY6 A;  2MKR A;  2JSV X;  2JUO A;  3ZKJ C;  3Q8E A;  5CHW A;  4II2 B;  1R4N I;  3TJP A;  4NAM A;  3OAW A;  2KC1 A;  4XDC A;  2DFK A;  2AQ3 B;  3VDZ A;  3W2D A;  3ZNZ B;  4MY6 A;  3GZN I;  1MI1 A;  3OJ4 B;  2AYO B;  5BO4 B;  1KLV A;  1WJ6 A;  1WMH A;  5I4D A;  3NOB A;  2L0T A;  3TMP B;  3ETR A;  2KQ4 X;  2Z8L A;  2DYN A;  3VFK A;  2I1K A;  1T5X D;  2BKR B;  3HM6 X;  1UPQ A;  1ACC A;  3D32 A;  2D3C A;  1P3Q U;  1K53 A;  3FIL B;  1TZO A;  1IRS A;  2KTR A;  3BZD B;  4KX6 B;  2VRW B;  2JZ3 B;  5C5B A;  4NAW B;  4KGS A;  2GS0 A;  2MWS B;  2NPT B;  2ZNV C;  2HE7 A;  2R2O A;  3RD2 A;  1WJ1 A;  4BBK A;  2JYT A;  3KUD B;  3W5U B;  4J3O D;  1OQQ A;  4NQL B;  1SB3 C;  5BMG A;  2FBW B;  2L8J A;  4W9C A;  5EE1 A;  2L05 A;  2LEK A;  2KOX A;  2ZW0 A;  1OMW A;  3E9S A;  2FUH B;  3SDL C;  3C19 A;  3H6N A;  2DYQ A;  4ZOH C;  5LG4 B;  2PE9 A;  2HDE A;  2VZK D;  2G4S A;  1N5W A;  2KO3 A;  2V4I B;  4K7S A;  1WF9 A;  1U27 A;  1YOV B;  4NSW A;  1I4P A;  2ELB A;  1K8R B;  5IRS A;  4DHJ D;  3DPD A;  1R4M I;  2IYD B;  3D8D A;  2BCJ A;  1WGY A;  1L7Y A;  4M02 A;  2MJE A;  3F5R A;  3BVM A;  1S3S G;  2I5C A;  2D9Y A;  1XD4 A;  2DAF A;  3ODX A;  4WQM A;  2YS3 A;  1V88 A;  3DVN U;  4GMV A;  2LMC A;  3TUO A;  4KKI A;  1KRH A;  2HJ8 A;  2QIL A;  3ZRF A;  1GB4 A;  5HE0 A;  5KQ4 A;  1WIA A;  4FJZ A;  1NVI D;  4CQN A;  3Q3O C;  3ZUN A;  5EE3 A;  2M17 A;  4ZRP A;  1NEK B;  4W9K A;  1U29 A;  1V1O A;  2GI9 A;  1BAK A;  3HSA A;  3ZTC A;  3EFU A;  4B9K A;  2ZPY A;  2DZJ A;  4G50 A;  2K2U A;  3E56 A;  1UEL A;  2NZ8 B;  2KCJ A;  5AUK A;  1Z5S B;  2GBN A;  2D4Q A;  3ZNG C;  1I4X A;  4PK1 A;  3AED B;  3FM8 C;  3P4R B;  3EUB 2;  2M38 A;  1RM6 C;  1MFW A;  4OSN A;  2R09 A;  1FNW A;  1KLG D;  5DHF B;  2H7E A;  1HTQ A;  4IW0 A;  1U5G A;  1W1G A;  1NYR A;  2LGI A;  1JCK B;  2LXC A;  3IVF A;  3PVL A;  4M01 A;  2WXQ A;  1WG7 A;  3GB1 A;  4AJY B;  1N6Z A;  2N9K A;  4YT0 B;  3N1Y C;  3AE5 B;  3P7Z A;  1TZ1 A;  3CXB B;  3S2A A;  3MC9 A;  4AJW A;  2J52 A;  2C5L C;  2KMM A;  2KDM A;  4TV3 A;  1VZ8 A;  2JRH A;  3VOQ A;  1E8Z A;  2KN5 A;  3NZS A;  3RNC C;  3V62 A;  1R4N B;  3LJU X;  4BAX A;  4K1R B;  1JRU A;  1E90 A;  1RAX A;  2WXI A;  1V81 A;  4ZHO A;  4HSI A;  2DNF A;  2PTL A;  5LON B;  4RF0 A;  5C3J B;  3A9J B;  2K25 A;  4HAY B;  5J2R A;  1HXY D;  4FHK A;  1YQ4 B;  2GLS A;  2Z0Q A;  2DKQ A;  3VHT C;  1WGQ A;  2M14 A;  2X38 A;  1I7H A;  3VUX A;  2YSZ A;  2J42 A;  1SE3 A;  5D3W A;  1R7S A;  2RNR B;  1RYJ A;  2ASQ A;  1E8X A;  2FIF A;  2FE8 A;  2DHI A;  1EU4 A;  1WXV A;  1X1M A;  2CRF A;  1BTK A;  5AZF A;  3VUY A;  1FB8 A;  1WE6 A;  4KZC A;  3BYT B;  1RWS A;  3NVY A;  1WGH A;  3P2B A;  5BMH A;  1FHW A;  3N1Z C;  1GUA B;  3R7R A;  2DX5 B;  2H88 B;  2W3R A;  2YT0 A;  1WX7 A;  2D10 A;  1WRD B;  2WDQ B;  5J3T A;  1J7B A;  4M0W B;  2QJL A;  3V60 A;  3O13 A;  1MJD A;  4XWW A;  4FXC A;  1Y8R C;  2N1V A;  4HAW B;  2PVO D;  3FC4 A;  3HVD A;  3FKY A;  4JLC A;  4W9D A;  3F0W A;  4P7I A;  3FIL A;  3TW1 A;  2W2X D;  2FCN A;  2NR2 A;  4WJP A;  2OQB A;  2WYQ A;  1C78 A;  1GB1 A;  5KQ1 A;  1GAQ B;  2LGX A;  2M8S A;  5GXG B;  4NAW A;  2OOB B;  5JHH A;  1X1F A;  3JVZ X;  2ELA A;  1YD8 U;  2D9X A;  2BS2 B;  2D3B A;  2L7R A;  2NPT A;  2FAZ A;  2KWV B;  4MH8 A;  3FEH A;  2XNA C;  5HFY A;  1EM7 A;  2DAJ A;  4OZB A;  4RNA A;  2P0H A;  3U12 A;  1FFU A;  2DYM A;  1MPE A;  2K22 A;  4US8 A;  1UPR A;  3W1Y A;  2JVC A;  3H7P B;  2MBO A;  1GPX A;  1P5T A;  2BTE A;  5LNK 1;  1ZC4 B;  2KX0 A;  1YJJ A;  2HTH B;  1IBX B;  3NUH B;  4LTU A;  1TY0 A;  5D6J B;  3PVU A;  1KLU D;  2G4D B;  4GDL B;  2LUM A;  4EOY A;  1HA5 A;  4NQK E;  1WGG A;  5I2M A;  3SUZ A;  2R0D A;  1E7P B;  2J59 M;  3ZNH B;  1JWM D;  4IM0 A;  1V1P B;  4XWX A;  1T6B X;  2WDT B;  1EF1 A;  2Y3A A;  2KAJ A;  2J53 A;  2BVC A;  3L17 A;  1G6J A;  1DRO A;  2SEB D;  2HTM E;  4FAD A;  2I1J A;  1N63 A;  4IC7 B;  1YQ3 B;  4A9A A;  4KSL C;  3N30 A;  4DQO C;  2UZR A;  2QKL A;  4ZRQ A;  1C9F A;  3P6A A;  2BKF A;  3IXS A;  4HB2 B;  5CLQ B;  4DBG A;  5D2M B;  3DCX A;  5G2N A;  4AQ7 A;  4R3D A;  2LUE A;  2JQR B;  3TEW A;  2COD A;  4J6I A;  3LXF A;  4YTP B;  3PG7 A;  4QAY A;  1L6V A;  3HRD D;  2KGX B;  3NWA A;  1VD2 A;  2QMT A;  3TL5 A;  3QA8 A;  2KR0 A;  4F7H A;  2PE6 B;  1NTV A;  1ZXH A;  3ABV B;  1E10 A;  2UVM A;  1PMS A;  2P0F A;  4EKU A;  4W9L A;  3URY A;  3V05 A;  1X05 A;  4JIO U;  2OED A;  1K5D B;  5CX3 A;  3ZJU A;  1XF5 L;  2JZP A;  1Z2M A;  4GPT B;  3MJW A;  5FI0 A;  5D3V A;  2Z59 B;  2O6V D;  5BMI A;  1D4B A;  4B6W A;  2BPS A;  3RZF A;  5FR3 A;  2GJY A;  2AL3 A;  3ZJV A;  3HIZ A;  5BYS A;  1WZ0 A;  3QJZ A;  2DBY A;  3DBH I;  3VUW A;  4A5K A;  5EE9 A;  1V61 A;  4WWN A;  1FRR A;  2LWP A;  1Q1O A;  3U7D A;  2L3Z A;  1B1Z A;  2NTS A;  3ZDT A;  3N20 C;  5D3Y A;  4XZ4 A;  4F7G A;  1ET9 A;  2BGF A;  2I5F A;  1MK7 B;  4HAT B;  3HHM A;  3A9J A;  2LHD A;  4MGI E;  4PNK A;  3MTN B;  2N4F A;  2BB5 A;  1V97 A;  4IWQ A;  3QBV B;  2VZK B;  1F77 A;  3Q3F A;  3U7Z A;  1WJN A;  3D8E A;  2YF0 A;  1P0R A;  4GOU A;  5C5B B;  2DHZ A;  4DHJ B;  2AL6 A;  2PPH A;  1M7E A;  1V89 A;  1CZP A;  4O1N A;  3D8F A;  2IO3 B;  4RH6 A;  4EEW A;  3RNE C;  2D2Q A;  1SXT A;  2IY1 B;  3AJ4 A;  2H89 B;  2WHI A;  1FGY A;  2X18 A;  2E6X A;  2KAC A;  1L4Z B;  2KFK B;  3AXC A;  1WFY A;  2CKH B;  3ML8 A;  1HE8 A;  3EC8 A;  2HD5 B;  2KNB A;  3ML4 A;  3ZIM A;  2R2Y A;  2DX5 A;  2CR5 A;  5JH5 C;  1FPY A;  1FGZ A;  2BB6 A;  1WM3 A;  3DBR B;  2WXH A;  1WJ4 A;  4HKQ A;  2BS3 B;  1TTN A;  4ZYS A;  1TS4 A;  4M0W A;  2DA0 A;  3OWE B;  4MAC A;  3PRM B;  5DPS A;  1XXG A;  3ZYY X;  2RDH A;  3M63 B;  1GC6 A;  1NI2 A;  1DGJ A;  2Z0O A;  4E3C A;  3PEG A;  3Q3J A;  2BBC A;  2L52 A;  3AEF B;  2EC1 A;  3BK1 A;  1B55 A;  3R2T A;  2CHW A;  2E3T A;  1J0W A;  4M00 A;  4OVV A;  4FJY A;  4DDG D;  1EVH A;  1HZ5 A;  1WY8 A;  2LXA A;  4L23 A;  4RM8 A;  3KYD D;  4WJQ A;  4IWO A;  4KHA A;  5HE3 A;  2XK5 B;  2D9W A;  3ULB A;  4YSZ B;  5J3Y A;  4CSQ A;  1I4H A;  2KLC A;  2W2X C;  4H2A A;  4FUL A;  5IP4 D;  3Q2A C;  4KSK C;  2D3G A;  4C56 C;  1K51 A;  4ZRK A;  4K2P A;  2HTH A;  1IBX A;  1WSP A;  3HUI A;  1PGX A;  2BYT A;  2KVZ A;  3SEB A;  2A5U A;  3IAS 1;  1P1A A;  4KDI C;  2ROZ B;  1UGJ A;  2Y5P A;  1H4R A;  2PVG C;  2W54 A;  2MQJ A;  3UGB B;  3ZXV A;  5DPW A;  2ZJD A;  4E71 A;  1QQG A;  5C16 A;  2V1Y A;  3QAQ A;  4REZ A;  4K7U A;  3VTW A;  2ADZ A;  2ZVN A;  1FRD A;  3OAN A;  1OQN A;  1TQZ A;  3P4P B;  3KW5 B;  2GRI A;  4LJP B;  4TSS A;  1AWD A;  2R2Q A;  3DXC A;  4C80 A;  2MJ3 A;  3OG5 A;  1DDM A;  2VH2 A;  5HG2 A;  4HKZ E;  2NMQ A;  4MK0 A;  3H7S A;  1TGZ B;  3RPF C;  1ZOY B;  4X57 B;  2RPQ A;  2MCN B;  1BXT A;  3DBH B;  3M3J A;  4MGZ E;  1FD6 A;  1QQR A;  3NG0 A;  2WXG A;  3AEE B;  4CHJ A;  2J7Q B;  2DX1 A;  2COF A;  5D3I B;  3PRE A;  5E6N A;  1D6E C;  1MPH A;  2K49 A;  4HRS A;  1TJE A;  3HW2 B;  2JZZ A;  3A58 A;  2PJH A;  1H10 A;  4DXG A;  1PGA A;  3G9W A;  2K39 A;  1OQR A;  3M62 B;  1E6E B;  4TYZ A;  4URK A;  1NEN B;  3I5J C;  2EMT A;  1PLS A;  1FHX A;  2MDX A;  2YLM A;  1I4G A;  2Z59 A;  1QOF A;  2LKO A;  2J4X A;  1XLO A;  1W1D A;  3U8Z A;  2IGD A;  3CSF A;  3A8Q A;  2KD0 A;  2RGF A;  4DHZ B;  2JPH A;  4BKS D;  2W82 A;  4HAZ B;  4K2O A;  2KQ7 A;  4DBB A;  2RUK B;  2KAN A;  4MM3 B;  3BIN A;  1OEY J;  2UWQ A;  2YT1 A;  3KWV A;  3O65 B;  2DN6 A;  3TFM A;  3NJT A;  3APC A;  3PRP B;  3MPX A;  3GOE A;  2LGD A;  1AN8 A;  2QKM A;  3R66 C;  3OLM D;  5EE0 A;  2IDY A;  4IAP A;  3OJ3 A;  1DOY A;  3TSS A;  4JGH B;  2KJR A;  4OT1 A;  3KWL A;  3CF6 E;  1WE7 A;  4HB0 B;  4IDI A;  3UF8 A;  3QHT A;  1QOG A;  1HZ6 A;  2DLB A;  1YIW A;  4B0M A;  1KF6 B;  3AH7 A;  1LFD A;  3WCQ A;  1YX5 B;  4EUT A;  4HK2 A;  4WSF A;  5J18 A;  2DTC A;  4CHK A;  3A33 B;  4WJO A;  2KFK A;  4FN2 A;  1T0Q C;  2LRW A;  2XEW A;  5JXV A;  3KRX A;  3PT2 B;  3ODO A;  3WYF B;  1OY2 A;  1TS3 A;  3AE8 B;  1OTR B;  1D3Z A;  2R61 A;  2BF8 B;  2L0F A;  3C0R B;  3CIK A;  2I2Y A;  2KN4 A;  5C79 A;  2WNM A;  4US9 A;  4IKG A;  1VZ6 A;  1MKE A;  3PGE A;  4AUQ C;  1FMA D;  3KUZ A;  1TXD A;  4H8S A;  4HB4 B;  1C4A A;  1WGK A;  3LYY A;  3VRA B;  1XCG A;  3ONS A;  2LD9 A;  3DWG C;  4RGN A;  4YXD B;  3Q14 C;  4WAA A;  5JLJ B;  3H1U A;  3QWZ B;  3U4E G;  1QLB B;  2AX5 A;  3TEY A;  3UIO B;  5HE1 A;  4WWO A;  1V5U A;  2XK5 A;  4IG7 B;  3IAM 1;  4RGO S;  2C7M B;  2O6V B;  2V76 A;  3DDC B;  2Y8F A;  4NJ7 A;  3PPA A;  3VH3 B;  1HEZ E;  4RGT A;  2DYO A;  3N1X C;  1WI1 A;  1E5W A;  4N58 A;  4MEL A;  1UNR A;  4P1C C;  4ANX A;  3AE1 B;  1T0R C;  2JYE A;  2WDV B;  2EKI A;  5EFX A;  2INC C;  4G11 A;  3DQV A;  4QJ4 B;  3ZO5 B;  1N5X A;  3GYP A;  1QIL A;  1FXA A;  3BY4 B;  3CWI A;  3AI5 A;  3A98 B;  5CHV C;  1L5P A;  2CJO A;  1YN5 A;  2D9V A;  1U4A A;  4GSW A;  4P6V F;  4XC2 A;  2IO1 B;  1LB1 A;  2NBV B;  4YSY B;  1CK1 A;  2Y5C A;  2RDB C;  5DCN A;  1ENF A;  1S1Q B;  3VTU A;  4KIK B;  4C0A A;  4PS3 A;  3UQA A;  3LDZ E;  3W5V B;  3QAR A;  2IYB A;  5CHF A;  1SF0 A;  1WX8 A;  3M1I B;  3JSV A;  4A6F B;  3TEZ A;  1WR1 A;  2FID A;  4DIX A;  1UNS A;  3IHP C;  3BVZ A;  4PS8 A;  1YJ1 A;  4OW0 A;  1L0Y B;  3ZGZ A;  3AV8 A;  2C9W B;  5CLL B;  3U2S C;  5JHB A;  1PDX A;  2MW5 A;  4LLG M;  2KDF B;  1WR6 E;  1WGD A;  2IGH A;  2B76 B;  2KC2 A;  1V6E A;  4YON A;  2GBR A;  3KZ1 A;  1E8W A;  4C7Y A;  1F0Z A;  3RZW C;  2RMM A;  1X11 A;  1FHO A;  2K8B A;  2KHW B;  1BWN A;  1JWA D;  3B0A A;  1RFK A;  2ZKM X;  1WJU A;  1XCT L;  1K5G B;  3KY9 A;  2BQQ A;  1F1H A;  4PT5 A;  4MEM A;  3PZ8 A;  2K00 A;  4HAV B;  2A4Z A;  3PHW B;  2UZS A;  4HXD A;  1AW7 A;  1UNP A;  1I35 A;  5D7G A;  3HK0 A;  2WXL A;  3PTF C;  4MM3 A;  3KRW A;  1EWC A;  3NVW A;  1F2R I;  5AZH A;  4GNK B;  5LOP B;  2K0P A;  2PW9 A;  4KAX B;  1F9J A;  4F1S A;  3GYO A;  1U2B A;  5BYR A;  3Q3M C;  3AN1 A;  3A4R A;  4FLH A;  1WJM A;  2MBQ A;  3A4S C;  1Z87 A;  3MHS D;  4EMO A;  2V0G A;  2DZI A;  1IP9 A;  3UIP B;  4DHZ E;  4NY0 A;  1SJE D;  1WX9 A;  5E6O A;  2KMC A;  2NS5 A;  2Y5B B;  1JWU D;  3V6E B;  2KIE A;  4FBJ B;  2MP2 B;  2OHF A;  4K17 A;  1GJZ A;  5DIF B;  1IUE A;  3L54 A;  1X1G A;  2KJ6 A;  1KZ7 A;  3HQC A;  4HB3 B;  1XX0 A;  4LNI A;  1SJH D;  3DBR I;  3ZTD A;  3A8P A;  1K52 A;  1XOD A;  1ESF A;  3AE2 B;  2KTF A;  4D6W A;  1ISN A;  1QKZ A;  1DBH A;  1PYW D;  2FUG 1;  2PZ1 A;  3R3M A;  1SE9 A;  5BYQ A;  2MA9 B;  1CQV A;  4HPM B;  1TT5 B;  4P1B C;  4A55 A;  3SU8 X;  4A3O A;  2IZV B;  4C4V A;  2WXJ A;  5FI1 A;  3ECI A;  1MI0 A;  3VRB B;  1UWM A;  4IM2 A;  4YTN B;  3U52 E;  1F2R C;  1KZG A;  1I4R A;  3APF A;  4RF1 A;  2Y8G A;  3WAP A;  2PEA A;  4NNJ B;  1FNV A;  3TEX A;  1NI3 A;  1KFY B;  2K8C A;  2ON8 A;  1C76 A;  1SIF A;  2JWZ A;  3V5W A;  1EF5 A;  1WXM A;  3W1S C;  2KXJ A;  1FCL A;  4BBN F;  2OJR A;  2YT2 A;  4JX1 C;  1AYF A;  1NU2 A;  4DX8 A;  4WAF A;  1P6S A;  4DDI D;  3L13 A;  2GBK A;  4EE2 A;  1XD3 B;  4MJS A;  1FXT B;  2DLW A;  1HQR D;  3DVG X;  3Q6B A;  2WP9 B;  2LFI A;  2O6V A;  2UU7 A;  3NW8 A;  3DHH C;  1C1Y B;  1QOA A;  2Z0E B;  3AUL A;  1JAL A;  4CO7 A;  2KWU B;  2RPV A;  3EA6 A;  1GOZ A;  2K8H A;  2EMS A;  3ZRC A;  3JYU A;  3L10 B;  1OGW A;  1WWT A;  3QWM A;  4RCO A;  2KWC A;  2DYB A;  2MFQ A;  2QC8 A;  3Q3N C;  2K1F A;  2WXN A;  1ZSQ A;  5D27 A;  2NBV A;  1Q5W B;  1FFV A;  2BWE S;  1UBI A;  1NYQ A;  2IBI B;  4KIK A;  2WX1 A;  1XT9 B;  4MT7 A;  1KTK A;  1MG8 A;  2V4L A;  2N9P C;  2REX A;  1BT0 A;  2GBM A;  3GE8 C;  1Q0W B;  5JZE B;  2G35 A;  2FNJ B;  1LXD A;  2DWQ A;  4A6F A;  4Z2M B;  4HDQ A;  2YS5 A;  1TIF A;  4GMX B;  4W9I A;  2W2W A;  4HPL B;  1NDD A;  3MP9 A;  4XGA B;  1XR0 B;  3AE6 B;  1RJ2 A;  1SHC A;  1CJE A;  2M0X A;  1LQB A;  4HAU B;  2WGS A;  4CYE A;  3KLS X;  4EZJ A;  1P7E A;  4D0N B;  3N32 A;  3U30 A;  4BKT A;  4YTM B;  2NMB A;  3L4P A;  4ANW A;  4GDK B;  1C79 A;  4IFS A;  1YX6 B;  4FA6 A;  1J7C A;  1V49 A;  2NBW B;  1WH3 A;  1JW9 D;  3K9P B;  1QF6 A;  2L00 B;  4PS7 A;  2C60 A;  4A3P A;  3L16 A;  1ZM0 A;  3PZD A;  1E0Z A;  1TYG B;  2B3A A;  1WVH A;  4K3B A;  4HWI B;  4IOY X;  3AU5 A;  1I42 A;  4XYC A;  3T3N A;  2LI5 A;  2LZ6 A;  4A8X C;  4TUU A;  2P0D A;  2GCL A;  3NY5 A;  1TKY A;  2M0A A;  1PUT A;  3PP2 A;  2N9X A;  4C7Z A;  5JP4 A;  1JWB D;  4EZL A;  1LO5 D;  2DZM A;  3TBL D;  4LCD E;  1DYN A;  1UEF A;  4AWJ A;  3AMZ A;  1L0X B;  1F52 A;  1TS2 A;  5AUI A;  2YVC A;  3HVZ A;  1A5R A;  1VLB A;  4USA A;  3ZNI D;  3T9L A;  5CTR C;  3AE4 B;  4S0R A;  3RNB C;  1BTN A;  2L83 A;  3WAL A;  2GOW A;  2MP2 A;  3KVF B;  3NSU A;  3AE3 B;  2DEN B;  4LNN A;  3R2I A;  2QDF A;  3B77 A;  3DOW A;  2YEP F;  3EFC A;  1N60 A;  5AZG A;  5KHO A;  2KQS A;  4NJ6 A;  3DVN V;  5IOI A;  3NWF A;  4AOF A;  2NBU A;  4OZA A;  2KYW A;  3VIA A;  4WJN A;  4ZRI A;  2GBJ A;  2L32 A;  1EWY C;  4F8C B;  1C3T A;  2LGY A;  5D3D A;  1WZ3 A;  3EHV A;  5C1Z A;  2KZR A;  3UZT A;  4UDU C;  2KKC A;  3MHZ A;  2CU3 A;  1SEB D;  2WS3 B;  5C23 A;  2N23 A;  1DDW A;  2FCQ A;  5GOW B;  3TO1 A;  2L1A A;  3CST A;  4GIV A;  3SV1 A;  2KUQ A;  2JWU A;  1XQQ A;  3AM9 A;  3I57 A;  3ZLZ A;  4C00 A;  5IAA C;  1FXI A;  2WXM A;  1TJ6 A;  4DXF A;  1EU3 A;  4KGR A;  5C2T B;  3V6C B;  2ZVO A;  4ASW C;  4KGT A;  4HAX B;  4MGK E;  4MDK E;  2JU6 X;  3RT3 B;  4NJC A;  2GCJ A;  2IND C;  1SSN A;  3I9V 1;  3LJ3 A;  3JSV B;  3HIE A;  3A1Q B;  4WIP A; 
#chains in the Genus database with same CATH homology
 1WYW B;  1ZGU B;  4M8N A;  1U5F A;  3QIJ A;  3RCZ A;  1P98 A;  5DPT A;  2N1W A;  3QC8 B;  4I6L B;  4F7U P;  2DKP A;  4BKS A;  2Z0D B;  3BJI A;  2YS1 A;  3WA0 A;  4A6H A;  2M1M A;  2ZEQ A;  5J17 A;  4KV2 A;  2OTX A;  5D94 A;  4B95 A;  4HCN B;  3NHE B;  1YQB A;  4WVF B;  4XX5 A;  4IWP A;  2FCM A;  5DHA B;  2RLO A;  2NCN A;  2LVO A;  3QK0 A;  1EAZ A;  2IFS A;  2D11 A;  3PVW A;  4W9F A;  4BKG A;  4KVG B;  1PFJ A;  3UQB A;  1DDV A;  2IO2 B;  3ODW A;  1FOE A;  5JHG A;  2LUL A;  3PLU A;  1LM8 B;  3W1S A;  3DXD A;  4WWP A;  2KDB A;  5DPR A;  4GDK A;  2W9N A;  4MGY E;  2O2V B;  2ZZP B;  2DZK A;  2KUP A;  3NS8 A;  4FHJ A;  3PHX B;  1M7R A;  1Q67 A;  1MIZ B;  2JP2 A;  1WGR A;  1IPG A;  1WM2 A;  2KVR A;  3DVG Y;  4Z2N A;  4DXA B;  1X86 A;  3IBE A;  1P9D U;  1V2Y A;  3X0W A;  1V5T A;  2CHX A;  2IO0 B;  1UH6 A;  1V5O A;  2LAS A;  2L2I A;  3SNH A;  1E7V A;  4OVU A;  1RRP B;  4II3 B;  4GOC A;  1RLF A;  4LDT D;  2MBH A;  2KLG A;  3SYX A;  2ZPN A;  3IFW B;  4IUM B;  2BYV E;  1I7A A;  4G0N B;  4MJS B;  3TVV A;  1V80 A;  2LRU A;  1KI1 B;  3QQ8 B;  2AEH A;  2BWF A;  5LXH A;  2EJ8 A;  4EJN A;  3M95 A;  1GNU A;  1WXS A;  4W9E A;  2MBB B;  2BYE A;  2Z0P A;  3APD A;  3DBS A;  3K9O B;  3SD5 A;  5EDS A;  1MK9 B;  3PSE B;  3ZW3 A;  1QZE A;  2C7H A;  3UIN B;  1ZC3 B;  4Y94 A;  3RUI B;  4BOZ B;  2DHK A;  3N7C A;  1NTY A;  1VCB A;  1EUV B;  4GB9 A;  4BBN C;  3TCA A;  2Y7B A;  3ML9 A;  2ZNV B;  1EGX A;  4PQ0 A;  2AWT A;  2IY0 B;  2COA A;  3A1Q A;  3KYC D;  1FAO A;  3B1L X;  4A6K A;  2J0M A;  5KCV A;  4BVU C;  4HLE A;  2XBB C;  3EEC A;  4GGQ A;  3H9D A;  1AAR A;  1J0G A;  3DBL I;  4CHM A;  3R7Q A;  4KHO A;  4YL8 A;  3VAW A;  2N9E B;  3N3K B;  1GG3 A;  2JT4 B;  5DI9 B;  5D3X A;  2KMA A;  5IA7 A;  4HCP B;  4GN1 A;  2RR9 A;  4E74 A;  2ZCB A;  5L81 A;  4G3X B;  2RVB B;  2JXX A;  2K6D B;  5KHQ A;  4TQ0 A;  5E6P A;  3WAM A;  1Y19 B;  4HDO A;  1UGM A;  1IYF A;  5HE2 A;  2LJ5 A;  3KSY A;  1KJT A;  2O2V A;  1CMX B;  4N9F 4;  1L2N A;  4KZ0 A;  4RM9 A;  3VVW B;  1E8Y A;  2EKE C;  1ZKH A;  4K7W A;  2JRI B;  2WWZ A;  2V3S A;  3ENE A;  4JQW C;  5HKH A;  4KHB B;  1ZVR A;  1H8C A;  2DHJ A;  2VKI A;  1V5P A;  3A9K B;  1UNQ A;  2RGN B;  2YRY A;  1QC6 A;  4DWF A;  3I3T B;  1I2H A;  2JF5 A;  4KDL B;  3DCG A;  1UD7 A;  2XQN M;  5JHA A;  3L08 A;  3KH0 A;  4BFR A;  4W9G A;  5G55 A;  1EO6 A;  4JL9 A;  1U5E A;  4M8M A;  2N7D A;  3JW0 X;  5L83 A;  2CY5 A;  2LOX A;  1WGU A;  2CS4 A;  1U5D A;  2ROV A;  3O96 A;  2LOZ A;  4ZYN A;  3ALB A;  3ZVV A;  3WAN A;  2MBE A;  4AP4 C;  3CMM B;  1NBF C;  1J8C A;  2RSG A;  2FJL A;  4HJK A;  1LW3 A;  2RD0 A;  4A20 A;  3RYT A;  3VXW A;  4W9J A;  4PYU A;  2LYD A;  3RCP A;  4ANV A;  3IG3 A;  2WX0 A;  2MRP A;  2M4N A;  3PS6 A;  5GMV A;  4EZK A;  3DXE A;  3PV1 A;  1T0Y A;  2LVP A;  2NVU I;  4ZDV A;  2RSU A;  1P3R A;  1WI0 A;  4DK5 A;  2K2J A;  3X23 A;  2FCS A;  1V9J A;  5L95 C;  1WMH B;  1ZW7 A;  2L76 A;  3SO6 A;  5AEK B;  4GXB A;  2VSZ A;  2COC A;  3NZU A;  3T06 A;  2KTR B;  2E2X A;  3V61 A;  2Q13 A;  3MDB C;  1V5M A;  2LG1 A;  2UYZ B;  2G3Q B;  1V86 A;  4MSQ B;  2MSE D;  3ULC A;  2GMI C;  4LDT B;  4TQ1 A;  4PYZ A;  2N0Y A;  3KUC B;  2KDE B;  4ICV A;  4HHV A;  1MAI A;  2D9Z A;  4HVB A;  2CAY A;  1E7U A;  3AU4 A;  2CY4 A;  4BOS C;  5DH9 B;  1AWE A;  4I6P A;  4LJO B;  1GC7 A;  2KJH B;  1M94 A;  2L1C A;  4ICU A;  2N7E A;  5LLI A;  2MX2 A;  2QHO A;  3QX1 A;  3FSS A;  1TBE A;  4IM3 A;  1OQY A;  1N3H A;  2KFJ A;  2G45 B;  4GU2 A;  4NPN A;  3PSC A;  3L0W B;  1UZX B;  2VRR B;  4WJ7 A;  2CU1 A;  4MH0 E;  3PLV A;  1PQS A;  1W1H A;  2CHZ A;  4W9H A;  3VH4 B;  1RFA A;  3ZVR A;  2J0J A;  3RUL A;  2C7N B;  3H7P A;  3A9K A;  1Y5O A;  3VQI A;  1AQC A;  3WIM A;  4ANU A;  2LVQ A;  4GDL A;  3TIX A;  2MLB A;  3T8M A;  2KDI A;  4GZU A;  4RMA A;  2BYF A;  5LXI B;  1XKE A;  5TR5 A;  1KOT A;  4MSM B;  2K6Q A;  1RRB A;  2J0K A;  3WAO A;  4WQO B;  4DX9 0;  2H7D A;  4FJV B;  1KM7 A;  1J19 A;  2ZCC A;  5C6R A;  2P8V A;  4B6H A;  1SGH A;  5J3Q A;  2MWN B;  2KK8 A;  4ZRJ A;  3VTV A;  3PRZ A;  4I6N B;  3ZDM C;  2KX3 A;  4L6E A;  1UBQ A;  3SHQ A;  3HM3 A;  1MIX A;  4K81 A;  4F7Z A;  3QCA A;  3B08 A;  4TKN A;  4EFO A;  5FR6 A;  2D07 B;  1WXA A;  1OEY A;  2JY6 A;  2MKR A;  2JUO A;  3ZKJ C;  5CHW A;  4II2 B;  1R4N I;  3TJP A;  3OAW A;  2KC1 A;  2DFK A;  3VDZ A;  3ZNZ B;  4MY6 A;  3GZN I;  3OJ4 B;  2AYO B;  5BO4 B;  1KLV A;  1WJ6 A;  1WMH A;  3NOB A;  2L0T A;  3TMP B;  2DYN A;  3VFK A;  2I1K A;  2BKR B;  3HM6 X;  1UPQ A;  3D32 A;  1P3Q U;  1IRS A;  2KTR A;  2VRW B;  2JZ3 B;  5C5B A;  4NAW B;  2GS0 A;  2MWS B;  2NPT B;  2ZNV C;  2HE7 A;  2R2O A;  3RD2 A;  1WJ1 A;  4BBK A;  3KUD B;  4NQL B;  2L8J A;  4W9C A;  2L05 A;  2KOX A;  1OMW A;  2FUH B;  3SDL C;  3H6N A;  2DYQ A;  2PE9 A;  2G4S A;  2KO3 A;  4K7S A;  1WF9 A;  1U27 A;  4NSW A;  2ELB A;  1K8R B;  4DHJ D;  3DPD A;  1R4M I;  2IYD B;  2BCJ A;  3D8D A;  1WGY A;  1L7Y A;  3F5R A;  1S3S G;  2I5C A;  2D9Y A;  1XD4 A;  2DAF A;  3ODX A;  2YS3 A;  1V88 A;  3DVN U;  4GMV A;  2HJ8 A;  3ZRF A;  5HE0 A;  5KQ4 A;  1WIA A;  4FJZ A;  3ZUN A;  2M17 A;  4W9K A;  1U29 A;  1BAK A;  3ZTC A;  3EFU A;  4B9K A;  2ZPY A;  2DZJ A;  4G50 A;  2K2U A;  1UEL A;  2NZ8 B;  2KCJ A;  1Z5S B;  2GBN A;  2D4Q A;  3ZNG C;  3FM8 C;  2M38 A;  2R09 A;  5DHF B;  2H7E A;  4IW0 A;  1U5G A;  1W1G A;  2LXC A;  3IVF A;  3PVL A;  1WG7 A;  4AJY B;  3P7Z A;  1TZ1 A;  3CXB B;  3S2A A;  4AJW A;  2C5L C;  4TV3 A;  2JRH A;  3VOQ A;  1E8Z A;  2KN5 A;  3NZS A;  3V62 A;  3LJU X;  4K1R B;  1JRU A;  1E90 A;  1RAX A;  1V81 A;  5LON B;  3A9J B;  2K25 A;  4HAY B;  5J2R A;  4FHK A;  2Z0Q A;  2DKQ A;  3VHT C;  1WGQ A;  2M14 A;  3VUX A;  2YSZ A;  5D3W A;  2RNR B;  2ASQ A;  1E8X A;  2FIF A;  2DHI A;  1WXV A;  1X1M A;  2CRF A;  1BTK A;  5AZF A;  3VUY A;  1FB8 A;  1WE6 A;  4KZC A;  1WGH A;  3P2B A;  1FHW A;  1GUA B;  3R7R A;  2DX5 B;  2YT0 A;  1WX7 A;  2D10 A;  1WRD B;  5J3T A;  4M0W B;  3V60 A;  1Y8R C;  2N1V A;  4HAW B;  4JLC A;  4W9D A;  3F0W A;  4P7I A;  3TW1 A;  2W2X D;  2FCN A;  2NR2 A;  4WJP A;  2OQB A;  2WYQ A;  5KQ1 A;  2LGX A;  2M8S A;  4NAW A;  2OOB B;  5JHH A;  1X1F A;  3JVZ X;  2ELA A;  1YD8 U;  2D9X A;  2L7R A;  2NPT A;  2FAZ A;  2KWV B;  3FEH A;  2DAJ A;  2P0H A;  2DYM A;  1UPR A;  3W1Y A;  2JVC A;  3H7P B;  2MBO A;  1P5T A;  1ZC4 B;  2KX0 A;  2HTH B;  5D6J B;  3PVU A;  2G4D B;  4GDL B;  4EOY A;  4NQK E;  1WGG A;  3SUZ A;  2R0D A;  2J59 M;  3ZNH B;  4IM0 A;  4XWX A;  2WDT B;  1EF1 A;  3L17 A;  1G6J A;  1DRO A;  4FAD A;  2I1J A;  4IC7 B;  4KSL C;  3N30 A;  2UZR A;  2QKL A;  3P6A A;  2BKF A;  4HB2 B;  5CLQ B;  4DBG A;  5D2M B;  5G2N A;  2LUE A;  2COD A;  4J6I A;  3PG7 A;  2KGX B;  1VD2 A;  3TL5 A;  3QA8 A;  4F7H A;  2PE6 B;  1NTV A;  2UVM A;  1PMS A;  2P0F A;  4EKU A;  4W9L A;  1X05 A;  4JIO U;  1K5D B;  5CX3 A;  1Z2M A;  4GPT B;  3MJW A;  5FI0 A;  5D3V A;  2Z59 B;  2O6V D;  4B6W A;  2BPS A;  3RZF A;  2GJY A;  2AL3 A;  3HIZ A;  1WZ0 A;  3QJZ A;  3DBH I;  3VUW A;  4A5K A;  1V61 A;  4WWN A;  2LWP A;  1Q1O A;  3U7D A;  2L3Z A;  3ZDT A;  4XZ4 A;  5D3Y A;  4F7G A;  2BGF A;  2I5F A;  1MK7 B;  4HAT B;  3HHM A;  3A9J A;  4MGI E;  4PNK A;  3MTN B;  2N4F A;  4IWQ A;  3QBV B;  3Q3F A;  1WJN A;  3D8E A;  2YF0 A;  1P0R A;  5C5B B;  2DHZ A;  4DHJ B;  2AL6 A;  2PPH A;  1M7E A;  1V89 A;  3D8F A;  2IO3 B;  4EEW A;  2D2Q A;  2IY1 B;  3AJ4 A;  1FGY A;  2X18 A;  2KFK B;  3AXC A;  1WFY A;  2CKH B;  3ML8 A;  1HE8 A;  3EC8 A;  2HD5 B;  2KNB A;  3ML4 A;  3ZIM A;  2DX5 A;  2CR5 A;  5JH5 C;  1FGZ A;  1WM3 A;  1WJ4 A;  1TTN A;  2DA0 A;  3PRM B;  5DPS A;  3M63 B;  1GC6 A;  1NI2 A;  2Z0O A;  4E3C A;  3PEG A;  3Q3J A;  2EC1 A;  1B55 A;  2CHW A;  1J0W A;  4OVV A;  4FJY A;  4DDG D;  1EVH A;  1WY8 A;  2LXA A;  4RM8 A;  3KYD D;  4WJQ A;  4IWO A;  4KHA A;  5HE3 A;  2XK5 B;  2D9W A;  3ULB A;  5J3Y A;  2KLC A;  2W2X C;  4FUL A;  4KSK C;  2D3G A;  4ZRK A;  4K2P A;  2HTH A;  2A5U A;  1P1A A;  4KDI C;  2ROZ B;  1H4R A;  2MQJ A;  3UGB B;  5DPW A;  2ZJD A;  4E71 A;  1QQG A;  5C16 A;  2V1Y A;  3QAQ A;  4K7U A;  3VTW A;  2ADZ A;  2ZVN A;  3OAN A;  1OQN A;  1TQZ A;  3KW5 B;  4LJP B;  2R2Q A;  3DXC A;  1DDM A;  4MK0 A;  3H7S A;  1TGZ B;  4X57 B;  2RPQ A;  2MCN B;  3M3J A;  4MGZ E;  4CHJ A;  2J7Q B;  2DX1 A;  2COF A;  3PRE A;  5E6N A;  1MPH A;  3HW2 B;  2JZZ A;  2PJH A;  1H10 A;  3G9W A;  2K39 A;  3M62 B;  4TYZ A;  4URK A;  2EMT A;  1PLS A;  1FHX A;  2MDX A;  2YLM A;  2LKO A;  1W1D A;  3U8Z A;  3CSF A;  3A8Q A;  2KD0 A;  2RGF A;  4DHZ B;  2JPH A;  4BKS D;  4HAZ B;  4K2O A;  2KQ7 A;  4DBB A;  2RUK B;  2KAN A;  3BIN A;  1OEY J;  2UWQ A;  2YT1 A;  3O65 B;  2DN6 A;  3TFM A;  3APC A;  3PRP B;  3MPX A;  3GOE A;  2LGD A;  2QKM A;  3R66 C;  3OLM D;  4IAP A;  3OJ3 A;  4JGH B;  2KJR A;  3CF6 E;  1WE7 A;  4HB0 B;  3UF8 A;  3QHT A;  1YIW A;  1LFD A;  4EUT A;  1YX5 B;  4HK2 A;  4WSF A;  5J18 A;  2DTC A;  4CHK A;  3A33 B;  4WJO A;  2KFK A;  4FN2 A;  2LRW A;  2XEW A;  3KRX A;  3PT2 B;  3ODO A;  3WYF B;  1OY2 A;  1OTR B;  1D3Z A;  2BF8 B;  2L0F A;  3C0R B;  3CIK A;  5C79 A;  1MKE A;  3PGE A;  4AUQ C;  3KUZ A;  1TXD A;  4H8S A;  4HB4 B;  1XCG A;  3ONS A;  2LD9 A;  4WAA A;  5JLJ B;  3H1U A;  3QWZ B;  3UIO B;  5HE1 A;  4WWO A;  1V5U A;  2XK5 A;  4IG7 B;  2C7M B;  2O6V B;  2V76 A;  3DDC B;  2Y8F A;  4NJ7 A;  3PPA A;  3VH3 B;  2DYO A;  1WI1 A;  1E5W A;  4MEL A;  1UNR A;  4ANX A;  3ZO5 B;  5EFX A;  4G11 A;  3DQV A;  3GYP A;  3BY4 B;  3AI5 A;  3A98 B;  5CHV C;  2D9V A;  1U4A A;  4GSW A;  4XC2 A;  2IO1 B;  1LB1 A;  2NBV B;  5DCN A;  1S1Q B;  3VTU A;  4KIK B;  4C0A A;  4PS3 A;  3UQA A;  3LDZ E;  3QAR A;  2IYB A;  5CHF A;  1WX8 A;  3M1I B;  3JSV A;  4A6F B;  1WR1 A;  2FID A;  3IHP C;  4PS8 A;  1YJ1 A;  2C9W B;  5CLL B;  5JHB A;  2MW5 A;  2KDF B;  1WR6 E;  1WGD A;  2KC2 A;  1V6E A;  4YON A;  2GBR A;  3KZ1 A;  1E8W A;  3RZW C;  1X11 A;  1FHO A;  2K8B A;  2KHW B;  1BWN A;  3B0A A;  1WJU A;  1K5G B;  3KY9 A;  4MEM A;  2K00 A;  4HAV B;  2A4Z A;  3PHW B;  2UZS A;  4HXD A;  1UNP A;  1I35 A;  5D7G A;  3HK0 A;  3PTF C;  4MM3 A;  3KRW A;  5AZH A;  5LOP B;  4KAX B;  1F9J A;  4F1S A;  3GYO A;  1U2B A;  3A4R A;  4FLH A;  1WJM A;  2MBQ A;  3A4S C;  1Z87 A;  3MHS D;  4EMO A;  2DZI A;  1IP9 A;  3UIP B;  4DHZ E;  4NY0 A;  1WX9 A;  5E6O A;  2KMC A;  2NS5 A;  2Y5B B;  3V6E B;  4FBJ B;  2MP2 B;  1GJZ A;  4K17 A;  5DIF B;  3L54 A;  1X1G A;  2KJ6 A;  1KZ7 A;  3HQC A;  4HB3 B;  1XX0 A;  3DBR I;  3ZTD A;  3A8P A;  1XOD A;  2KTF A;  1ISN A;  1DBH A;  2PZ1 A;  3R3M A;  1SE9 A;  2MA9 B;  4HPM B;  3SU8 X;  4A3O A;  2IZV B;  5FI1 A;  3ECI A;  4IM2 A;  1KZG A;  3APF A;  2Y8G A;  3WAP A;  2PEA A;  4NNJ B;  2K8C A;  1SIF A;  2JWZ A;  3V5W A;  1EF5 A;  1WXM A;  3W1S C;  2KXJ A;  4BBN F;  2OJR A;  1NU2 A;  4DX8 A;  1P6S A;  4DDI D;  3L13 A;  2GBK A;  1XD3 B;  4MJS A;  1FXT B;  2DLW A;  3DVG X;  2O6V A;  1C1Y B;  2Z0E B;  3AUL A;  4CO7 A;  2KWU B;  2K8H A;  2EMS A;  3ZRC A;  3JYU A;  3L10 B;  1OGW A;  3QWM A;  2KWC A;  2DYB A;  2MFQ A;  2K1F A;  1ZSQ A;  5D27 A;  1Q5W B;  2BWE S;  1UBI A;  2IBI B;  4KIK A;  2WX1 A;  1XT9 B;  4MT7 A;  1MG8 A;  2V4L A;  2N9P C;  2REX A;  1BT0 A;  2GBM A;  1Q0W B;  5JZE B;  2G35 A;  2FNJ B;  1LXD A;  4A6F A;  4Z2M B;  4HDQ A;  2YS5 A;  4GMX B;  4W9I A;  2W2W A;  4HPL B;  1NDD A;  1XR0 B;  1RJ2 A;  1SHC A;  2M0X A;  1LQB A;  4HAU B;  4CYE A;  4EZJ A;  4D0N B;  3N32 A;  3U30 A;  4BKT A;  2NMB A;  4ANW A;  4GDK B;  1YX6 B;  4IFS A;  4FA6 A;  1V49 A;  2NBW B;  1WH3 A;  3K9P B;  2L00 B;  4PS7 A;  2C60 A;  4A3P A;  3L16 A;  1ZM0 A;  3PZD A;  2B3A A;  1WVH A;  4HWI B;  4IOY X;  3AU5 A;  1I42 A;  2LI5 A;  2LZ6 A;  4TUU A;  2P0D A;  2GCL A;  3NY5 A;  3PP2 A;  2N9X A;  5JP4 A;  4EZL A;  2DZM A;  3TBL D;  4LCD E;  1DYN A;  1UEF A;  4AWJ A;  2YVC A;  1A5R A;  3ZNI D;  3T9L A;  5CTR C;  1BTN A;  3WAL A;  2GOW A;  2MP2 A;  3KVF B;  3NSU A;  2DEN B;  3DOW A;  5AZG A;  5KHO A;  2KQS A;  4NJ6 A;  3DVN V;  4AOF A;  2NBU A;  3VIA A;  4WJN A;  4ZRI A;  2GBJ A;  4F8C B;  1C3T A;  2LGY A;  1WZ3 A;  3EHV A;  5C1Z A;  2KZR A;  3UZT A;  2KKC A;  5C23 A;  2N23 A;  1DDW A;  2FCQ A;  5GOW B;  3TO1 A;  3CST A;  4GIV A;  3SV1 A;  1XQQ A;  3ZLZ A;  5IAA C;  1TJ6 A;  3V6C B;  2ZVO A;  4ASW C;  4HAX B;  4MGK E;  4MDK E;  3RT3 B;  2GCJ A;  3LJ3 A;  3JSV B;  3A1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...