4K81A

Crystal structure of the grb14 ra and ph domains in complex with gtp-loaded h-ras
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
251
structure length
244
Chain Sequence
KKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSAAPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 14
publication title Structural basis for the interaction of the adaptor protein grb14 with activated ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 244
sequence length 251
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4k81A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4k81A01
2IYBA 2D07B 4HXDA 3QJZA 3PLVA 1RAXA 2FCNA 4LJOB 1M7EA 3L08A 4JL9A 1C1YB 1K5GB 4DHZE 1NTYA 3PRPB 3H7PA 1V5OA 1B55A 3F5RA 4A6FB 4K7UA 3UGBB 2IY1B 3L17A 3R7RA 2GMIC 2BYVE 4GMXB 4BBNF 2W2XC 2W2XD 2BYFA 3ZDTA 3F0WA 3W1YA 3SHQA 1WMHA 3VFKA 5JH5C 3UINB 4CYEA 1Q67A 4MY6A 4IC7B 2M14A 1H10A 2KFKB 2K39A 3DVNV 1Z5SB 2D9VA 3A33B 2W2WA 4ANVA 3NS8A 3OAWA 2KXJA 4E74A 3M95A 2G4SA 1PLSA 1WX7A 2N7EA 1YQBA 2O6VB 4ICVA 4GU2A 3V6CB 2JZZA 2ROZB 1GC6A 2DHJA 1MG8A 5EFXA 4NSWA 3H7SA 2KZRA 2D9ZA 2KWUB 4W9KA 1P3QU 3M62B 3A1QB 2ZVNA 2KQ7A 3A4RA 2KX0A 1X1MA 2DFKA 4F8CB 4ANUA 1KLVA 3JVZX 1OTRB 2GJYA 2MA9B 1WH3A 5CLLB 4W9IA 1V6EA 2KLGA 2LRWA 4BFRA 3RYTA 2GCLA 3W1SC 3PVUA 2Y8GA 1PQSA 4IM3A 1NU2A 3ZNZB 4PYZA 3VH3B 3BY4B 2QKLA 2YVCA 3H9DA 3LJ3A 1A5RA 3T06A 1Z2MA 2G35A 2CY4A 4GZUA 2I1JA 1OQYA 2JF5A 4IWQA 2JRHA 3JSVB 3PEGA 2DZIA 3APCA 1NBFC 2DAFA 2NS5A 2EMTA 3PLUA 1J0GA 4IAPA 3R3MA 3ZUNA 4MSQB 2UWQA 5CHVC 2K25A 4WSFA 5JZEB 1E8ZA 2VSZA 4BOZB 4WJNA 3PSEB 4GPTB 3OANA 4M0WB 2FCSA 2YT1A 3IHPC 2K00A 1X1FA 2CKHB 1BAKA 2CRFA 2JUOA 1IYFA 2KANA 3UQAA 3UF8A 4DBGA 4I6LB 4YL8A 3VH4B 2KKCA 5KHOA 5J2RA 1LFDA 4EUTA 3X23A 4CO7A 2GOWA 1E8YA 3NY5A 3CF6E 1V80A 2O6VD 4MDKE 3ZO5B 5GMVA 2M1MA 3EECA 5JHBA 2N4FA 4MJSB 2MBBB 3A4SC 1XQQA 1UNPA 3MTNB 3Q3FA 2ELBA 1RRPB 1WGHA 1WR6E 2L8JA 1Q0WB 3QAQA 3KRWA 1MIXA 4II2B 4BBNC 4GDLB 2KD0A 2DAJA 4W9FA 4AUQC 2R2QA 3KZ1A 3N30A 4NAWB 2DHKA 4FBJB 2PJHA 4HVBA 1R4MI 2N9XA 2JXXA 2COCA 2EKEC 4W9GA 2RGNB 4MGYE 4HB3B 1FB8A 4II3B 5CX3A 2CHWA 2RNRB 4NQLB 1DBHA 4GMVA 4GDKB 2IO1B 2DZMA 4TUUA 1W1HA 3VOQA 1E7UA 4KZCA 4G3XB 3CSTA 2DYMA 3U7DA 5GOWB 5LLIA 4PS7A 1WGRA 2KWCA 5J3TA 2C9WB 2P8VA 4FLHA 1WJMA 4PQ0A 3MJWA 2GBJA 2XK5A 4W9HA 4MELA 3NOBA 4EMOA 3CMMB 2ZNVB 2ASQA 3A9KB 3DOWA 3QA8A 3R66C 5D3XA 4WQOB 1RRBA 1LQBA 3D32A 4IWOA 1S3SG 1OMWA 3MHSD 2YS3A 1MAIA 4FHJA 1MKEA 2WWZA 5J17A 2GBKA 2LGXA 2V4LA 4J6IA 2WX0A 2RVBB 3KH0A 2HD5B 5KHQA 5C1ZA 1GC7A 3L16A 4ICUA 2AYOB 1WGQA 2D11A 1P6SA 3VTVA 5D7GA 2ZPYA 4WWPA 2Z0PA 2ZZPB 2HTHA 1ZC3B 4DXAB 4L6EA 2HJ8A 5C79A 1WXVA 1YD8U 3DVGY 5DPSA 3APDA 2KTRA 4KHOA 4DX90 2QKMA 4HPLB 1WF9A 2FUHB 4CHMA 1NDDA 2J59M 3L0WB 2KGXB 4EFOA 3FM8C 5L95C 2J0JA 3GYOA 4GN1A 1BWNA 3ULCA 1RJ2A 3V6EB 4MT7A 2D9YA 3VUYA 2UZSA 4WWOA 2LOXA 4KSKC 4GSWA 1FHWA 2DHIA 1XX0A 3PT2B 2IO3B 2MQJA 4FJVB 4TKNA 3KY9A 3KUDB 3D8FA 3DCGA 1KOTA 5C6RA 3AXCA 2NPTB 5AEKB 4WWNA 3KRXA 4HDQA 2LGYA 3V5WA 1EO6A 2COFA 1XR0B 4Y94A 3ZVRA 2RGFA 1WX8A 5C23A 2ZNVC 4IOYX 4XZ4A 3U8ZA 2N9EB 2K8HA 3A9JB 4WAAA 2J0KA 4PNKA 3ZNGC 5J18A 2LD9A 1Z87A 4NJ7A 5C5BB 2A5UA 2I1KA 3D8EA 3HQCA 5AZGA 1F9JA 4HPMB 4JQWC 3CIKA 3EHVA 2MLBA 1K5DB 1U29A 4HB2B 2X18A 4W9JA 2NCNA 1WXAA 1WJNA 2AEHA 2L76A 2DN6A 1AWEA 2Z59B 4RM9A 4AOFA 2P0DA 1FXTB 4AJWA 1V9JA 2L3ZA 2C5LC 2LXAA 5G55A 4HB0B 2MP2A 4NY0A 5KCVA 4M8NA 4KZ0A 2GBRA 2DYNA 2P0FA 4KVGB 2GBNA 3VUWA 1H8CA 2D10A 2ZVOA 1NTVA 2KTFA 1OGWA 3ZRCA 1UNRA 2N1VA 3P7ZA 2J7QB 2FIDA 2ZEQA 3PSCA 2P0HA 1OQNA 1VCBA 2KDIA 3TFMA 1FOEA 3PRZA 4TQ0A 2JVCA 4A5KA 4EZKA 4FHKA 1FHOA 2YT0A 2DYQA 3FEHA 2OQBA 4F1SA 4I6PA 1P9DU 4MEMA 4TV3A 4ZYNA 2ZCCA 3DBSA 5E6OA 4F7HA 3ZLZA 1FGYA 5DIFB 4WJQA 1ZSQA 4KHBB 5L83A 3DBLI 2IO0B 1K8RB 3DVNU 2ROVA 4DDID 5KQ4A 3TCAA 1XD3B 4B9KA 1SGHA 3VIAA 2V3SA 1U5FA 2JT4B 2JZ3B 1M94A 2BWES 5TR5A 4DWFA 3QX1A 3JSVA 2BF8B 5JLJB 1P5TA 4DHZB 3NZUA 3ODWA 4W9CA 2MCNB 3R7QA 3HM6X 4JGHB 1KM7A 2KCJA 3PREA 2LASA 4NQKE 1M7RA 1U5EA 4IUMB 2L00B 5E6PA 1Y5OA 1LW3A 1WMHB 2D9XA 5D3WA 2RSUA 4HAYB 2RLOA 3PV1A 5FI0A 1XCGA 2VRRB 2BGFA 3FSSA 1WGDA 2JRIB 3AI5A 3KUCB 2CY5A 5FR6A 5AZHA 3LJUX 2IY0B 2UYZB 3ZRFA 2YS5A 1YX6B 3RZWC 2LOZA 2C7NB 2BCJA 4FADA 2YS1A 1RLFA 2RR9A 4FULA 3VAWA 4X57B 2MKRA 1N3HA 2LGDA 4B6WA 3QC8B 1C3TA 5HE3A 4EEWA 2VKIA 1WYWB 4GXBA 4LCDE 3CXBB 4IW0A 1UBIA 1UGMA 4G11A 2WYQA 3Q3JA 3GYPA 3ML4A 2OJRA 2M8SA 3U30A 3AULA 4GDLA 1I7AA 2MWSB 3SDLC 1P1AA 1KI1B 1WVHA 3ECIA 2ZJDA 2KJ6A 1YX5B 2DYOA 4A6KA 1MK9B 2EJ8A 3DQVA 2DHZA 3KVFB 3D8DA 4DBBA 5DI9B 3IBEA 5LONB 2PE9A 3MDBC 4B95A 1ZKHA 2R09A 2O2VB 1ZGUB 3AU5A 1Y19B 4XX5A 3SV1A 2I5CA 4ZDVA 2KX3A 4HCNB 1DROA 4AWJA 3VTUA 4EZJA 2FCQA 3PGEA 4GB9A 5LXIB 3SYXA 3UIOB 2H7DA 3WAPA 1CMXB 3HHMA 3CSFA 2XQNM 3NHEB 1KZGA 1S1QB 1WJ6A 4KDLB 1XKEA 1UNQA 3M63B 1P3RA 2KDBA 1QZEA 2DKPA 2IZVB 1UPQA 3IG3A 2FNJB 2CU1A 2KWVB 1IP9A 1WJ4A 2PEAA 4JIOU 5J3QA 2KC2A 3TW1A 4BBKA 3ULBA 2REXA 2UZRA 4FJYA 1EUVB 4NJ6A 1EAZA 2NBUA 4IM2A 2E2XA 2NBWB 2L2IA 1DYNA 3A8PA 5C16A 4RM8A 2KK8A 2KDEB 5DPWA 4AP4C 3UZTA 4ZRIA 2IBIB 4HDOA 3ZKJC 3WAMA 1J19A 2FAZA 1PMSA 2N9PC 1VD2A 3X0WA 4K17A 2XBBC 3B1LX 3WANA 2AL3A 2MWNB 1OEYA 2N1WA 4FJZA 5DH9B 1MK7B 3TBLD 2NZ8B 3RCZA 1NI2A 1YJ1A 2C7HA 1SHCA 4IM0A 2V1YA 1Q5WB 3B0AA 1DDMA 2Z0DB 2MRPA 1P0RA 2MBEA 1T0YA 5EDSA 2MDXA 2QHOA 3SUZA 1W1DA 2KJRA 3UQBA 3SD5A 2NPTA 1WGGA 3I3TB 3B08A 1WG7A 5AZFA 1LM8B 1RFAA 1MPHA 2HE7A 1L2NA 2NMBA 5E6NA 5BO4B 3V61A 2L7RA 1TBEA 4CHJA 3UIPB 1UZXB 2K6QA 3VDZA 1Y8RC 4W9LA 1E5WA 5JHGA 2MBQA 3BJIA 1WI1A 2AL6A 3QHTA 2CS4A 3HW2B 4HK2A 3LDZE 3RZFA 5C5BA 1WZ0A 4W9DA 3W1SA 4PYUA 4XC2A 2JY6A 1EF5A 4HAWB 1GUAB 2ZPNA 4DK5A 4A6HA 2DX5B 3EC8A 4B6HA 5D6JB 4WJ7A 2DTCA 2HTHB 2H7EA 1WE7A 2LG1A 1WJUA 2K1FA 3RUIB 1U27A 4BOSC 3VHTC 3L54A 1ZC4B 2EMSA 2G45B 2DX1A 3PRMB 4P7IA 2DENB 1SE9A 1J8CA 5HE0A 2KTRB 1V49A 2AWTA 4A6FA 2KMCA 4F7ZA 1V5UA 4HAUB 3RT3B 1WIAA 3OLMD 5IAAC 3TJPA 3K9PB 1WXMA 2KFJA 4MGKE 3VUXA 3ODOA 3TO1A 2L0FA 4HAXB 4A3PA 1XODA 4BKSD 3WAOA 2L05A 4TYZA 2LVQA 2J0MA 2K2UA 3PVWA 2YSZA 2KFKA 2RPQA 2DZKA 4KIKB 4F7UP 2BKRB 4MM3A 2KLCA 2FJLA 1WM3A 3APFA 4IG7B 1OEYJ 2LI5A 2JPHA 2MBOA 2KNBA 5D2MB 2O6VA 1WR1A 3KW5B 3HIZA 2OTXA 1WY8A 3ZW3A 1WX9A 1UBQA 4WVFB 1BTKA 2Q13A 1XD4A 4KDIC 1DDWA 3PP2A 3HM3A 2RSGA 2JWZA 1V86A 1MIZB 3DXDA 4EKUA 3A1QA 2FIFA 2BKFA 1WGYA 4NPNA 3WYFB 5FI1A 5JP4A 2M17A 4YONA 2W9NA 2WDTB 3PS6A 3DXCA 2NVUI 4GIVA 3PPAA 1BT0A 3T9LA 3RD2A 2N0YA 3VXWA 4C0AA 1E8WA 3A8QA 2KOXA 4FN2A 2BWFA 2KVRA 2KN5A 3V60A 2CHZA 4K2PA 4WJPA 2A4ZA 4MGZE 2MP2B 5HE2A 3ONSA 3ZNID 2K2JA 4EZLA 3H7PB 3KSYA 3EFUA 1FGZA 4EOYA 1V5PA 3M1IB 3MPXA 3AJ4A 5CTRC 1X1GA 3PVLA 4KSLC 4KHAA 4LDTD 3WA0A 2R0DA 3QARA 2IO2B 3T8MA 3GZNI 1X11A 3A98B 3M3JA 2KHWB 2ZCBA 2L0TA 2ELAA 1U5DA 3WIMA 3DXEA 2GS0A 2Y7BA 3OJ3A 4IFSA 5D94A 3DBHI 4KAXB 2K8CA 1OY2A 1IPGA 4OVUA 3SNHA 1IRSA 4HJKA 4HAVB 4RMAA 1J0WA 2YLMA 3ZDMC 3O96A 4MJSA 3QQ8B 4KV2A 3PHWB 2D9WA 2D2QA 4TQ1A 2O2VA 4Z2NA 2GCJA 4HATB 1WJ1A 1D3ZA 1UPRA 1GNUA 5DPTA 3V62A 5D3YA 3RCPA 3HK0A 5DPRA 5CHFA 3TL5A 5LOPB 3PHXB 1GJZA 2Y8FA 2L1CA 4MSMB 4IWPA 3G9WA 2KQSA 4NAWA 4FA6A 4BKGA 1R4NI 3DDCB 4D0NB 3ZIMA 1I42A 3QK0A 2Z0OA 1PFJA 2RD0A 4GDKA 2M0XA 2KMAA 2KDFB 3K9OB 4ASWC 1AQCA 2D3GA 1X86A 3JW0X 1WRDB 2C60A 5CHWA 2K8BA 2N7DA 4HB4B 1AARA 1XT9B 3DBRI 5DCNA 2LUEA 1WGUA 2KUPA 1P98A 1E7VA 4K1RB 1UH6A 1U5GA 1TJ6A 2N23A 3ODXA 2M4NA 3H1UA 3N3KB 2CR5A 1YIWA 1UEFA 3A9KA 2YF0A 4H8SA 3C0RB 1EF1A 2RUKB 2G4DB 4PS3A 3IVFA 4MH0E 3N7CA 1TQZA 1TTNA 4K81A 3KUZA 5CLQB 3DPDA 4DX8A 1WZ3A 4BKSA 2K6DB 2M38A 3PTFC 3P6AA 4AJYB 3NSUA 4CHKA 2V76A 2NBVB 3SU8X 4XWXA 3JYUA 2LWPA 4HHVA 1ZM0A 3PG7A 3TIXA 4NNJB 5JHHA 4JLCA 1QQGA 3N32A 3QCAA 3L10B 3BINA 1E90A 3AU4A 2EC1A 4WJOA 2B3AA 3IFWB 4Z2MB 1LB1A 1TXDA 2MBHA 4I6NB 2VRWB 4ZRKA 4HAZB 1V5TA 1WXSA 1L7YA 2YRYA 1H4RA 3GOEA 2I5FA 3QWZB 2LYDA 2BYEA 1X05A 2LJ5A 4ANWA 3ALBA 2XEWA 4K2OA 5HKHA 5D3VA 2MW5A 1W1GA 2FCMA 2MFQA 2DA0A 2KC1A 5JHAA 2R2OA 4E3CA 2PZ1A 4G50A 1WFYA 1ZW7A 2Z0EB 4DDGD 4DHJB 3TVVA 5J3YA 1TGZB 3KYCD 5L81A 4GOCA 5KQ1A 2DZJA 3QIJA 3KYDD 3WALA 4BKTA 1V5MA 5HE1A 2BPSA 2DX5A 3L13A 2NR2A 2XK5B 3O65B 1EVHA 4A20A 1WE6A 3ML8A 1GG3A 4N9F4 2DKQA 1KJTA 3NZSA 2MX2A 3VVWB 3ZVVA 2LZ6A 4OVVA 3SO6A 2LVPA 2ADZA 2MSED 1SIFA 1QC6A 3A9JA 3VQIA 2KJHB 1BTNA 1V2YA 4PS8A 4HWIB 2IYDB 1V89A 1I2HA 2WX1A 2Y5BB 3ENEA 1FAOA 5IA7A 4K7WA 2CAYA 2DLWA 4EJNA 1V81A 1ZVRA 2PE6B 2CHXA 1V61A 2LVOA 1UELA 4GGQA 4K7SA 2G3QB 2UVMA 4M8MA 1U4AA 4G0NB 4KIKA 2LULA 3H6NA 4LJPB 5DHAB 4ZRJA 2LXCA 1EGXA 2CODA 1WI0A 3TMPB 2PPHA 4ANXA 4MGIE 1HE8A 2OOBB 2GBMA 2LRUA 2KO3A 3S2AA 2COAA 2JP2A 1U2BA 4URKA 4LDTB 2Z0QA 3QBVB 1JRUA 1V88A 3ZTCA 4A3OA 3QWMA 5LXHA 1G6JA 4HCPB 3P2BA 1Q1OA 1DDVA 3ZTDA 3PZDA 3DVGX 2C7MB 1I35A 3VTWA 1TZ1A 1E8XA 2D4QA 4MK0A 1WM2A 5D27A 1KZ7A 1FHXA 4BVUC 4F7GA 1UD7A 2DYBA 2LKOA 3ML9A 3ZNHB 4DHJD 3OJ4B 4HLEA 1LXDA 5G2NA 4E71A 5DHFB 3RULA 1ISNA 4W9EA 2IFSA
chains in the Genus database with same CATH superfamily
2IYBA 2D07B 2MJ3A 2WHIA 3N20C 4C4VB 2J53A 4HXDA 3QJZA 3PLVA 1RAXA 3MFGA 2FCNA 2WP9B 2RDHA 4LJOB 1M7EA 3L08A 4JL9A 1C1YB 1K5GB 4DHZE 3P1MA 4KGRA 1NTYA 3PRPB 2WLBA 3H7PA 1V5OA 1B55A 2PVOD 3F5RA 1ZPSA 2K8EA 4A6FB 1C4CA 4K7UA 3UGBB 1C4AA 3W5UB 2IY1B 3L17A 2WXMA 3R7RA 1ET9A 2GMIC 2BYVE 2K0PA 4GMXB 4BBNF 2W2XC 2W2XD 3AE4B 2BYFA 3ZDTA 3F0WA 4A90A 4EE2A 3W1YA 3SHQA 1WMHA 5I2SA 3VFKA 2KR0A 5JH5C 3UINB 4CYEA 1XCQL 5H92C 1Q67A 1F2RI 4MY6A 2N9LA 4IC7B 2M14A 3RNAC 1H10A 2KFKB 3LXFA 2K39A 3DVNV 2WXKA 1Z5SB 2D9VA 4ZRPA 4TMAB 3A33B 2W2WA 1VZ6A 4ANVA 2V3PA 3NS8A 3OAWA 2KXJA 2NTTA 4E74A 3M95A 4P6VF 2G4SA 2MH7A 4AS1A 4A55A 1PLSA 2PKOA 1WX7A 2N7EA 1YQBA 2O6VB 2Q5WD 4ICVA 4ZRQA 1JWAD 4GU2A 3V6CB 1C76A 2JZZA 2ROZB 1GC6A 3SFDB 2DHJA 1MG8A 1K51A 3NWFA 4OSNA 5EFXA 4NSWA 2JWUA 3H7SA 1QKZA 2KZRA 2D9ZA 2KWUB 4P1BC 3RNFC 3U52E 4W9KA 1P3QU 3M62B 5BYRA 3A1QB 2ZVNA 1JQ4A 2KQ7A 3BYYB 3A4RA 2M0AA 2VH1A 4PT5A 3NG0A 2KX0A 2LUMA 1X1MA 2DFKA 4F8CB 4ANUA 1KLVA 3JVZX 1FCCC 1OTRB 2GJYA 2MA9B 3VR9B 1WH3A 1FNWA 5CLLB 4W9IA 1V6EA 3C8YA 1DYQA 2KLGA 2LRWA 4BFRA 3RYTA 3ZJTA 2GCLA 3W1SC 3PVUA 2Y8GA 4YSZB 1JRPA 1PQSA 4YWGG 3R8BA 2JZPA 4IM3A 1NU2A 2INCC 2OEDA 3ZNZB 1ROEA 2PMVA 4PYZA 4DXGA 4DXFA 2JQRB 3VH3B 3W5VB 5IP4D 3BY4B 2QKLA 2YVCA 3H9DA 3LJ3A 2IJ0A 1NYRA 2AQ1B 1A5RA 3T06A 1T5XD 2PTLA 3BWUD 1Z2MA 2G35A 4XYCA 2WXOA 2CY4A 4GZUA 2I1JA 1OQYA 2JF5A 4IWQA 2JRHA 3JSVB 1P7FA 3PEGA 2DZIA 3APCA 1NBFC 2DAFA 2IDYA 2NS5A 2EMTA 3PLUA 1J0GA 2V3NA 4IAPA 2GRIA 3R3MA 2AQ3B 3ZUNA 4MSQB 2UWQA 5CHVC 2K25A 4WSFA 1QOFA 2BQQA 2ZKMX 5HG2A 1L6VA 5JZEB 1E8ZA 3FKYA 2VSZA 4BOZB 4WJNA 3PSEB 5BMHA 4GPTB 3OANA 4FXCA 4M0WB 2FCSA 2YT1A 3IHPC 2KUQA 2K00A 1X1FA 2CKHB 1BAKA 2CRFA 2JUOA 1IYFA 4LLGM 2KANA 3DCXA 3UQAA 1PUTA 1B1ZA 3UF8A 4C56C 4DBGA 4I6LB 1PGAA 4YL8A 3P4QB 2KKCA 5KHOA 3VH4B 2NMQA 5J2RA 1SXTA 3ZXRA 3RMKC 1LFDA 4EUTA 1TKEA 1UUPA 4YXDB 3BVGA 1PGXA 1NEKB 2V4IB 3X23A 2Z13A 1DOYA 4CO7A 2GOWA 2KN4A 3FILB 1HTOA 1E8YA 3NY5A 1L4ZB 3CF6E 1V80A 2O6VD 4MDKE 2X38A 3ZO5B 1ACCA 5GMVA 2M1MA 3EECA 5JHBA 1I4RA 2N4FA 2QILA 4BAXA 4MJSB 1ZUD2 2MBBB 5LNK1 3A4SC 3HRDD 1XQQA 3TEZA 3VR8B 1UNPA 2Z4DA 3MTNB 3Q3FA 1MI1A 2ELBA 1RRPB 1MHHE 2RMMA 1WGHA 3AE8B 3GE3C 3I9V1 1WR6E 2L8JA 1C79A 1Q0WB 3Q8EA 3QAQA 5HHDG 4O1NA 3KRWA 1MIXA 4II2B 4BBNC 1EWCA 2LFIA 4GDLB 2KD0A 3P63A 2DAJA 4W9FA 4AUQC 1F1HA 2R2QA 4JX1C 3KZ1A 2CJOA 2Z8LA 3N30A 4A8XC 4NAWB 2DHKA 4FBJB 2PJHA 2AQ2B 4JPSA 4A6QA 4HVBA 1R4MI 2N9XA 2JXXA 4A9AA 1TKYA 2COCA 1ENFA 2EKEC 4W9GA 2RGNB 4MGYE 4HB3B 4HRSA 1FB8A 4II3B 5CX3A 2CHWA 2RNRB 1PDXA 3AMZA 3AEBB 4NQLB 1DBHA 1KH0A 4GMVA 4GDKB 2WXNA 1XLOA 1VDVA 1FXIA 5D3DA 2IO1B 2DZMA 4TUUA 1W1HA 3VOQA 1QILA 1E7UA 4KZCA 5IOIA 4G3XB 3DBLB 3CSTA 2DYMA 3U7DA 5GOWB 3FC4A 5LLIA 4PS7A 1WGRA 1WYGA 1JWSD 2KWCA 5J3TA 2C9WB 2P8VA 1D5ZC 4FLHA 3AE3B 1WJMA 4PQ0A 3MJWA 2BS3B 2GBJA 1EWYC 2KIEA 2XK5A 3NWDA 4W9HA 1ZDVA 3MC9A 4MELA 1FCLA 3NOBA 4EMOA 3CMMB 2ZNVB 2ASQA 3A9KB 3DOWA 1XCTL 3QA8A 3R66C 3AE1B 1F0ZA 5D3XA 4WQOB 1RRBA 1LQBA 1TS2A 1TT5B 5C2TB 3D32A 4IWOA 1S3SG 1OMWA 3MHSD 2YS3A 1MAIA 4FHJA 1E6EB 1MKEA 4UDUC 2OHFA 5IO9A 2WWZA 3TSSA 5J17A 2GBKA 2LGXA 2V4LA 5HFYA 1AWDA 4J6IA 2CU3A 2RVBB 2WX0A 2DLBA 3KH0A 1DOIA 1FNVA 1XO3A 2HD5B 1FRRA 4MACA 5AUIA 5KHQA 5C1ZA 1GC7A 4KGSA 3L16A 2LGSA 3N1ZC 1UF0A 2M56B 4ICUA 2AYOB 3HIEA 1WGQA 3LB8C 2D11A 1P6SA 1ZYIA 3VTVA 5D7GA 2ZPYA 1YJJA 4WWPA 3Q8FA 1YNTE 1YN5A 2Z0PA 2ZZPB 2HTHA 1ZC3B 4DXAB 4L6EA 3B2GA 2HJ8A 5C79A 1WXVA 1YQ4B 5C3JB 1E7PB 1YD8U 3DVGY 1TJEA 3Q6BA 1WXQA 5FK9C 2SEBD 1T0QC 5DPSA 3APDA 2KTRA 2MHJA 4KHOA 3AM9A 4DX90 2QKMA 3KWLA 4HPLB 1WF9A 3ZGZA 1TY2A 2FUHB 4CHMA 1NDDA 2J59M 3L0WB 1FRDA 2KGXB 4EFOA 3FM8C 5L95C 2J0JA 3GYOA 4GN1A 2XNAC 1BWNA 2DWQA 3ULCA 1RJ2A 3N9YC 3V6EB 1AYFA 3NJTA 4MT7A 3RI7C 2D9YA 2MJEA 2UZSA 3VUYA 3HVDA 3P4PB 4WWOA 1NENB 2LOXA 1VJKA 1SEBD 4KSKC 2K22A 4GSWA 1FHWA 1STEA 5LG4B 3BK2A 2DHIA 1XX0A 1DOXA 3PT2B 2IO3B 2MQJA 4FJVB 4TKNA 3KY9A 3KUDB 4P16A 1I4XA 3D8FA 1J7CA 3DCGA 1KOTA 1I4GA 5C6RA 4D6WA 3AXCA 2NPTB 3OHMB 4KKIA 4QJ5B 4M00A 2INDC 5AEKB 5MPOA 4WWNA 1XLQA 3KRXA 4HDQA 4YSYB 1SF0A 2N9KA 2LGYA 3V5WA 1EO6A 1F52A 2COFA 1XR0B 4Y94A 3ZVRA 2RGFA 1WX8A 5C23A 3SFEB 2ZNVC 4H2AA 3VRBB 4IOYX 4XZ4A 3U8ZA 2N9EB 2WDRB 4REZA 2K8HA 2FUG1 3A9JB 4WAAA 2J0KA 4L23A 4PNKA 2WU2B 3ZNGC 5J18A 2LD9A 4HEA1 3AEDB 1Z87A 4NJ7A 2KIGA 5C5BB 2A5UA 2WNMA 2I1KA 3D8EA 3HQCA 4K3CA 5AZGA 3Q3MC 1F9JA 4HPMB 4JQWC 2FBWB 1WWTA 1GOZA 3CIKA 3EHVA 2MLBA 1K5DB 1U29A 1V1PB 3I63C 3BK1A 2HJ1A 4HB2B 1T6BX 1UWXA 2X18A 4W9JA 2NCNA 3B77A 1ZOYB 3U12A 1WXAA 3PZ7A 1BXTA 1WJNA 2AEHA 1FFUA 1TZOA 2L76A 3MHZA 3MJ5A 2DN6A 1AWEA 2Z59B 4RM9A 1N63A 4AOFA 3RNGC 2P0DA 2D3BA 1FXTB 3TEYA 4AJWA 1V9JA 2L3ZA 2C5LC 1VZ7A 2LXAA 5G55A 4RNAA 4HB0B 2MP2A 4NY0A 1C9FA 1KRHA 5KCVA 4M8NA 1SJHD 4KZ0A 2GBRA 1JWMD 2VZKD 1Q10A 2DYNA 3Q14C 1L6UA 3NVZA 2P0FA 4KVGB 2GBNA 2HDEA 4S17A 2JX5A 3VUWA 1H8CA 2D10A 2ZVOA 1NTVA 4LNFA 2OJWA 2KTFA 1OGWA 5E6JA 3ZRCA 4RGOS 1UNRA 4WURA 2N1VA 3P7ZA 1XEEA 2J7QB 3BYTB 2FIDA 2ZEQA 3GE8C 3PSCA 3Q69A 2P0HA 1V1OA 1OQNA 1VCBA 1YJIA 1NYQA 2KDIA 2RDGA 3TFMA 1FOEA 3PRZA 3BZDB 4TQ0A 2JVCA 4A5KA 3AH7A 4FHKA 4EZKA 1FHOA 1T0RC 2YT0A 3V05A 2DYQA 4YTMB 3FEHA 4K3BA 4XWWA 4S0RA 2OQBA 2J52A 4F1SA 4I6PA 1P9DU 4MEMA 4TV3A 4ZYNA 2WS3B 4MM3B 2ZCCA 3DBSA 3KQ4A 5E6OA 4F7HA 1L0YB 3ZLZA 1FGYA 5DIFB 4WJQA 1ZSQA 4KHBB 5L83A 3DBLI 2DBYA 1OQRA 2IO0B 3RPFC 1K8RB 3DVNU 1K53A 2W54A 2ROVA 3Q2AC 4DDID 5KQ4A 3TCAA 1XD3B 4B9KA 1SGHA 3VIAA 1JROA 5D3IB 5TSSA 2V3SA 1U5FA 1NI3A 2JT4B 2JZ3B 3I5JC 1M94A 2BWES 5TR5A 4DWFA 2QC8A 2K9XA 3QX1A 1SE2A 3JSVA 3CWIA 1WRIA 2BF8B 2L52A 2LHDA 5JLJB 1P5TA 4R3DA 4DHZB 2IGDA 3NZUA 3ODWA 4W9CA 1YMHE 2MCNB 3R7QA 4L2YA 3HM6X 1R7SA 4JGHB 4GOUA 1KM7A 1SSNA 2Y3AA 2KCJA 3PREA 2LASA 2WU5B 4NQKE 1M7RA 1U5EA 4IUMB 2WDQB 4ARIA 2EKIA 2L00B 3OG5A 5E6PA 1Y5OA 2J4XA 4M0WA 1LW3A 1WMHB 2D9XA 5D3WA 2RSUA 4HAYB 1QLBB 2WXLA 2RLOA 3PV1A 5FI0A 1XCGA 2ICIA 2VRRB 2BGFA 2LHEA 3FSSA 1SJED 1WGDA 3N1XC 4RH6A 2JRIB 3AI5A 3KUCB 2CY5A 5FR6A 3MC0B 1BMLC 3R2TA 5AZHA 3LJUX 1FFVA 2AX5A 2IY0B 2UYZB 3ZRFA 1AN8A 2YS5A 1N61A 1YX6B 3IXSA 3RZWC 2LOZA 2C7NB 1YN3A 2BCJA 1IBXA 3IT6B 5EE3A 2QDFA 3VRAB 4FADA 2YS1A 1RLFA 2ZW1A 1SE4A 3IAS1 4GLSC 2RR9A 4FULA 3T3OA 3VAWA 4X57B 2MKRA 3W9CB 1PFDA 2M19A 1N3HA 2X8XX 2LGDA 4B6WA 3QC8B 1J7BA 1C3TA 5HE3A 4EEWA 3A58A 2VKIA 1N62A 4CQNA 5EE0A 1WYWB 4HSIA 4GXBA 4LCDE 3CXBB 4L1BA 4IW0A 1UBIA 1UGMA 4G11A 2WYQA 3Q3JA 3GYPA 2W3SA 3ML4A 2OJRA 2M8SA 3U30A 2BB6A 1VRAB 3AULA 2G9HD 4GDLA 3ZJUA 1I7AA 2BT6A 2E6XA 1VZ8A 2MWSB 3SDLC 1P1AA 1KI1B 1WVHA 3ECIA 2ZJDA 2N7JA 2KJ6A 1YX5B 5FR3A 2DYOA 2NBVA 1QQRA 2KDMA 3TUOA 4A6KA 2INNE 1KLUD 5I2MA 4LNNA 3SEBA 1MK9B 2EJ8A 3DQVA 2DHZA 3KVFB 4OZAA 3D8DA 1WSPA 4DBBA 5DI9B 2RPVA 3IBEA 5LONB 3Q8CA 1RM6C 2PE9A 3EFCA 3MDBC 4C7ZA 1IGCA 1PGBA 4B95A 3B9JA 1ZKHA 2R09A 2O2VB 1ZGUB 4IDIA 3AU5A 1Y19B 1Y56A 4XX5A 4M01A 3SV1A 2I5CA 2G1EA 2VH2A 4ZDVA 2KX3A 1RYJA 1TY0A 2LEKA 1DROA 4HCNB 4JWSC 4RGNA 4AWJA 2PIAA 5BYSA 3VTUA 3DWMA 4IKGA 4EZJA 2FCQA 3PGEA 4GB9A 5LXIB 4LNIA 3SYXA 3UIOB 1QF6A 3HVZA 2H7DA 3WAPA 3U7ZA 3DHIC 1CMXB 3ZJVA 3HHMA 4OW0A 3CSFA 2JU6X 3E56A 2XQNM 3NHEB 1KZGA 3FAHA 1TYGB 4D2KA 2IGGA 1S1QB 1WJ6A 4KDLB 1XKEA 1UNQA 3ZXVA 3M63B 2ACZB 3OWEB 1P3RA 2KDBA 1FMAD 1QZEA 2DKPA 2WQYB 2IZVB 1UPQA 3IG3A 2FNJB 2LJIA 2CU1A 2KWVB 1IP9A 1WJ4A 2PEAA 4JIOU 5J3QA 1KF6B 3NUHB 2KC2A 3TW1A 4BBKA 4HJGE 3ULBA 1FEHA 2REXA 4OZCA 2K49A 2UZRA 4FJYA 1EUVB 2NTSA 4NJ6A 1EAZA 2NBUA 4IM2A 1HZ5A 2E2XA 2NBWB 1D5XC 2L2IA 1DYNA 2J42A 3A8PA 5C16A 4RF1A 4RM8A 2KK8A 2PW9A 2KDEB 5DPWA 4RGTA 4AP4C 1UWMA 4ZYSA 4ZHOA 3UZTA 2H88B 1T77A 4ZRIA 1E0ZA 1JMLA 2IBIB 2SAKA 2KAJA 4HDOA 3ZKJC 3Q3OC 2KACA 4MT5A 3WAMA 1J19A 2FAZA 3AECB 1PMSA 2N9PC 1VD2A 1B9RA 5IKCM 2Y5PA 3X0WA 3GZNB 4K17A 3NVYA 2XBBC 3AE9B 3B1LX 3N1YC 4OT1A 3WANA 2AL3A 2MWNB 2MJDA 1OEYA 1D6EC 2N1WA 4FJZA 1HXYD 2K5PA 5DH9B 1MK7B 3TBLD 2NZ8B 3RCZA 1NI2A 1E9MA 1YJ1A 4XWTA 2C7HA 1SHCA 1WGKA 4OZBA 4HPPA 4IM0A 2V1YA 1Q5WB 3O13A 3B0AA 1DDMA 2Z0DB 1QT9A 2GLSA 2MRPA 4TSSA 1P0RA 1XF5L 3PO0A 3DBHB 2MBEA 3ABVB 1T0YA 5I4DA 2KT7A 5EDSA 1ZXIA 1T3QA 3GS2A 1C78A 2MDXA 2QHOA 3SUZA 1W1DA 2VZKB 2JYTA 2KJRA 2QJLA 1MFWA 3UQBA 3SD5A 2NPTA 4YSXB 1WGGA 3I3TB 3B08A 1WG7A 5AZFA 1LM8B 1RFAA 1MPHA 2HE7A 1L2NA 5EE9A 2NMBA 4QAYA 1JCKB 3RNEC 5E6NA 5BO4B 3V61A 2L7RA 1TBEA 4CHJA 3UIPB 2BS4B 1UZXB 4MH8A 2K6QA 4KKJA 3VDZA 1ZE3D 1Y8RC 4ACFA 4W9LA 1E5WA 5JHGA 2MBQA 3BJIA 1WI1A 3RFZB 2AL6A 4QJ4B 1FNUA 3QHTA 4WIPA 2CS4A 3HW2B 4HK2A 3LDZE 3RZFA 1VLBA 3AV8A 5C5BA 3NVWA 2INPE 1WZ0A 4W9DA 2PVGC 4HKZE 3W1SA 1ET6A 1R4NB 4PYUA 4XC2A 2JY6A 3NVVA 1EF5A 4HAWB 1EM7A 3FVCA 1GUAB 2ZPNA 4DK5A 4A6HA 2Z59A 2DX5B 3EC8A 3WCQA 4B6HA 1OFFA 5D6JB 4WJ7A 2DTCA 2HTHB 2H7EA 1WE7A 2LG1A 1WJUA 4C4VA 2K1FA 3RUIB 1U27A 4BOSC 4OVZA 3VHTC 3L54A 1ZC4B 1UNSA 2EMSA 2G45B 3DBRB 2DX1A 3PRMB 4P7IA 4C7YA 3BIID 2DENB 1SE9A 1J8CA 5HE0A 4RCOA 2KTRB 1V49A 3RNCC 2AWTA 2WXIA 4A6FA 2KMCA 4F7ZA 1SIJA 1V5UA 4HAUB 3RT3B 1N5XA 1WIAA 3OLMD 5IAAC 3TJPA 3W2DA 3K9PB 1WXMA 2KFJA 4MGKE 1D5MC 3VUXA 3ODOA 3TO1A 2L0FA 4HAXB 4A3PA 1XODA 4BKSD 3WAOA 2L05A 4TYZA 2LVQA 1K52A 2J0MA 1V97A 2K2UA 2GI9A 3PVWA 4AQ7A 2YSZA 2KFKA 2RPQA 2W82A 2DZKA 4KIKB 4DQOC 4F7UP 2R61A 2BKRB 3IT4B 4MM3A 3P4RB 2KLCA 3TEWA 2KQ4X 2FJLA 1WM3A 4YTNB 3APFA 4IG7B 3C19A 1OEYJ 2LI5A 2JPHA 2MBOA 2KNBA 5D2MB 2O6VA 1WR1A 2JXTA 2L83A 3GP7A 3KW5B 3HIZA 2OTXA 4QJ3B 1WY8A 3ZW3A 1FPYA 1WX9A 1UBQA 4WVFB 4J3OD 1BTKA 2Q13A 1XD4A 4KDIC 5GXGB 3AEFB 2WXFA 1DDWA 2LMCA 4NJCA 4QXAB 3B2FA 3PP2A 4LNOA 3HM3A 1JALA 2RSGA 2JWZA 1V86A 1MIZB 4LNKA 1NVID 3DXDA 4EKUA 4XDDA 3A1QA 4NAMA 2FIFA 2BKFA 4ARCA 1WGYA 4NPNA 3WYFB 5FI1A 5JP4A 2M17A 4ZOHC 4YONA 2W3RA 2WXGA 2W9NA 2H89B 2WDTB 1D4BA 3PS6A 3DXCA 2NVUI 4GIVA 3PPAA 1SE3A 2TSSA 1BT0A 3T9LA 3RD2A 2N0YA 3VXWA 4C0AA 1E8WA 1K50A 3A8QA 2KOXA 4FN2A 2BWFA 4XGAB 2KVRA 2KN5A 3V60A 2CHZA 3RN9C 4B0MA 4K2PA 1YN4A 4WJPA 2A4ZA 4MGZE 3U2SC 1LGRA 1AW7A 2MP2B 5HE2A 3ONSA 3ZNID 2K2JA 4B0EA 1TKGA 4EZLA 4C00A 3H7PB 3KSYA 2UU7A 3EFUA 1FGZA 4EOYA 1V5PA 3M1IB 1TIFA 3MPXA 3AJ4A 1MPEA 5CTRC 1X1GA 3PVLA 4KSLC 3DWGC 2XN9C 1MG4A 4KHAA 4LDTD 3KWVA 2GB1A 3WA0A 2R0DA 3QARA 2IO2B 3T8MA 3GZNI 1X11A 3A98B 3I57A 3IAM1 3M3JA 4RGMA 1IGDA 2WGSA 1GAQB 2KHWB 5IN7A 2ZCBA 2L0TA 1J7AA 2ELAA 1HTQA 1U5DA 3WIMA 3DXEA 1GPXA 3AE6B 2GS0A 2Y7BA 2KMMA 3OJ3A 4IFSA 5D94A 1E10A 3DBHI 4KAXB 2LGIA 2D3CA 2K8CA 1OY2A 1UGJA 1IPGA 4OVUA 3SNHA 1IRSA 1EU3A 2I2YA 3UI3A 4HJKA 4HAVB 4RMAA 1I4PA 3LYYA 1J0WA 2YLMA 3FILA 5H8YE 4N6EB 3ZDMC 1MJDA 3L4PA 2R2YA 3O96A 3RNBC 4MJSA 2KYWA 1L4DB 1CQVA 3QQ8B 4KV2A 3AE2B 3PHWB 2D9WA 2D2QA 1ESFA 1FM0D 4TQ1A 2O2VA 1RWSA 4Z2NA 1GB4A 4ZHPA 2DNFA 2GCJA 4HATB 1WJ1A 1D3ZA 1UPRA 1GNUA 5DPTA 2QEJC 1F77A 1TS3A 1XLPA 3V62A 4JWUC 5D3YA 4RF0A 4LTUA 4WWMA 3RCPA 4RFBA 3HK0A 1JWBD 5DPRA 3MP9A 5CHFA 3TL5A 5LOPB 2K3UA 3BVZA 3PHXB 1C77A 1GJZA 2Y8FA 2L1CA 4MSMB 4IWPA 2Z14A 3G9WA 2KQSA 3ZYYX 4NAWA 2WXJA 3P4SB 1PYWD 4FA6A 4C80A 4BKGA 3AB5A 1R4NI 3DDCB 3P42A 4D0NB 3ZIMA 1I42A 2WXHA 3E9SA 3QK0A 2Z0OA 1PFJA 2RD0A 2FJUB 2L1AA 4XE0A 1L0XB 4PK1A 4OHJA 4GDKA 2QMTA 2M0XA 2KMAA 2KDFB 3K9OB 4ASWC 1AQCA 2D3GA 1X86A 1TS4A 3JW0X 1WRDB 2C60A 2IGHA 3EUB2 5CHWA 2K8BA 4GNKB 1SB3C 2N7DA 1IBXB 4HB4B 4N58A 1AARA 5IRSA 1XT9B 3DBRI 5DCNA 2LUEA 1WGUA 2KUPA 3EGRA 3ETRA 3Q8BA 2IPKD 1P98A 1E7VA 4K1RB 1QOBA 5M4YB 1UH6A 4N59A 2JSVX 1U5GA 5G5HA 3KLSX 3AN1A 1JW9D 1TJ6A 2KWDA 2N23A 3ODXA 2M4NA 3H1UA 4XDCA 1MVKA 4US8A 3NWAA 5T8IA 3N3KB 2CR5A 2BTEA 1YIWA 1UEFA 3A9KA 3T3NA 3URYA 2YF0A 4H8SA 3R2IA 3C0RB 2PLPA 1ZXHA 3SR6A 1EF1A 2RUKB 2G4DB 5EE1A 4PS3A 3AEEB 3IVFA 4MH0E 3N7CA 1TQZA 1TTNA 4K81A 3KUZA 5CLQB 3DPDA 2RRFA 4DX8A 1WZ3A 4IOIE 4BKSA 2B76B 1N6ZA 1KFYB 2K6DB 4USAA 2M38A 1FD6A 3PTFC 3P6AA 4AJYB 4BZAA 3NSUA 4ITKA 1HZ6A 1BUIC 2RDBC 4CHKA 2V76A 2NBVB 3SU8X 4XWXA 3JYUA 2LWPA 4HHVA 1ZM0A 2FE8A 3PG7A 3TIXA 4NNJB 5JHHA 1C4PA 4JLCA 2BS2B 1OQQA 1QQGA 3N32A 3QCAA 4DIXA 3L10B 3NRZA 3BINA 4WQMA 4Q2JA 1E90A 3AU4A 3Q8AA 2EC1A 4WJOA 4WH4A 1L0VB 2B3AA 2QCZA 3IFWB 1SBBB 4Z2MB 1LB1A 1CK1A 1QOAA 1FIQA 1TXDA 2MBHA 3NW8A 4I6NB 2VRWB 1I4HA 5BYQA 1ZDXA 4P1CC 4ZRKA 3U4EG 4HAZB 1TS5A 1V5TA 1WXSA 1P7EA 1L7YA 2YRYA 2WXPA 3NS1A 1H4RA 3GOEA 3H8HA 1M4VA 2I5FA 3QWZB 2LYDA 2BYEA 1X05A 2LJ5A 4ANWA 3ALBA 4YTPB 1VR9A 2XEWA 2D3AA 2E3TA 4K2OA 2BVCA 1I4QA 2ON8A 5HKHA 5D3VA 2GUMA 1W1GA 2MW5A 2FCMA 4KGTA 4LK0M 2MFQA 2DA0A 2KC1A 5JHAA 2R2OA 4YT0B 4E3CA 1RFKA 2PZ1A 4G50A 1YOVB 1WFYA 3BVMA 1ZW7A 2Z0EB 1XXGA 2L32A 1DGJA 1JWUD 4DDGD 4DHJB 3GB1A 3Q3NC 1IUEA 2BBCA 3TVVA 5J3YA 1TGZB 3KYCD 5L81A 4L1RA 4GOCA 1V8CA 5KQ1A 2BB5A 2DZJA 4M02A 3QIJA 3KYDD 3WALA 4BKTA 4CSQA 1V5MA 2WDVB 3AE5B 1A70A 5HE1A 2BPSA 4HKQA 2DX5A 2QIEB 3L13A 2NR2A 2XK5B 3O65B 1EVHA 2V0GA 4A20A 5JXVA 1WE6A 4HROA 3ML8A 1GG3A 2YEPF 3DHHC 4N9F4 2DKQA 1KJTA 3NZSA 2MX2A 3PZ8A 3VVWB 1QOGA 2Y5CA 3ZVVA 2LZ6A 4OVVA 3SO6A 2LVPA 2ADZA 2MSED 1SIFA 1QC6A 1ZP0B 3DHGC 3A9JA 3VQIA 2BYTA 5HI1A 2KJHB 1BTNA 1V2YA 4PS8A 2KVZA 4HWIB 2IYDB 1V89A 1I2HA 2WX1A 2Y5BB 3ENEA 1N60A 1HA5A 1FAOA 5IA7A 1FXAA 4K7WA 2CAYA 1KLGD 2DLWA 4EJNA 1V81A 1ZVRA 2PE6B 4NZLB 1FO4A 2D5GA 2CHXA 1V61A 2LVOA 1V1PA 1UELA 1F2RC 4GGQA 4K7SA 2G3QB 1L5PA 2UVMA 4M8MA 1XLNA 2W55A 3AEGB 1U4AA 4G0NB 2EELA 4KIKA 3CIRB 3NZ3A 3V3XA 2LULA 3H6NA 2YT2A 3MC8A 2MEKA 2BW2A 4LJPB 4KX6B 5DHAB 4ZRJA 2LXCA 1EGXA 2CODA 1WI0A 3TMPB 2V9HA 4US9A 2I38A 2PPHA 1MI0A 4MGIE 4ANXA 1CZPA 1HE8A 2OOBB 2GBMA 1I7HA 2LRUA 1YQ3B 2N0SB 2KO3A 1N5WA 3S2AA 2COAA 3HSAA 2YEPB 3HUIA 3TEXA 5FKAC 2JP2A 3AE7B 1HQRD 1U2BA 4URKA 4LDTB 1T0SC 3J9CA 1MHXA 2Z0QA 2CJNA 4WAFA 1LO5D 2WXQA 3EA6A 3QBVB 1JRUA 1V88A 3ZTCA 5G5GA 2QSDA 2HTME 4A3OA 1GB1A 3QWMA 5LXHA 1G6JA 4HCPB 2JYEA 3P2BA 1Q1OA 1DDVA 3ZTDA 4JE3B 3PZDA 3DVGX 2C7MB 1I35A 3VTWA 1TZ1A 1E8XA 2D4QA 2ONQA 4MK0A 1R4MB 1WM2A 3AEAB 5D27A 1KZ7A 1FHXA 1EU4A 4F7GA 1KTKA 1UD7A 2DYBA 4BVUC 2LKOA 3ML9A 2ZW0A 3ZNHB 5BMGA 1CJEA 4DHJD 4KHBA 3OJ4B 4HLEA 2WXRA 1LXDA 5G2NA 4E71A 5DHFB 3RULA 5BMIA 1ISNA 4W9EA 2IFSA 1HEZE 3ZQ4A 5AUKA
chains in the Genus database with same CATH topology
2IYBA 2D07B 4HXDA 3QJZA 3PLVA 1RAXA 2FCNA 4LJOB 1M7EA 3L08A 4JL9A 1C1YB 1K5GB 4DHZE 1NTYA 3PRPB 3H7PA 1V5OA 1B55A 3F5RA 4A6FB 4K7UA 3UGBB 2IY1B 3L17A 3R7RA 2GMIC 2BYVE 4GMXB 4BBNF 2W2XC 2W2XD 2BYFA 3ZDTA 3F0WA 3W1YA 3SHQA 1WMHA 3VFKA 5JH5C 3UINB 4CYEA 1Q67A 4MY6A 4IC7B 2M14A 1H10A 2KFKB 2K39A 3DVNV 1Z5SB 2D9VA 3A33B 2W2WA 4ANVA 3NS8A 3OAWA 2KXJA 4E74A 3M95A 2G4SA 1PLSA 1WX7A 2N7EA 1YQBA 2O6VB 4ICVA 4GU2A 3V6CB 2JZZA 2ROZB 1GC6A 2DHJA 1MG8A 5EFXA 4NSWA 3H7SA 2KZRA 2D9ZA 2KWUB 4W9KA 1P3QU 3M62B 3A1QB 2ZVNA 2KQ7A 3A4RA 2KX0A 1X1MA 2DFKA 4F8CB 4ANUA 1KLVA 3JVZX 1OTRB 2GJYA 2MA9B 1WH3A 5CLLB 4W9IA 1V6EA 2KLGA 2LRWA 4BFRA 3RYTA 2GCLA 3W1SC 3PVUA 2Y8GA 1PQSA 4IM3A 1NU2A 3ZNZB 4PYZA 3VH3B 3BY4B 2QKLA 2YVCA 3H9DA 3LJ3A 1A5RA 3T06A 1Z2MA 2G35A 2CY4A 4GZUA 2I1JA 1OQYA 2JF5A 4IWQA 2JRHA 3JSVB 3PEGA 2DZIA 3APCA 1NBFC 2DAFA 2NS5A 2EMTA 3PLUA 1J0GA 4IAPA 3R3MA 3ZUNA 4MSQB 2UWQA 5CHVC 2K25A 4WSFA 5JZEB 1E8ZA 2VSZA 4BOZB 4WJNA 3PSEB 4GPTB 3OANA 4M0WB 2FCSA 2YT1A 3IHPC 2K00A 1X1FA 2CKHB 1BAKA 2CRFA 2JUOA 1IYFA 2KANA 3UQAA 3UF8A 4DBGA 4I6LB 4YL8A 3VH4B 2KKCA 5KHOA 5J2RA 1LFDA 4EUTA 3X23A 4CO7A 2GOWA 1E8YA 3NY5A 3CF6E 1V80A 2O6VD 4MDKE 3ZO5B 5GMVA 2M1MA 3EECA 5JHBA 2N4FA 4MJSB 2MBBB 3A4SC 1XQQA 1UNPA 3MTNB 3Q3FA 2ELBA 1RRPB 1WGHA 1WR6E 2L8JA 1Q0WB 3QAQA 3KRWA 1MIXA 4II2B 4BBNC 4GDLB 2KD0A 2DAJA 4W9FA 4AUQC 2R2QA 3KZ1A 3N30A 4NAWB 2DHKA 4FBJB 2PJHA 4HVBA 1R4MI 2N9XA 2JXXA 2COCA 2EKEC 4W9GA 2RGNB 4MGYE 4HB3B 1FB8A 4II3B 5CX3A 2CHWA 2RNRB 4NQLB 1DBHA 4GMVA 4GDKB 2IO1B 2DZMA 4TUUA 1W1HA 3VOQA 1E7UA 4KZCA 4G3XB 3CSTA 2DYMA 3U7DA 5GOWB 5LLIA 4PS7A 1WGRA 2KWCA 5J3TA 2C9WB 2P8VA 4FLHA 1WJMA 4PQ0A 3MJWA 2GBJA 2XK5A 4W9HA 4MELA 3NOBA 4EMOA 3CMMB 2ZNVB 2ASQA 3A9KB 3DOWA 3QA8A 3R66C 5D3XA 4WQOB 1RRBA 1LQBA 3D32A 4IWOA 1S3SG 1OMWA 3MHSD 2YS3A 1MAIA 4FHJA 1MKEA 2WWZA 5J17A 2GBKA 2LGXA 2V4LA 4J6IA 2WX0A 2RVBB 3KH0A 2HD5B 5KHQA 5C1ZA 1GC7A 3L16A 4ICUA 2AYOB 1WGQA 2D11A 1P6SA 3VTVA 5D7GA 2ZPYA 4WWPA 2Z0PA 2ZZPB 2HTHA 1ZC3B 4DXAB 4L6EA 2HJ8A 5C79A 1WXVA 1YD8U 3DVGY 5DPSA 3APDA 2KTRA 4KHOA 4DX90 2QKMA 4HPLB 1WF9A 2FUHB 4CHMA 1NDDA 2J59M 3L0WB 2KGXB 4EFOA 3FM8C 5L95C 2J0JA 3GYOA 4GN1A 1BWNA 3ULCA 1RJ2A 3V6EB 4MT7A 2D9YA 3VUYA 2UZSA 4WWOA 2LOXA 4KSKC 4GSWA 1FHWA 2DHIA 1XX0A 3PT2B 2IO3B 2MQJA 4FJVB 4TKNA 3KY9A 3KUDB 3D8FA 3DCGA 1KOTA 5C6RA 3AXCA 2NPTB 5AEKB 4WWNA 3KRXA 4HDQA 2LGYA 3V5WA 1EO6A 2COFA 1XR0B 4Y94A 3ZVRA 2RGFA 1WX8A 5C23A 2ZNVC 4IOYX 4XZ4A 3U8ZA 2N9EB 2K8HA 3A9JB 4WAAA 2J0KA 4PNKA 3ZNGC 5J18A 2LD9A 1Z87A 4NJ7A 5C5BB 2A5UA 2I1KA 3D8EA 3HQCA 5AZGA 1F9JA 4HPMB 4JQWC 3CIKA 3EHVA 2MLBA 1K5DB 1U29A 4HB2B 2X18A 4W9JA 2NCNA 1WXAA 1WJNA 2AEHA 2L76A 2DN6A 1AWEA 2Z59B 4RM9A 4AOFA 2P0DA 1FXTB 4AJWA 1V9JA 2L3ZA 2C5LC 2LXAA 5G55A 4HB0B 2MP2A 4NY0A 5KCVA 4M8NA 4KZ0A 2GBRA 2DYNA 2P0FA 4KVGB 2GBNA 3VUWA 1H8CA 2D10A 2ZVOA 1NTVA 2KTFA 1OGWA 3ZRCA 1UNRA 2N1VA 3P7ZA 2J7QB 2FIDA 2ZEQA 3PSCA 2P0HA 1OQNA 1VCBA 2KDIA 3TFMA 1FOEA 3PRZA 4TQ0A 2JVCA 4A5KA 4EZKA 4FHKA 1FHOA 2YT0A 2DYQA 3FEHA 2OQBA 4F1SA 4I6PA 1P9DU 4MEMA 4TV3A 4ZYNA 2ZCCA 3DBSA 5E6OA 4F7HA 3ZLZA 1FGYA 5DIFB 4WJQA 1ZSQA 4KHBB 5L83A 3DBLI 2IO0B 1K8RB 3DVNU 2ROVA 4DDID 5KQ4A 3TCAA 1XD3B 4B9KA 1SGHA 3VIAA 2V3SA 1U5FA 2JT4B 2JZ3B 1M94A 2BWES 5TR5A 4DWFA 3QX1A 3JSVA 2BF8B 5JLJB 1P5TA 4DHZB 3NZUA 3ODWA 4W9CA 2MCNB 3R7QA 3HM6X 4JGHB 1KM7A 2KCJA 3PREA 2LASA 4NQKE 1M7RA 1U5EA 4IUMB 2L00B 5E6PA 1Y5OA 1LW3A 1WMHB 2D9XA 5D3WA 2RSUA 4HAYB 2RLOA 3PV1A 5FI0A 1XCGA 2VRRB 2BGFA 3FSSA 1WGDA 2JRIB 3AI5A 3KUCB 2CY5A 5FR6A 5AZHA 3LJUX 2IY0B 2UYZB 3ZRFA 2YS5A 1YX6B 3RZWC 2LOZA 2C7NB 2BCJA 4FADA 2YS1A 1RLFA 2RR9A 4FULA 3VAWA 4X57B 2MKRA 1N3HA 2LGDA 4B6WA 3QC8B 1C3TA 5HE3A 4EEWA 2VKIA 1WYWB 4GXBA 4LCDE 3CXBB 4IW0A 1UBIA 1UGMA 4G11A 2WYQA 3Q3JA 3GYPA 3ML4A 2OJRA 2M8SA 3U30A 3AULA 4GDLA 1I7AA 2MWSB 3SDLC 1P1AA 1KI1B 1WVHA 3ECIA 2ZJDA 2KJ6A 1YX5B 2DYOA 4A6KA 1MK9B 2EJ8A 3DQVA 2DHZA 3KVFB 3D8DA 4DBBA 5DI9B 3IBEA 5LONB 2PE9A 3MDBC 4B95A 1ZKHA 2R09A 2O2VB 1ZGUB 3AU5A 1Y19B 4XX5A 3SV1A 2I5CA 4ZDVA 2KX3A 4HCNB 1DROA 4AWJA 3VTUA 4EZJA 2FCQA 3PGEA 4GB9A 5LXIB 3SYXA 3UIOB 2H7DA 3WAPA 1CMXB 3HHMA 3CSFA 2XQNM 3NHEB 1KZGA 1S1QB 1WJ6A 4KDLB 1XKEA 1UNQA 3M63B 1P3RA 2KDBA 1QZEA 2DKPA 2IZVB 1UPQA 3IG3A 2FNJB 2CU1A 2KWVB 1IP9A 1WJ4A 2PEAA 4JIOU 5J3QA 2KC2A 3TW1A 4BBKA 3ULBA 2REXA 2UZRA 4FJYA 1EUVB 4NJ6A 1EAZA 2NBUA 4IM2A 2E2XA 2NBWB 2L2IA 1DYNA 3A8PA 5C16A 4RM8A 2KK8A 2KDEB 5DPWA 4AP4C 3UZTA 4ZRIA 2IBIB 4HDOA 3ZKJC 3WAMA 1J19A 2FAZA 1PMSA 2N9PC 1VD2A 3X0WA 4K17A 2XBBC 3B1LX 3WANA 2AL3A 2MWNB 1OEYA 2N1WA 4FJZA 5DH9B 1MK7B 3TBLD 2NZ8B 3RCZA 1NI2A 1YJ1A 2C7HA 1SHCA 4IM0A 2V1YA 1Q5WB 3B0AA 1DDMA 2Z0DB 2MRPA 1P0RA 2MBEA 1T0YA 5EDSA 2MDXA 2QHOA 3SUZA 1W1DA 2KJRA 3UQBA 3SD5A 2NPTA 1WGGA 3I3TB 3B08A 1WG7A 5AZFA 1LM8B 1RFAA 1MPHA 2HE7A 1L2NA 2NMBA 5E6NA 5BO4B 3V61A 2L7RA 1TBEA 4CHJA 3UIPB 1UZXB 2K6QA 3VDZA 1Y8RC 4W9LA 1E5WA 5JHGA 2MBQA 3BJIA 1WI1A 2AL6A 3QHTA 2CS4A 3HW2B 4HK2A 3LDZE 3RZFA 5C5BA 1WZ0A 4W9DA 3W1SA 4PYUA 4XC2A 2JY6A 1EF5A 4HAWB 1GUAB 2ZPNA 4DK5A 4A6HA 2DX5B 3EC8A 4B6HA 5D6JB 4WJ7A 2DTCA 2HTHB 2H7EA 1WE7A 2LG1A 1WJUA 2K1FA 3RUIB 1U27A 4BOSC 3VHTC 3L54A 1ZC4B 2EMSA 2G45B 2DX1A 3PRMB 4P7IA 2DENB 1SE9A 1J8CA 5HE0A 2KTRB 1V49A 2AWTA 4A6FA 2KMCA 4F7ZA 1V5UA 4HAUB 3RT3B 1WIAA 3OLMD 5IAAC 3TJPA 3K9PB 1WXMA 2KFJA 4MGKE 3VUXA 3ODOA 3TO1A 2L0FA 4HAXB 4A3PA 1XODA 4BKSD 3WAOA 2L05A 4TYZA 2LVQA 2J0MA 2K2UA 3PVWA 2YSZA 2KFKA 2RPQA 2DZKA 4KIKB 4F7UP 2BKRB 4MM3A 2KLCA 2FJLA 1WM3A 3APFA 4IG7B 1OEYJ 2LI5A 2JPHA 2MBOA 2KNBA 5D2MB 2O6VA 1WR1A 3KW5B 3HIZA 2OTXA 1WY8A 3ZW3A 1WX9A 1UBQA 4WVFB 1BTKA 2Q13A 1XD4A 4KDIC 1DDWA 3PP2A 3HM3A 2RSGA 2JWZA 1V86A 1MIZB 3DXDA 4EKUA 3A1QA 2FIFA 2BKFA 1WGYA 4NPNA 3WYFB 5FI1A 5JP4A 2M17A 4YONA 2W9NA 2WDTB 3PS6A 3DXCA 2NVUI 4GIVA 3PPAA 1BT0A 3T9LA 3RD2A 2N0YA 3VXWA 4C0AA 1E8WA 3A8QA 2KOXA 4FN2A 2BWFA 2KVRA 2KN5A 3V60A 2CHZA 4K2PA 4WJPA 2A4ZA 4MGZE 2MP2B 5HE2A 3ONSA 3ZNID 2K2JA 4EZLA 3H7PB 3KSYA 3EFUA 1FGZA 4EOYA 1V5PA 3M1IB 3MPXA 3AJ4A 5CTRC 1X1GA 3PVLA 4KSLC 4KHAA 4LDTD 3WA0A 2R0DA 3QARA 2IO2B 3T8MA 3GZNI 1X11A 3A98B 3M3JA 2KHWB 2ZCBA 2L0TA 2ELAA 1U5DA 3WIMA 3DXEA 2GS0A 2Y7BA 3OJ3A 4IFSA 5D94A 3DBHI 4KAXB 2K8CA 1OY2A 1IPGA 4OVUA 3SNHA 1IRSA 4HJKA 4HAVB 4RMAA 1J0WA 2YLMA 3ZDMC 3O96A 4MJSA 3QQ8B 4KV2A 3PHWB 2D9WA 2D2QA 4TQ1A 2O2VA 4Z2NA 2GCJA 4HATB 1WJ1A 1D3ZA 1UPRA 1GNUA 5DPTA 3V62A 5D3YA 3RCPA 3HK0A 5DPRA 5CHFA 3TL5A 5LOPB 3PHXB 1GJZA 2Y8FA 2L1CA 4MSMB 4IWPA 3G9WA 2KQSA 4NAWA 4FA6A 4BKGA 1R4NI 3DDCB 4D0NB 3ZIMA 1I42A 3QK0A 2Z0OA 1PFJA 2RD0A 4GDKA 2M0XA 2KMAA 2KDFB 3K9OB 4ASWC 1AQCA 2D3GA 1X86A 3JW0X 1WRDB 2C60A 5CHWA 2K8BA 2N7DA 4HB4B 1AARA 1XT9B 3DBRI 5DCNA 2LUEA 1WGUA 2KUPA 1P98A 1E7VA 4K1RB 1UH6A 1U5GA 1TJ6A 2N23A 3ODXA 2M4NA 3H1UA 3N3KB 2CR5A 1YIWA 1UEFA 3A9KA 2YF0A 4H8SA 3C0RB 1EF1A 2RUKB 2G4DB 4PS3A 3IVFA 4MH0E 3N7CA 1TQZA 1TTNA 4K81A 3KUZA 5CLQB 3DPDA 4DX8A 1WZ3A 4BKSA 2K6DB 2M38A 3PTFC 3P6AA 4AJYB 3NSUA 4CHKA 2V76A 2NBVB 3SU8X 4XWXA 3JYUA 2LWPA 4HHVA 1ZM0A 3PG7A 3TIXA 4NNJB 5JHHA 4JLCA 1QQGA 3N32A 3QCAA 3L10B 3BINA 1E90A 3AU4A 2EC1A 4WJOA 2B3AA 3IFWB 4Z2MB 1LB1A 1TXDA 2MBHA 4I6NB 2VRWB 4ZRKA 4HAZB 1V5TA 1WXSA 1L7YA 2YRYA 1H4RA 3GOEA 2I5FA 3QWZB 2LYDA 2BYEA 1X05A 2LJ5A 4ANWA 3ALBA 2XEWA 4K2OA 5HKHA 5D3VA 2MW5A 1W1GA 2FCMA 2MFQA 2DA0A 2KC1A 5JHAA 2R2OA 4E3CA 2PZ1A 4G50A 1WFYA 1ZW7A 2Z0EB 4DDGD 4DHJB 3TVVA 5J3YA 1TGZB 3KYCD 5L81A 4GOCA 5KQ1A 2DZJA 3QIJA 3KYDD 3WALA 4BKTA 1V5MA 5HE1A 2BPSA 2DX5A 3L13A 2NR2A 2XK5B 3O65B 1EVHA 4A20A 1WE6A 3ML8A 1GG3A 4N9F4 2DKQA 1KJTA 3NZSA 2MX2A 3VVWB 3ZVVA 2LZ6A 4OVVA 3SO6A 2LVPA 2ADZA 2MSED 1SIFA 1QC6A 3A9JA 3VQIA 2KJHB 1BTNA 1V2YA 4PS8A 4HWIB 2IYDB 1V89A 1I2HA 2WX1A 2Y5BB 3ENEA 1FAOA 5IA7A 4K7WA 2CAYA 2DLWA 4EJNA 1V81A 1ZVRA 2PE6B 2CHXA 1V61A 2LVOA 1UELA 4GGQA 4K7SA 2G3QB 2UVMA 4M8MA 1U4AA 4G0NB 4KIKA 2LULA 3H6NA 4LJPB 5DHAB 4ZRJA 2LXCA 1EGXA 2CODA 1WI0A 3TMPB 2PPHA 4ANXA 4MGIE 1HE8A 2OOBB 2GBMA 2LRUA 2KO3A 3S2AA 2COAA 2JP2A 1U2BA 4URKA 4LDTB 2Z0QA 3QBVB 1JRUA 1V88A 3ZTCA 4A3OA 3QWMA 5LXHA 1G6JA 4HCPB 3P2BA 1Q1OA 1DDVA 3ZTDA 3PZDA 3DVGX 2C7MB 1I35A 3VTWA 1TZ1A 1E8XA 2D4QA 4MK0A 1WM2A 5D27A 1KZ7A 1FHXA 4BVUC 4F7GA 1UD7A 2DYBA 2LKOA 3ML9A 3ZNHB 4DHJD 3OJ4B 4HLEA 1LXDA 5G2NA 4E71A 5DHFB 3RULA 1ISNA 4W9EA 2IFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IYB A;  2D07 B;  4HXD A;  3QJZ A;  3PLV A;  1RAX A;  2FCN A;  4LJO B;  1M7E A;  3L08 A;  4JL9 A;  1C1Y B;  1K5G B;  4DHZ E;  1NTY A;  3PRP B;  3H7P A;  1V5O A;  1B55 A;  3F5R A;  4A6F B;  4K7U A;  3UGB B;  2IY1 B;  3L17 A;  3R7R A;  2GMI C;  2BYV E;  4GMX B;  4BBN F;  2W2X C;  2W2X D;  2BYF A;  3ZDT A;  3F0W A;  3W1Y A;  3SHQ A;  1WMH A;  3VFK A;  5JH5 C;  3UIN B;  4CYE A;  1Q67 A;  4MY6 A;  4IC7 B;  2M14 A;  1H10 A;  2KFK B;  2K39 A;  3DVN V;  1Z5S B;  2D9V A;  3A33 B;  2W2W A;  4ANV A;  3NS8 A;  3OAW A;  2KXJ A;  4E74 A;  3M95 A;  2G4S A;  1PLS A;  1WX7 A;  2N7E A;  1YQB A;  2O6V B;  4ICV A;  4GU2 A;  3V6C B;  2JZZ A;  2ROZ B;  1GC6 A;  2DHJ A;  1MG8 A;  5EFX A;  4NSW A;  3H7S A;  2KZR A;  2D9Z A;  2KWU B;  4W9K A;  1P3Q U;  3M62 B;  3A1Q B;  2ZVN A;  2KQ7 A;  3A4R A;  2KX0 A;  1X1M A;  2DFK A;  4F8C B;  4ANU A;  1KLV A;  3JVZ X;  1OTR B;  2GJY A;  2MA9 B;  1WH3 A;  5CLL B;  4W9I A;  1V6E A;  2KLG A;  2LRW A;  4BFR A;  3RYT A;  2GCL A;  3W1S C;  3PVU A;  2Y8G A;  1PQS A;  4IM3 A;  1NU2 A;  3ZNZ B;  4PYZ A;  3VH3 B;  3BY4 B;  2QKL A;  2YVC A;  3H9D A;  3LJ3 A;  1A5R A;  3T06 A;  1Z2M A;  2G35 A;  2CY4 A;  4GZU A;  2I1J A;  1OQY A;  2JF5 A;  4IWQ A;  2JRH A;  3JSV B;  3PEG A;  2DZI A;  3APC A;  1NBF C;  2DAF A;  2NS5 A;  2EMT A;  3PLU A;  1J0G A;  4IAP A;  3R3M A;  3ZUN A;  4MSQ B;  2UWQ A;  5CHV C;  2K25 A;  4WSF A;  5JZE B;  1E8Z A;  2VSZ A;  4BOZ B;  4WJN A;  3PSE B;  4GPT B;  3OAN A;  4M0W B;  2FCS A;  2YT1 A;  3IHP C;  2K00 A;  1X1F A;  2CKH B;  1BAK A;  2CRF A;  2JUO A;  1IYF A;  2KAN A;  3UQA A;  3UF8 A;  4DBG A;  4I6L B;  4YL8 A;  3VH4 B;  2KKC A;  5KHO A;  5J2R A;  1LFD A;  4EUT A;  3X23 A;  4CO7 A;  2GOW A;  1E8Y A;  3NY5 A;  3CF6 E;  1V80 A;  2O6V D;  4MDK E;  3ZO5 B;  5GMV A;  2M1M A;  3EEC A;  5JHB A;  2N4F A;  4MJS B;  2MBB B;  3A4S C;  1XQQ A;  1UNP A;  3MTN B;  3Q3F A;  2ELB A;  1RRP B;  1WGH A;  1WR6 E;  2L8J A;  1Q0W B;  3QAQ A;  3KRW A;  1MIX A;  4II2 B;  4BBN C;  4GDL B;  2KD0 A;  2DAJ A;  4W9F A;  4AUQ C;  2R2Q A;  3KZ1 A;  3N30 A;  4NAW B;  2DHK A;  4FBJ B;  2PJH A;  4HVB A;  1R4M I;  2N9X A;  2JXX A;  2COC A;  2EKE C;  4W9G A;  2RGN B;  4MGY E;  4HB3 B;  1FB8 A;  4II3 B;  5CX3 A;  2CHW A;  2RNR B;  4NQL B;  1DBH A;  4GMV A;  4GDK B;  2IO1 B;  2DZM A;  4TUU A;  1W1H A;  3VOQ A;  1E7U A;  4KZC A;  4G3X B;  3CST A;  2DYM A;  3U7D A;  5GOW B;  5LLI A;  4PS7 A;  1WGR A;  2KWC A;  5J3T A;  2C9W B;  2P8V A;  4FLH A;  1WJM A;  4PQ0 A;  3MJW A;  2GBJ A;  2XK5 A;  4W9H A;  4MEL A;  3NOB A;  4EMO A;  3CMM B;  2ZNV B;  2ASQ A;  3A9K B;  3DOW A;  3QA8 A;  3R66 C;  5D3X A;  4WQO B;  1RRB A;  1LQB A;  3D32 A;  4IWO A;  1S3S G;  1OMW A;  3MHS D;  2YS3 A;  1MAI A;  4FHJ A;  1MKE A;  2WWZ A;  5J17 A;  2GBK A;  2LGX A;  2V4L A;  4J6I A;  2WX0 A;  2RVB B;  3KH0 A;  2HD5 B;  5KHQ A;  5C1Z A;  1GC7 A;  3L16 A;  4ICU A;  2AYO B;  1WGQ A;  2D11 A;  1P6S A;  3VTV A;  5D7G A;  2ZPY A;  4WWP A;  2Z0P A;  2ZZP B;  2HTH A;  1ZC3 B;  4DXA B;  4L6E A;  2HJ8 A;  5C79 A;  1WXV A;  1YD8 U;  3DVG Y;  5DPS A;  3APD A;  2KTR A;  4KHO A;  4DX9 0;  2QKM A;  4HPL B;  1WF9 A;  2FUH B;  4CHM A;  1NDD A;  2J59 M;  3L0W B;  2KGX B;  4EFO A;  3FM8 C;  5L95 C;  2J0J A;  3GYO A;  4GN1 A;  1BWN A;  3ULC A;  1RJ2 A;  3V6E B;  4MT7 A;  2D9Y A;  3VUY A;  2UZS A;  4WWO A;  2LOX A;  4KSK C;  4GSW A;  1FHW A;  2DHI A;  1XX0 A;  3PT2 B;  2IO3 B;  2MQJ A;  4FJV B;  4TKN A;  3KY9 A;  3KUD B;  3D8F A;  3DCG A;  1KOT A;  5C6R A;  3AXC A;  2NPT B;  5AEK B;  4WWN A;  3KRX A;  4HDQ A;  2LGY A;  3V5W A;  1EO6 A;  2COF A;  1XR0 B;  4Y94 A;  3ZVR A;  2RGF A;  1WX8 A;  5C23 A;  2ZNV C;  4IOY X;  4XZ4 A;  3U8Z A;  2N9E B;  2K8H A;  3A9J B;  4WAA A;  2J0K A;  4PNK A;  3ZNG C;  5J18 A;  2LD9 A;  1Z87 A;  4NJ7 A;  5C5B B;  2A5U A;  2I1K A;  3D8E A;  3HQC A;  5AZG A;  1F9J A;  4HPM B;  4JQW C;  3CIK A;  3EHV A;  2MLB A;  1K5D B;  1U29 A;  4HB2 B;  2X18 A;  4W9J A;  2NCN A;  1WXA A;  1WJN A;  2AEH A;  2L76 A;  2DN6 A;  1AWE A;  2Z59 B;  4RM9 A;  4AOF A;  2P0D A;  1FXT B;  4AJW A;  1V9J A;  2L3Z A;  2C5L C;  2LXA A;  5G55 A;  4HB0 B;  2MP2 A;  4NY0 A;  5KCV A;  4M8N A;  4KZ0 A;  2GBR A;  2DYN A;  2P0F A;  4KVG B;  2GBN A;  3VUW A;  1H8C A;  2D10 A;  2ZVO A;  1NTV A;  2KTF A;  1OGW A;  3ZRC A;  1UNR A;  2N1V A;  3P7Z A;  2J7Q B;  2FID A;  2ZEQ A;  3PSC A;  2P0H A;  1OQN A;  1VCB A;  2KDI A;  3TFM A;  1FOE A;  3PRZ A;  4TQ0 A;  2JVC A;  4A5K A;  4EZK A;  4FHK A;  1FHO A;  2YT0 A;  2DYQ A;  3FEH A;  2OQB A;  4F1S A;  4I6P A;  1P9D U;  4MEM A;  4TV3 A;  4ZYN A;  2ZCC A;  3DBS A;  5E6O A;  4F7H A;  3ZLZ A;  1FGY A;  5DIF B;  4WJQ A;  1ZSQ A;  4KHB B;  5L83 A;  3DBL I;  2IO0 B;  1K8R B;  3DVN U;  2ROV A;  4DDI D;  5KQ4 A;  3TCA A;  1XD3 B;  4B9K A;  1SGH A;  3VIA A;  2V3S A;  1U5F A;  2JT4 B;  2JZ3 B;  1M94 A;  2BWE S;  5TR5 A;  4DWF A;  3QX1 A;  3JSV A;  2BF8 B;  5JLJ B;  1P5T A;  4DHZ B;  3NZU A;  3ODW A;  4W9C A;  2MCN B;  3R7Q A;  3HM6 X;  4JGH B;  1KM7 A;  2KCJ A;  3PRE A;  2LAS A;  4NQK E;  1M7R A;  1U5E A;  4IUM B;  2L00 B;  5E6P A;  1Y5O A;  1LW3 A;  1WMH B;  2D9X A;  5D3W A;  2RSU A;  4HAY B;  2RLO A;  3PV1 A;  5FI0 A;  1XCG A;  2VRR B;  2BGF A;  3FSS A;  1WGD A;  2JRI B;  3AI5 A;  3KUC B;  2CY5 A;  5FR6 A;  5AZH A;  3LJU X;  2IY0 B;  2UYZ B;  3ZRF A;  2YS5 A;  1YX6 B;  3RZW C;  2LOZ A;  2C7N B;  2BCJ A;  4FAD A;  2YS1 A;  1RLF A;  2RR9 A;  4FUL A;  3VAW A;  4X57 B;  2MKR A;  1N3H A;  2LGD A;  4B6W A;  3QC8 B;  1C3T A;  5HE3 A;  4EEW A;  2VKI A;  1WYW B;  4GXB A;  4LCD E;  3CXB B;  4IW0 A;  1UBI A;  1UGM A;  4G11 A;  2WYQ A;  3Q3J A;  3GYP A;  3ML4 A;  2OJR A;  2M8S A;  3U30 A;  3AUL A;  4GDL A;  1I7A A;  2MWS B;  3SDL C;  1P1A A;  1KI1 B;  1WVH A;  3ECI A;  2ZJD A;  2KJ6 A;  1YX5 B;  2DYO A;  4A6K A;  1MK9 B;  2EJ8 A;  3DQV A;  2DHZ A;  3KVF B;  3D8D A;  4DBB A;  5DI9 B;  3IBE A;  5LON B;  2PE9 A;  3MDB C;  4B95 A;  1ZKH A;  2R09 A;  2O2V B;  1ZGU B;  3AU5 A;  1Y19 B;  4XX5 A;  3SV1 A;  2I5C A;  4ZDV A;  2KX3 A;  4HCN B;  1DRO A;  4AWJ A;  3VTU A;  4EZJ A;  2FCQ A;  3PGE A;  4GB9 A;  5LXI B;  3SYX A;  3UIO B;  2H7D A;  3WAP A;  1CMX B;  3HHM A;  3CSF A;  2XQN M;  3NHE B;  1KZG A;  1S1Q B;  1WJ6 A;  4KDL B;  1XKE A;  1UNQ A;  3M63 B;  1P3R A;  2KDB A;  1QZE A;  2DKP A;  2IZV B;  1UPQ A;  3IG3 A;  2FNJ B;  2CU1 A;  2KWV B;  1IP9 A;  1WJ4 A;  2PEA A;  4JIO U;  5J3Q A;  2KC2 A;  3TW1 A;  4BBK A;  3ULB A;  2REX A;  2UZR A;  4FJY A;  1EUV B;  4NJ6 A;  1EAZ A;  2NBU A;  4IM2 A;  2E2X A;  2NBW B;  2L2I A;  1DYN A;  3A8P A;  5C16 A;  4RM8 A;  2KK8 A;  2KDE B;  5DPW A;  4AP4 C;  3UZT A;  4ZRI A;  2IBI B;  4HDO A;  3ZKJ C;  3WAM A;  1J19 A;  2FAZ A;  1PMS A;  2N9P C;  1VD2 A;  3X0W A;  4K17 A;  2XBB C;  3B1L X;  3WAN A;  2AL3 A;  2MWN B;  1OEY A;  2N1W A;  4FJZ A;  5DH9 B;  1MK7 B;  3TBL D;  2NZ8 B;  3RCZ A;  1NI2 A;  1YJ1 A;  2C7H A;  1SHC A;  4IM0 A;  2V1Y A;  1Q5W B;  3B0A A;  1DDM A;  2Z0D B;  2MRP A;  1P0R A;  2MBE A;  1T0Y A;  5EDS A;  2MDX A;  2QHO A;  3SUZ A;  1W1D A;  2KJR A;  3UQB A;  3SD5 A;  2NPT A;  1WGG A;  3I3T B;  3B08 A;  1WG7 A;  5AZF A;  1LM8 B;  1RFA A;  1MPH A;  2HE7 A;  1L2N A;  2NMB A;  5E6N A;  5BO4 B;  3V61 A;  2L7R A;  1TBE A;  4CHJ A;  3UIP B;  1UZX B;  2K6Q A;  3VDZ A;  1Y8R C;  4W9L A;  1E5W A;  5JHG A;  2MBQ A;  3BJI A;  1WI1 A;  2AL6 A;  3QHT A;  2CS4 A;  3HW2 B;  4HK2 A;  3LDZ E;  3RZF A;  5C5B A;  1WZ0 A;  4W9D A;  3W1S A;  4PYU A;  4XC2 A;  2JY6 A;  1EF5 A;  4HAW B;  1GUA B;  2ZPN A;  4DK5 A;  4A6H A;  2DX5 B;  3EC8 A;  4B6H A;  5D6J B;  4WJ7 A;  2DTC A;  2HTH B;  2H7E A;  1WE7 A;  2LG1 A;  1WJU A;  2K1F A;  3RUI B;  1U27 A;  4BOS C;  3VHT C;  3L54 A;  1ZC4 B;  2EMS A;  2G45 B;  2DX1 A;  3PRM B;  4P7I A;  2DEN B;  1SE9 A;  1J8C A;  5HE0 A;  2KTR B;  1V49 A;  2AWT A;  4A6F A;  2KMC A;  4F7Z A;  1V5U A;  4HAU B;  3RT3 B;  1WIA A;  3OLM D;  5IAA C;  3TJP A;  3K9P B;  1WXM A;  2KFJ A;  4MGK E;  3VUX A;  3ODO A;  3TO1 A;  2L0F A;  4HAX B;  4A3P A;  1XOD A;  4BKS D;  3WAO A;  2L05 A;  4TYZ A;  2LVQ A;  2J0M A;  2K2U A;  3PVW A;  2YSZ A;  2KFK A;  2RPQ A;  2DZK A;  4KIK B;  4F7U P;  2BKR B;  4MM3 A;  2KLC A;  2FJL A;  1WM3 A;  3APF A;  4IG7 B;  1OEY J;  2LI5 A;  2JPH A;  2MBO A;  2KNB A;  5D2M B;  2O6V A;  1WR1 A;  3KW5 B;  3HIZ A;  2OTX A;  1WY8 A;  3ZW3 A;  1WX9 A;  1UBQ A;  4WVF B;  1BTK A;  2Q13 A;  1XD4 A;  4KDI C;  1DDW A;  3PP2 A;  3HM3 A;  2RSG A;  2JWZ A;  1V86 A;  1MIZ B;  3DXD A;  4EKU A;  3A1Q A;  2FIF A;  2BKF A;  1WGY A;  4NPN A;  3WYF B;  5FI1 A;  5JP4 A;  2M17 A;  4YON A;  2W9N A;  2WDT B;  3PS6 A;  3DXC A;  2NVU I;  4GIV A;  3PPA A;  1BT0 A;  3T9L A;  3RD2 A;  2N0Y A;  3VXW A;  4C0A A;  1E8W A;  3A8Q A;  2KOX A;  4FN2 A;  2BWF A;  2KVR A;  2KN5 A;  3V60 A;  2CHZ A;  4K2P A;  4WJP A;  2A4Z A;  4MGZ E;  2MP2 B;  5HE2 A;  3ONS A;  3ZNI D;  2K2J A;  4EZL A;  3H7P B;  3KSY A;  3EFU A;  1FGZ A;  4EOY A;  1V5P A;  3M1I B;  3MPX A;  3AJ4 A;  5CTR C;  1X1G A;  3PVL A;  4KSL C;  4KHA A;  4LDT D;  3WA0 A;  2R0D A;  3QAR A;  2IO2 B;  3T8M A;  3GZN I;  1X11 A;  3A98 B;  3M3J A;  2KHW B;  2ZCB A;  2L0T A;  2ELA A;  1U5D A;  3WIM A;  3DXE A;  2GS0 A;  2Y7B A;  3OJ3 A;  4IFS A;  5D94 A;  3DBH I;  4KAX B;  2K8C A;  1OY2 A;  1IPG A;  4OVU A;  3SNH A;  1IRS A;  4HJK A;  4HAV B;  4RMA A;  1J0W A;  2YLM A;  3ZDM C;  3O96 A;  4MJS A;  3QQ8 B;  4KV2 A;  3PHW B;  2D9W A;  2D2Q A;  4TQ1 A;  2O2V A;  4Z2N A;  2GCJ A;  4HAT B;  1WJ1 A;  1D3Z A;  1UPR A;  1GNU A;  5DPT A;  3V62 A;  5D3Y A;  3RCP A;  3HK0 A;  5DPR A;  5CHF A;  3TL5 A;  5LOP B;  3PHX B;  1GJZ A;  2Y8F A;  2L1C A;  4MSM B;  4IWP A;  3G9W A;  2KQS A;  4NAW A;  4FA6 A;  4BKG A;  1R4N I;  3DDC B;  4D0N B;  3ZIM A;  1I42 A;  3QK0 A;  2Z0O A;  1PFJ A;  2RD0 A;  4GDK A;  2M0X A;  2KMA A;  2KDF B;  3K9O B;  4ASW C;  1AQC A;  2D3G A;  1X86 A;  3JW0 X;  1WRD B;  2C60 A;  5CHW A;  2K8B A;  2N7D A;  4HB4 B;  1AAR A;  1XT9 B;  3DBR I;  5DCN A;  2LUE A;  1WGU A;  2KUP A;  1P98 A;  1E7V A;  4K1R B;  1UH6 A;  1U5G A;  1TJ6 A;  2N23 A;  3ODX A;  2M4N A;  3H1U A;  3N3K B;  2CR5 A;  1YIW A;  1UEF A;  3A9K A;  2YF0 A;  4H8S A;  3C0R B;  1EF1 A;  2RUK B;  2G4D B;  4PS3 A;  3IVF A;  4MH0 E;  3N7C A;  1TQZ A;  1TTN A;  4K81 A;  3KUZ A;  5CLQ B;  3DPD A;  4DX8 A;  1WZ3 A;  4BKS A;  2K6D B;  2M38 A;  3PTF C;  3P6A A;  4AJY B;  3NSU A;  4CHK A;  2V76 A;  2NBV B;  3SU8 X;  4XWX A;  3JYU A;  2LWP A;  4HHV A;  1ZM0 A;  3PG7 A;  3TIX A;  4NNJ B;  5JHH A;  4JLC A;  1QQG A;  3N32 A;  3QCA A;  3L10 B;  3BIN A;  1E90 A;  3AU4 A;  2EC1 A;  4WJO A;  2B3A A;  3IFW B;  4Z2M B;  1LB1 A;  1TXD A;  2MBH A;  4I6N B;  2VRW B;  4ZRK A;  4HAZ B;  1V5T A;  1WXS A;  1L7Y A;  2YRY A;  1H4R A;  3GOE A;  2I5F A;  3QWZ B;  2LYD A;  2BYE A;  1X05 A;  2LJ5 A;  4ANW A;  3ALB A;  2XEW A;  4K2O A;  5HKH A;  5D3V A;  2MW5 A;  1W1G A;  2FCM A;  2MFQ A;  2DA0 A;  2KC1 A;  5JHA A;  2R2O A;  4E3C A;  2PZ1 A;  4G50 A;  1WFY A;  1ZW7 A;  2Z0E B;  4DDG D;  4DHJ B;  3TVV A;  5J3Y A;  1TGZ B;  3KYC D;  5L81 A;  4GOC A;  5KQ1 A;  2DZJ A;  3QIJ A;  3KYD D;  3WAL A;  4BKT A;  1V5M A;  5HE1 A;  2BPS A;  2DX5 A;  3L13 A;  2NR2 A;  2XK5 B;  3O65 B;  1EVH A;  4A20 A;  1WE6 A;  3ML8 A;  1GG3 A;  4N9F 4;  2DKQ A;  1KJT A;  3NZS A;  2MX2 A;  3VVW B;  3ZVV A;  2LZ6 A;  4OVV A;  3SO6 A;  2LVP A;  2ADZ A;  2MSE D;  1SIF A;  1QC6 A;  3A9J A;  3VQI A;  2KJH B;  1BTN A;  1V2Y A;  4PS8 A;  4HWI B;  2IYD B;  1V89 A;  1I2H A;  2WX1 A;  2Y5B B;  3ENE A;  1FAO A;  5IA7 A;  4K7W A;  2CAY A;  2DLW A;  4EJN A;  1V81 A;  1ZVR A;  2PE6 B;  2CHX A;  1V61 A;  2LVO A;  1UEL A;  4GGQ A;  4K7S A;  2G3Q B;  2UVM A;  4M8M A;  1U4A A;  4G0N B;  4KIK A;  2LUL A;  3H6N A;  4LJP B;  5DHA B;  4ZRJ A;  2LXC A;  1EGX A;  2COD A;  1WI0 A;  3TMP B;  2PPH A;  4ANX A;  4MGI E;  1HE8 A;  2OOB B;  2GBM A;  2LRU A;  2KO3 A;  3S2A A;  2COA A;  2JP2 A;  1U2B A;  4URK A;  4LDT B;  2Z0Q A;  3QBV B;  1JRU A;  1V88 A;  3ZTC A;  4A3O A;  3QWM A;  5LXH A;  1G6J A;  4HCP B;  3P2B A;  1Q1O A;  1DDV A;  3ZTD A;  3PZD A;  3DVG X;  2C7M B;  1I35 A;  3VTW A;  1TZ1 A;  1E8X A;  2D4Q A;  4MK0 A;  1WM2 A;  5D27 A;  1KZ7 A;  1FHX A;  4BVU C;  4F7G A;  1UD7 A;  2DYB A;  2LKO A;  3ML9 A;  3ZNH B;  4DHJ D;  3OJ4 B;  4HLE A;  1LXD A;  5G2N A;  4E71 A;  5DHF B;  3RUL A;  1ISN A;  4W9E A;  2IFS A; 
#chains in the Genus database with same CATH topology
 2IYB A;  2D07 B;  2MJ3 A;  2WHI A;  3N20 C;  4C4V B;  2J53 A;  4HXD A;  3QJZ A;  3PLV A;  1RAX A;  3MFG A;  2FCN A;  2WP9 B;  2RDH A;  4LJO B;  1M7E A;  3L08 A;  4JL9 A;  1C1Y B;  1K5G B;  4DHZ E;  3P1M A;  4KGR A;  1NTY A;  3PRP B;  2WLB A;  3H7P A;  1V5O A;  1B55 A;  2PVO D;  3F5R A;  1ZPS A;  2K8E A;  4A6F B;  1C4C A;  4K7U A;  3UGB B;  1C4A A;  3W5U B;  2IY1 B;  3L17 A;  2WXM A;  3R7R A;  1ET9 A;  2GMI C;  2BYV E;  2K0P A;  4GMX B;  4BBN F;  2W2X C;  2W2X D;  3AE4 B;  2BYF A;  3ZDT A;  3F0W A;  4A90 A;  4EE2 A;  3W1Y A;  3SHQ A;  1WMH A;  5I2S A;  3VFK A;  2KR0 A;  5JH5 C;  3UIN B;  4CYE A;  1XCQ L;  5H92 C;  1Q67 A;  1F2R I;  4MY6 A;  2N9L A;  4IC7 B;  2M14 A;  3RNA C;  1H10 A;  2KFK B;  3LXF A;  2K39 A;  3DVN V;  2WXK A;  1Z5S B;  2D9V A;  4ZRP A;  4TMA B;  3A33 B;  2W2W A;  1VZ6 A;  4ANV A;  2V3P A;  3NS8 A;  3OAW A;  2KXJ A;  2NTT A;  4E74 A;  3M95 A;  4P6V F;  2G4S A;  2MH7 A;  4AS1 A;  4A55 A;  1PLS A;  2PKO A;  1WX7 A;  2N7E A;  1YQB A;  2O6V B;  2Q5W D;  4ICV A;  4ZRQ A;  1JWA D;  4GU2 A;  3V6C B;  1C76 A;  2JZZ A;  2ROZ B;  1GC6 A;  3SFD B;  2DHJ A;  1MG8 A;  1K51 A;  3NWF A;  4OSN A;  5EFX A;  4NSW A;  2JWU A;  3H7S A;  1QKZ A;  2KZR A;  2D9Z A;  2KWU B;  4P1B C;  3RNF C;  3U52 E;  4W9K A;  1P3Q U;  3M62 B;  5BYR A;  3A1Q B;  2ZVN A;  1JQ4 A;  2KQ7 A;  3BYY B;  3A4R A;  2M0A A;  2VH1 A;  4PT5 A;  3NG0 A;  2KX0 A;  2LUM A;  1X1M A;  2DFK A;  4F8C B;  4ANU A;  1KLV A;  3JVZ X;  1FCC C;  1OTR B;  2GJY A;  2MA9 B;  3VR9 B;  1WH3 A;  1FNW A;  5CLL B;  4W9I A;  1V6E A;  3C8Y A;  1DYQ A;  2KLG A;  2LRW A;  4BFR A;  3RYT A;  3ZJT A;  2GCL A;  3W1S C;  3PVU A;  2Y8G A;  4YSZ B;  1JRP A;  1PQS A;  4YWG G;  3R8B A;  2JZP A;  4IM3 A;  1NU2 A;  2INC C;  2OED A;  3ZNZ B;  1ROE A;  2PMV A;  4PYZ A;  4DXG A;  4DXF A;  2JQR B;  3VH3 B;  3W5V B;  5IP4 D;  3BY4 B;  2QKL A;  2YVC A;  3H9D A;  3LJ3 A;  2IJ0 A;  1NYR A;  2AQ1 B;  1A5R A;  3T06 A;  1T5X D;  2PTL A;  3BWU D;  1Z2M A;  2G35 A;  4XYC A;  2WXO A;  2CY4 A;  4GZU A;  2I1J A;  1OQY A;  2JF5 A;  4IWQ A;  2JRH A;  3JSV B;  1P7F A;  3PEG A;  2DZI A;  3APC A;  1NBF C;  2DAF A;  2IDY A;  2NS5 A;  2EMT A;  3PLU A;  1J0G A;  2V3N A;  4IAP A;  2GRI A;  3R3M A;  2AQ3 B;  3ZUN A;  4MSQ B;  2UWQ A;  5CHV C;  2K25 A;  4WSF A;  1QOF A;  2BQQ A;  2ZKM X;  5HG2 A;  1L6V A;  5JZE B;  1E8Z A;  3FKY A;  2VSZ A;  4BOZ B;  4WJN A;  3PSE B;  5BMH A;  4GPT B;  3OAN A;  4FXC A;  4M0W B;  2FCS A;  2YT1 A;  3IHP C;  2KUQ A;  2K00 A;  1X1F A;  2CKH B;  1BAK A;  2CRF A;  2JUO A;  1IYF A;  4LLG M;  2KAN A;  3DCX A;  3UQA A;  1PUT A;  1B1Z A;  3UF8 A;  4C56 C;  4DBG A;  4I6L B;  1PGA A;  4YL8 A;  3P4Q B;  2KKC A;  5KHO A;  3VH4 B;  2NMQ A;  5J2R A;  1SXT A;  3ZXR A;  3RMK C;  1LFD A;  4EUT A;  1TKE A;  1UUP A;  4YXD B;  3BVG A;  1PGX A;  1NEK B;  2V4I B;  3X23 A;  2Z13 A;  1DOY A;  4CO7 A;  2GOW A;  2KN4 A;  3FIL B;  1HTO A;  1E8Y A;  3NY5 A;  1L4Z B;  3CF6 E;  1V80 A;  2O6V D;  4MDK E;  2X38 A;  3ZO5 B;  1ACC A;  5GMV A;  2M1M A;  3EEC A;  5JHB A;  1I4R A;  2N4F A;  2QIL A;  4BAX A;  4MJS B;  1ZUD 2;  2MBB B;  5LNK 1;  3A4S C;  3HRD D;  1XQQ A;  3TEZ A;  3VR8 B;  1UNP A;  2Z4D A;  3MTN B;  3Q3F A;  1MI1 A;  2ELB A;  1RRP B;  1MHH E;  2RMM A;  1WGH A;  3AE8 B;  3GE3 C;  3I9V 1;  1WR6 E;  2L8J A;  1C79 A;  1Q0W B;  3Q8E A;  3QAQ A;  5HHD G;  4O1N A;  3KRW A;  1MIX A;  4II2 B;  4BBN C;  1EWC A;  2LFI A;  4GDL B;  2KD0 A;  3P63 A;  2DAJ A;  4W9F A;  4AUQ C;  1F1H A;  2R2Q A;  4JX1 C;  3KZ1 A;  2CJO A;  2Z8L A;  3N30 A;  4A8X C;  4NAW B;  2DHK A;  4FBJ B;  2PJH A;  2AQ2 B;  4JPS A;  4A6Q A;  4HVB A;  1R4M I;  2N9X A;  2JXX A;  4A9A A;  1TKY A;  2COC A;  1ENF A;  2EKE C;  4W9G A;  2RGN B;  4MGY E;  4HB3 B;  4HRS A;  1FB8 A;  4II3 B;  5CX3 A;  2CHW A;  2RNR B;  1PDX A;  3AMZ A;  3AEB B;  4NQL B;  1DBH A;  1KH0 A;  4GMV A;  4GDK B;  2WXN A;  1XLO A;  1VDV A;  1FXI A;  5D3D A;  2IO1 B;  2DZM A;  4TUU A;  1W1H A;  3VOQ A;  1QIL A;  1E7U A;  4KZC A;  5IOI A;  4G3X B;  3DBL B;  3CST A;  2DYM A;  3U7D A;  5GOW B;  3FC4 A;  5LLI A;  4PS7 A;  1WGR A;  1WYG A;  1JWS D;  2KWC A;  5J3T A;  2C9W B;  2P8V A;  1D5Z C;  4FLH A;  3AE3 B;  1WJM A;  4PQ0 A;  3MJW A;  2BS3 B;  2GBJ A;  1EWY C;  2KIE A;  2XK5 A;  3NWD A;  4W9H A;  1ZDV A;  3MC9 A;  4MEL A;  1FCL A;  3NOB A;  4EMO A;  3CMM B;  2ZNV B;  2ASQ A;  3A9K B;  3DOW A;  1XCT L;  3QA8 A;  3R66 C;  3AE1 B;  1F0Z A;  5D3X A;  4WQO B;  1RRB A;  1LQB A;  1TS2 A;  1TT5 B;  5C2T B;  3D32 A;  4IWO A;  1S3S G;  1OMW A;  3MHS D;  2YS3 A;  1MAI A;  4FHJ A;  1E6E B;  1MKE A;  4UDU C;  2OHF A;  5IO9 A;  2WWZ A;  3TSS A;  5J17 A;  2GBK A;  2LGX A;  2V4L A;  5HFY A;  1AWD A;  4J6I A;  2CU3 A;  2RVB B;  2WX0 A;  2DLB A;  3KH0 A;  1DOI A;  1FNV A;  1XO3 A;  2HD5 B;  1FRR A;  4MAC A;  5AUI A;  5KHQ A;  5C1Z A;  1GC7 A;  4KGS A;  3L16 A;  2LGS A;  3N1Z C;  1UF0 A;  2M56 B;  4ICU A;  2AYO B;  3HIE A;  1WGQ A;  3LB8 C;  2D11 A;  1P6S A;  1ZYI A;  3VTV A;  5D7G A;  2ZPY A;  1YJJ A;  4WWP A;  3Q8F A;  1YNT E;  1YN5 A;  2Z0P A;  2ZZP B;  2HTH A;  1ZC3 B;  4DXA B;  4L6E A;  3B2G A;  2HJ8 A;  5C79 A;  1WXV A;  1YQ4 B;  5C3J B;  1E7P B;  1YD8 U;  3DVG Y;  1TJE A;  3Q6B A;  1WXQ A;  5FK9 C;  2SEB D;  1T0Q C;  5DPS A;  3APD A;  2KTR A;  2MHJ A;  4KHO A;  3AM9 A;  4DX9 0;  2QKM A;  3KWL A;  4HPL B;  1WF9 A;  3ZGZ A;  1TY2 A;  2FUH B;  4CHM A;  1NDD A;  2J59 M;  3L0W B;  1FRD A;  2KGX B;  4EFO A;  3FM8 C;  5L95 C;  2J0J A;  3GYO A;  4GN1 A;  2XNA C;  1BWN A;  2DWQ A;  3ULC A;  1RJ2 A;  3N9Y C;  3V6E B;  1AYF A;  3NJT A;  4MT7 A;  3RI7 C;  2D9Y A;  2MJE A;  2UZS A;  3VUY A;  3HVD A;  3P4P B;  4WWO A;  1NEN B;  2LOX A;  1VJK A;  1SEB D;  4KSK C;  2K22 A;  4GSW A;  1FHW A;  1STE A;  5LG4 B;  3BK2 A;  2DHI A;  1XX0 A;  1DOX A;  3PT2 B;  2IO3 B;  2MQJ A;  4FJV B;  4TKN A;  3KY9 A;  3KUD B;  4P16 A;  1I4X A;  3D8F A;  1J7C A;  3DCG A;  1KOT A;  1I4G A;  5C6R A;  4D6W A;  3AXC A;  2NPT B;  3OHM B;  4KKI A;  4QJ5 B;  4M00 A;  2IND C;  5AEK B;  5MPO A;  4WWN A;  1XLQ A;  3KRX A;  4HDQ A;  4YSY B;  1SF0 A;  2N9K A;  2LGY A;  3V5W A;  1EO6 A;  1F52 A;  2COF A;  1XR0 B;  4Y94 A;  3ZVR A;  2RGF A;  1WX8 A;  5C23 A;  3SFE B;  2ZNV C;  4H2A A;  3VRB B;  4IOY X;  4XZ4 A;  3U8Z A;  2N9E B;  2WDR B;  4REZ A;  2K8H A;  2FUG 1;  3A9J B;  4WAA A;  2J0K A;  4L23 A;  4PNK A;  2WU2 B;  3ZNG C;  5J18 A;  2LD9 A;  4HEA 1;  3AED B;  1Z87 A;  4NJ7 A;  2KIG A;  5C5B B;  2A5U A;  2WNM A;  2I1K A;  3D8E A;  3HQC A;  4K3C A;  5AZG A;  3Q3M C;  1F9J A;  4HPM B;  4JQW C;  2FBW B;  1WWT A;  1GOZ A;  3CIK A;  3EHV A;  2MLB A;  1K5D B;  1U29 A;  1V1P B;  3I63 C;  3BK1 A;  2HJ1 A;  4HB2 B;  1T6B X;  1UWX A;  2X18 A;  4W9J A;  2NCN A;  3B77 A;  1ZOY B;  3U12 A;  1WXA A;  3PZ7 A;  1BXT A;  1WJN A;  2AEH A;  1FFU A;  1TZO A;  2L76 A;  3MHZ A;  3MJ5 A;  2DN6 A;  1AWE A;  2Z59 B;  4RM9 A;  1N63 A;  4AOF A;  3RNG C;  2P0D A;  2D3B A;  1FXT B;  3TEY A;  4AJW A;  1V9J A;  2L3Z A;  2C5L C;  1VZ7 A;  2LXA A;  5G55 A;  4RNA A;  4HB0 B;  2MP2 A;  4NY0 A;  1C9F A;  1KRH A;  5KCV A;  4M8N A;  1SJH D;  4KZ0 A;  2GBR A;  1JWM D;  2VZK D;  1Q10 A;  2DYN A;  3Q14 C;  1L6U A;  3NVZ A;  2P0F A;  4KVG B;  2GBN A;  2HDE A;  4S17 A;  2JX5 A;  3VUW A;  1H8C A;  2D10 A;  2ZVO A;  1NTV A;  4LNF A;  2OJW A;  2KTF A;  1OGW A;  5E6J A;  3ZRC A;  4RGO S;  1UNR A;  4WUR A;  2N1V A;  3P7Z A;  1XEE A;  2J7Q B;  3BYT B;  2FID A;  2ZEQ A;  3GE8 C;  3PSC A;  3Q69 A;  2P0H A;  1V1O A;  1OQN A;  1VCB A;  1YJI A;  1NYQ A;  2KDI A;  2RDG A;  3TFM A;  1FOE A;  3PRZ A;  3BZD B;  4TQ0 A;  2JVC A;  4A5K A;  3AH7 A;  4FHK A;  4EZK A;  1FHO A;  1T0R C;  2YT0 A;  3V05 A;  2DYQ A;  4YTM B;  3FEH A;  4K3B A;  4XWW A;  4S0R A;  2OQB A;  2J52 A;  4F1S A;  4I6P A;  1P9D U;  4MEM A;  4TV3 A;  4ZYN A;  2WS3 B;  4MM3 B;  2ZCC A;  3DBS A;  3KQ4 A;  5E6O A;  4F7H A;  1L0Y B;  3ZLZ A;  1FGY A;  5DIF B;  4WJQ A;  1ZSQ A;  4KHB B;  5L83 A;  3DBL I;  2DBY A;  1OQR A;  2IO0 B;  3RPF C;  1K8R B;  3DVN U;  1K53 A;  2W54 A;  2ROV A;  3Q2A C;  4DDI D;  5KQ4 A;  3TCA A;  1XD3 B;  4B9K A;  1SGH A;  3VIA A;  1JRO A;  5D3I B;  5TSS A;  2V3S A;  1U5F A;  1NI3 A;  2JT4 B;  2JZ3 B;  3I5J C;  1M94 A;  2BWE S;  5TR5 A;  4DWF A;  2QC8 A;  2K9X A;  3QX1 A;  1SE2 A;  3JSV A;  3CWI A;  1WRI A;  2BF8 B;  2L52 A;  2LHD A;  5JLJ B;  1P5T A;  4R3D A;  4DHZ B;  2IGD A;  3NZU A;  3ODW A;  4W9C A;  1YMH E;  2MCN B;  3R7Q A;  4L2Y A;  3HM6 X;  1R7S A;  4JGH B;  4GOU A;  1KM7 A;  1SSN A;  2Y3A A;  2KCJ A;  3PRE A;  2LAS A;  2WU5 B;  4NQK E;  1M7R A;  1U5E A;  4IUM B;  2WDQ B;  4ARI A;  2EKI A;  2L00 B;  3OG5 A;  5E6P A;  1Y5O A;  2J4X A;  4M0W A;  1LW3 A;  1WMH B;  2D9X A;  5D3W A;  2RSU A;  4HAY B;  1QLB B;  2WXL A;  2RLO A;  3PV1 A;  5FI0 A;  1XCG A;  2ICI A;  2VRR B;  2BGF A;  2LHE A;  3FSS A;  1SJE D;  1WGD A;  3N1X C;  4RH6 A;  2JRI B;  3AI5 A;  3KUC B;  2CY5 A;  5FR6 A;  3MC0 B;  1BML C;  3R2T A;  5AZH A;  3LJU X;  1FFV A;  2AX5 A;  2IY0 B;  2UYZ B;  3ZRF A;  1AN8 A;  2YS5 A;  1N61 A;  1YX6 B;  3IXS A;  3RZW C;  2LOZ A;  2C7N B;  1YN3 A;  2BCJ A;  1IBX A;  3IT6 B;  5EE3 A;  2QDF A;  3VRA B;  4FAD A;  2YS1 A;  1RLF A;  2ZW1 A;  1SE4 A;  3IAS 1;  4GLS C;  2RR9 A;  4FUL A;  3T3O A;  3VAW A;  4X57 B;  2MKR A;  3W9C B;  1PFD A;  2M19 A;  1N3H A;  2X8X X;  2LGD A;  4B6W A;  3QC8 B;  1J7B A;  1C3T A;  5HE3 A;  4EEW A;  3A58 A;  2VKI A;  1N62 A;  4CQN A;  5EE0 A;  1WYW B;  4HSI A;  4GXB A;  4LCD E;  3CXB B;  4L1B A;  4IW0 A;  1UBI A;  1UGM A;  4G11 A;  2WYQ A;  3Q3J A;  3GYP A;  2W3S A;  3ML4 A;  2OJR A;  2M8S A;  3U30 A;  2BB6 A;  1VRA B;  3AUL A;  2G9H D;  4GDL A;  3ZJU A;  1I7A A;  2BT6 A;  2E6X A;  1VZ8 A;  2MWS B;  3SDL C;  1P1A A;  1KI1 B;  1WVH A;  3ECI A;  2ZJD A;  2N7J A;  2KJ6 A;  1YX5 B;  5FR3 A;  2DYO A;  2NBV A;  1QQR A;  2KDM A;  3TUO A;  4A6K A;  2INN E;  1KLU D;  5I2M A;  4LNN A;  3SEB A;  1MK9 B;  2EJ8 A;  3DQV A;  2DHZ A;  3KVF B;  4OZA A;  3D8D A;  1WSP A;  4DBB A;  5DI9 B;  2RPV A;  3IBE A;  5LON B;  3Q8C A;  1RM6 C;  2PE9 A;  3EFC A;  3MDB C;  4C7Z A;  1IGC A;  1PGB A;  4B95 A;  3B9J A;  1ZKH A;  2R09 A;  2O2V B;  1ZGU B;  4IDI A;  3AU5 A;  1Y19 B;  1Y56 A;  4XX5 A;  4M01 A;  3SV1 A;  2I5C A;  2G1E A;  2VH2 A;  4ZDV A;  2KX3 A;  1RYJ A;  1TY0 A;  2LEK A;  1DRO A;  4HCN B;  4JWS C;  4RGN A;  4AWJ A;  2PIA A;  5BYS A;  3VTU A;  3DWM A;  4IKG A;  4EZJ A;  2FCQ A;  3PGE A;  4GB9 A;  5LXI B;  4LNI A;  3SYX A;  3UIO B;  1QF6 A;  3HVZ A;  2H7D A;  3WAP A;  3U7Z A;  3DHI C;  1CMX B;  3ZJV A;  3HHM A;  4OW0 A;  3CSF A;  2JU6 X;  3E56 A;  2XQN M;  3NHE B;  1KZG A;  3FAH A;  1TYG B;  4D2K A;  2IGG A;  1S1Q B;  1WJ6 A;  4KDL B;  1XKE A;  1UNQ A;  3ZXV A;  3M63 B;  2ACZ B;  3OWE B;  1P3R A;  2KDB A;  1FMA D;  1QZE A;  2DKP A;  2WQY B;  2IZV B;  1UPQ A;  3IG3 A;  2FNJ B;  2LJI A;  2CU1 A;  2KWV B;  1IP9 A;  1WJ4 A;  2PEA A;  4JIO U;  5J3Q A;  1KF6 B;  3NUH B;  2KC2 A;  3TW1 A;  4BBK A;  4HJG E;  3ULB A;  1FEH A;  2REX A;  4OZC A;  2K49 A;  2UZR A;  4FJY A;  1EUV B;  2NTS A;  4NJ6 A;  1EAZ A;  2NBU A;  4IM2 A;  1HZ5 A;  2E2X A;  2NBW B;  1D5X C;  2L2I A;  1DYN A;  2J42 A;  3A8P A;  5C16 A;  4RF1 A;  4RM8 A;  2KK8 A;  2PW9 A;  2KDE B;  5DPW A;  4RGT A;  4AP4 C;  1UWM A;  4ZYS A;  4ZHO A;  3UZT A;  2H88 B;  1T77 A;  4ZRI A;  1E0Z A;  1JML A;  2IBI B;  2SAK A;  2KAJ A;  4HDO A;  3ZKJ C;  3Q3O C;  2KAC A;  4MT5 A;  3WAM A;  1J19 A;  2FAZ A;  3AEC B;  1PMS A;  2N9P C;  1VD2 A;  1B9R A;  5IKC M;  2Y5P A;  3X0W A;  3GZN B;  4K17 A;  3NVY A;  2XBB C;  3AE9 B;  3B1L X;  3N1Y C;  4OT1 A;  3WAN A;  2AL3 A;  2MWN B;  2MJD A;  1OEY A;  1D6E C;  2N1W A;  4FJZ A;  1HXY D;  2K5P A;  5DH9 B;  1MK7 B;  3TBL D;  2NZ8 B;  3RCZ A;  1NI2 A;  1E9M A;  1YJ1 A;  4XWT A;  2C7H A;  1SHC A;  1WGK A;  4OZB A;  4HPP A;  4IM0 A;  2V1Y A;  1Q5W B;  3O13 A;  3B0A A;  1DDM A;  2Z0D B;  1QT9 A;  2GLS A;  2MRP A;  4TSS A;  1P0R A;  1XF5 L;  3PO0 A;  3DBH B;  2MBE A;  3ABV B;  1T0Y A;  5I4D A;  2KT7 A;  5EDS A;  1ZXI A;  1T3Q A;  3GS2 A;  1C78 A;  2MDX A;  2QHO A;  3SUZ A;  1W1D A;  2VZK B;  2JYT A;  2KJR A;  2QJL A;  1MFW A;  3UQB A;  3SD5 A;  2NPT A;  4YSX B;  1WGG A;  3I3T B;  3B08 A;  1WG7 A;  5AZF A;  1LM8 B;  1RFA A;  1MPH A;  2HE7 A;  1L2N A;  5EE9 A;  2NMB A;  4QAY A;  1JCK B;  3RNE C;  5E6N A;  5BO4 B;  3V61 A;  2L7R A;  1TBE A;  4CHJ A;  3UIP B;  2BS4 B;  1UZX B;  4MH8 A;  2K6Q A;  4KKJ A;  3VDZ A;  1ZE3 D;  1Y8R C;  4ACF A;  4W9L A;  1E5W A;  5JHG A;  2MBQ A;  3BJI A;  1WI1 A;  3RFZ B;  2AL6 A;  4QJ4 B;  1FNU A;  3QHT A;  4WIP A;  2CS4 A;  3HW2 B;  4HK2 A;  3LDZ E;  3RZF A;  1VLB A;  3AV8 A;  5C5B A;  3NVW A;  2INP E;  1WZ0 A;  4W9D A;  2PVG C;  4HKZ E;  3W1S A;  1ET6 A;  1R4N B;  4PYU A;  4XC2 A;  2JY6 A;  3NVV A;  1EF5 A;  4HAW B;  1EM7 A;  3FVC A;  1GUA B;  2ZPN A;  4DK5 A;  4A6H A;  2Z59 A;  2DX5 B;  3EC8 A;  3WCQ A;  4B6H A;  1OFF A;  5D6J B;  4WJ7 A;  2DTC A;  2HTH B;  2H7E A;  1WE7 A;  2LG1 A;  1WJU A;  4C4V A;  2K1F A;  3RUI B;  1U27 A;  4BOS C;  4OVZ A;  3VHT C;  3L54 A;  1ZC4 B;  1UNS A;  2EMS A;  2G45 B;  3DBR B;  2DX1 A;  3PRM B;  4P7I A;  4C7Y A;  3BII D;  2DEN B;  1SE9 A;  1J8C A;  5HE0 A;  4RCO A;  2KTR B;  1V49 A;  3RNC C;  2AWT A;  2WXI A;  4A6F A;  2KMC A;  4F7Z A;  1SIJ A;  1V5U A;  4HAU B;  3RT3 B;  1N5X A;  1WIA A;  3OLM D;  5IAA C;  3TJP A;  3W2D A;  3K9P B;  1WXM A;  2KFJ A;  4MGK E;  1D5M C;  3VUX A;  3ODO A;  3TO1 A;  2L0F A;  4HAX B;  4A3P A;  1XOD A;  4BKS D;  3WAO A;  2L05 A;  4TYZ A;  2LVQ A;  1K52 A;  2J0M A;  1V97 A;  2K2U A;  2GI9 A;  3PVW A;  4AQ7 A;  2YSZ A;  2KFK A;  2RPQ A;  2W82 A;  2DZK A;  4KIK B;  4DQO C;  4F7U P;  2R61 A;  2BKR B;  3IT4 B;  4MM3 A;  3P4R B;  2KLC A;  3TEW A;  2KQ4 X;  2FJL A;  1WM3 A;  4YTN B;  3APF A;  4IG7 B;  3C19 A;  1OEY J;  2LI5 A;  2JPH A;  2MBO A;  2KNB A;  5D2M B;  2O6V A;  1WR1 A;  2JXT A;  2L83 A;  3GP7 A;  3KW5 B;  3HIZ A;  2OTX A;  4QJ3 B;  1WY8 A;  3ZW3 A;  1FPY A;  1WX9 A;  1UBQ A;  4WVF B;  4J3O D;  1BTK A;  2Q13 A;  1XD4 A;  4KDI C;  5GXG B;  3AEF B;  2WXF A;  1DDW A;  2LMC A;  4NJC A;  4QXA B;  3B2F A;  3PP2 A;  4LNO A;  3HM3 A;  1JAL A;  2RSG A;  2JWZ A;  1V86 A;  1MIZ B;  4LNK A;  1NVI D;  3DXD A;  4EKU A;  4XDD A;  3A1Q A;  4NAM A;  2FIF A;  2BKF A;  4ARC A;  1WGY A;  4NPN A;  3WYF B;  5FI1 A;  5JP4 A;  2M17 A;  4ZOH C;  4YON A;  2W3R A;  2WXG A;  2W9N A;  2H89 B;  2WDT B;  1D4B A;  3PS6 A;  3DXC A;  2NVU I;  4GIV A;  3PPA A;  1SE3 A;  2TSS A;  1BT0 A;  3T9L A;  3RD2 A;  2N0Y A;  3VXW A;  4C0A A;  1E8W A;  1K50 A;  3A8Q A;  2KOX A;  4FN2 A;  2BWF A;  4XGA B;  2KVR A;  2KN5 A;  3V60 A;  2CHZ A;  3RN9 C;  4B0M A;  4K2P A;  1YN4 A;  4WJP A;  2A4Z A;  4MGZ E;  3U2S C;  1LGR A;  1AW7 A;  2MP2 B;  5HE2 A;  3ONS A;  3ZNI D;  2K2J A;  4B0E A;  1TKG A;  4EZL A;  4C00 A;  3H7P B;  3KSY A;  2UU7 A;  3EFU A;  1FGZ A;  4EOY A;  1V5P A;  3M1I B;  1TIF A;  3MPX A;  3AJ4 A;  1MPE A;  5CTR C;  1X1G A;  3PVL A;  4KSL C;  3DWG C;  2XN9 C;  1MG4 A;  4KHA A;  4LDT D;  3KWV A;  2GB1 A;  3WA0 A;  2R0D A;  3QAR A;  2IO2 B;  3T8M A;  3GZN I;  1X11 A;  3A98 B;  3I57 A;  3IAM 1;  3M3J A;  4RGM A;  1IGD A;  2WGS A;  1GAQ B;  2KHW B;  5IN7 A;  2ZCB A;  2L0T A;  1J7A A;  2ELA A;  1HTQ A;  1U5D A;  3WIM A;  3DXE A;  1GPX A;  3AE6 B;  2GS0 A;  2Y7B A;  2KMM A;  3OJ3 A;  4IFS A;  5D94 A;  1E10 A;  3DBH I;  4KAX B;  2LGI A;  2D3C A;  2K8C A;  1OY2 A;  1UGJ A;  1IPG A;  4OVU A;  3SNH A;  1IRS A;  1EU3 A;  2I2Y A;  3UI3 A;  4HJK A;  4HAV B;  4RMA A;  1I4P A;  3LYY A;  1J0W A;  2YLM A;  3FIL A;  5H8Y E;  4N6E B;  3ZDM C;  1MJD A;  3L4P A;  2R2Y A;  3O96 A;  3RNB C;  4MJS A;  2KYW A;  1L4D B;  1CQV A;  3QQ8 B;  4KV2 A;  3AE2 B;  3PHW B;  2D9W A;  2D2Q A;  1ESF A;  1FM0 D;  4TQ1 A;  2O2V A;  1RWS A;  4Z2N A;  1GB4 A;  4ZHP A;  2DNF A;  2GCJ A;  4HAT B;  1WJ1 A;  1D3Z A;  1UPR A;  1GNU A;  5DPT A;  2QEJ C;  1F77 A;  1TS3 A;  1XLP A;  3V62 A;  4JWU C;  5D3Y A;  4RF0 A;  4LTU A;  4WWM A;  3RCP A;  4RFB A;  3HK0 A;  1JWB D;  5DPR A;  3MP9 A;  5CHF A;  3TL5 A;  5LOP B;  2K3U A;  3BVZ A;  3PHX B;  1C77 A;  1GJZ A;  2Y8F A;  2L1C A;  4MSM B;  4IWP A;  2Z14 A;  3G9W A;  2KQS A;  3ZYY X;  4NAW A;  2WXJ A;  3P4S B;  1PYW D;  4FA6 A;  4C80 A;  4BKG A;  3AB5 A;  1R4N I;  3DDC B;  3P42 A;  4D0N B;  3ZIM A;  1I42 A;  2WXH A;  3E9S A;  3QK0 A;  2Z0O A;  1PFJ A;  2RD0 A;  2FJU B;  2L1A A;  4XE0 A;  1L0X B;  4PK1 A;  4OHJ A;  4GDK A;  2QMT A;  2M0X A;  2KMA A;  2KDF B;  3K9O B;  4ASW C;  1AQC A;  2D3G A;  1X86 A;  1TS4 A;  3JW0 X;  1WRD B;  2C60 A;  2IGH A;  3EUB 2;  5CHW A;  2K8B A;  4GNK B;  1SB3 C;  2N7D A;  1IBX B;  4HB4 B;  4N58 A;  1AAR A;  5IRS A;  1XT9 B;  3DBR I;  5DCN A;  2LUE A;  1WGU A;  2KUP A;  3EGR A;  3ETR A;  3Q8B A;  2IPK D;  1P98 A;  1E7V A;  4K1R B;  1QOB A;  5M4Y B;  1UH6 A;  4N59 A;  2JSV X;  1U5G A;  5G5H A;  3KLS X;  3AN1 A;  1JW9 D;  1TJ6 A;  2KWD A;  2N23 A;  3ODX A;  2M4N A;  3H1U A;  4XDC A;  1MVK A;  4US8 A;  3NWA A;  5T8I A;  3N3K B;  2CR5 A;  2BTE A;  1YIW A;  1UEF A;  3A9K A;  3T3N A;  3URY A;  2YF0 A;  4H8S A;  3R2I A;  3C0R B;  2PLP A;  1ZXH A;  3SR6 A;  1EF1 A;  2RUK B;  2G4D B;  5EE1 A;  4PS3 A;  3AEE B;  3IVF A;  4MH0 E;  3N7C A;  1TQZ A;  1TTN A;  4K81 A;  3KUZ A;  5CLQ B;  3DPD A;  2RRF A;  4DX8 A;  1WZ3 A;  4IOI E;  4BKS A;  2B76 B;  1N6Z A;  1KFY B;  2K6D B;  4USA A;  2M38 A;  1FD6 A;  3PTF C;  3P6A A;  4AJY B;  4BZA A;  3NSU A;  4ITK A;  1HZ6 A;  1BUI C;  2RDB C;  4CHK A;  2V76 A;  2NBV B;  3SU8 X;  4XWX A;  3JYU A;  2LWP A;  4HHV A;  1ZM0 A;  2FE8 A;  3PG7 A;  3TIX A;  4NNJ B;  5JHH A;  1C4P A;  4JLC A;  2BS2 B;  1OQQ A;  1QQG A;  3N32 A;  3QCA A;  4DIX A;  3L10 B;  3NRZ A;  3BIN A;  4WQM A;  4Q2J A;  1E90 A;  3AU4 A;  3Q8A A;  2EC1 A;  4WJO A;  4WH4 A;  1L0V B;  2B3A A;  2QCZ A;  3IFW B;  1SBB B;  4Z2M B;  1LB1 A;  1CK1 A;  1QOA A;  1FIQ A;  1TXD A;  2MBH A;  3NW8 A;  4I6N B;  2VRW B;  1I4H A;  5BYQ A;  1ZDX A;  4P1C C;  4ZRK A;  3U4E G;  4HAZ B;  1TS5 A;  1V5T A;  1WXS A;  1P7E A;  1L7Y A;  2YRY A;  2WXP A;  3NS1 A;  1H4R A;  3GOE A;  3H8H A;  1M4V A;  2I5F A;  3QWZ B;  2LYD A;  2BYE A;  1X05 A;  2LJ5 A;  4ANW A;  3ALB A;  4YTP B;  1VR9 A;  2XEW A;  2D3A A;  2E3T A;  4K2O A;  2BVC A;  1I4Q A;  2ON8 A;  5HKH A;  5D3V A;  2GUM A;  1W1G A;  2MW5 A;  2FCM A;  4KGT A;  4LK0 M;  2MFQ A;  2DA0 A;  2KC1 A;  5JHA A;  2R2O A;  4YT0 B;  4E3C A;  1RFK A;  2PZ1 A;  4G50 A;  1YOV B;  1WFY A;  3BVM A;  1ZW7 A;  2Z0E B;  1XXG A;  2L32 A;  1DGJ A;  1JWU D;  4DDG D;  4DHJ B;  3GB1 A;  3Q3N C;  1IUE A;  2BBC A;  3TVV A;  5J3Y A;  1TGZ B;  3KYC D;  5L81 A;  4L1R A;  4GOC A;  1V8C A;  5KQ1 A;  2BB5 A;  2DZJ A;  4M02 A;  3QIJ A;  3KYD D;  3WAL A;  4BKT A;  4CSQ A;  1V5M A;  2WDV B;  3AE5 B;  1A70 A;  5HE1 A;  2BPS A;  4HKQ A;  2DX5 A;  2QIE B;  3L13 A;  2NR2 A;  2XK5 B;  3O65 B;  1EVH A;  2V0G A;  4A20 A;  5JXV A;  1WE6 A;  4HRO A;  3ML8 A;  1GG3 A;  2YEP F;  3DHH C;  4N9F 4;  2DKQ A;  1KJT A;  3NZS A;  2MX2 A;  3PZ8 A;  3VVW B;  1QOG A;  2Y5C A;  3ZVV A;  2LZ6 A;  4OVV A;  3SO6 A;  2LVP A;  2ADZ A;  2MSE D;  1SIF A;  1QC6 A;  1ZP0 B;  3DHG C;  3A9J A;  3VQI A;  2BYT A;  5HI1 A;  2KJH B;  1BTN A;  1V2Y A;  4PS8 A;  2KVZ A;  4HWI B;  2IYD B;  1V89 A;  1I2H A;  2WX1 A;  2Y5B B;  3ENE A;  1N60 A;  1HA5 A;  1FAO A;  5IA7 A;  1FXA A;  4K7W A;  2CAY A;  1KLG D;  2DLW A;  4EJN A;  1V81 A;  1ZVR A;  2PE6 B;  4NZL B;  1FO4 A;  2D5G A;  2CHX A;  1V61 A;  2LVO A;  1V1P A;  1UEL A;  1F2R C;  4GGQ A;  4K7S A;  2G3Q B;  1L5P A;  2UVM A;  4M8M A;  1XLN A;  2W55 A;  3AEG B;  1U4A A;  4G0N B;  2EEL A;  4KIK A;  3CIR B;  3NZ3 A;  3V3X A;  2LUL A;  3H6N A;  2YT2 A;  3MC8 A;  2MEK A;  2BW2 A;  4LJP B;  4KX6 B;  5DHA B;  4ZRJ A;  2LXC A;  1EGX A;  2COD A;  1WI0 A;  3TMP B;  2V9H A;  4US9 A;  2I38 A;  2PPH A;  1MI0 A;  4MGI E;  4ANX A;  1CZP A;  1HE8 A;  2OOB B;  2GBM A;  1I7H A;  2LRU A;  1YQ3 B;  2N0S B;  2KO3 A;  1N5W A;  3S2A A;  2COA A;  3HSA A;  2YEP B;  3HUI A;  3TEX A;  5FKA C;  2JP2 A;  3AE7 B;  1HQR D;  1U2B A;  4URK A;  4LDT B;  1T0S C;  3J9C A;  1MHX A;  2Z0Q A;  2CJN A;  4WAF A;  1LO5 D;  2WXQ A;  3EA6 A;  3QBV B;  1JRU A;  1V88 A;  3ZTC A;  5G5G A;  2QSD A;  2HTM E;  4A3O A;  1GB1 A;  3QWM A;  5LXH A;  1G6J A;  4HCP B;  2JYE A;  3P2B A;  1Q1O A;  1DDV A;  3ZTD A;  4JE3 B;  3PZD A;  3DVG X;  2C7M B;  1I35 A;  3VTW A;  1TZ1 A;  1E8X A;  2D4Q A;  2ONQ A;  4MK0 A;  1R4M B;  1WM2 A;  3AEA B;  5D27 A;  1KZ7 A;  1FHX A;  1EU4 A;  4F7G A;  1KTK A;  1UD7 A;  2DYB A;  4BVU C;  2LKO A;  3ML9 A;  2ZW0 A;  3ZNH B;  5BMG A;  1CJE A;  4DHJ D;  4KHB A;  3OJ4 B;  4HLE A;  2WXR A;  1LXD A;  5G2N A;  4E71 A;  5DHF B;  3RUL A;  5BMI A;  1ISN A;  4W9E A;  2IFS A;  1HEZ E;  3ZQ4 A;  5AUK A; 
#chains in the Genus database with same CATH homology
 2IYB A;  2D07 B;  4HXD A;  3QJZ A;  3PLV A;  1RAX A;  2FCN A;  4LJO B;  1M7E A;  3L08 A;  4JL9 A;  1C1Y B;  1K5G B;  4DHZ E;  1NTY A;  3PRP B;  3H7P A;  1V5O A;  1B55 A;  3F5R A;  4A6F B;  4K7U A;  3UGB B;  2IY1 B;  3L17 A;  3R7R A;  2GMI C;  2BYV E;  4GMX B;  4BBN F;  2W2X C;  2W2X D;  2BYF A;  3ZDT A;  3F0W A;  3W1Y A;  3SHQ A;  1WMH A;  3VFK A;  5JH5 C;  3UIN B;  4CYE A;  1Q67 A;  4MY6 A;  4IC7 B;  2M14 A;  1H10 A;  2KFK B;  2K39 A;  3DVN V;  1Z5S B;  2D9V A;  3A33 B;  2W2W A;  4ANV A;  3NS8 A;  3OAW A;  2KXJ A;  4E74 A;  3M95 A;  2G4S A;  1PLS A;  1WX7 A;  2N7E A;  1YQB A;  2O6V B;  4ICV A;  4GU2 A;  3V6C B;  2JZZ A;  2ROZ B;  1GC6 A;  2DHJ A;  1MG8 A;  5EFX A;  4NSW A;  3H7S A;  2KZR A;  2D9Z A;  2KWU B;  4W9K A;  1P3Q U;  3M62 B;  3A1Q B;  2ZVN A;  2KQ7 A;  3A4R A;  2KX0 A;  1X1M A;  2DFK A;  4F8C B;  4ANU A;  1KLV A;  3JVZ X;  1OTR B;  2GJY A;  2MA9 B;  1WH3 A;  5CLL B;  4W9I A;  1V6E A;  2KLG A;  2LRW A;  4BFR A;  3RYT A;  2GCL A;  3W1S C;  3PVU A;  2Y8G A;  1PQS A;  4IM3 A;  1NU2 A;  3ZNZ B;  4PYZ A;  3VH3 B;  3BY4 B;  2QKL A;  2YVC A;  3H9D A;  3LJ3 A;  1A5R A;  3T06 A;  1Z2M A;  2G35 A;  2CY4 A;  4GZU A;  2I1J A;  1OQY A;  2JF5 A;  4IWQ A;  2JRH A;  3JSV B;  3PEG A;  2DZI A;  3APC A;  1NBF C;  2DAF A;  2NS5 A;  2EMT A;  3PLU A;  1J0G A;  4IAP A;  3R3M A;  3ZUN A;  4MSQ B;  2UWQ A;  5CHV C;  2K25 A;  4WSF A;  5JZE B;  1E8Z A;  2VSZ A;  4BOZ B;  4WJN A;  3PSE B;  4GPT B;  3OAN A;  4M0W B;  2FCS A;  2YT1 A;  3IHP C;  2K00 A;  1X1F A;  2CKH B;  1BAK A;  2CRF A;  2JUO A;  1IYF A;  2KAN A;  3UQA A;  3UF8 A;  4DBG A;  4I6L B;  4YL8 A;  3VH4 B;  2KKC A;  5KHO A;  5J2R A;  1LFD A;  4EUT A;  3X23 A;  4CO7 A;  2GOW A;  1E8Y A;  3NY5 A;  3CF6 E;  1V80 A;  2O6V D;  4MDK E;  3ZO5 B;  5GMV A;  2M1M A;  3EEC A;  5JHB A;  2N4F A;  4MJS B;  2MBB B;  3A4S C;  1XQQ A;  1UNP A;  3MTN B;  3Q3F A;  2ELB A;  1RRP B;  1WGH A;  1WR6 E;  2L8J A;  1Q0W B;  3QAQ A;  3KRW A;  1MIX A;  4II2 B;  4BBN C;  4GDL B;  2KD0 A;  2DAJ A;  4W9F A;  4AUQ C;  2R2Q A;  3KZ1 A;  3N30 A;  4NAW B;  2DHK A;  4FBJ B;  2PJH A;  4HVB A;  1R4M I;  2N9X A;  2JXX A;  2COC A;  2EKE C;  4W9G A;  2RGN B;  4MGY E;  4HB3 B;  1FB8 A;  4II3 B;  5CX3 A;  2CHW A;  2RNR B;  4NQL B;  1DBH A;  4GMV A;  4GDK B;  2IO1 B;  2DZM A;  4TUU A;  1W1H A;  3VOQ A;  1E7U A;  4KZC A;  4G3X B;  3CST A;  2DYM A;  3U7D A;  5GOW B;  5LLI A;  4PS7 A;  1WGR A;  2KWC A;  5J3T A;  2C9W B;  2P8V A;  4FLH A;  1WJM A;  4PQ0 A;  3MJW A;  2GBJ A;  2XK5 A;  4W9H A;  4MEL A;  3NOB A;  4EMO A;  3CMM B;  2ZNV B;  2ASQ A;  3A9K B;  3DOW A;  3QA8 A;  3R66 C;  5D3X A;  4WQO B;  1RRB A;  1LQB A;  3D32 A;  4IWO A;  1S3S G;  1OMW A;  3MHS D;  2YS3 A;  1MAI A;  4FHJ A;  1MKE A;  2WWZ A;  5J17 A;  2GBK A;  2LGX A;  2V4L A;  4J6I A;  2WX0 A;  2RVB B;  3KH0 A;  2HD5 B;  5KHQ A;  5C1Z A;  1GC7 A;  3L16 A;  4ICU A;  2AYO B;  1WGQ A;  2D11 A;  1P6S A;  3VTV A;  5D7G A;  2ZPY A;  4WWP A;  2Z0P A;  2ZZP B;  2HTH A;  1ZC3 B;  4DXA B;  4L6E A;  2HJ8 A;  5C79 A;  1WXV A;  1YD8 U;  3DVG Y;  5DPS A;  3APD A;  2KTR A;  4KHO A;  4DX9 0;  2QKM A;  4HPL B;  1WF9 A;  2FUH B;  4CHM A;  1NDD A;  2J59 M;  3L0W B;  2KGX B;  4EFO A;  3FM8 C;  5L95 C;  2J0J A;  3GYO A;  4GN1 A;  1BWN A;  3ULC A;  1RJ2 A;  3V6E B;  4MT7 A;  2D9Y A;  3VUY A;  2UZS A;  4WWO A;  2LOX A;  4KSK C;  4GSW A;  1FHW A;  2DHI A;  1XX0 A;  3PT2 B;  2IO3 B;  2MQJ A;  4FJV B;  4TKN A;  3KY9 A;  3KUD B;  3D8F A;  3DCG A;  1KOT A;  5C6R A;  3AXC A;  2NPT B;  5AEK B;  4WWN A;  3KRX A;  4HDQ A;  2LGY A;  3V5W A;  1EO6 A;  2COF A;  1XR0 B;  4Y94 A;  3ZVR A;  2RGF A;  1WX8 A;  5C23 A;  2ZNV C;  4IOY X;  4XZ4 A;  3U8Z A;  2N9E B;  2K8H A;  3A9J B;  4WAA A;  2J0K A;  4PNK A;  3ZNG C;  5J18 A;  2LD9 A;  1Z87 A;  4NJ7 A;  5C5B B;  2A5U A;  2I1K A;  3D8E A;  3HQC A;  5AZG A;  1F9J A;  4HPM B;  4JQW C;  3CIK A;  3EHV A;  2MLB A;  1K5D B;  1U29 A;  4HB2 B;  2X18 A;  4W9J A;  2NCN A;  1WXA A;  1WJN A;  2AEH A;  2L76 A;  2DN6 A;  1AWE A;  2Z59 B;  4RM9 A;  4AOF A;  2P0D A;  1FXT B;  4AJW A;  1V9J A;  2L3Z A;  2C5L C;  2LXA A;  5G55 A;  4HB0 B;  2MP2 A;  4NY0 A;  5KCV A;  4M8N A;  4KZ0 A;  2GBR A;  2DYN A;  2P0F A;  4KVG B;  2GBN A;  3VUW A;  1H8C A;  2D10 A;  2ZVO A;  1NTV A;  2KTF A;  1OGW A;  3ZRC A;  1UNR A;  2N1V A;  3P7Z A;  2J7Q B;  2FID A;  2ZEQ A;  3PSC A;  2P0H A;  1OQN A;  1VCB A;  2KDI A;  3TFM A;  1FOE A;  3PRZ A;  4TQ0 A;  2JVC A;  4A5K A;  4EZK A;  4FHK A;  1FHO A;  2YT0 A;  2DYQ A;  3FEH A;  2OQB A;  4F1S A;  4I6P A;  1P9D U;  4MEM A;  4TV3 A;  4ZYN A;  2ZCC A;  3DBS A;  5E6O A;  4F7H A;  3ZLZ A;  1FGY A;  5DIF B;  4WJQ A;  1ZSQ A;  4KHB B;  5L83 A;  3DBL I;  2IO0 B;  1K8R B;  3DVN U;  2ROV A;  4DDI D;  5KQ4 A;  3TCA A;  1XD3 B;  4B9K A;  1SGH A;  3VIA A;  2V3S A;  1U5F A;  2JT4 B;  2JZ3 B;  1M94 A;  2BWE S;  5TR5 A;  4DWF A;  3QX1 A;  3JSV A;  2BF8 B;  5JLJ B;  1P5T A;  4DHZ B;  3NZU A;  3ODW A;  4W9C A;  2MCN B;  3R7Q A;  3HM6 X;  4JGH B;  1KM7 A;  2KCJ A;  3PRE A;  2LAS A;  4NQK E;  1M7R A;  1U5E A;  4IUM B;  2L00 B;  5E6P A;  1Y5O A;  1LW3 A;  1WMH B;  2D9X A;  5D3W A;  2RSU A;  4HAY B;  2RLO A;  3PV1 A;  5FI0 A;  1XCG A;  2VRR B;  2BGF A;  3FSS A;  1WGD A;  2JRI B;  3AI5 A;  3KUC B;  2CY5 A;  5FR6 A;  5AZH A;  3LJU X;  2IY0 B;  2UYZ B;  3ZRF A;  2YS5 A;  1YX6 B;  3RZW C;  2LOZ A;  2C7N B;  2BCJ A;  4FAD A;  2YS1 A;  1RLF A;  2RR9 A;  4FUL A;  3VAW A;  4X57 B;  2MKR A;  1N3H A;  2LGD A;  4B6W A;  3QC8 B;  1C3T A;  5HE3 A;  4EEW A;  2VKI A;  1WYW B;  4GXB A;  4LCD E;  3CXB B;  4IW0 A;  1UBI A;  1UGM A;  4G11 A;  2WYQ A;  3Q3J A;  3GYP A;  3ML4 A;  2OJR A;  2M8S A;  3U30 A;  3AUL A;  4GDL A;  1I7A A;  2MWS B;  3SDL C;  1P1A A;  1KI1 B;  1WVH A;  3ECI A;  2ZJD A;  2KJ6 A;  1YX5 B;  2DYO A;  4A6K A;  1MK9 B;  2EJ8 A;  3DQV A;  2DHZ A;  3KVF B;  3D8D A;  4DBB A;  5DI9 B;  3IBE A;  5LON B;  2PE9 A;  3MDB C;  4B95 A;  1ZKH A;  2R09 A;  2O2V B;  1ZGU B;  3AU5 A;  1Y19 B;  4XX5 A;  3SV1 A;  2I5C A;  4ZDV A;  2KX3 A;  4HCN B;  1DRO A;  4AWJ A;  3VTU A;  4EZJ A;  2FCQ A;  3PGE A;  4GB9 A;  5LXI B;  3SYX A;  3UIO B;  2H7D A;  3WAP A;  1CMX B;  3HHM A;  3CSF A;  2XQN M;  3NHE B;  1KZG A;  1S1Q B;  1WJ6 A;  4KDL B;  1XKE A;  1UNQ A;  3M63 B;  1P3R A;  2KDB A;  1QZE A;  2DKP A;  2IZV B;  1UPQ A;  3IG3 A;  2FNJ B;  2CU1 A;  2KWV B;  1IP9 A;  1WJ4 A;  2PEA A;  4JIO U;  5J3Q A;  2KC2 A;  3TW1 A;  4BBK A;  3ULB A;  2REX A;  2UZR A;  4FJY A;  1EUV B;  4NJ6 A;  1EAZ A;  2NBU A;  4IM2 A;  2E2X A;  2NBW B;  2L2I A;  1DYN A;  3A8P A;  5C16 A;  4RM8 A;  2KK8 A;  2KDE B;  5DPW A;  4AP4 C;  3UZT A;  4ZRI A;  2IBI B;  4HDO A;  3ZKJ C;  3WAM A;  1J19 A;  2FAZ A;  1PMS A;  2N9P C;  1VD2 A;  3X0W A;  4K17 A;  2XBB C;  3B1L X;  3WAN A;  2AL3 A;  2MWN B;  1OEY A;  2N1W A;  4FJZ A;  5DH9 B;  1MK7 B;  3TBL D;  2NZ8 B;  3RCZ A;  1NI2 A;  1YJ1 A;  2C7H A;  1SHC A;  4IM0 A;  2V1Y A;  1Q5W B;  3B0A A;  1DDM A;  2Z0D B;  2MRP A;  1P0R A;  2MBE A;  1T0Y A;  5EDS A;  2MDX A;  2QHO A;  3SUZ A;  1W1D A;  2KJR A;  3UQB A;  3SD5 A;  2NPT A;  1WGG A;  3I3T B;  3B08 A;  1WG7 A;  5AZF A;  1LM8 B;  1RFA A;  1MPH A;  2HE7 A;  1L2N A;  2NMB A;  5E6N A;  5BO4 B;  3V61 A;  2L7R A;  1TBE A;  4CHJ A;  3UIP B;  1UZX B;  2K6Q A;  3VDZ A;  1Y8R C;  4W9L A;  1E5W A;  5JHG A;  2MBQ A;  3BJI A;  1WI1 A;  2AL6 A;  3QHT A;  2CS4 A;  3HW2 B;  4HK2 A;  3LDZ E;  3RZF A;  5C5B A;  1WZ0 A;  4W9D A;  3W1S A;  4PYU A;  4XC2 A;  2JY6 A;  1EF5 A;  4HAW B;  1GUA B;  2ZPN A;  4DK5 A;  4A6H A;  2DX5 B;  3EC8 A;  4B6H A;  5D6J B;  4WJ7 A;  2DTC A;  2HTH B;  2H7E A;  1WE7 A;  2LG1 A;  1WJU A;  2K1F A;  3RUI B;  1U27 A;  4BOS C;  3VHT C;  3L54 A;  1ZC4 B;  2EMS A;  2G45 B;  2DX1 A;  3PRM B;  4P7I A;  2DEN B;  1SE9 A;  1J8C A;  5HE0 A;  2KTR B;  1V49 A;  2AWT A;  4A6F A;  2KMC A;  4F7Z A;  1V5U A;  4HAU B;  3RT3 B;  1WIA A;  3OLM D;  5IAA C;  3TJP A;  3K9P B;  1WXM A;  2KFJ A;  4MGK E;  3VUX A;  3ODO A;  3TO1 A;  2L0F A;  4HAX B;  4A3P A;  1XOD A;  4BKS D;  3WAO A;  2L05 A;  4TYZ A;  2LVQ A;  2J0M A;  2K2U A;  3PVW A;  2YSZ A;  2KFK A;  2RPQ A;  2DZK A;  4KIK B;  4F7U P;  2BKR B;  4MM3 A;  2KLC A;  2FJL A;  1WM3 A;  3APF A;  4IG7 B;  1OEY J;  2LI5 A;  2JPH A;  2MBO A;  2KNB A;  5D2M B;  2O6V A;  1WR1 A;  3KW5 B;  3HIZ A;  2OTX A;  1WY8 A;  3ZW3 A;  1WX9 A;  1UBQ A;  4WVF B;  1BTK A;  2Q13 A;  1XD4 A;  4KDI C;  1DDW A;  3PP2 A;  3HM3 A;  2RSG A;  2JWZ A;  1V86 A;  1MIZ B;  3DXD A;  4EKU A;  3A1Q A;  2FIF A;  2BKF A;  1WGY A;  4NPN A;  3WYF B;  5FI1 A;  5JP4 A;  2M17 A;  4YON A;  2W9N A;  2WDT B;  3PS6 A;  3DXC A;  2NVU I;  4GIV A;  3PPA A;  1BT0 A;  3T9L A;  3RD2 A;  2N0Y A;  3VXW A;  4C0A A;  1E8W A;  3A8Q A;  2KOX A;  4FN2 A;  2BWF A;  2KVR A;  2KN5 A;  3V60 A;  2CHZ A;  4K2P A;  4WJP A;  2A4Z A;  4MGZ E;  2MP2 B;  5HE2 A;  3ONS A;  3ZNI D;  2K2J A;  4EZL A;  3H7P B;  3KSY A;  3EFU A;  1FGZ A;  4EOY A;  1V5P A;  3M1I B;  3MPX A;  3AJ4 A;  5CTR C;  1X1G A;  3PVL A;  4KSL C;  4KHA A;  4LDT D;  3WA0 A;  2R0D A;  3QAR A;  2IO2 B;  3T8M A;  3GZN I;  1X11 A;  3A98 B;  3M3J A;  2KHW B;  2ZCB A;  2L0T A;  2ELA A;  1U5D A;  3WIM A;  3DXE A;  2GS0 A;  2Y7B A;  3OJ3 A;  4IFS A;  5D94 A;  3DBH I;  4KAX B;  2K8C A;  1OY2 A;  1IPG A;  4OVU A;  3SNH A;  1IRS A;  4HJK A;  4HAV B;  4RMA A;  1J0W A;  2YLM A;  3ZDM C;  3O96 A;  4MJS A;  3QQ8 B;  4KV2 A;  3PHW B;  2D9W A;  2D2Q A;  4TQ1 A;  2O2V A;  4Z2N A;  2GCJ A;  4HAT B;  1WJ1 A;  1D3Z A;  1UPR A;  1GNU A;  5DPT A;  3V62 A;  5D3Y A;  3RCP A;  3HK0 A;  5DPR A;  5CHF A;  3TL5 A;  5LOP B;  3PHX B;  1GJZ A;  2Y8F A;  2L1C A;  4MSM B;  4IWP A;  3G9W A;  2KQS A;  4NAW A;  4FA6 A;  4BKG A;  1R4N I;  3DDC B;  4D0N B;  3ZIM A;  1I42 A;  3QK0 A;  2Z0O A;  1PFJ A;  2RD0 A;  4GDK A;  2M0X A;  2KMA A;  2KDF B;  3K9O B;  4ASW C;  1AQC A;  2D3G A;  1X86 A;  3JW0 X;  1WRD B;  2C60 A;  5CHW A;  2K8B A;  2N7D A;  4HB4 B;  1AAR A;  1XT9 B;  3DBR I;  5DCN A;  2LUE A;  1WGU A;  2KUP A;  1P98 A;  1E7V A;  4K1R B;  1UH6 A;  1U5G A;  1TJ6 A;  2N23 A;  3ODX A;  2M4N A;  3H1U A;  3N3K B;  2CR5 A;  1YIW A;  1UEF A;  3A9K A;  2YF0 A;  4H8S A;  3C0R B;  1EF1 A;  2RUK B;  2G4D B;  4PS3 A;  3IVF A;  4MH0 E;  3N7C A;  1TQZ A;  1TTN A;  4K81 A;  3KUZ A;  5CLQ B;  3DPD A;  4DX8 A;  1WZ3 A;  4BKS A;  2K6D B;  2M38 A;  3PTF C;  3P6A A;  4AJY B;  3NSU A;  4CHK A;  2V76 A;  2NBV B;  3SU8 X;  4XWX A;  3JYU A;  2LWP A;  4HHV A;  1ZM0 A;  3PG7 A;  3TIX A;  4NNJ B;  5JHH A;  4JLC A;  1QQG A;  3N32 A;  3QCA A;  3L10 B;  3BIN A;  1E90 A;  3AU4 A;  2EC1 A;  4WJO A;  2B3A A;  3IFW B;  4Z2M B;  1LB1 A;  1TXD A;  2MBH A;  4I6N B;  2VRW B;  4ZRK A;  4HAZ B;  1V5T A;  1WXS A;  1L7Y A;  2YRY A;  1H4R A;  3GOE A;  2I5F A;  3QWZ B;  2LYD A;  2BYE A;  1X05 A;  2LJ5 A;  4ANW A;  3ALB A;  2XEW A;  4K2O A;  5HKH A;  5D3V A;  2MW5 A;  1W1G A;  2FCM A;  2MFQ A;  2DA0 A;  2KC1 A;  5JHA A;  2R2O A;  4E3C A;  2PZ1 A;  4G50 A;  1WFY A;  1ZW7 A;  2Z0E B;  4DDG D;  4DHJ B;  3TVV A;  5J3Y A;  1TGZ B;  3KYC D;  5L81 A;  4GOC A;  5KQ1 A;  2DZJ A;  3QIJ A;  3KYD D;  3WAL A;  4BKT A;  1V5M A;  5HE1 A;  2BPS A;  2DX5 A;  3L13 A;  2NR2 A;  2XK5 B;  3O65 B;  1EVH A;  4A20 A;  1WE6 A;  3ML8 A;  1GG3 A;  4N9F 4;  2DKQ A;  1KJT A;  3NZS A;  2MX2 A;  3VVW B;  3ZVV A;  2LZ6 A;  4OVV A;  3SO6 A;  2LVP A;  2ADZ A;  2MSE D;  1SIF A;  1QC6 A;  3A9J A;  3VQI A;  2KJH B;  1BTN A;  1V2Y A;  4PS8 A;  4HWI B;  2IYD B;  1V89 A;  1I2H A;  2WX1 A;  2Y5B B;  3ENE A;  1FAO A;  5IA7 A;  4K7W A;  2CAY A;  2DLW A;  4EJN A;  1V81 A;  1ZVR A;  2PE6 B;  2CHX A;  1V61 A;  2LVO A;  1UEL A;  4GGQ A;  4K7S A;  2G3Q B;  2UVM A;  4M8M A;  1U4A A;  4G0N B;  4KIK A;  2LUL A;  3H6N A;  4LJP B;  5DHA B;  4ZRJ A;  2LXC A;  1EGX A;  2COD A;  1WI0 A;  3TMP B;  2PPH A;  4ANX A;  4MGI E;  1HE8 A;  2OOB B;  2GBM A;  2LRU A;  2KO3 A;  3S2A A;  2COA A;  2JP2 A;  1U2B A;  4URK A;  4LDT B;  2Z0Q A;  3QBV B;  1JRU A;  1V88 A;  3ZTC A;  4A3O A;  3QWM A;  5LXH A;  1G6J A;  4HCP B;  3P2B A;  1Q1O A;  1DDV A;  3ZTD A;  3PZD A;  3DVG X;  2C7M B;  1I35 A;  3VTW A;  1TZ1 A;  1E8X A;  2D4Q A;  4MK0 A;  1WM2 A;  5D27 A;  1KZ7 A;  1FHX A;  4BVU C;  4F7G A;  1UD7 A;  2DYB A;  2LKO A;  3ML9 A;  3ZNH B;  4DHJ D;  3OJ4 B;  4HLE A;  1LXD A;  5G2N A;  4E71 A;  5DHF B;  3RUL A;  1ISN A;  4W9E A;  2IFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...