4K81A

Crystal structure of the grb14 ra and ph domains in complex with gtp-loaded h-ras
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
251
structure length
244
Chain Sequence
b'KKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSAAPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 14
publication title Structural basis for the interaction of the adaptor protein grb14 with activated ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 244
sequence length 251
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4k81A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4k81A01
4HJKA 4MGYE 1WGYA 3HM6X 2ZVOA 3U7DA 1MKEA 2FJLA 2DYOA 2JVCA 1I35A 2Y8GA 1V2YA 3A9JB 4W9DA 4WJOA 2DYMA 3MDBC 4XWXA 1UBIA 2LASA 5JH5C 4ICUA 5J2RA 4K1RB 4IG7B 4KZCA 4TV3A 2Z0QA 1WZ0A 1BWNA 3H9DA 3TCAA 2NPTA 5LXHA 2OOBB 1Q5WB 1U27A 3AI5A 4GPTB 2O6VA 2KX0A 3WIMA 1QZEA 4BVUC 2IBIB 1SGHA 4GGQA 2BWFA 4NJ7A 4IFSA 2CS4A 1Y8RC 2JXXA 2LVPA 2EC1A 2KWUB 5E6NA 2X18A 4XC2A 5HE1A 2BCJA 1V81A 4CHJA 2IO3B 4EOYA 2FIDA 1WM2A 4WJ7A 3CF6E 2IO1B 5BO4B 2FCSA 1C3TA 4W9CA 1J8CA 1LW3A 2DKQA 4HAXB 3AJ4A 1CMXB 3H1UA 4IUMB 4ZRIA 1M7RA 1EAZA 4ICVA 4EFOA 2EMTA 2H7DA 5DHAB 1VD2A 1P9DU 2L05A 4GXBA 4IOYX 3ZNGC 4KIKA 1X11A 2RD0A 2Y8FA 2N1VA 3L10B 1V49A 1X1GA 2UVMA 2ELAA 4GOCA 2K6DB 4PYUA 2DFKA 2C9WB 1X86A 1TBEA 4HB0B 3ZRCA 2MP2B 3UIOB 3RCPA 2KDEB 2PJHA 4MSQB 4FHKA 2LXCA 4GDKA 2V4LA 4KDIC 4FJYA 4Y94A 5EFXA 3KY9A 1WIAA 3RYTA 2PE9A 3PHWB 4FHJA 2CHXA 4MGIE 2P0FA 4I6LB 2CAYA 1BTNA 2L1CA 2CHZA 3W1SA 4MEMA 4WWOA 5DIFB 2MRPA 3R66C 3KUDB 4AJWA 2XBBC 2JRIB 2FCNA 5KHQA 3PGEA 3QJZA 4ANWA 1HE8A 2BYEA 2C7MB 3QQ8B 3PEGA 4LJOB 2Y5BB 4F7ZA 1UBQA 2WX1A 2RR9A 3TO1A 5CHWA 1YX5B 2NR2A 2N7DA 2KLCA 1C1YB 2Y7BA 2DZJA 2W2WA 1WE7A 2DHIA 4HAYB 4EJNA 1ZC4B 1P3RA 3A4SC 5JHBA 4MJSA 4KHBB 1P0RA 3V60A 4EMOA 3AU4A 2DZMA 2A4ZA 3WANA 2DHJA 3VTVA 3PRMB 3VUYA 3ZTDA 4PYZA 2N23A 2RGFA 5KHOA 2ROVA 4HATB 2LGYA 1SE9A 2REXA 3DPDA 3UGBB 1WG7A 2RPQA 1IRSA 2K8CA 2D9ZA 3DBLI 5DI9B 4F8CB 2KO3A 2KD0A 2AL3A 2DA0A 5D6JB 2BGFA 2KK8A 2KQSA 4TUUA 2ADZA 3L13A 1KI1B 1ZC3B 3SO6A 3QBVB 3PHXB 2ASQA 2C7NB 4A3OA 1D3ZA 3KVFB 1RJ2A 1V5UA 2K8BA 2MX2A 2LRWA 2ZPYA 4HB3B 2XK5B 3V62A 3SNHA 1MK9B 2MFQA 2JWZA 4KHOA 2BKRB 5C1ZA 2ZCBA 4TQ0A 3I3TB 4F7GA 2KMAA 3ZUNA 1V5TA 1OEYJ 2NBWB 3LJ3A 2MCNB 4BKSD 5G55A 4GDLA 3PZDA 2I5FA 3GZNI 2YSZA 1WFYA 1TQZA 3RD2A 1QC6A 3PRZA 2M14A 2VRRB 4YONA 3VQIA 1U2BA 1WZ3A 1TGZB 1I7AA 1ZGUB 4MM3A 2BYFA 5D94A 1P6SA 3VH3B 1WVHA 1KM7A 3BY4B 4HK2A 1Z5SB 3P7ZA 1P3QU 1WXAA 4HB4B 4BFRA 4PS7A 3F5RA 1UPRA 3T9LA 4NQKE 2IFSA 4HVBA 3A4RA 3TIXA 1Q0WB 4LDTD 1WJ1A 4IM3A 2JY6A 2D9XA 1GC7A 3ML8A 1X05A 2DENB 4GU2A 2YS3A 3MPXA 1AQCA 1WMHA 3N32A 2MSED 3PT2B 3KYDD 4M8NA 1NI2A 1V89A 2XQNM 2R2OA 1ZVRA 2KKCA 3IFWB 2L76A 4F1SA 4D0NB 2Z0OA 2DHKA 4KHAA 2M4NA 2V76A 3B0AA 3ODWA 2JZ3B 4GZUA 5DPRA 2B3AA 4A20A 4HHVA 1GNUA 3R3MA 1M7EA 2NS5A 5J3YA 1L2NA 3H7PA 1EGXA 3TVVA 1MAIA 2K1FA 4K7UA 3OJ4B 4MH0E 2RLOA 1WRDB 5D3VA 1W1DA 3KUCB 3V5WA 2M38A 1WR6E 3X23A 3EECA 5D3XA 1M94A 1WJUA 1V5PA 3M1IB 1S3SG 1U5DA 1RFAA 3MHSD 3TW1A 4BOSC 2ZNVB 3R7QA 5AZHA 1DDVA 2CU1A 1V5OA 2YS1A 2D10A 2ZZPB 1WJMA 2DX5A 1TZ1A 4MELA 4BKTA 4W9GA 5J3TA 1PMSA 2ZVNA 2RNRB 3PS6A 3PP2A 2L00B 4N9F4 1FOEA 3PRPB 3PV1A 4IW0A 1FB8A 3ZNHB 2NPTB 3DBHI 5AEKB 3VH4B 5GOWB 1AWEA 2O6VB 3K9OB 4KV2A 2DTCA 3PTFC 4TKNA 2XEWA 4EZLA 3NY5A 1PQSA 3ZO5B 1WGUA 3QHTA 5FI0A 4IC7B 3VUXA 4FLHA 4DHZE 1V9JA 4FADA 1SIFA 4II3B 1WGQA 5CHVC 4NAWA 4FA6A 3JYUA 2O2VA 4KDLB 3RULA 2LD9A 1FHOA 1E90A 1RRPB 4HPLB 3P2BA 2COFA 4W9KA 3A9KA 3FM8C 1UH6A 2I5CA 3PVUA 2GBMA 2N9PC 3CMMB 4E3CA 1I2HA 1WH3A 2BWES 1K8RB 4IWQA 3A33B 4A3PA 2BF8B 3L0WB 2FCMA 2KMCA 4W9IA 4GSWA 4URKA 1XQQA 2P8VA 2ROZB 5D3YA 2KTRA 1IP9A 1XD3B 4G50A 4GIVA 1MPHA 5L83A 3UQAA 1FGYA 4RM8A 4C0AA 2KFKA 4CYEA 4BBKA 5LONB 3ZTCA 2Z0EB 1TTNA 4JIOU 2K2JA 4GDKB 5C5BA 2LGDA 1WI0A 1WJNA 3LDZE 2HD5B 3UIPB 2C60A 1OY2A 3VTWA 2E2XA 3CIKA 2AWTA 1LXDA 2MLBA 5JLJB 2BYVE 1IYFA 2QKLA 1EVHA 4CHKA 1WX7A 2Q13A 2N9EB 3DQVA 3OLMD 2DAFA 4M8MA 3QC8B 5J18A 4DHJB 2AEHA 2J0KA 1E8WA 1OQYA 3ONSA 4K7SA 3KRWA 1E7UA 1XKEA 1MK7B 4DWFA 4ANXA 1YIWA 2KVRA 3QK0A 1YX6B 4HXDA 4I6PA 2PEAA 2JRHA 4IAPA 2IO2B 4ZYNA 3CXBB 4JL9A 4MJSB 4AP4C 1VCBA 1U29A 1FHWA 3VOQA 2N9XA 2LG1A 3U30A 5D27A 5J17A 4ANVA 3X0WA 3ZDMC 3VIAA 3ZNID 2MW5A 4BBNC 2DYNA 3VXWA 3KZ1A 2MWSB 1WGGA 3MJWA 4ASWC 1LFDA 3ENEA 2YLMA 1WE6A 2ZCCA 4HCPB 3ALBA 2I1JA 2UZSA 1EF5A 1N3HA 1KLVA 1U4AA 3ZLZA 4BOZB 3OAWA 2LOZA 4ZRJA 1XODA 2MBHA 2KTFA 3A8QA 1E8ZA 2ZEQA 3JVZX 4HAWB 4Z2NA 2EJ8A 2KDBA 2LYDA 2L3ZA 3D8DA 2KHWB 3HQCA 2KC1A 5JHHA 2DZIA 2GBJA 3DBSA 2OQBA 2P0HA 4PQ0A 1WGHA 1XD4A 2WYQA 3N7CA 3RUIB 4MSMB 5FI1A 2P0DA 4MDKE 1UNRA 2CY5A 4GDLB 5C23A 4GN1A 2VRWB 4MK0A 4FBJB 2KJHB 2DN6A 1XT9B 4G11A 3KH0A 3U8ZA 3ZDTA 5JZEB 3DVNV 2K2UA 2GMIC 3WYFB 3WAMA 1NDDA 1XX0A 1KZ7A 4K7WA 3NHEB 5DPTA 1BTKA 3NS8A 3G9WA 1B55A 3GYOA 1OQNA 3PG7A 3IVFA 5HE0A 3DDCB 3ZW3A 3PPAA 4A6FA 3AULA 5DPSA 2QHOA 2KDIA 3UQBA 3VVWB 2GJYA 5C6RA 4WWPA 1QQGA 1R4MI 4IM2A 5JHAA 4X57B 3T8MA 1H4RA 2Z0PA 4F7HA 1WGRA 1L7YA 4DBGA 2MA9B 5J3QA 1WI1A 3SD5A 2KX3A 1E5WA 5D2MB 1V80A 3M95A 1WXVA 2R2QA 4HAVB 4XZ4A 4A5KA 2JPHA 1ISNA 4BKSA 1YJ1A 1WX8A 1OGWA 1V6EA 3TL5A 2DLWA 1NTYA 3L17A 3QIJA 3KRXA 2G45B 2IY0B 3WAOA 5C16A 1EUVB 2COCA 2N1WA 2CODA 3D32A 3ECIA 3L54A 2KLGA 2GCLA 2D11A 2C5LC 2NBVB 3O96A 5E6PA 4RM9A 4B95A 4W9LA 3H7PB 3W1YA 1UELA 2KUPA 3QCAA 4WAAA 4EEWA 4DDGD 2N0YA 3IG3A 2L2IA 2VKIA 2Z59B 3CSFA 1X1MA 3VHTC 4M0WB 1U5GA 2NZ8B 3RZWC 2ZNVC 1WGDA 4RMAA 3V6EB 2V1YA 1WM3A 2OTXA 1SHCA 2W2XC 3SDLC 5CTRC 4IM0A 5CLLB 1U5EA 2A5UA 2DYQA 2RUKB 3WA0A 3FSSA 2LJ5A 2DX5B 1W1GA 4OVVA 1V86A 2GBNA 2RSGA 1XR0B 2LVOA 2J59M 3SU8X 2WX0A 5HKHA 2HTHA 3K9PB 3N3KB 2KWCA 2N4FA 1IPGA 4W9EA 4HDOA 3VFKA 2ELBA 3PSCA 2CRFA 4HCNB 3D8EA 2GCJA 1R4NI 4WJNA 1BT0A 4NPNA 2D3GA 2LULA 2PZ1A 4NAWB 2JF5A 4P7IA 3PLUA 3C0RB 3KW5B 3APFA 3PSEB 2O2VB 3ML9A 1UZXB 1EO6A 1H10A 3KYCD 4ZDVA 3QWMA 2NBUA 2G3QB 2N7EA 1DBHA 4MY6A 4WSFA 5LXIB 2NVUI 2WDTB 5LOPB 2YT0A 2ZJDA 3A1QA 4K2OA 3GYPA 2KZRA 2KOXA 5HE2A 2LKOA 5G2NA 3JW0X 3BINA 4MT7A 1WJ6A 5FR6A 1GUAB 5JP4A 2CY4A 2KTRB 3DVGY 3JSVA 3PLVA 1UEFA 3T06A 4B6HA 3GOEA 4YL8A 2KFKB 5KCVA 1U5FA 5DH9B 1P98A 2J0MA 1FXTB 1FAOA 3UZTA 5C5BB 4HAZB 1RLFA 4LJPB 2L7RA 2BKFA 2KCJA 3W1SC 3SV1A 2KFJA 4IWPA 2YT1A 2L0FA 2CKHB 3L16A 4DHZB 2IYDB 4FULA 2JUOA 1GG3A 5C79A 3UINB 1XCGA 2W2XD 2M17A 4KVGB 1H8CA 4KIKB 4TQ1A 1WR1A 3L08A 2MBEA 1NU2A 2J0JA 2K25A 2O6VD 3ZNZB 4B9KA 4KZ0A 1Y5OA 4OVUA 1UNQA 3H6NA 2EMSA 4NJ6A 1DROA 3S2AA 2UZRA 1JRUA 1DYNA 2LGXA 2FCQA 4L6EA 3EFUA 4I6NB 4K17A 2DKPA 2R0DA 3DXCA 2K6QA 3NZUA 2YRYA 3RZFA 2KN5A 4NNJB 3A8PA 3RCZA 4DXAB 3A9JA 1WXSA 4TYZA 1YD8U 3O65B 2FAZA 5CX3A 3F0WA 1PLSA 3MTNB 4MGKE 2HJ8A 3DVNU 2UYZB 2KNBA 2RVBB 4EZKA 1LM8B 2LWPA 4FJVB 2DAJA 4KAXB 2BPSA 3N30A 2IY1B 2OJRA 2GOWA 3ZVVA 2Z0DB 1OTRB 4PNKA 1Y19B 1EF1A 4ZRKA 4DX8A 3B08A 2KANA 4WWNA 5CLQB 4HDQA 2MWNB 3CSTA 4NSWA 2DHZA 1I42A 5HE3A 3PREA 3VAWA 1YQBA 3DOWA 1KZGA 2AYOB 1UNPA 1UPQA 1ZM0A 1E8YA 3WALA 2MBQA 2LOXA 1RAXA 1K5GB 4BBNF 3TMPB 1BAKA 3ZIMA 3FEHA 3QWZB 3OANA 2M8SA 1ZW7A 1A5RA 1KJTA 1LQBA 3DXDA 2PPHA 2KQ7A 4E71A 3AU5A 4A6FB 2HE7A 4DHJD 4DBBA 4WQOB 2G35A 5EDSA 1E7VA 4GMXB 4HB2B 5IA7A 1J19A 4DK5A 3M62B 3B1LX 2PE6B 2G4DB 1X1FA 4G0NB 3PVLA 3VUWA 4JQWC 5DPWA 5KQ4A 1DDWA 2MP2A 4LCDE 1V88A 3DBRI 2ZPNA 1WYWB 2JP2A 4W9JA 1ZSQA 3LJUX 1Z2MA 2FNJB 2YS5A 2I1KA 3D8FA 4KSKC 1E8XA 2YVCA 3DVGX 4DDID 3ULCA 2FIFA 2LZ6A 3NSUA 2W9NA 1V61A 4GMVA 3APCA 4FN2A 5IAAC 1K5DB 1OMWA 4JGHB 4HLEA 3PVWA 3V61A 1J0WA 3SHQA 4WVFB 5KQ1A 4HAUB 1OEYA 4GB9A 3AXCA 4LDTB 3KUZA 2DYBA 5L81A 2RSUA 4Z2MB 5TR5A 2KJ6A 2LRUA 4HPMB 3RT3B 2L8JA 2AL6A 1KOTA 2M1MA 1WMHB 2MKRA 3WAPA 1NBFC 2DZKA 2M0XA 3SYXA 4G3XB 5CHFA 2K39A 4H8SA 2EKEC 1RRBA 1WF9A 5DCNA 4AOFA 3ML4A 2COAA 4F7UP 4WJPA 2JT4B 4XX5A 3QX1A 4EZJA 3EC8A 3QA8A 3BJIA 2HTHB 1AARA 4NQLB 1P5TA 3VDZA 2NMBA 3R7RA 3IBEA 1TJ6A 4JLCA 1J0GA 3TFMA 3OJ3A 5AZFA 1WXMA 5JHGA 3HK0A 4ANUA 1W1HA 3P6AA 5AZGA 2MQJA 4CHMA 4A6KA 2WWZA 1GJZA 1WY8A 2KWVB 4A6HA 4K81A 4IWOA 2LVQA 1S1QB 3ZRFA 1NTVA 2K00A 1Q1OA 4WJQA 3NOBA 2D9YA 2XK5A 2K8HA 2GBKA 3UF8A 3QAQA 2UWQA 5DHFB 3EHVA 2YF0A 1GC6A 4W9FA 1WX9A 5GMVA 2JZZA 2KDFB 2LUEA 4NY0A 2D07B 4MGZE 1Z87A 5L95C 3HHMA 1FHXA 1Q67A 1UGMA 2D2QA 2IYBA 1P1AA 2G4SA 2C7HA 2KGXB 2LI5A 2NCNA 4FJZA 1MG8A 3A1QB 2GS0A 3V6CB 4W9HA 1V5MA 1WJ4A 3ZKJC 3DXEA 1DDMA 3TJPA 2MDXA 2KJRA 1FGZA 2KXJA 2MBOA 1T0YA 3JSVB 4J6IA 3M3JA 2L0TA 2GBRA 3VTUA 4AWJA 2D4QA 3QARA 1UD7A 2H7EA 2CHWA 4PS8A 3H7SA 4AUQC 2R09A 1LB1A 5E6OA 2V3SA 1MIZB 3KSYA 4BKGA 3ULBA 1PFJA 5D3WA 3A9KB 1F9JA 3ZVRA 3IHPC 2VSZA 4EUTA 4E74A 2D9WA 3TBLD 2KC2A 4B6WA 4HWIB 3SUZA 1G6JA 2QKMA 4CO7A 2IZVB 4DX90 2LXAA 2DX1A 4K2PA 2D9VA 4PS3A 3DCGA 2MBBB 5LLIA 1MIXA 1ZKHA 2RGNB 3Q3FA 4AJYB 3A98B 3ODXA 2CR5A 4KSLC 4EKUA 3ODOA 3M63B 3HW2B 3NZSA 3HM3A 2FUHB 3HIZA 3Q3JA 1TXDA 4II2B 2J7QB 3APDA 5D7GA 2IO0B
chains in the Genus database with same CATH superfamily
4HJKA 4MGYE 1WGYA 3HM6X 2ZVOA 3U7DA 2HDEA 4HPPA 1MKEA 4GLSC 4P6VF 2FJLA 2DYOA 2JVCA 1I35A 1SXTA 4L1BA 2Y8GA 1V2YA 3A9JB 1I4RA 4W9DA 4WJOA 1F1HA 1VJKA 1EWYC 1F52A 2DYMA 1UNSA 2ZW0A 3MDBC 1C4CA 4XWXA 1UBIA 2JQRB 2LASA 5JH5C 4ICUA 5J2RA 2Y5PA 4K1RB 4IG7B 4KZCA 3A58A 2Z0QA 1V1OA 4TV3A 3AE1B 1WZ0A 1BWNA 2KR0A 3H9DA 3TCAA 4YTNB 2NPTA 4L2YA 5LXHA 2OOBB 1Q5WB 2N9LA 1U27A 3AI5A 4GPTB 5H8YE 2O6VA 3EA6A 5FK9C 2KX0A 3WIMA 3W9CB 1QZEA 4BVUC 2IBIB 1KLUD 2AX5A 1SGHA 4GGQA 2DLBA 1TYGB 2Z8LA 5BYRA 2JZPA 2BWFA 4NJ7A 4IFSA 2CS4A 4ZHPA 1Y8RC 2JXXA 2LVPA 2K8EA 2EC1A 4YTPB 2KWUB 3J9CA 5E6NA 2X18A 4XC2A 1J7AA 2V3NA 5HE1A 2BCJA 1V81A 3IT4B 1QOBA 1KRHA 4CHJA 2IO3B 2YEPB 2PLPA 4EOYA 2FIDA 1WM2A 4WJ7A 3CF6E 2KMMA 1CJEA 2IO1B 5BO4B 2FCSA 1C3TA 4W9CA 1J8CA 1QOGA 1LW3A 2DKQA 4HAXB 3AJ4A 2JXTA 1CMXB 2WU5B 2SEBD 3H1UA 4IUMB 4ZRIA 1C4AA 1M7RA 1EAZA 4K3BA 2XNAC 4ICVA 2EMTA 4RGOS 2H7DA 4EFOA 5DHAB 1ZUD2 1FMAD 1VD2A 1P9DU 2L05A 3VRBB 4GXBA 1LO5D 2L32A 4IOYX 1C76A 3ZNGC 1N63A 1KTKA 4KIKA 3FVCA 2WNMA 1HZ6A 1X11A 2RD0A 4Q2JA 2Y8FA 1L4DB 3DWMA 2VH1A 5LNK1 3N9YC 2N1VA 3L10B 1V49A 3RFZB 2GI9A 1X1GA 2UVMA 2ELAA 1KFYB 4GOCA 2K6DB 4PYUA 5IOIA 2DFKA 2C9WB 1X86A 1TBEA 4HB0B 3BK1A 3ZRCA 2MP2B 1E9MA 1IGCA 3AEEB 3UIOB 3RCPA 4YSYB 2KDEB 1VLBA 4OVZA 2PJHA 4MSQB 4FHKA 3HSAA 1JWBD 2LXCA 4GDKA 2V4LA 4KDIC 4FJYA 4Y94A 5EFXA 3KY9A 1VZ8A 1SEBD 1WIAA 4WIPA 2KUQA 3RYTA 3EFCA 3PZ8A 2PE9A 3PHWB 3MFGA 4FHJA 3NW8A 2BVCA 1NENB 2CHXA 4MGIE 2P0FA 4I6LB 2CAYA 1UGJA 1BTNA 1E0ZA 2L1CA 3AM9A 2SAKA 2CHZA 3W1SA 4MEMA 1HXYD 1ZOYB 4WWOA 2WP9B 5DIFB 2MRPA 3R66C 3KUDB 4CQNA 2G1EA 4AJWA 2XBBC 2JRIB 2FCNA 1EWCA 5KHQA 3PGEA 3QJZA 4ANWA 1HE8A 2INNE 2BYEA 3IAM1 2C7MB 3QQ8B 3PEGA 4LJOB 2LJIA 1FRRA 2Y5BB 4F7ZA 1JCKB 2L83A 1UBQA 2WX1A 2RR9A 3NVYA 1TKEA 2Z4DA 3TO1A 1YX5B 5CHWA 2NR2A 2N7DA 2KLCA 4FXCA 5LG4B 2LHEA 3BVZA 5G5HA 4HJGE 1C1YB 2Y7BA 2DZJA 1C4PA 2W2WA 4XDCA 1WE7A 2DHIA 4HAYB 4EJNA 1ZC4B 1P3RA 3A4SC 5JHBA 4MJSA 3IAS1 4OZAA 1R7SA 4KHBB 1P0RA 3V60A 4EMOA 3FKYA 1E7PB 3AU4A 2DZMA 2L1AA 2A4ZA 3AEBB 4P16A 3WANA 1UF0A 3KWLA 2DHJA 3VTVA 3PRMB 3VUYA 3EGRA 3ZTDA 4PYZA 3AEFB 2N23A 2HJ1A 2RGFA 5KHOA 2ROVA 4HATB 2LGYA 1SE9A 2REXA 3DPDA 1ZXIA 3UGBB 3BZDB 1WG7A 2RPQA 4P1BC 4JE3B 1IRSA 2K8CA 2D9ZA 4N6EB 3DBLI 5G5GA 5DI9B 1NVID 2G9HD 4F8CB 2KO3A 2KD0A 1UUPA 2AL3A 2DA0A 5D6JB 2BGFA 1MI1A 2KK8A 2KQSA 2EELA 4TUUA 4LNOA 2ADZA 3L13A 1WYGA 3T3OA 1KI1B 1L0YB 1ZC3B 3SO6A 3QBVB 3PHXB 2LGSA 2ASQA 3U4EG 2C7NB 1FCLA 3B9JA 4A3OA 5AUKA 1SB3C 1D3ZA 4YT0B 3KVFB 1RJ2A 1V5UA 2K8BA 2MX2A 3RPFC 2LRWA 2ZPYA 4HB3B 2XK5B 1YMHE 3V62A 3SNHA 1MK9B 2MFQA 2JWZA 4KHOA 4LK0M 2BKRB 3L4PA 5C1ZA 2ZCBA 4TQ0A 3I3TB 4F7GA 2KMAA 3ZUNA 2PIAA 1V5TA 2WXMA 1PGAA 1OEYJ 2NBWB 2LEKA 3LJ3A 2MCNB 3I5JC 4XE0A 5HI1A 4BKSD 5G55A 4GDLA 2QDFA 3PZDA 1J7CA 2I5FA 3GZNI 4C4VB 2YSZA 1WFYA 2RDHA 1TQZA 3RD2A 1QC6A 3PRZA 2M14A 2VRRB 4YONA 2KDMA 3VQIA 1FFUA 1U2BA 1WZ3A 1TGZB 1I7AA 1ZGUB 3AEDB 4MM3A 2BYFA 5D94A 2D3AA 1ZYIA 1P6SA 3VH3B 1WVHA 5C3JB 1KM7A 3BY4B 2FUG1 1Z5SB 4HK2A 3P7ZA 1P3QU 3NRZA 4ARCA 2ZW1A 1FXAA 2VZKD 2GB1A 4HROA 1WXAA 4HB4B 4BFRA 3ZQ4A 4PS7A 3F5RA 1UPRA 3PO0A 3T9LA 4NQKE 2IFSA 4HVBA 1XLQA 3A4RA 3TIXA 1Q0WB 3RNFC 4LDTD 1WJ1A 1F2RC 1AW7A 1QOAA 4IM3A 1FNWA 2JY6A 3U7ZA 2D9XA 1GC7A 4WWMA 3ML8A 1OQRA 1X05A 1D6EC 3U12A 2DENB 4GU2A 2YS3A 1ENFA 3MPXA 1AQCA 4M01A 4ZRPA 3DHHC 2WXGA 1WMHA 4KGTA 3N32A 2MSED 3PT2B 2Z13A 4OT1A 3KYDD 4M8NA 1NI2A 1V89A 3SFEB 4OHJA 2H89B 2XQNM 2MHJA 2R2OA 3U52E 1HA5A 1ZVRA 1C77A 2AQ1B 2KKCA 3IFWB 2L76A 4HKQA 4F1SA 4D0NB 1I4PA 2Z0OA 2DHKA 4KHAA 3AB5A 1FXIA 2M4NA 2V76A 3B0AA 3ODWA 3IXSA 2JZ3B 4GZUA 4HKZE 5DPRA 2B3AA 4A20A 1JW9D 4HHVA 1GNUA 1SE4A 3R3MA 1M7EA 2NS5A 5J3YA 1JQ4A 2V3PA 1L2NA 1N62A 3H7PA 1EGXA 3DBRB 3FC4A 1T77A 4JX1C 3TVVA 1L6VA 4BAXA 1MAIA 3EUB2 2K1FA 3VR8B 4K7UA 3OJ4B 4MH0E 2RLOA 1C78A 1WRDB 2Z59A 5D3VA 1W1DA 3KUCB 1NI3A 4M0WA 3V5WA 2M38A 1WR6E 3ETRA 3X23A 3EECA 5D3XA 1M94A 5M4YB 3Q8FA 1WJUA 1ZXHA 1V5PA 3M1IB 1S3SG 1U5DA 1JWMD 1RFAA 3MHSD 1XLPA 3TW1A 3DBLB 1SF0A 4BOSC 2ZNVB 3R7QA 5AZHA 2L52A 1ET9A 1DDVA 2CU1A 1V5OA 2YS1A 2KYWA 2D10A 2ZZPB 1WJMA 2DX5A 1TZ1A 4MELA 4BKTA 4W9GA 5J3TA 1PMSA 2ZVNA 2RNRB 1SBBB 3DWGC 3PS6A 3PP2A 2L00B 4N9F4 1FOEA 3PRPB 3PV1A 4IW0A 1FB8A 3ZNHB 2NPTB 5IP4D 1V1PA 2D3CA 2ONQA 3DBHI 5AEKB 3VH4B 5GOWB 2BS2B 2HTME 1AWEA 2PVGC 2IDYA 2O6VB 3K9OB 4KV2A 2DTCA 1ZDXA 3PTFC 4TKNA 3RNAC 2XEWA 4EZLA 1K53A 3NY5A 1PQSA 3ZO5B 1WGUA 4WAFA 3QHTA 5FI0A 3GP7A 4IC7B 2NMQA 3VUXA 3AEAB 4FLHA 4DHZE 1C9FA 1V9JA 2IPKD 4FADA 1SIFA 1JWSD 3GZNB 2N0SB 4II3B 1WGQA 1T3QA 5CHVC 4NAWA 3V05A 2E6XA 1RM6C 4FA6A 3JYUA 2I38A 3BIID 1FO4A 2MJDA 2O2VA 4KDLB 1BXTA 4M00A 2LD9A 3RULA 4XGAB 1FHOA 3R8BA 1E90A 3B2GA 4MT5A 1RRPB 5HFYA 4HPLB 3P2BA 2COFA 3NG0A 4W9KA 3A9KA 3FM8C 1UH6A 1A70A 2J42A 2I5CA 3PVUA 2GBMA 2LHDA 4RFBA 5HG2A 2DWQA 2N9PC 1T0QC 3CMMB 4RF0A 4E3CA 1I2HA 3NWAA 1WH3A 3RNGC 2BWES 1K8RB 4IWQA 1MJDA 3A33B 4A3PA 2BF8B 2WDRB 3L0WB 5JXVA 2FCMA 4XYCA 2KMCA 4W9IA 4GSWA 4LNNA 4URKA 1XQQA 2P8VA 2ROZB 5D3YA 1P7EA 1YQ3B 2KTRA 1YN3A 3P1MA 1IP9A 1L0XB 1XD3B 4G50A 4GIVA 1MPHA 5L83A 3IT6B 3N1YC 3AE8B 3RNCC 1F0ZA 3UQAA 1FGYA 3AEGB 1N5XA 4C0AA 2KFKA 3DHIC 4RM8A 1T5XD 4CYEA 4BBKA 5LONB 3ZTCA 3V3XA 1KLGD 2Z0EB 1TTNA 4JIOU 2K2JA 4GDKB 5C5BA 2BW2A 2LGDA 2WS3B 1MG4A 3ABVB 1WI0A 1WJNA 3LDZE 2HD5B 2J4XA 3UIPB 2C60A 1TIFA 1OY2A 3VTWA 2E2XA 3CIKA 2AWTA 4ARIA 1LXDA 2IJ0A 2MLBA 5JLJB 2BYVE 3FILB 4LNKA 1IYFA 3HIEA 2QKLA 2V4IB 1EVHA 2J53A 4CHKA 1VZ6A 1WX7A 1TZOA 1DOIA 2Q13A 4XWTA 3AECB 2N9EB 1TJEA 1QLBB 1CZPA 2DAFA 3DQVA 3OLMD 3QC8B 4M8MA 4YSXB 5J18A 2WXNA 4DHJB 1FNUA 1GPXA 2AEHA 5BMHA 3P63A 2J0KA 3AE6B 1E8WA 1OQYA 1ZP0B 1YQ4B 3ONSA 1ET6A 2R2YA 1QT9A 4K7SA 5HHDG 1IBXA 3Q3OC 1MHXA 1XCTL 3KRWA 3DCXA 2K9XA 1E7UA 2QILA 1XKEA 5T8IA 1MK7B 4DWFA 2DBYA 3W5UB 1YIWA 2KVRA 3QK0A 4ANXA 1YX6B 4HXDA 3P4SB 4US9A 2PW9A 4I6PA 4DQOC 4A8XC 2PEAA 2JRHA 4IAPA 2IO2B 4ZYNA 3CXBB 4JL9A 4MJSB 5C2TB 4AP4C 3FAHA 4RCOA 1VCBA 4IDIA 4YTMB 1U29A 1FHWA 3VOQA 1Q10A 3ZGZA 2N9XA 3GS2A 1L6UA 4P1CC 2LG1A 3U30A 5D27A 5J17A 4ANVA 3X0WA 4KKJA 3AN1A 1ZE3D 4RGNA 3ZDMC 3VIAA 2IGDA 3LB8C 3ZNID 2MW5A 4BBNC 3DBHB 2DYNA 3VXWA 2ON8A 3KZ1A 2MWSB 2RRFA 1IGDA 1WGGA 3Q3MC 1QILA 3MJWA 4ASWC 3P4RB 1LFDA 3ENEA 3RN9C 3ZJUA 2YLMA 1WE6A 2ZCCA 4HCPB 3ALBA 2I1JA 2UZSA 1EF5A 1N3HA 1KLVA 1U4AA 3SFDB 3TEYA 3ZLZA 4BOZB 3OAWA 2LOZA 4O1NA 4ZRJA 4QJ5B 1XODA 2MBHA 5BMGA 2KTFA 3A8QA 1E8ZA 2JYTA 2ZEQA 3JVZX 4HAWB 4WH4A 4Z2NA 2EJ8A 2KDBA 2MJ3A 2LYDA 2L3ZA 3D8DA 2KHWB 3HQCA 1N5WA 2KC1A 5JHHA 2DZIA 2GBJA 3DBSA 2KIEA 2OQBA 1MI0A 2P0HA 4PQ0A 2RDGA 1WGHA 4OZBA 1XD4A 4B0EA 4ZOHC 2WYQA 1L4ZB 3N7CA 3RUIB 2KAJA 4MSMB 1PUTA 5FI1A 2P0DA 2PMVA 1MHHE 3I57A 4MDKE 1ROEA 3MJ5A 1UNRA 2CY5A 1GB1A 2K22A 4GDLB 5C23A 4GN1A 2VRWB 4C00A 4MK0A 4FBJB 2KJHB 2DN6A 1XT9B 1RYJA 4G11A 3KH0A 1FD6A 3U8ZA 5I2SA 3ZDTA 2LMCA 2BBCA 5JZEB 3DVNV 2K2UA 2IGHA 3TEXA 2GMIC 3WYFB 4MM3B 3WAMA 1NDDA 1XX0A 1KZ7A 4K7WA 3NHEB 3OHMB 5DPTA 2FJUB 1BTKA 3NS8A 4A90A 3G9WA 1B55A 3URYA 3GYOA 1OQNA 4ZYSA 3PG7A 3IVFA 2Z14A 4RF1A 5HE0A 3DDCB 3ZW3A 3PPAA 1AYFA 4A6FA 3AULA 5DPSA 2QHOA 2WQYB 1HEZE 1YNTE 2KDIA 3UQBA 2K0PA 3VVWB 2GJYA 5C6RA 2K5PA 4WWPA 1QQGA 1R4MI 1DOXA 4IM2A 5JHAA 4X57B 1IUEA 1D4BA 3N1XC 3T8MA 3GE3C 1H4RA 2MH7A 2Z0PA 4F7HA 2KIGA 1WGRA 1L7YA 4DBGA 3MC9A 2MA9B 3TSSA 3Q8AA 5J3QA 1WI1A 3SD5A 2KX3A 5E6JA 1E5WA 5D2MB 1V80A 3M95A 3RI7C 1WXVA 2R2QA 4HAVB 4XZ4A 4A5KA 2JPHA 1ISNA 4BKSA 1YJ1A 1T0RC 1WX8A 3HRDD 1OGWA 1V6EA 2WXJA 3TL5A 2DLWA 1NTYA 3L17A 1P7FA 4PK1A 3QIJA 3KRXA 2G45B 4JWUC 1TS5A 2QCZA 2YT2A 2IY0B 3WAOA 5C16A 1EUVB 3AE4B 2V9HA 2COCA 5BYSA 4KX6B 4LNIA 2N1WA 2WHIA 2CODA 3C19A 3D32A 4QXAB 3ECIA 1I4XA 3L54A 2KLGA 3R2IA 2GCLA 1M4VA 1YOVB 2D11A 2C5LC 1JWAD 2NBVB 1XEEA 2QIEB 3O96A 5E6PA 4RM9A 4B95A 3R2TA 4NZLB 4W9LA 3H7PB 2DNFA 4KKIA 2BTEA 3MP9A 2MJEA 4A55A 1J7BA 3W1YA 1UELA 2KUPA 3QCAA 2KACA 4WAAA 4EEWA 4DDGD 2N0YA 3IG3A 2KN4A 2L2IA 2W3SA 2VKIA 1WSPA 2OEDA 2Z59B 3CSFA 1X1MA 3VHTC 4M0WB 4C7ZA 1U5GA 2NZ8B 3RZWC 2ZNVC 1WGDA 2JYEA 2W55A 4RMAA 2H88B 3V6EB 2V1YA 1WM3A 2OTXA 3MC0B 1SHCA 5I4DA 2Y3AA 2W2XC 2QMTA 3SDLC 5CTRC 4IM0A 1YJJA 5CLLB 1U5EA 4HEA1 2A5UA 2DYQA 2RUKB 3GB1A 3WA0A 3FSSA 2OHFA 2LJ5A 2DX5B 1W1GA 4OVVA 1VZ7A 2WGSA 1V86A 4C4VA 5EE9A 4J3OD 2GBNA 2RSGA 1XR0B 2LVOA 2J59M 3UI3A 3B2FA 3SU8X 4B0MA 1FNVA 2WX0A 3AMZA 3BWUD 2BB6A 1I4QA 5HKHA 4S17A 1I4GA 3LYYA 2HTHA 4C7YA 3K9PB 5EE0A 3N3KB 5EE3A 2KWCA 2N4FA 3HVDA 1IPGA 4W9EA 4HDOA 3VFKA 2ELBA 1VR9A 3Q8BA 3PSCA 3Q8CA 2BS3B 2CRFA 3TUOA 4GOUA 4HCNB 3D8EA 2GCJA 3Q69A 2QC8A 4LLGM 1R4NI 1L5PA 4WJNA 1TKYA 1BT0A 4NPNA 2D3GA 2LULA 2JWUA 1MPEA 1EM7A 2WXKA 3P4PB 1FRDA 5IKCM 2PZ1A 4NAWB 2JF5A 3MHZA 3NJTA 4DIXA 4KGSA 4P7IA 2M19A 1XCQL 3PLUA 3C0RB 4JPSA 3KW5B 3APFA 2OJWA 3PSEB 2BT6A 2O2VB 3ML9A 5IRSA 3HVZA 1HTQA 1UZXB 1EO6A 1H10A 2LUMA 3KYCD 1C79A 4ZDVA 3QWMA 3NUHB 2NBUA 1WWTA 2G3QB 2N7EA 1DBHA 4MY6A 4WSFA 3W2DA 5LXIB 1RFKA 2NVUI 2WDTB 2KT7A 3NVZA 5GXGB 5LOPB 2V0GA 2BYTA 2YT0A 2ZJDA 3A1QA 4K2OA 1CQVA 1R4MB 3GYPA 2KZRA 2KOXA 5HE2A 2LKOA 2GRIA 5G2NA 2WXFA 3JW0X 2WLBA 1OQQA 3BINA 1QQRA 4MT7A 1WJ6A 5FR6A 1GUAB 5JP4A 1PGXA 2QEJC 2CY4A 2WXHA 2KTRB 3DVGY 2JSVX 3JSVA 2D5GA 4RH6A 1KF6B 3PLVA 1UEFA 2NTSA 3T06A 4B6HA 3GOEA 4C56C 1EU3A 3AE7B 1XLNA 4RNAA 1ZPSA 3WCQA 4TSSA 3KLSX 4YL8A 1QKZA 2KFKB 5KCVA 2YEPF 1U5FA 2CJOA 1HTOA 5DH9B 3B77A 1P98A 2J0MA 1FXTB 1FAOA 3UZTA 5C5BB 4HAZB 1RLFA 4LJPB 3Q14C 4R3DA 2L7RA 2BKFA 1I7HA 3E56A 2KCJA 4HSIA 2WDVB 3W1SC 3SV1A 2KFJA 4IWPA 2YT1A 2L0FA 2QSDA 4ZHOA 2CKHB 3L16A 4DHZB 2IYDB 3OWEB 4FULA 2JUOA 1GG3A 5C79A 3UINB 1XCGA 2VH2A 2W2XD 2M17A 1BMLC 4KVGB 2ACZB 1H8CA 4KIKB 2M0AA 4TQ1A 1NYQA 1WR1A 2BS4B 3L08A 1VDVA 2MBEA 2M56B 2WXPA 1CK1A 4NAMA 1IBXB 1D5ZC 1NU2A 2FE8A 2J0JA 2K25A 1FIQA 2CJNA 2O6VD 4USAA 3ZNZB 4B9KA 3E9SA 3BVMA 4ZRQA 4KZ0A 1Y5OA 4OVUA 1UNQA 3H6NA 2EMSA 4NJ6A 3BYYB 1DROA 3BK2A 1TS3A 4A9AA 3S2AA 3MC8A 2UZRA 1JRUA 1DYNA 4ITKA 2LGXA 2FCQA 4YSZB 3U2SC 1PDXA 4L6EA 1SE3A 3VR9B 5FKAC 3EFUA 4I6NB 4K17A 2DKPA 2R0DA 3DXCA 2K6QA 3NZUA 4D2KA 3NWDA 5EE1A 1XLOA 1FM0D 2YRYA 4RGMA 3RZFA 4LTUA 2KN5A 4NNJB 3A8PA 2TSSA 3RCZA 4DXAB 2LFIA 4K3CA 3A9JA 1WXSA 4IKGA 1XF5L 4TYZA 3I63C 3KQ4A 2WU2B 1YD8U 3O65B 1TKGA 2FAZA 4US8A 5CX3A 3F0WA 1PLSA 3MTNB 4MGKE 2HJ8A 1WRIA 1R4NB 5FR3A 4MACA 4H2AA 3DVNU 4AQ7A 1JROA 2UYZB 2KNBA 2RVBB 4EZKA 1LM8B 2LWPA 4FJVB 2DAJA 5IO9A 4KAXB 2BPSA 3N30A 2IY1B 2OJRA 2GOWA 3ZVVA 2Z0DB 3ZJVA 4N59A 3NWFA 1I4HA 4QAYA 3AE2B 3W5VB 1OTRB 4TMAB 4PNKA 3KWVA 1Y19B 1EF1A 4ZRKA 4IOIE 3P4QB 3HUIA 1K52A 2INCC 4DX8A 3C8YA 3B08A 4EE2A 2KANA 3AE9B 2PTLA 4WWNA 5CLQB 3ZXVA 4HDQA 2MWNB 3CSTA 4NSWA 2XN9C 3N1ZC 1V8CA 2DHZA 1I42A 5HE3A 3PREA 3ZJTA 3VAWA 4A6QA 1YQBA 2BB5A 1LGRA 2I2YA 3DOWA 1KZGA 2AYOB 4CSQA 1UNPA 1UPQA 3LXFA 4L1RA 1ZM0A 3ZYYX 1E8YA 3WALA 3T3NA 2MBQA 2LOXA 1RAXA 3Q3NC 1K5GB 4BBNF 4LNFA 3TMPB 1BAKA 3ZIMA 3FEHA 3QWZB 3OANA 1SSNA 3ZXRA 2M8SA 1V97A 3FILA 4DXFA 1ZW7A 1A5RA 1KJTA 1LQBA 3DXDA 2PPHA 1L0VB 2KQ7A 4XDDA 4E71A 3AU5A 4A6FB 2HE7A 4DHJD 5BYQA 4DBBA 2AQ3B 1SJED 3NVWA 1PGBA 4WQOB 2PVOD 2G35A 2J52A 5EDSA 1E7VA 4GMXB 4HB2B 2W3RA 1GAQB 4OZCA 5IA7A 1J19A 2N9KA 1TY0A 4DK5A 1JALA 3B1LX 2PE6B 2G4DB 1X1FA 3M62B 5H92C 4G0NB 3PVLA 3AV8A 3NVVA 5MPOA 1N61A 3VUWA 4JQWC 2ZKMX 5DPWA 5KQ4A 1DDWA 1VRAB 2MP2A 4LCDE 4D6WA 1V88A 3DBRI 2ZPNA 3OG5A 1WYWB 4REZA 2JP2A 4W9JA 1ZSQA 3NZ3A 3LJUX 1Z2MA 4AS1A 2FNJB 2YS5A 2I1KA 3D8FA 4KSKC 4QJ3B 2WXRA 4HRSA 1E8XA 1E10A 2YVCA 3DVGX 4DDID 3ULCA 1E6EB 4L23A 2FIFA 2LZ6A 1TS2A 3NSUA 2W9NA 1B9RA 1HZ5A 2W54A 1F2RI 2R61A 1V61A 4GMVA 3APCA 4FN2A 5IAAC 1K5DB 1OMWA 5AUIA 4JGHB 4HLEA 1Y56A 2VZKB 1WGKA 4YWGG 3PVWA 3V61A 2WDQB 1J0WA 1ESFA 4WVFB 1MVKA 2BQQA 5KQ1A 3SHQA 2B76B 4HAUB 1DOYA 3P42A 2X8XX 1OEYA 4GB9A 3AXCA 4LDTB 4C80A 4NJCA 3KUZA 2DYBA 5L81A 2RSUA 4Z2MB 5TR5A 2KJ6A 1PYWD 1WXQA 4KGRA 2LRUA 1NEKB 4HPMB 1JWUD 3RT3B 2L8JA 2AL6A 3N20C 1KOTA 2M1MA 1WMHB 2MKRA 4M02A 3WAPA 1NBFC 2DZKA 1NYRA 2M0XA 3SYXA 1D5XC 2N7JA 4G3XB 1QF6A 3GE8C 4KHBA 4WURA 5CHFA 1FFVA 2K39A 4H8SA 2EKEC 2ICIA 1RRBA 1WF9A 1QOFA 1D5MC 3Q6BA 3TEZA 5DCNA 2KVZA 4JWSC 4AOFA 1UWXA 3ML4A 2COAA 4F7UP 4WJPA 2JT4B 1ZDVA 1STEA 3RNBC 4XX5A 2LGIA 3QX1A 4EZJA 3EC8A 5IN7A 3QA8A 4S0RA 1RWSA 2AQ2B 3BJIA 2HTHB 1AARA 4ACFA 4NQLB 1P5TA 3VDZA 2NMBA 3R7RA 3AE5B 3IBEA 1TJ6A 4JLCA 1J0GA 3TFMA 2D3BA 1JRPA 3OJ3A 5AZFA 1WXMA 5JHGA 3HK0A 1DYQA 3CIRB 1T6BX 4WQMA 2KWDA 3H8HA 4ANUA 1W1HA 2INPE 4RGTA 3P6AA 5AZGA 1AN8A 2GUMA 2RDBC 2K49A 1ACCA 2MQJA 4CHMA 4A6KA 2WWZA 1GJZA 1WY8A 2KWVB 4A6HA 4K81A 1DGJA 4IWOA 2LVQA 1S1QB 3ZRFA 4PT5A 5I2MA 1NTVA 2K00A 1Q1OA 4WJQA 3SEBA 3NOBA 2D9YA 3BYTB 2NTTA 2XK5A 2K8HA 2GBKA 3UF8A 3QAQA 2UWQA 5DHFB 3EHVA 2YF0A 1GC6A 4W9FA 1WX9A 3Q8EA 5GMVA 1FCCC 1TY2A 2JZZA 2KDFB 2LUEA 4NY0A 2D07B 4MGZE 2Y5CA 5D3DA 1Z87A 1K51A 2CU3A 5L95C 3HHMA 3AH7A 3I9V1 2QJLA 1FHXA 1Q67A 1UGMA 1XXGA 2RMMA 1FEHA 2FBWB 2D2QA 2IYBA 2EKIA 1P1AA 2G4SA 2C7HA 2RPVA 2KGXB 2LI5A 2NCNA 1K50A 1SIJA 1MG8A 4FJZA 3A1QB 2UU7A 1FPYA 1V1PB 3BVGA 1GB4A 1OFFA 2GS0A 3V6CB 4W9HA 4BZAA 1V5MA 1WJ4A 3ZKJC 3DXEA 1DDMA 3TJPA 3Q2AC 3DHGC 2MDXA 2KJRA 4UDUC 1FGZA 2KXJA 2MEKA 2MBOA 1T0YA 2NBVA 3JSVB 1BUIC 2WXIA 4J6IA 1TT5B 3M3JA 2L0TA 2GBRA 3VTUA 3PZ7A 4QJ4B 2PKOA 2JU6X 4AWJA 2D4QA 1N6ZA 3QARA 1UD7A 2H7EA 2CHWA 4PS8A 4N58A 1YJIA 3SR6A 1YN4A 3H7SA 3O13A 3NS1A 4AUQC 2R09A 1LB1A 1MFWA 5E6OA 2V3SA 1TS4A 1MIZB 1YN5A 3KSYA 1UWMA 4BKGA 3ULBA 2Q5WD 1PFJA 5D3WA 2IGGA 3A9KB 1F9JA 3VRAB 1B1ZA 3ZVRA 2X38A 3IHPC 5BMIA 3RMKC 2E3TA 1PFDA 1T0SC 1KH0A 2VSZA 4EUTA 4E74A 1N60A 2D9WA 3TBLD 2KC2A 4GNKB 4B6WA 4YXDB 4HWIB 3SUZA 2W82A 1G6JA 4MH8A 2QKMA 5TSSA 4DXGA 4CO7A 2IZVB 4DX90 3TEWA 2LXAA 2WXOA 2DX1A 4K2PA 1JMLA 1XO3A 4OSNA 1EU4A 2D9VA 1AWDA 1GOZA 4PS3A 3DCGA 2MBBB 5LLIA 1MIXA 2K3UA 1ZKHA 2RGNB 3Q3FA 4AJYB 2GLSA 3A98B 3RNEC 5D3IB 3ODXA 2CR5A 1SJHD 3CWIA 4KSLC 4EKUA 2KQ4X 3ODOA 1F77A 3M63B 3HW2B 2WXQA 3AE3B 3NZSA 3HM3A 4OW0A 2FUHB 2INDC 2WXLA 3HIZA 1HQRD 3Q3JA 1SE2A 1TXDA 4II2B 2J7QB 3APDA 5D7GA 2JX5A 4XWWA 2IO0B
chains in the Genus database with same CATH topology
4HJKA 4MGYE 1WGYA 3HM6X 2ZVOA 3U7DA 1MKEA 2FJLA 2DYOA 2JVCA 1I35A 2Y8GA 1V2YA 3A9JB 4W9DA 4WJOA 2DYMA 3MDBC 4XWXA 1UBIA 2LASA 5JH5C 4ICUA 5J2RA 4K1RB 4IG7B 4KZCA 4TV3A 2Z0QA 1WZ0A 1BWNA 3H9DA 3TCAA 2NPTA 5LXHA 2OOBB 1Q5WB 1U27A 3AI5A 4GPTB 2O6VA 2KX0A 3WIMA 1QZEA 4BVUC 2IBIB 1SGHA 4GGQA 2BWFA 4NJ7A 4IFSA 2CS4A 1Y8RC 2JXXA 2LVPA 2EC1A 2KWUB 5E6NA 2X18A 4XC2A 5HE1A 2BCJA 1V81A 4CHJA 2IO3B 4EOYA 2FIDA 1WM2A 4WJ7A 3CF6E 2IO1B 5BO4B 2FCSA 1C3TA 4W9CA 1J8CA 1LW3A 2DKQA 4HAXB 3AJ4A 1CMXB 3H1UA 4IUMB 4ZRIA 1M7RA 1EAZA 4ICVA 4EFOA 2EMTA 2H7DA 5DHAB 1VD2A 1P9DU 2L05A 4GXBA 4IOYX 3ZNGC 4KIKA 1X11A 2RD0A 2Y8FA 2N1VA 3L10B 1V49A 1X1GA 2UVMA 2ELAA 4GOCA 2K6DB 4PYUA 2DFKA 2C9WB 1X86A 1TBEA 4HB0B 3ZRCA 2MP2B 3UIOB 3RCPA 2KDEB 2PJHA 4MSQB 4FHKA 2LXCA 4GDKA 2V4LA 4KDIC 4FJYA 4Y94A 5EFXA 3KY9A 1WIAA 3RYTA 2PE9A 3PHWB 4FHJA 2CHXA 4MGIE 2P0FA 4I6LB 2CAYA 1BTNA 2L1CA 2CHZA 3W1SA 4MEMA 4WWOA 5DIFB 2MRPA 3R66C 3KUDB 4AJWA 2XBBC 2JRIB 2FCNA 5KHQA 3PGEA 3QJZA 4ANWA 1HE8A 2BYEA 2C7MB 3QQ8B 3PEGA 4LJOB 2Y5BB 4F7ZA 1UBQA 2WX1A 2RR9A 3TO1A 5CHWA 1YX5B 2NR2A 2N7DA 2KLCA 1C1YB 2Y7BA 2DZJA 2W2WA 1WE7A 2DHIA 4HAYB 4EJNA 1ZC4B 1P3RA 3A4SC 5JHBA 4MJSA 4KHBB 1P0RA 3V60A 4EMOA 3AU4A 2DZMA 2A4ZA 3WANA 2DHJA 3VTVA 3PRMB 3VUYA 3ZTDA 4PYZA 2N23A 2RGFA 5KHOA 2ROVA 4HATB 2LGYA 1SE9A 2REXA 3DPDA 3UGBB 1WG7A 2RPQA 1IRSA 2K8CA 2D9ZA 3DBLI 5DI9B 4F8CB 2KO3A 2KD0A 2AL3A 2DA0A 5D6JB 2BGFA 2KK8A 2KQSA 4TUUA 2ADZA 3L13A 1KI1B 1ZC3B 3SO6A 3QBVB 3PHXB 2ASQA 2C7NB 4A3OA 1D3ZA 3KVFB 1RJ2A 1V5UA 2K8BA 2MX2A 2LRWA 2ZPYA 4HB3B 2XK5B 3V62A 3SNHA 1MK9B 2MFQA 2JWZA 4KHOA 2BKRB 5C1ZA 2ZCBA 4TQ0A 3I3TB 4F7GA 2KMAA 3ZUNA 1V5TA 1OEYJ 2NBWB 3LJ3A 2MCNB 4BKSD 5G55A 4GDLA 3PZDA 2I5FA 3GZNI 2YSZA 1WFYA 1TQZA 3RD2A 1QC6A 3PRZA 2M14A 2VRRB 4YONA 3VQIA 1U2BA 1WZ3A 1TGZB 1I7AA 1ZGUB 4MM3A 2BYFA 5D94A 1P6SA 3VH3B 1WVHA 1KM7A 3BY4B 4HK2A 1Z5SB 3P7ZA 1P3QU 1WXAA 4HB4B 4BFRA 4PS7A 3F5RA 1UPRA 3T9LA 4NQKE 2IFSA 4HVBA 3A4RA 3TIXA 1Q0WB 4LDTD 1WJ1A 4IM3A 2JY6A 2D9XA 1GC7A 3ML8A 1X05A 2DENB 4GU2A 2YS3A 3MPXA 1AQCA 1WMHA 3N32A 2MSED 3PT2B 3KYDD 4M8NA 1NI2A 1V89A 2XQNM 2R2OA 1ZVRA 2KKCA 3IFWB 2L76A 4F1SA 4D0NB 2Z0OA 2DHKA 4KHAA 2M4NA 2V76A 3B0AA 3ODWA 2JZ3B 4GZUA 5DPRA 2B3AA 4A20A 4HHVA 1GNUA 3R3MA 1M7EA 2NS5A 5J3YA 1L2NA 3H7PA 1EGXA 3TVVA 1MAIA 2K1FA 4K7UA 3OJ4B 4MH0E 2RLOA 1WRDB 5D3VA 1W1DA 3KUCB 3V5WA 2M38A 1WR6E 3X23A 3EECA 5D3XA 1M94A 1WJUA 1V5PA 3M1IB 1S3SG 1U5DA 1RFAA 3MHSD 3TW1A 4BOSC 2ZNVB 3R7QA 5AZHA 1DDVA 2CU1A 1V5OA 2YS1A 2D10A 2ZZPB 1WJMA 2DX5A 1TZ1A 4MELA 4BKTA 4W9GA 5J3TA 1PMSA 2ZVNA 2RNRB 3PS6A 3PP2A 2L00B 4N9F4 1FOEA 3PRPB 3PV1A 4IW0A 1FB8A 3ZNHB 2NPTB 3DBHI 5AEKB 3VH4B 5GOWB 1AWEA 2O6VB 3K9OB 4KV2A 2DTCA 3PTFC 4TKNA 2XEWA 4EZLA 3NY5A 1PQSA 3ZO5B 1WGUA 3QHTA 5FI0A 4IC7B 3VUXA 4FLHA 4DHZE 1V9JA 4FADA 1SIFA 4II3B 1WGQA 5CHVC 4NAWA 4FA6A 3JYUA 2O2VA 4KDLB 3RULA 2LD9A 1FHOA 1E90A 1RRPB 4HPLB 3P2BA 2COFA 4W9KA 3A9KA 3FM8C 1UH6A 2I5CA 3PVUA 2GBMA 2N9PC 3CMMB 4E3CA 1I2HA 1WH3A 2BWES 1K8RB 4IWQA 3A33B 4A3PA 2BF8B 3L0WB 2FCMA 2KMCA 4W9IA 4GSWA 4URKA 1XQQA 2P8VA 2ROZB 5D3YA 2KTRA 1IP9A 1XD3B 4G50A 4GIVA 1MPHA 5L83A 3UQAA 1FGYA 4RM8A 4C0AA 2KFKA 4CYEA 4BBKA 5LONB 3ZTCA 2Z0EB 1TTNA 4JIOU 2K2JA 4GDKB 5C5BA 2LGDA 1WI0A 1WJNA 3LDZE 2HD5B 3UIPB 2C60A 1OY2A 3VTWA 2E2XA 3CIKA 2AWTA 1LXDA 2MLBA 5JLJB 2BYVE 1IYFA 2QKLA 1EVHA 4CHKA 1WX7A 2Q13A 2N9EB 3DQVA 3OLMD 2DAFA 4M8MA 3QC8B 5J18A 4DHJB 2AEHA 2J0KA 1E8WA 1OQYA 3ONSA 4K7SA 3KRWA 1E7UA 1XKEA 1MK7B 4DWFA 4ANXA 1YIWA 2KVRA 3QK0A 1YX6B 4HXDA 4I6PA 2PEAA 2JRHA 4IAPA 2IO2B 4ZYNA 3CXBB 4JL9A 4MJSB 4AP4C 1VCBA 1U29A 1FHWA 3VOQA 2N9XA 2LG1A 3U30A 5D27A 5J17A 4ANVA 3X0WA 3ZDMC 3VIAA 3ZNID 2MW5A 4BBNC 2DYNA 3VXWA 3KZ1A 2MWSB 1WGGA 3MJWA 4ASWC 1LFDA 3ENEA 2YLMA 1WE6A 2ZCCA 4HCPB 3ALBA 2I1JA 2UZSA 1EF5A 1N3HA 1KLVA 1U4AA 3ZLZA 4BOZB 3OAWA 2LOZA 4ZRJA 1XODA 2MBHA 2KTFA 3A8QA 1E8ZA 2ZEQA 3JVZX 4HAWB 4Z2NA 2EJ8A 2KDBA 2LYDA 2L3ZA 3D8DA 2KHWB 3HQCA 2KC1A 5JHHA 2DZIA 2GBJA 3DBSA 2OQBA 2P0HA 4PQ0A 1WGHA 1XD4A 2WYQA 3N7CA 3RUIB 4MSMB 5FI1A 2P0DA 4MDKE 1UNRA 2CY5A 4GDLB 5C23A 4GN1A 2VRWB 4MK0A 4FBJB 2KJHB 2DN6A 1XT9B 4G11A 3KH0A 3U8ZA 3ZDTA 5JZEB 3DVNV 2K2UA 2GMIC 3WYFB 3WAMA 1NDDA 1XX0A 1KZ7A 4K7WA 3NHEB 5DPTA 1BTKA 3NS8A 3G9WA 1B55A 3GYOA 1OQNA 3PG7A 3IVFA 5HE0A 3DDCB 3ZW3A 3PPAA 4A6FA 3AULA 5DPSA 2QHOA 2KDIA 3UQBA 3VVWB 2GJYA 5C6RA 4WWPA 1QQGA 1R4MI 4IM2A 5JHAA 4X57B 3T8MA 1H4RA 2Z0PA 4F7HA 1WGRA 1L7YA 4DBGA 2MA9B 5J3QA 1WI1A 3SD5A 2KX3A 1E5WA 5D2MB 1V80A 3M95A 1WXVA 2R2QA 4HAVB 4XZ4A 4A5KA 2JPHA 1ISNA 4BKSA 1YJ1A 1WX8A 1OGWA 1V6EA 3TL5A 2DLWA 1NTYA 3L17A 3QIJA 3KRXA 2G45B 2IY0B 3WAOA 5C16A 1EUVB 2COCA 2N1WA 2CODA 3D32A 3ECIA 3L54A 2KLGA 2GCLA 2D11A 2C5LC 2NBVB 3O96A 5E6PA 4RM9A 4B95A 4W9LA 3H7PB 3W1YA 1UELA 2KUPA 3QCAA 4WAAA 4EEWA 4DDGD 2N0YA 3IG3A 2L2IA 2VKIA 2Z59B 3CSFA 1X1MA 3VHTC 4M0WB 1U5GA 2NZ8B 3RZWC 2ZNVC 1WGDA 4RMAA 3V6EB 2V1YA 1WM3A 2OTXA 1SHCA 2W2XC 3SDLC 5CTRC 4IM0A 5CLLB 1U5EA 2A5UA 2DYQA 2RUKB 3WA0A 3FSSA 2LJ5A 2DX5B 1W1GA 4OVVA 1V86A 2GBNA 2RSGA 1XR0B 2LVOA 2J59M 3SU8X 2WX0A 5HKHA 2HTHA 3K9PB 3N3KB 2KWCA 2N4FA 1IPGA 4W9EA 4HDOA 3VFKA 2ELBA 3PSCA 2CRFA 4HCNB 3D8EA 2GCJA 1R4NI 4WJNA 1BT0A 4NPNA 2D3GA 2LULA 2PZ1A 4NAWB 2JF5A 4P7IA 3PLUA 3C0RB 3KW5B 3APFA 3PSEB 2O2VB 3ML9A 1UZXB 1EO6A 1H10A 3KYCD 4ZDVA 3QWMA 2NBUA 2G3QB 2N7EA 1DBHA 4MY6A 4WSFA 5LXIB 2NVUI 2WDTB 5LOPB 2YT0A 2ZJDA 3A1QA 4K2OA 3GYPA 2KZRA 2KOXA 5HE2A 2LKOA 5G2NA 3JW0X 3BINA 4MT7A 1WJ6A 5FR6A 1GUAB 5JP4A 2CY4A 2KTRB 3DVGY 3JSVA 3PLVA 1UEFA 3T06A 4B6HA 3GOEA 4YL8A 2KFKB 5KCVA 1U5FA 5DH9B 1P98A 2J0MA 1FXTB 1FAOA 3UZTA 5C5BB 4HAZB 1RLFA 4LJPB 2L7RA 2BKFA 2KCJA 3W1SC 3SV1A 2KFJA 4IWPA 2YT1A 2L0FA 2CKHB 3L16A 4DHZB 2IYDB 4FULA 2JUOA 1GG3A 5C79A 3UINB 1XCGA 2W2XD 2M17A 4KVGB 1H8CA 4KIKB 4TQ1A 1WR1A 3L08A 2MBEA 1NU2A 2J0JA 2K25A 2O6VD 3ZNZB 4B9KA 4KZ0A 1Y5OA 4OVUA 1UNQA 3H6NA 2EMSA 4NJ6A 1DROA 3S2AA 2UZRA 1JRUA 1DYNA 2LGXA 2FCQA 4L6EA 3EFUA 4I6NB 4K17A 2DKPA 2R0DA 3DXCA 2K6QA 3NZUA 2YRYA 3RZFA 2KN5A 4NNJB 3A8PA 3RCZA 4DXAB 3A9JA 1WXSA 4TYZA 1YD8U 3O65B 2FAZA 5CX3A 3F0WA 1PLSA 3MTNB 4MGKE 2HJ8A 3DVNU 2UYZB 2KNBA 2RVBB 4EZKA 1LM8B 2LWPA 4FJVB 2DAJA 4KAXB 2BPSA 3N30A 2IY1B 2OJRA 2GOWA 3ZVVA 2Z0DB 1OTRB 4PNKA 1Y19B 1EF1A 4ZRKA 4DX8A 3B08A 2KANA 4WWNA 5CLQB 4HDQA 2MWNB 3CSTA 4NSWA 2DHZA 1I42A 5HE3A 3PREA 3VAWA 1YQBA 3DOWA 1KZGA 2AYOB 1UNPA 1UPQA 1ZM0A 1E8YA 3WALA 2MBQA 2LOXA 1RAXA 1K5GB 4BBNF 3TMPB 1BAKA 3ZIMA 3FEHA 3QWZB 3OANA 2M8SA 1ZW7A 1A5RA 1KJTA 1LQBA 3DXDA 2PPHA 2KQ7A 4E71A 3AU5A 4A6FB 2HE7A 4DHJD 4DBBA 4WQOB 2G35A 5EDSA 1E7VA 4GMXB 4HB2B 5IA7A 1J19A 4DK5A 3M62B 3B1LX 2PE6B 2G4DB 1X1FA 4G0NB 3PVLA 3VUWA 4JQWC 5DPWA 5KQ4A 1DDWA 2MP2A 4LCDE 1V88A 3DBRI 2ZPNA 1WYWB 2JP2A 4W9JA 1ZSQA 3LJUX 1Z2MA 2FNJB 2YS5A 2I1KA 3D8FA 4KSKC 1E8XA 2YVCA 3DVGX 4DDID 3ULCA 2FIFA 2LZ6A 3NSUA 2W9NA 1V61A 4GMVA 3APCA 4FN2A 5IAAC 1K5DB 1OMWA 4JGHB 4HLEA 3PVWA 3V61A 1J0WA 3SHQA 4WVFB 5KQ1A 4HAUB 1OEYA 4GB9A 3AXCA 4LDTB 3KUZA 2DYBA 5L81A 2RSUA 4Z2MB 5TR5A 2KJ6A 2LRUA 4HPMB 3RT3B 2L8JA 2AL6A 1KOTA 2M1MA 1WMHB 2MKRA 3WAPA 1NBFC 2DZKA 2M0XA 3SYXA 4G3XB 5CHFA 2K39A 4H8SA 2EKEC 1RRBA 1WF9A 5DCNA 4AOFA 3ML4A 2COAA 4F7UP 4WJPA 2JT4B 4XX5A 3QX1A 4EZJA 3EC8A 3QA8A 3BJIA 2HTHB 1AARA 4NQLB 1P5TA 3VDZA 2NMBA 3R7RA 3IBEA 1TJ6A 4JLCA 1J0GA 3TFMA 3OJ3A 5AZFA 1WXMA 5JHGA 3HK0A 4ANUA 1W1HA 3P6AA 5AZGA 2MQJA 4CHMA 4A6KA 2WWZA 1GJZA 1WY8A 2KWVB 4A6HA 4K81A 4IWOA 2LVQA 1S1QB 3ZRFA 1NTVA 2K00A 1Q1OA 4WJQA 3NOBA 2D9YA 2XK5A 2K8HA 2GBKA 3UF8A 3QAQA 2UWQA 5DHFB 3EHVA 2YF0A 1GC6A 4W9FA 1WX9A 5GMVA 2JZZA 2KDFB 2LUEA 4NY0A 2D07B 4MGZE 1Z87A 5L95C 3HHMA 1FHXA 1Q67A 1UGMA 2D2QA 2IYBA 1P1AA 2G4SA 2C7HA 2KGXB 2LI5A 2NCNA 4FJZA 1MG8A 3A1QB 2GS0A 3V6CB 4W9HA 1V5MA 1WJ4A 3ZKJC 3DXEA 1DDMA 3TJPA 2MDXA 2KJRA 1FGZA 2KXJA 2MBOA 1T0YA 3JSVB 4J6IA 3M3JA 2L0TA 2GBRA 3VTUA 4AWJA 2D4QA 3QARA 1UD7A 2H7EA 2CHWA 4PS8A 3H7SA 4AUQC 2R09A 1LB1A 5E6OA 2V3SA 1MIZB 3KSYA 4BKGA 3ULBA 1PFJA 5D3WA 3A9KB 1F9JA 3ZVRA 3IHPC 2VSZA 4EUTA 4E74A 2D9WA 3TBLD 2KC2A 4B6WA 4HWIB 3SUZA 1G6JA 2QKMA 4CO7A 2IZVB 4DX90 2LXAA 2DX1A 4K2PA 2D9VA 4PS3A 3DCGA 2MBBB 5LLIA 1MIXA 1ZKHA 2RGNB 3Q3FA 4AJYB 3A98B 3ODXA 2CR5A 4KSLC 4EKUA 3ODOA 3M63B 3HW2B 3NZSA 3HM3A 2FUHB 3HIZA 3Q3JA 1TXDA 4II2B 2J7QB 3APDA 5D7GA 2IO0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJK A;  4MGY E;  1WGY A;  3HM6 X;  2ZVO A;  3U7D A;  1MKE A;  2FJL A;  2DYO A;  2JVC A;  1I35 A;  2Y8G A;  1V2Y A;  3A9J B;  4W9D A;  4WJO A;  2DYM A;  3MDB C;  4XWX A;  1UBI A;  2LAS A;  5JH5 C;  4ICU A;  5J2R A;  4K1R B;  4IG7 B;  4KZC A;  4TV3 A;  2Z0Q A;  1WZ0 A;  1BWN A;  3H9D A;  3TCA A;  2NPT A;  5LXH A;  2OOB B;  1Q5W B;  1U27 A;  3AI5 A;  4GPT B;  2O6V A;  2KX0 A;  3WIM A;  1QZE A;  4BVU C;  2IBI B;  1SGH A;  4GGQ A;  2BWF A;  4NJ7 A;  4IFS A;  2CS4 A;  1Y8R C;  2JXX A;  2LVP A;  2EC1 A;  2KWU B;  5E6N A;  2X18 A;  4XC2 A;  5HE1 A;  2BCJ A;  1V81 A;  4CHJ A;  2IO3 B;  4EOY A;  2FID A;  1WM2 A;  4WJ7 A;  3CF6 E;  2IO1 B;  5BO4 B;  2FCS A;  1C3T A;  4W9C A;  1J8C A;  1LW3 A;  2DKQ A;  4HAX B;  3AJ4 A;  1CMX B;  3H1U A;  4IUM B;  4ZRI A;  1M7R A;  1EAZ A;  4ICV A;  4EFO A;  2EMT A;  2H7D A;  5DHA B;  1VD2 A;  1P9D U;  2L05 A;  4GXB A;  4IOY X;  3ZNG C;  4KIK A;  1X11 A;  2RD0 A;  2Y8F A;  2N1V A;  3L10 B;  1V49 A;  1X1G A;  2UVM A;  2ELA A;  4GOC A;  2K6D B;  4PYU A;  2DFK A;  2C9W B;  1X86 A;  1TBE A;  4HB0 B;  3ZRC A;  2MP2 B;  3UIO B;  3RCP A;  2KDE B;  2PJH A;  4MSQ B;  4FHK A;  2LXC A;  4GDK A;  2V4L A;  4KDI C;  4FJY A;  4Y94 A;  5EFX A;  3KY9 A;  1WIA A;  3RYT A;  2PE9 A;  3PHW B;  4FHJ A;  2CHX A;  4MGI E;  2P0F A;  4I6L B;  2CAY A;  1BTN A;  2L1C A;  2CHZ A;  3W1S A;  4MEM A;  4WWO A;  5DIF B;  2MRP A;  3R66 C;  3KUD B;  4AJW A;  2XBB C;  2JRI B;  2FCN A;  5KHQ A;  3PGE A;  3QJZ A;  4ANW A;  1HE8 A;  2BYE A;  2C7M B;  3QQ8 B;  3PEG A;  4LJO B;  2Y5B B;  4F7Z A;  1UBQ A;  2WX1 A;  2RR9 A;  3TO1 A;  5CHW A;  1YX5 B;  2NR2 A;  2N7D A;  2KLC A;  1C1Y B;  2Y7B A;  2DZJ A;  2W2W A;  1WE7 A;  2DHI A;  4HAY B;  4EJN A;  1ZC4 B;  1P3R A;  3A4S C;  5JHB A;  4MJS A;  4KHB B;  1P0R A;  3V60 A;  4EMO A;  3AU4 A;  2DZM A;  2A4Z A;  3WAN A;  2DHJ A;  3VTV A;  3PRM B;  3VUY A;  3ZTD A;  4PYZ A;  2N23 A;  2RGF A;  5KHO A;  2ROV A;  4HAT B;  2LGY A;  1SE9 A;  2REX A;  3DPD A;  3UGB B;  1WG7 A;  2RPQ A;  1IRS A;  2K8C A;  2D9Z A;  3DBL I;  5DI9 B;  4F8C B;  2KO3 A;  2KD0 A;  2AL3 A;  2DA0 A;  5D6J B;  2BGF A;  2KK8 A;  2KQS A;  4TUU A;  2ADZ A;  3L13 A;  1KI1 B;  1ZC3 B;  3SO6 A;  3QBV B;  3PHX B;  2ASQ A;  2C7N B;  4A3O A;  1D3Z A;  3KVF B;  1RJ2 A;  1V5U A;  2K8B A;  2MX2 A;  2LRW A;  2ZPY A;  4HB3 B;  2XK5 B;  3V62 A;  3SNH A;  1MK9 B;  2MFQ A;  2JWZ A;  4KHO A;  2BKR B;  5C1Z A;  2ZCB A;  4TQ0 A;  3I3T B;  4F7G A;  2KMA A;  3ZUN A;  1V5T A;  1OEY J;  2NBW B;  3LJ3 A;  2MCN B;  4BKS D;  5G55 A;  4GDL A;  3PZD A;  2I5F A;  3GZN I;  2YSZ A;  1WFY A;  1TQZ A;  3RD2 A;  1QC6 A;  3PRZ A;  2M14 A;  2VRR B;  4YON A;  3VQI A;  1U2B A;  1WZ3 A;  1TGZ B;  1I7A A;  1ZGU B;  4MM3 A;  2BYF A;  5D94 A;  1P6S A;  3VH3 B;  1WVH A;  1KM7 A;  3BY4 B;  4HK2 A;  1Z5S B;  3P7Z A;  1P3Q U;  1WXA A;  4HB4 B;  4BFR A;  4PS7 A;  3F5R A;  1UPR A;  3T9L A;  4NQK E;  2IFS A;  4HVB A;  3A4R A;  3TIX A;  1Q0W B;  4LDT D;  1WJ1 A;  4IM3 A;  2JY6 A;  2D9X A;  1GC7 A;  3ML8 A;  1X05 A;  2DEN B;  4GU2 A;  2YS3 A;  3MPX A;  1AQC A;  1WMH A;  3N32 A;  2MSE D;  3PT2 B;  3KYD D;  4M8N A;  1NI2 A;  1V89 A;  2XQN M;  2R2O A;  1ZVR A;  2KKC A;  3IFW B;  2L76 A;  4F1S A;  4D0N B;  2Z0O A;  2DHK A;  4KHA A;  2M4N A;  2V76 A;  3B0A A;  3ODW A;  2JZ3 B;  4GZU A;  5DPR A;  2B3A A;  4A20 A;  4HHV A;  1GNU A;  3R3M A;  1M7E A;  2NS5 A;  5J3Y A;  1L2N A;  3H7P A;  1EGX A;  3TVV A;  1MAI A;  2K1F A;  4K7U A;  3OJ4 B;  4MH0 E;  2RLO A;  1WRD B;  5D3V A;  1W1D A;  3KUC B;  3V5W A;  2M38 A;  1WR6 E;  3X23 A;  3EEC A;  5D3X A;  1M94 A;  1WJU A;  1V5P A;  3M1I B;  1S3S G;  1U5D A;  1RFA A;  3MHS D;  3TW1 A;  4BOS C;  2ZNV B;  3R7Q A;  5AZH A;  1DDV A;  2CU1 A;  1V5O A;  2YS1 A;  2D10 A;  2ZZP B;  1WJM A;  2DX5 A;  1TZ1 A;  4MEL A;  4BKT A;  4W9G A;  5J3T A;  1PMS A;  2ZVN A;  2RNR B;  3PS6 A;  3PP2 A;  2L00 B;  4N9F 4;  1FOE A;  3PRP B;  3PV1 A;  4IW0 A;  1FB8 A;  3ZNH B;  2NPT B;  3DBH I;  5AEK B;  3VH4 B;  5GOW B;  1AWE A;  2O6V B;  3K9O B;  4KV2 A;  2DTC A;  3PTF C;  4TKN A;  2XEW A;  4EZL A;  3NY5 A;  1PQS A;  3ZO5 B;  1WGU A;  3QHT A;  5FI0 A;  4IC7 B;  3VUX A;  4FLH A;  4DHZ E;  1V9J A;  4FAD A;  1SIF A;  4II3 B;  1WGQ A;  5CHV C;  4NAW A;  4FA6 A;  3JYU A;  2O2V A;  4KDL B;  3RUL A;  2LD9 A;  1FHO A;  1E90 A;  1RRP B;  4HPL B;  3P2B A;  2COF A;  4W9K A;  3A9K A;  3FM8 C;  1UH6 A;  2I5C A;  3PVU A;  2GBM A;  2N9P C;  3CMM B;  4E3C A;  1I2H A;  1WH3 A;  2BWE S;  1K8R B;  4IWQ A;  3A33 B;  4A3P A;  2BF8 B;  3L0W B;  2FCM A;  2KMC A;  4W9I A;  4GSW A;  4URK A;  1XQQ A;  2P8V A;  2ROZ B;  5D3Y A;  2KTR A;  1IP9 A;  1XD3 B;  4G50 A;  4GIV A;  1MPH A;  5L83 A;  3UQA A;  1FGY A;  4RM8 A;  4C0A A;  2KFK A;  4CYE A;  4BBK A;  5LON B;  3ZTC A;  2Z0E B;  1TTN A;  4JIO U;  2K2J A;  4GDK B;  5C5B A;  2LGD A;  1WI0 A;  1WJN A;  3LDZ E;  2HD5 B;  3UIP B;  2C60 A;  1OY2 A;  3VTW A;  2E2X A;  3CIK A;  2AWT A;  1LXD A;  2MLB A;  5JLJ B;  2BYV E;  1IYF A;  2QKL A;  1EVH A;  4CHK A;  1WX7 A;  2Q13 A;  2N9E B;  3DQV A;  3OLM D;  2DAF A;  4M8M A;  3QC8 B;  5J18 A;  4DHJ B;  2AEH A;  2J0K A;  1E8W A;  1OQY A;  3ONS A;  4K7S A;  3KRW A;  1E7U A;  1XKE A;  1MK7 B;  4DWF A;  4ANX A;  1YIW A;  2KVR A;  3QK0 A;  1YX6 B;  4HXD A;  4I6P A;  2PEA A;  2JRH A;  4IAP A;  2IO2 B;  4ZYN A;  3CXB B;  4JL9 A;  4MJS B;  4AP4 C;  1VCB A;  1U29 A;  1FHW A;  3VOQ A;  2N9X A;  2LG1 A;  3U30 A;  5D27 A;  5J17 A;  4ANV A;  3X0W A;  3ZDM C;  3VIA A;  3ZNI D;  2MW5 A;  4BBN C;  2DYN A;  3VXW A;  3KZ1 A;  2MWS B;  1WGG A;  3MJW A;  4ASW C;  1LFD A;  3ENE A;  2YLM A;  1WE6 A;  2ZCC A;  4HCP B;  3ALB A;  2I1J A;  2UZS A;  1EF5 A;  1N3H A;  1KLV A;  1U4A A;  3ZLZ A;  4BOZ B;  3OAW A;  2LOZ A;  4ZRJ A;  1XOD A;  2MBH A;  2KTF A;  3A8Q A;  1E8Z A;  2ZEQ A;  3JVZ X;  4HAW B;  4Z2N A;  2EJ8 A;  2KDB A;  2LYD A;  2L3Z A;  3D8D A;  2KHW B;  3HQC A;  2KC1 A;  5JHH A;  2DZI A;  2GBJ A;  3DBS A;  2OQB A;  2P0H A;  4PQ0 A;  1WGH A;  1XD4 A;  2WYQ A;  3N7C A;  3RUI B;  4MSM B;  5FI1 A;  2P0D A;  4MDK E;  1UNR A;  2CY5 A;  4GDL B;  5C23 A;  4GN1 A;  2VRW B;  4MK0 A;  4FBJ B;  2KJH B;  2DN6 A;  1XT9 B;  4G11 A;  3KH0 A;  3U8Z A;  3ZDT A;  5JZE B;  3DVN V;  2K2U A;  2GMI C;  3WYF B;  3WAM A;  1NDD A;  1XX0 A;  1KZ7 A;  4K7W A;  3NHE B;  5DPT A;  1BTK A;  3NS8 A;  3G9W A;  1B55 A;  3GYO A;  1OQN A;  3PG7 A;  3IVF A;  5HE0 A;  3DDC B;  3ZW3 A;  3PPA A;  4A6F A;  3AUL A;  5DPS A;  2QHO A;  2KDI A;  3UQB A;  3VVW B;  2GJY A;  5C6R A;  4WWP A;  1QQG A;  1R4M I;  4IM2 A;  5JHA A;  4X57 B;  3T8M A;  1H4R A;  2Z0P A;  4F7H A;  1WGR A;  1L7Y A;  4DBG A;  2MA9 B;  5J3Q A;  1WI1 A;  3SD5 A;  2KX3 A;  1E5W A;  5D2M B;  1V80 A;  3M95 A;  1WXV A;  2R2Q A;  4HAV B;  4XZ4 A;  4A5K A;  2JPH A;  1ISN A;  4BKS A;  1YJ1 A;  1WX8 A;  1OGW A;  1V6E A;  3TL5 A;  2DLW A;  1NTY A;  3L17 A;  3QIJ A;  3KRX A;  2G45 B;  2IY0 B;  3WAO A;  5C16 A;  1EUV B;  2COC A;  2N1W A;  2COD A;  3D32 A;  3ECI A;  3L54 A;  2KLG A;  2GCL A;  2D11 A;  2C5L C;  2NBV B;  3O96 A;  5E6P A;  4RM9 A;  4B95 A;  4W9L A;  3H7P B;  3W1Y A;  1UEL A;  2KUP A;  3QCA A;  4WAA A;  4EEW A;  4DDG D;  2N0Y A;  3IG3 A;  2L2I A;  2VKI A;  2Z59 B;  3CSF A;  1X1M A;  3VHT C;  4M0W B;  1U5G A;  2NZ8 B;  3RZW C;  2ZNV C;  1WGD A;  4RMA A;  3V6E B;  2V1Y A;  1WM3 A;  2OTX A;  1SHC A;  2W2X C;  3SDL C;  5CTR C;  4IM0 A;  5CLL B;  1U5E A;  2A5U A;  2DYQ A;  2RUK B;  3WA0 A;  3FSS A;  2LJ5 A;  2DX5 B;  1W1G A;  4OVV A;  1V86 A;  2GBN A;  2RSG A;  1XR0 B;  2LVO A;  2J59 M;  3SU8 X;  2WX0 A;  5HKH A;  2HTH A;  3K9P B;  3N3K B;  2KWC A;  2N4F A;  1IPG A;  4W9E A;  4HDO A;  3VFK A;  2ELB A;  3PSC A;  2CRF A;  4HCN B;  3D8E A;  2GCJ A;  1R4N I;  4WJN A;  1BT0 A;  4NPN A;  2D3G A;  2LUL A;  2PZ1 A;  4NAW B;  2JF5 A;  4P7I A;  3PLU A;  3C0R B;  3KW5 B;  3APF A;  3PSE B;  2O2V B;  3ML9 A;  1UZX B;  1EO6 A;  1H10 A;  3KYC D;  4ZDV A;  3QWM A;  2NBU A;  2G3Q B;  2N7E A;  1DBH A;  4MY6 A;  4WSF A;  5LXI B;  2NVU I;  2WDT B;  5LOP B;  2YT0 A;  2ZJD A;  3A1Q A;  4K2O A;  3GYP A;  2KZR A;  2KOX A;  5HE2 A;  2LKO A;  5G2N A;  3JW0 X;  3BIN A;  4MT7 A;  1WJ6 A;  5FR6 A;  1GUA B;  5JP4 A;  2CY4 A;  2KTR B;  3DVG Y;  3JSV A;  3PLV A;  1UEF A;  3T06 A;  4B6H A;  3GOE A;  4YL8 A;  2KFK B;  5KCV A;  1U5F A;  5DH9 B;  1P98 A;  2J0M A;  1FXT B;  1FAO A;  3UZT A;  5C5B B;  4HAZ B;  1RLF A;  4LJP B;  2L7R A;  2BKF A;  2KCJ A;  3W1S C;  3SV1 A;  2KFJ A;  4IWP A;  2YT1 A;  2L0F A;  2CKH B;  3L16 A;  4DHZ B;  2IYD B;  4FUL A;  2JUO A;  1GG3 A;  5C79 A;  3UIN B;  1XCG A;  2W2X D;  2M17 A;  4KVG B;  1H8C A;  4KIK B;  4TQ1 A;  1WR1 A;  3L08 A;  2MBE A;  1NU2 A;  2J0J A;  2K25 A;  2O6V D;  3ZNZ B;  4B9K A;  4KZ0 A;  1Y5O A;  4OVU A;  1UNQ A;  3H6N A;  2EMS A;  4NJ6 A;  1DRO A;  3S2A A;  2UZR A;  1JRU A;  1DYN A;  2LGX A;  2FCQ A;  4L6E A;  3EFU A;  4I6N B;  4K17 A;  2DKP A;  2R0D A;  3DXC A;  2K6Q A;  3NZU A;  2YRY A;  3RZF A;  2KN5 A;  4NNJ B;  3A8P A;  3RCZ A;  4DXA B;  3A9J A;  1WXS A;  4TYZ A;  1YD8 U;  3O65 B;  2FAZ A;  5CX3 A;  3F0W A;  1PLS A;  3MTN B;  4MGK E;  2HJ8 A;  3DVN U;  2UYZ B;  2KNB A;  2RVB B;  4EZK A;  1LM8 B;  2LWP A;  4FJV B;  2DAJ A;  4KAX B;  2BPS A;  3N30 A;  2IY1 B;  2OJR A;  2GOW A;  3ZVV A;  2Z0D B;  1OTR B;  4PNK A;  1Y19 B;  1EF1 A;  4ZRK A;  4DX8 A;  3B08 A;  2KAN A;  4WWN A;  5CLQ B;  4HDQ A;  2MWN B;  3CST A;  4NSW A;  2DHZ A;  1I42 A;  5HE3 A;  3PRE A;  3VAW A;  1YQB A;  3DOW A;  1KZG A;  2AYO B;  1UNP A;  1UPQ A;  1ZM0 A;  1E8Y A;  3WAL A;  2MBQ A;  2LOX A;  1RAX A;  1K5G B;  4BBN F;  3TMP B;  1BAK A;  3ZIM A;  3FEH A;  3QWZ B;  3OAN A;  2M8S A;  1ZW7 A;  1A5R A;  1KJT A;  1LQB A;  3DXD A;  2PPH A;  2KQ7 A;  4E71 A;  3AU5 A;  4A6F B;  2HE7 A;  4DHJ D;  4DBB A;  4WQO B;  2G35 A;  5EDS A;  1E7V A;  4GMX B;  4HB2 B;  5IA7 A;  1J19 A;  4DK5 A;  3M62 B;  3B1L X;  2PE6 B;  2G4D B;  1X1F A;  4G0N B;  3PVL A;  3VUW A;  4JQW C;  5DPW A;  5KQ4 A;  1DDW A;  2MP2 A;  4LCD E;  1V88 A;  3DBR I;  2ZPN A;  1WYW B;  2JP2 A;  4W9J A;  1ZSQ A;  3LJU X;  1Z2M A;  2FNJ B;  2YS5 A;  2I1K A;  3D8F A;  4KSK C;  1E8X A;  2YVC A;  3DVG X;  4DDI D;  3ULC A;  2FIF A;  2LZ6 A;  3NSU A;  2W9N A;  1V61 A;  4GMV A;  3APC A;  4FN2 A;  5IAA C;  1K5D B;  1OMW A;  4JGH B;  4HLE A;  3PVW A;  3V61 A;  1J0W A;  3SHQ A;  4WVF B;  5KQ1 A;  4HAU B;  1OEY A;  4GB9 A;  3AXC A;  4LDT B;  3KUZ A;  2DYB A;  5L81 A;  2RSU A;  4Z2M B;  5TR5 A;  2KJ6 A;  2LRU A;  4HPM B;  3RT3 B;  2L8J A;  2AL6 A;  1KOT A;  2M1M A;  1WMH B;  2MKR A;  3WAP A;  1NBF C;  2DZK A;  2M0X A;  3SYX A;  4G3X B;  5CHF A;  2K39 A;  4H8S A;  2EKE C;  1RRB A;  1WF9 A;  5DCN A;  4AOF A;  3ML4 A;  2COA A;  4F7U P;  4WJP A;  2JT4 B;  4XX5 A;  3QX1 A;  4EZJ A;  3EC8 A;  3QA8 A;  3BJI A;  2HTH B;  1AAR A;  4NQL B;  1P5T A;  3VDZ A;  2NMB A;  3R7R A;  3IBE A;  1TJ6 A;  4JLC A;  1J0G A;  3TFM A;  3OJ3 A;  5AZF A;  1WXM A;  5JHG A;  3HK0 A;  4ANU A;  1W1H A;  3P6A A;  5AZG A;  2MQJ A;  4CHM A;  4A6K A;  2WWZ A;  1GJZ A;  1WY8 A;  2KWV B;  4A6H A;  4K81 A;  4IWO A;  2LVQ A;  1S1Q B;  3ZRF A;  1NTV A;  2K00 A;  1Q1O A;  4WJQ A;  3NOB A;  2D9Y A;  2XK5 A;  2K8H A;  2GBK A;  3UF8 A;  3QAQ A;  2UWQ A;  5DHF B;  3EHV A;  2YF0 A;  1GC6 A;  4W9F A;  1WX9 A;  5GMV A;  2JZZ A;  2KDF B;  2LUE A;  4NY0 A;  2D07 B;  4MGZ E;  1Z87 A;  5L95 C;  3HHM A;  1FHX A;  1Q67 A;  1UGM A;  2D2Q A;  2IYB A;  1P1A A;  2G4S A;  2C7H A;  2KGX B;  2LI5 A;  2NCN A;  4FJZ A;  1MG8 A;  3A1Q B;  2GS0 A;  3V6C B;  4W9H A;  1V5M A;  1WJ4 A;  3ZKJ C;  3DXE A;  1DDM A;  3TJP A;  2MDX A;  2KJR A;  1FGZ A;  2KXJ A;  2MBO A;  1T0Y A;  3JSV B;  4J6I A;  3M3J A;  2L0T A;  2GBR A;  3VTU A;  4AWJ A;  2D4Q A;  3QAR A;  1UD7 A;  2H7E A;  2CHW A;  4PS8 A;  3H7S A;  4AUQ C;  2R09 A;  1LB1 A;  5E6O A;  2V3S A;  1MIZ B;  3KSY A;  4BKG A;  3ULB A;  1PFJ A;  5D3W A;  3A9K B;  1F9J A;  3ZVR A;  3IHP C;  2VSZ A;  4EUT A;  4E74 A;  2D9W A;  3TBL D;  2KC2 A;  4B6W A;  4HWI B;  3SUZ A;  1G6J A;  2QKM A;  4CO7 A;  2IZV B;  4DX9 0;  2LXA A;  2DX1 A;  4K2P A;  2D9V A;  4PS3 A;  3DCG A;  2MBB B;  5LLI A;  1MIX A;  1ZKH A;  2RGN B;  3Q3F A;  4AJY B;  3A98 B;  3ODX A;  2CR5 A;  4KSL C;  4EKU A;  3ODO A;  3M63 B;  3HW2 B;  3NZS A;  3HM3 A;  2FUH B;  3HIZ A;  3Q3J A;  1TXD A;  4II2 B;  2J7Q B;  3APD A;  5D7G A;  2IO0 B; 
#chains in the Genus database with same CATH topology
 4HJK A;  4MGY E;  1WGY A;  3HM6 X;  2ZVO A;  3U7D A;  2HDE A;  4HPP A;  1MKE A;  4GLS C;  4P6V F;  2FJL A;  2DYO A;  2JVC A;  1I35 A;  1SXT A;  4L1B A;  2Y8G A;  1V2Y A;  3A9J B;  1I4R A;  4W9D A;  4WJO A;  1F1H A;  1VJK A;  1EWY C;  1F52 A;  2DYM A;  1UNS A;  2ZW0 A;  3MDB C;  1C4C A;  4XWX A;  1UBI A;  2JQR B;  2LAS A;  5JH5 C;  4ICU A;  5J2R A;  2Y5P A;  4K1R B;  4IG7 B;  4KZC A;  3A58 A;  2Z0Q A;  1V1O A;  4TV3 A;  3AE1 B;  1WZ0 A;  1BWN A;  2KR0 A;  3H9D A;  3TCA A;  4YTN B;  2NPT A;  4L2Y A;  5LXH A;  2OOB B;  1Q5W B;  2N9L A;  1U27 A;  3AI5 A;  4GPT B;  5H8Y E;  2O6V A;  3EA6 A;  5FK9 C;  2KX0 A;  3WIM A;  3W9C B;  1QZE A;  4BVU C;  2IBI B;  1KLU D;  2AX5 A;  1SGH A;  4GGQ A;  2DLB A;  1TYG B;  2Z8L A;  5BYR A;  2JZP A;  2BWF A;  4NJ7 A;  4IFS A;  2CS4 A;  4ZHP A;  1Y8R C;  2JXX A;  2LVP A;  2K8E A;  2EC1 A;  4YTP B;  2KWU B;  3J9C A;  5E6N A;  2X18 A;  4XC2 A;  1J7A A;  2V3N A;  5HE1 A;  2BCJ A;  1V81 A;  3IT4 B;  1QOB A;  1KRH A;  4CHJ A;  2IO3 B;  2YEP B;  2PLP A;  4EOY A;  2FID A;  1WM2 A;  4WJ7 A;  3CF6 E;  2KMM A;  1CJE A;  2IO1 B;  5BO4 B;  2FCS A;  1C3T A;  4W9C A;  1J8C A;  1QOG A;  1LW3 A;  2DKQ A;  4HAX B;  3AJ4 A;  2JXT A;  1CMX B;  2WU5 B;  2SEB D;  3H1U A;  4IUM B;  4ZRI A;  1C4A A;  1M7R A;  1EAZ A;  4K3B A;  2XNA C;  4ICV A;  2EMT A;  4RGO S;  2H7D A;  4EFO A;  5DHA B;  1ZUD 2;  1FMA D;  1VD2 A;  1P9D U;  2L05 A;  3VRB B;  4GXB A;  1LO5 D;  2L32 A;  4IOY X;  1C76 A;  3ZNG C;  1N63 A;  1KTK A;  4KIK A;  3FVC A;  2WNM A;  1HZ6 A;  1X11 A;  2RD0 A;  4Q2J A;  2Y8F A;  1L4D B;  3DWM A;  2VH1 A;  5LNK 1;  3N9Y C;  2N1V A;  3L10 B;  1V49 A;  3RFZ B;  2GI9 A;  1X1G A;  2UVM A;  2ELA A;  1KFY B;  4GOC A;  2K6D B;  4PYU A;  5IOI A;  2DFK A;  2C9W B;  1X86 A;  1TBE A;  4HB0 B;  3BK1 A;  3ZRC A;  2MP2 B;  1E9M A;  1IGC A;  3AEE B;  3UIO B;  3RCP A;  4YSY B;  2KDE B;  1VLB A;  4OVZ A;  2PJH A;  4MSQ B;  4FHK A;  3HSA A;  1JWB D;  2LXC A;  4GDK A;  2V4L A;  4KDI C;  4FJY A;  4Y94 A;  5EFX A;  3KY9 A;  1VZ8 A;  1SEB D;  1WIA A;  4WIP A;  2KUQ A;  3RYT A;  3EFC A;  3PZ8 A;  2PE9 A;  3PHW B;  3MFG A;  4FHJ A;  3NW8 A;  2BVC A;  1NEN B;  2CHX A;  4MGI E;  2P0F A;  4I6L B;  2CAY A;  1UGJ A;  1BTN A;  1E0Z A;  2L1C A;  3AM9 A;  2SAK A;  2CHZ A;  3W1S A;  4MEM A;  1HXY D;  1ZOY B;  4WWO A;  2WP9 B;  5DIF B;  2MRP A;  3R66 C;  3KUD B;  4CQN A;  2G1E A;  4AJW A;  2XBB C;  2JRI B;  2FCN A;  1EWC A;  5KHQ A;  3PGE A;  3QJZ A;  4ANW A;  1HE8 A;  2INN E;  2BYE A;  3IAM 1;  2C7M B;  3QQ8 B;  3PEG A;  4LJO B;  2LJI A;  1FRR A;  2Y5B B;  4F7Z A;  1JCK B;  2L83 A;  1UBQ A;  2WX1 A;  2RR9 A;  3NVY A;  1TKE A;  2Z4D A;  3TO1 A;  1YX5 B;  5CHW A;  2NR2 A;  2N7D A;  2KLC A;  4FXC A;  5LG4 B;  2LHE A;  3BVZ A;  5G5H A;  4HJG E;  1C1Y B;  2Y7B A;  2DZJ A;  1C4P A;  2W2W A;  4XDC A;  1WE7 A;  2DHI A;  4HAY B;  4EJN A;  1ZC4 B;  1P3R A;  3A4S C;  5JHB A;  4MJS A;  3IAS 1;  4OZA A;  1R7S A;  4KHB B;  1P0R A;  3V60 A;  4EMO A;  3FKY A;  1E7P B;  3AU4 A;  2DZM A;  2L1A A;  2A4Z A;  3AEB B;  4P16 A;  3WAN A;  1UF0 A;  3KWL A;  2DHJ A;  3VTV A;  3PRM B;  3VUY A;  3EGR A;  3ZTD A;  4PYZ A;  3AEF B;  2N23 A;  2HJ1 A;  2RGF A;  5KHO A;  2ROV A;  4HAT B;  2LGY A;  1SE9 A;  2REX A;  3DPD A;  1ZXI A;  3UGB B;  3BZD B;  1WG7 A;  2RPQ A;  4P1B C;  4JE3 B;  1IRS A;  2K8C A;  2D9Z A;  4N6E B;  3DBL I;  5G5G A;  5DI9 B;  1NVI D;  2G9H D;  4F8C B;  2KO3 A;  2KD0 A;  1UUP A;  2AL3 A;  2DA0 A;  5D6J B;  2BGF A;  1MI1 A;  2KK8 A;  2KQS A;  2EEL A;  4TUU A;  4LNO A;  2ADZ A;  3L13 A;  1WYG A;  3T3O A;  1KI1 B;  1L0Y B;  1ZC3 B;  3SO6 A;  3QBV B;  3PHX B;  2LGS A;  2ASQ A;  3U4E G;  2C7N B;  1FCL A;  3B9J A;  4A3O A;  5AUK A;  1SB3 C;  1D3Z A;  4YT0 B;  3KVF B;  1RJ2 A;  1V5U A;  2K8B A;  2MX2 A;  3RPF C;  2LRW A;  2ZPY A;  4HB3 B;  2XK5 B;  1YMH E;  3V62 A;  3SNH A;  1MK9 B;  2MFQ A;  2JWZ A;  4KHO A;  4LK0 M;  2BKR B;  3L4P A;  5C1Z A;  2ZCB A;  4TQ0 A;  3I3T B;  4F7G A;  2KMA A;  3ZUN A;  2PIA A;  1V5T A;  2WXM A;  1PGA A;  1OEY J;  2NBW B;  2LEK A;  3LJ3 A;  2MCN B;  3I5J C;  4XE0 A;  5HI1 A;  4BKS D;  5G55 A;  4GDL A;  2QDF A;  3PZD A;  1J7C A;  2I5F A;  3GZN I;  4C4V B;  2YSZ A;  1WFY A;  2RDH A;  1TQZ A;  3RD2 A;  1QC6 A;  3PRZ A;  2M14 A;  2VRR B;  4YON A;  2KDM A;  3VQI A;  1FFU A;  1U2B A;  1WZ3 A;  1TGZ B;  1I7A A;  1ZGU B;  3AED B;  4MM3 A;  2BYF A;  5D94 A;  2D3A A;  1ZYI A;  1P6S A;  3VH3 B;  1WVH A;  5C3J B;  1KM7 A;  3BY4 B;  2FUG 1;  1Z5S B;  4HK2 A;  3P7Z A;  1P3Q U;  3NRZ A;  4ARC A;  2ZW1 A;  1FXA A;  2VZK D;  2GB1 A;  4HRO A;  1WXA A;  4HB4 B;  4BFR A;  3ZQ4 A;  4PS7 A;  3F5R A;  1UPR A;  3PO0 A;  3T9L A;  4NQK E;  2IFS A;  4HVB A;  1XLQ A;  3A4R A;  3TIX A;  1Q0W B;  3RNF C;  4LDT D;  1WJ1 A;  1F2R C;  1AW7 A;  1QOA A;  4IM3 A;  1FNW A;  2JY6 A;  3U7Z A;  2D9X A;  1GC7 A;  4WWM A;  3ML8 A;  1OQR A;  1X05 A;  1D6E C;  3U12 A;  2DEN B;  4GU2 A;  2YS3 A;  1ENF A;  3MPX A;  1AQC A;  4M01 A;  4ZRP A;  3DHH C;  2WXG A;  1WMH A;  4KGT A;  3N32 A;  2MSE D;  3PT2 B;  2Z13 A;  4OT1 A;  3KYD D;  4M8N A;  1NI2 A;  1V89 A;  3SFE B;  4OHJ A;  2H89 B;  2XQN M;  2MHJ A;  2R2O A;  3U52 E;  1HA5 A;  1ZVR A;  1C77 A;  2AQ1 B;  2KKC A;  3IFW B;  2L76 A;  4HKQ A;  4F1S A;  4D0N B;  1I4P A;  2Z0O A;  2DHK A;  4KHA A;  3AB5 A;  1FXI A;  2M4N A;  2V76 A;  3B0A A;  3ODW A;  3IXS A;  2JZ3 B;  4GZU A;  4HKZ E;  5DPR A;  2B3A A;  4A20 A;  1JW9 D;  4HHV A;  1GNU A;  1SE4 A;  3R3M A;  1M7E A;  2NS5 A;  5J3Y A;  1JQ4 A;  2V3P A;  1L2N A;  1N62 A;  3H7P A;  1EGX A;  3DBR B;  3FC4 A;  1T77 A;  4JX1 C;  3TVV A;  1L6V A;  4BAX A;  1MAI A;  3EUB 2;  2K1F A;  3VR8 B;  4K7U A;  3OJ4 B;  4MH0 E;  2RLO A;  1C78 A;  1WRD B;  2Z59 A;  5D3V A;  1W1D A;  3KUC B;  1NI3 A;  4M0W A;  3V5W A;  2M38 A;  1WR6 E;  3ETR A;  3X23 A;  3EEC A;  5D3X A;  1M94 A;  5M4Y B;  3Q8F A;  1WJU A;  1ZXH A;  1V5P A;  3M1I B;  1S3S G;  1U5D A;  1JWM D;  1RFA A;  3MHS D;  1XLP A;  3TW1 A;  3DBL B;  1SF0 A;  4BOS C;  2ZNV B;  3R7Q A;  5AZH A;  2L52 A;  1ET9 A;  1DDV A;  2CU1 A;  1V5O A;  2YS1 A;  2KYW A;  2D10 A;  2ZZP B;  1WJM A;  2DX5 A;  1TZ1 A;  4MEL A;  4BKT A;  4W9G A;  5J3T A;  1PMS A;  2ZVN A;  2RNR B;  1SBB B;  3DWG C;  3PS6 A;  3PP2 A;  2L00 B;  4N9F 4;  1FOE A;  3PRP B;  3PV1 A;  4IW0 A;  1FB8 A;  3ZNH B;  2NPT B;  5IP4 D;  1V1P A;  2D3C A;  2ONQ A;  3DBH I;  5AEK B;  3VH4 B;  5GOW B;  2BS2 B;  2HTM E;  1AWE A;  2PVG C;  2IDY A;  2O6V B;  3K9O B;  4KV2 A;  2DTC A;  1ZDX A;  3PTF C;  4TKN A;  3RNA C;  2XEW A;  4EZL A;  1K53 A;  3NY5 A;  1PQS A;  3ZO5 B;  1WGU A;  4WAF A;  3QHT A;  5FI0 A;  3GP7 A;  4IC7 B;  2NMQ A;  3VUX A;  3AEA B;  4FLH A;  4DHZ E;  1C9F A;  1V9J A;  2IPK D;  4FAD A;  1SIF A;  1JWS D;  3GZN B;  2N0S B;  4II3 B;  1WGQ A;  1T3Q A;  5CHV C;  4NAW A;  3V05 A;  2E6X A;  1RM6 C;  4FA6 A;  3JYU A;  2I38 A;  3BII D;  1FO4 A;  2MJD A;  2O2V A;  4KDL B;  1BXT A;  4M00 A;  2LD9 A;  3RUL A;  4XGA B;  1FHO A;  3R8B A;  1E90 A;  3B2G A;  4MT5 A;  1RRP B;  5HFY A;  4HPL B;  3P2B A;  2COF A;  3NG0 A;  4W9K A;  3A9K A;  3FM8 C;  1UH6 A;  1A70 A;  2J42 A;  2I5C A;  3PVU A;  2GBM A;  2LHD A;  4RFB A;  5HG2 A;  2DWQ A;  2N9P C;  1T0Q C;  3CMM B;  4RF0 A;  4E3C A;  1I2H A;  3NWA A;  1WH3 A;  3RNG C;  2BWE S;  1K8R B;  4IWQ A;  1MJD A;  3A33 B;  4A3P A;  2BF8 B;  2WDR B;  3L0W B;  5JXV A;  2FCM A;  4XYC A;  2KMC A;  4W9I A;  4GSW A;  4LNN A;  4URK A;  1XQQ A;  2P8V A;  2ROZ B;  5D3Y A;  1P7E A;  1YQ3 B;  2KTR A;  1YN3 A;  3P1M A;  1IP9 A;  1L0X B;  1XD3 B;  4G50 A;  4GIV A;  1MPH A;  5L83 A;  3IT6 B;  3N1Y C;  3AE8 B;  3RNC C;  1F0Z A;  3UQA A;  1FGY A;  3AEG B;  1N5X A;  4C0A A;  2KFK A;  3DHI C;  4RM8 A;  1T5X D;  4CYE A;  4BBK A;  5LON B;  3ZTC A;  3V3X A;  1KLG D;  2Z0E B;  1TTN A;  4JIO U;  2K2J A;  4GDK B;  5C5B A;  2BW2 A;  2LGD A;  2WS3 B;  1MG4 A;  3ABV B;  1WI0 A;  1WJN A;  3LDZ E;  2HD5 B;  2J4X A;  3UIP B;  2C60 A;  1TIF A;  1OY2 A;  3VTW A;  2E2X A;  3CIK A;  2AWT A;  4ARI A;  1LXD A;  2IJ0 A;  2MLB A;  5JLJ B;  2BYV E;  3FIL B;  4LNK A;  1IYF A;  3HIE A;  2QKL A;  2V4I B;  1EVH A;  2J53 A;  4CHK A;  1VZ6 A;  1WX7 A;  1TZO A;  1DOI A;  2Q13 A;  4XWT A;  3AEC B;  2N9E B;  1TJE A;  1QLB B;  1CZP A;  2DAF A;  3DQV A;  3OLM D;  3QC8 B;  4M8M A;  4YSX B;  5J18 A;  2WXN A;  4DHJ B;  1FNU A;  1GPX A;  2AEH A;  5BMH A;  3P63 A;  2J0K A;  3AE6 B;  1E8W A;  1OQY A;  1ZP0 B;  1YQ4 B;  3ONS A;  1ET6 A;  2R2Y A;  1QT9 A;  4K7S A;  5HHD G;  1IBX A;  3Q3O C;  1MHX A;  1XCT L;  3KRW A;  3DCX A;  2K9X A;  1E7U A;  2QIL A;  1XKE A;  5T8I A;  1MK7 B;  4DWF A;  2DBY A;  3W5U B;  1YIW A;  2KVR A;  3QK0 A;  4ANX A;  1YX6 B;  4HXD A;  3P4S B;  4US9 A;  2PW9 A;  4I6P A;  4DQO C;  4A8X C;  2PEA A;  2JRH A;  4IAP A;  2IO2 B;  4ZYN A;  3CXB B;  4JL9 A;  4MJS B;  5C2T B;  4AP4 C;  3FAH A;  4RCO A;  1VCB A;  4IDI A;  4YTM B;  1U29 A;  1FHW A;  3VOQ A;  1Q10 A;  3ZGZ A;  2N9X A;  3GS2 A;  1L6U A;  4P1C C;  2LG1 A;  3U30 A;  5D27 A;  5J17 A;  4ANV A;  3X0W A;  4KKJ A;  3AN1 A;  1ZE3 D;  4RGN A;  3ZDM C;  3VIA A;  2IGD A;  3LB8 C;  3ZNI D;  2MW5 A;  4BBN C;  3DBH B;  2DYN A;  3VXW A;  2ON8 A;  3KZ1 A;  2MWS B;  2RRF A;  1IGD A;  1WGG A;  3Q3M C;  1QIL A;  3MJW A;  4ASW C;  3P4R B;  1LFD A;  3ENE A;  3RN9 C;  3ZJU A;  2YLM A;  1WE6 A;  2ZCC A;  4HCP B;  3ALB A;  2I1J A;  2UZS A;  1EF5 A;  1N3H A;  1KLV A;  1U4A A;  3SFD B;  3TEY A;  3ZLZ A;  4BOZ B;  3OAW A;  2LOZ A;  4O1N A;  4ZRJ A;  4QJ5 B;  1XOD A;  2MBH A;  5BMG A;  2KTF A;  3A8Q A;  1E8Z A;  2JYT A;  2ZEQ A;  3JVZ X;  4HAW B;  4WH4 A;  4Z2N A;  2EJ8 A;  2KDB A;  2MJ3 A;  2LYD A;  2L3Z A;  3D8D A;  2KHW B;  3HQC A;  1N5W A;  2KC1 A;  5JHH A;  2DZI A;  2GBJ A;  3DBS A;  2KIE A;  2OQB A;  1MI0 A;  2P0H A;  4PQ0 A;  2RDG A;  1WGH A;  4OZB A;  1XD4 A;  4B0E A;  4ZOH C;  2WYQ A;  1L4Z B;  3N7C A;  3RUI B;  2KAJ A;  4MSM B;  1PUT A;  5FI1 A;  2P0D A;  2PMV A;  1MHH E;  3I57 A;  4MDK E;  1ROE A;  3MJ5 A;  1UNR A;  2CY5 A;  1GB1 A;  2K22 A;  4GDL B;  5C23 A;  4GN1 A;  2VRW B;  4C00 A;  4MK0 A;  4FBJ B;  2KJH B;  2DN6 A;  1XT9 B;  1RYJ A;  4G11 A;  3KH0 A;  1FD6 A;  3U8Z A;  5I2S A;  3ZDT A;  2LMC A;  2BBC A;  5JZE B;  3DVN V;  2K2U A;  2IGH A;  3TEX A;  2GMI C;  3WYF B;  4MM3 B;  3WAM A;  1NDD A;  1XX0 A;  1KZ7 A;  4K7W A;  3NHE B;  3OHM B;  5DPT A;  2FJU B;  1BTK A;  3NS8 A;  4A90 A;  3G9W A;  1B55 A;  3URY A;  3GYO A;  1OQN A;  4ZYS A;  3PG7 A;  3IVF A;  2Z14 A;  4RF1 A;  5HE0 A;  3DDC B;  3ZW3 A;  3PPA A;  1AYF A;  4A6F A;  3AUL A;  5DPS A;  2QHO A;  2WQY B;  1HEZ E;  1YNT E;  2KDI A;  3UQB A;  2K0P A;  3VVW B;  2GJY A;  5C6R A;  2K5P A;  4WWP A;  1QQG A;  1R4M I;  1DOX A;  4IM2 A;  5JHA A;  4X57 B;  1IUE A;  1D4B A;  3N1X C;  3T8M A;  3GE3 C;  1H4R A;  2MH7 A;  2Z0P A;  4F7H A;  2KIG A;  1WGR A;  1L7Y A;  4DBG A;  3MC9 A;  2MA9 B;  3TSS A;  3Q8A A;  5J3Q A;  1WI1 A;  3SD5 A;  2KX3 A;  5E6J A;  1E5W A;  5D2M B;  1V80 A;  3M95 A;  3RI7 C;  1WXV A;  2R2Q A;  4HAV B;  4XZ4 A;  4A5K A;  2JPH A;  1ISN A;  4BKS A;  1YJ1 A;  1T0R C;  1WX8 A;  3HRD D;  1OGW A;  1V6E A;  2WXJ A;  3TL5 A;  2DLW A;  1NTY A;  3L17 A;  1P7F A;  4PK1 A;  3QIJ A;  3KRX A;  2G45 B;  4JWU C;  1TS5 A;  2QCZ A;  2YT2 A;  2IY0 B;  3WAO A;  5C16 A;  1EUV B;  3AE4 B;  2V9H A;  2COC A;  5BYS A;  4KX6 B;  4LNI A;  2N1W A;  2WHI A;  2COD A;  3C19 A;  3D32 A;  4QXA B;  3ECI A;  1I4X A;  3L54 A;  2KLG A;  3R2I A;  2GCL A;  1M4V A;  1YOV B;  2D11 A;  2C5L C;  1JWA D;  2NBV B;  1XEE A;  2QIE B;  3O96 A;  5E6P A;  4RM9 A;  4B95 A;  3R2T A;  4NZL B;  4W9L A;  3H7P B;  2DNF A;  4KKI A;  2BTE A;  3MP9 A;  2MJE A;  4A55 A;  1J7B A;  3W1Y A;  1UEL A;  2KUP A;  3QCA A;  2KAC A;  4WAA A;  4EEW A;  4DDG D;  2N0Y A;  3IG3 A;  2KN4 A;  2L2I A;  2W3S A;  2VKI A;  1WSP A;  2OED A;  2Z59 B;  3CSF A;  1X1M A;  3VHT C;  4M0W B;  4C7Z A;  1U5G A;  2NZ8 B;  3RZW C;  2ZNV C;  1WGD A;  2JYE A;  2W55 A;  4RMA A;  2H88 B;  3V6E B;  2V1Y A;  1WM3 A;  2OTX A;  3MC0 B;  1SHC A;  5I4D A;  2Y3A A;  2W2X C;  2QMT A;  3SDL C;  5CTR C;  4IM0 A;  1YJJ A;  5CLL B;  1U5E A;  4HEA 1;  2A5U A;  2DYQ A;  2RUK B;  3GB1 A;  3WA0 A;  3FSS A;  2OHF A;  2LJ5 A;  2DX5 B;  1W1G A;  4OVV A;  1VZ7 A;  2WGS A;  1V86 A;  4C4V A;  5EE9 A;  4J3O D;  2GBN A;  2RSG A;  1XR0 B;  2LVO A;  2J59 M;  3UI3 A;  3B2F A;  3SU8 X;  4B0M A;  1FNV A;  2WX0 A;  3AMZ A;  3BWU D;  2BB6 A;  1I4Q A;  5HKH A;  4S17 A;  1I4G A;  3LYY A;  2HTH A;  4C7Y A;  3K9P B;  5EE0 A;  3N3K B;  5EE3 A;  2KWC A;  2N4F A;  3HVD A;  1IPG A;  4W9E A;  4HDO A;  3VFK A;  2ELB A;  1VR9 A;  3Q8B A;  3PSC A;  3Q8C A;  2BS3 B;  2CRF A;  3TUO A;  4GOU A;  4HCN B;  3D8E A;  2GCJ A;  3Q69 A;  2QC8 A;  4LLG M;  1R4N I;  1L5P A;  4WJN A;  1TKY A;  1BT0 A;  4NPN A;  2D3G A;  2LUL A;  2JWU A;  1MPE A;  1EM7 A;  2WXK A;  3P4P B;  1FRD A;  5IKC M;  2PZ1 A;  4NAW B;  2JF5 A;  3MHZ A;  3NJT A;  4DIX A;  4KGS A;  4P7I A;  2M19 A;  1XCQ L;  3PLU A;  3C0R B;  4JPS A;  3KW5 B;  3APF A;  2OJW A;  3PSE B;  2BT6 A;  2O2V B;  3ML9 A;  5IRS A;  3HVZ A;  1HTQ A;  1UZX B;  1EO6 A;  1H10 A;  2LUM A;  3KYC D;  1C79 A;  4ZDV A;  3QWM A;  3NUH B;  2NBU A;  1WWT A;  2G3Q B;  2N7E A;  1DBH A;  4MY6 A;  4WSF A;  3W2D A;  5LXI B;  1RFK A;  2NVU I;  2WDT B;  2KT7 A;  3NVZ A;  5GXG B;  5LOP B;  2V0G A;  2BYT A;  2YT0 A;  2ZJD A;  3A1Q A;  4K2O A;  1CQV A;  1R4M B;  3GYP A;  2KZR A;  2KOX A;  5HE2 A;  2LKO A;  2GRI A;  5G2N A;  2WXF A;  3JW0 X;  2WLB A;  1OQQ A;  3BIN A;  1QQR A;  4MT7 A;  1WJ6 A;  5FR6 A;  1GUA B;  5JP4 A;  1PGX A;  2QEJ C;  2CY4 A;  2WXH A;  2KTR B;  3DVG Y;  2JSV X;  3JSV A;  2D5G A;  4RH6 A;  1KF6 B;  3PLV A;  1UEF A;  2NTS A;  3T06 A;  4B6H A;  3GOE A;  4C56 C;  1EU3 A;  3AE7 B;  1XLN A;  4RNA A;  1ZPS A;  3WCQ A;  4TSS A;  3KLS X;  4YL8 A;  1QKZ A;  2KFK B;  5KCV A;  2YEP F;  1U5F A;  2CJO A;  1HTO A;  5DH9 B;  3B77 A;  1P98 A;  2J0M A;  1FXT B;  1FAO A;  3UZT A;  5C5B B;  4HAZ B;  1RLF A;  4LJP B;  3Q14 C;  4R3D A;  2L7R A;  2BKF A;  1I7H A;  3E56 A;  2KCJ A;  4HSI A;  2WDV B;  3W1S C;  3SV1 A;  2KFJ A;  4IWP A;  2YT1 A;  2L0F A;  2QSD A;  4ZHO A;  2CKH B;  3L16 A;  4DHZ B;  2IYD B;  3OWE B;  4FUL A;  2JUO A;  1GG3 A;  5C79 A;  3UIN B;  1XCG A;  2VH2 A;  2W2X D;  2M17 A;  1BML C;  4KVG B;  2ACZ B;  1H8C A;  4KIK B;  2M0A A;  4TQ1 A;  1NYQ A;  1WR1 A;  2BS4 B;  3L08 A;  1VDV A;  2MBE A;  2M56 B;  2WXP A;  1CK1 A;  4NAM A;  1IBX B;  1D5Z C;  1NU2 A;  2FE8 A;  2J0J A;  2K25 A;  1FIQ A;  2CJN A;  2O6V D;  4USA A;  3ZNZ B;  4B9K A;  3E9S A;  3BVM A;  4ZRQ A;  4KZ0 A;  1Y5O A;  4OVU A;  1UNQ A;  3H6N A;  2EMS A;  4NJ6 A;  3BYY B;  1DRO A;  3BK2 A;  1TS3 A;  4A9A A;  3S2A A;  3MC8 A;  2UZR A;  1JRU A;  1DYN A;  4ITK A;  2LGX A;  2FCQ A;  4YSZ B;  3U2S C;  1PDX A;  4L6E A;  1SE3 A;  3VR9 B;  5FKA C;  3EFU A;  4I6N B;  4K17 A;  2DKP A;  2R0D A;  3DXC A;  2K6Q A;  3NZU A;  4D2K A;  3NWD A;  5EE1 A;  1XLO A;  1FM0 D;  2YRY A;  4RGM A;  3RZF A;  4LTU A;  2KN5 A;  4NNJ B;  3A8P A;  2TSS A;  3RCZ A;  4DXA B;  2LFI A;  4K3C A;  3A9J A;  1WXS A;  4IKG A;  1XF5 L;  4TYZ A;  3I63 C;  3KQ4 A;  2WU2 B;  1YD8 U;  3O65 B;  1TKG A;  2FAZ A;  4US8 A;  5CX3 A;  3F0W A;  1PLS A;  3MTN B;  4MGK E;  2HJ8 A;  1WRI A;  1R4N B;  5FR3 A;  4MAC A;  4H2A A;  3DVN U;  4AQ7 A;  1JRO A;  2UYZ B;  2KNB A;  2RVB B;  4EZK A;  1LM8 B;  2LWP A;  4FJV B;  2DAJ A;  5IO9 A;  4KAX B;  2BPS A;  3N30 A;  2IY1 B;  2OJR A;  2GOW A;  3ZVV A;  2Z0D B;  3ZJV A;  4N59 A;  3NWF A;  1I4H A;  4QAY A;  3AE2 B;  3W5V B;  1OTR B;  4TMA B;  4PNK A;  3KWV A;  1Y19 B;  1EF1 A;  4ZRK A;  4IOI E;  3P4Q B;  3HUI A;  1K52 A;  2INC C;  4DX8 A;  3C8Y A;  3B08 A;  4EE2 A;  2KAN A;  3AE9 B;  2PTL A;  4WWN A;  5CLQ B;  3ZXV A;  4HDQ A;  2MWN B;  3CST A;  4NSW A;  2XN9 C;  3N1Z C;  1V8C A;  2DHZ A;  1I42 A;  5HE3 A;  3PRE A;  3ZJT A;  3VAW A;  4A6Q A;  1YQB A;  2BB5 A;  1LGR A;  2I2Y A;  3DOW A;  1KZG A;  2AYO B;  4CSQ A;  1UNP A;  1UPQ A;  3LXF A;  4L1R A;  1ZM0 A;  3ZYY X;  1E8Y A;  3WAL A;  3T3N A;  2MBQ A;  2LOX A;  1RAX A;  3Q3N C;  1K5G B;  4BBN F;  4LNF A;  3TMP B;  1BAK A;  3ZIM A;  3FEH A;  3QWZ B;  3OAN A;  1SSN A;  3ZXR A;  2M8S A;  1V97 A;  3FIL A;  4DXF A;  1ZW7 A;  1A5R A;  1KJT A;  1LQB A;  3DXD A;  2PPH A;  1L0V B;  2KQ7 A;  4XDD A;  4E71 A;  3AU5 A;  4A6F B;  2HE7 A;  4DHJ D;  5BYQ A;  4DBB A;  2AQ3 B;  1SJE D;  3NVW A;  1PGB A;  4WQO B;  2PVO D;  2G35 A;  2J52 A;  5EDS A;  1E7V A;  4GMX B;  4HB2 B;  2W3R A;  1GAQ B;  4OZC A;  5IA7 A;  1J19 A;  2N9K A;  1TY0 A;  4DK5 A;  1JAL A;  3B1L X;  2PE6 B;  2G4D B;  1X1F A;  3M62 B;  5H92 C;  4G0N B;  3PVL A;  3AV8 A;  3NVV A;  5MPO A;  1N61 A;  3VUW A;  4JQW C;  2ZKM X;  5DPW A;  5KQ4 A;  1DDW A;  1VRA B;  2MP2 A;  4LCD E;  4D6W A;  1V88 A;  3DBR I;  2ZPN A;  3OG5 A;  1WYW B;  4REZ A;  2JP2 A;  4W9J A;  1ZSQ A;  3NZ3 A;  3LJU X;  1Z2M A;  4AS1 A;  2FNJ B;  2YS5 A;  2I1K A;  3D8F A;  4KSK C;  4QJ3 B;  2WXR A;  4HRS A;  1E8X A;  1E10 A;  2YVC A;  3DVG X;  4DDI D;  3ULC A;  1E6E B;  4L23 A;  2FIF A;  2LZ6 A;  1TS2 A;  3NSU A;  2W9N A;  1B9R A;  1HZ5 A;  2W54 A;  1F2R I;  2R61 A;  1V61 A;  4GMV A;  3APC A;  4FN2 A;  5IAA C;  1K5D B;  1OMW A;  5AUI A;  4JGH B;  4HLE A;  1Y56 A;  2VZK B;  1WGK A;  4YWG G;  3PVW A;  3V61 A;  2WDQ B;  1J0W A;  1ESF A;  4WVF B;  1MVK A;  2BQQ A;  5KQ1 A;  3SHQ A;  2B76 B;  4HAU B;  1DOY A;  3P42 A;  2X8X X;  1OEY A;  4GB9 A;  3AXC A;  4LDT B;  4C80 A;  4NJC A;  3KUZ A;  2DYB A;  5L81 A;  2RSU A;  4Z2M B;  5TR5 A;  2KJ6 A;  1PYW D;  1WXQ A;  4KGR A;  2LRU A;  1NEK B;  4HPM B;  1JWU D;  3RT3 B;  2L8J A;  2AL6 A;  3N20 C;  1KOT A;  2M1M A;  1WMH B;  2MKR A;  4M02 A;  3WAP A;  1NBF C;  2DZK A;  1NYR A;  2M0X A;  3SYX A;  1D5X C;  2N7J A;  4G3X B;  1QF6 A;  3GE8 C;  4KHB A;  4WUR A;  5CHF A;  1FFV A;  2K39 A;  4H8S A;  2EKE C;  2ICI A;  1RRB A;  1WF9 A;  1QOF A;  1D5M C;  3Q6B A;  3TEZ A;  5DCN A;  2KVZ A;  4JWS C;  4AOF A;  1UWX A;  3ML4 A;  2COA A;  4F7U P;  4WJP A;  2JT4 B;  1ZDV A;  1STE A;  3RNB C;  4XX5 A;  2LGI A;  3QX1 A;  4EZJ A;  3EC8 A;  5IN7 A;  3QA8 A;  4S0R A;  1RWS A;  2AQ2 B;  3BJI A;  2HTH B;  1AAR A;  4ACF A;  4NQL B;  1P5T A;  3VDZ A;  2NMB A;  3R7R A;  3AE5 B;  3IBE A;  1TJ6 A;  4JLC A;  1J0G A;  3TFM A;  2D3B A;  1JRP A;  3OJ3 A;  5AZF A;  1WXM A;  5JHG A;  3HK0 A;  1DYQ A;  3CIR B;  1T6B X;  4WQM A;  2KWD A;  3H8H A;  4ANU A;  1W1H A;  2INP E;  4RGT A;  3P6A A;  5AZG A;  1AN8 A;  2GUM A;  2RDB C;  2K49 A;  1ACC A;  2MQJ A;  4CHM A;  4A6K A;  2WWZ A;  1GJZ A;  1WY8 A;  2KWV B;  4A6H A;  4K81 A;  1DGJ A;  4IWO A;  2LVQ A;  1S1Q B;  3ZRF A;  4PT5 A;  5I2M A;  1NTV A;  2K00 A;  1Q1O A;  4WJQ A;  3SEB A;  3NOB A;  2D9Y A;  3BYT B;  2NTT A;  2XK5 A;  2K8H A;  2GBK A;  3UF8 A;  3QAQ A;  2UWQ A;  5DHF B;  3EHV A;  2YF0 A;  1GC6 A;  4W9F A;  1WX9 A;  3Q8E A;  5GMV A;  1FCC C;  1TY2 A;  2JZZ A;  2KDF B;  2LUE A;  4NY0 A;  2D07 B;  4MGZ E;  2Y5C A;  5D3D A;  1Z87 A;  1K51 A;  2CU3 A;  5L95 C;  3HHM A;  3AH7 A;  3I9V 1;  2QJL A;  1FHX A;  1Q67 A;  1UGM A;  1XXG A;  2RMM A;  1FEH A;  2FBW B;  2D2Q A;  2IYB A;  2EKI A;  1P1A A;  2G4S A;  2C7H A;  2RPV A;  2KGX B;  2LI5 A;  2NCN A;  1K50 A;  1SIJ A;  1MG8 A;  4FJZ A;  3A1Q B;  2UU7 A;  1FPY A;  1V1P B;  3BVG A;  1GB4 A;  1OFF A;  2GS0 A;  3V6C B;  4W9H A;  4BZA A;  1V5M A;  1WJ4 A;  3ZKJ C;  3DXE A;  1DDM A;  3TJP A;  3Q2A C;  3DHG C;  2MDX A;  2KJR A;  4UDU C;  1FGZ A;  2KXJ A;  2MEK A;  2MBO A;  1T0Y A;  2NBV A;  3JSV B;  1BUI C;  2WXI A;  4J6I A;  1TT5 B;  3M3J A;  2L0T A;  2GBR A;  3VTU A;  3PZ7 A;  4QJ4 B;  2PKO A;  2JU6 X;  4AWJ A;  2D4Q A;  1N6Z A;  3QAR A;  1UD7 A;  2H7E A;  2CHW A;  4PS8 A;  4N58 A;  1YJI A;  3SR6 A;  1YN4 A;  3H7S A;  3O13 A;  3NS1 A;  4AUQ C;  2R09 A;  1LB1 A;  1MFW A;  5E6O A;  2V3S A;  1TS4 A;  1MIZ B;  1YN5 A;  3KSY A;  1UWM A;  4BKG A;  3ULB A;  2Q5W D;  1PFJ A;  5D3W A;  2IGG A;  3A9K B;  1F9J A;  3VRA B;  1B1Z A;  3ZVR A;  2X38 A;  3IHP C;  5BMI A;  3RMK C;  2E3T A;  1PFD A;  1T0S C;  1KH0 A;  2VSZ A;  4EUT A;  4E74 A;  1N60 A;  2D9W A;  3TBL D;  2KC2 A;  4GNK B;  4B6W A;  4YXD B;  4HWI B;  3SUZ A;  2W82 A;  1G6J A;  4MH8 A;  2QKM A;  5TSS A;  4DXG A;  4CO7 A;  2IZV B;  4DX9 0;  3TEW A;  2LXA A;  2WXO A;  2DX1 A;  4K2P A;  1JML A;  1XO3 A;  4OSN A;  1EU4 A;  2D9V A;  1AWD A;  1GOZ A;  4PS3 A;  3DCG A;  2MBB B;  5LLI A;  1MIX A;  2K3U A;  1ZKH A;  2RGN B;  3Q3F A;  4AJY B;  2GLS A;  3A98 B;  3RNE C;  5D3I B;  3ODX A;  2CR5 A;  1SJH D;  3CWI A;  4KSL C;  4EKU A;  2KQ4 X;  3ODO A;  1F77 A;  3M63 B;  3HW2 B;  2WXQ A;  3AE3 B;  3NZS A;  3HM3 A;  4OW0 A;  2FUH B;  2IND C;  2WXL A;  3HIZ A;  1HQR D;  3Q3J A;  1SE2 A;  1TXD A;  4II2 B;  2J7Q B;  3APD A;  5D7G A;  2JX5 A;  4XWW A;  2IO0 B; 
#chains in the Genus database with same CATH homology
 4HJK A;  4MGY E;  1WGY A;  3HM6 X;  2ZVO A;  3U7D A;  1MKE A;  2FJL A;  2DYO A;  2JVC A;  1I35 A;  2Y8G A;  1V2Y A;  3A9J B;  4W9D A;  4WJO A;  2DYM A;  3MDB C;  4XWX A;  1UBI A;  2LAS A;  5JH5 C;  4ICU A;  5J2R A;  4K1R B;  4IG7 B;  4KZC A;  4TV3 A;  2Z0Q A;  1WZ0 A;  1BWN A;  3H9D A;  3TCA A;  2NPT A;  5LXH A;  2OOB B;  1Q5W B;  1U27 A;  3AI5 A;  4GPT B;  2O6V A;  2KX0 A;  3WIM A;  1QZE A;  4BVU C;  2IBI B;  1SGH A;  4GGQ A;  2BWF A;  4NJ7 A;  4IFS A;  2CS4 A;  1Y8R C;  2JXX A;  2LVP A;  2EC1 A;  2KWU B;  5E6N A;  2X18 A;  4XC2 A;  5HE1 A;  2BCJ A;  1V81 A;  4CHJ A;  2IO3 B;  4EOY A;  2FID A;  1WM2 A;  4WJ7 A;  3CF6 E;  2IO1 B;  5BO4 B;  2FCS A;  1C3T A;  4W9C A;  1J8C A;  1LW3 A;  2DKQ A;  4HAX B;  3AJ4 A;  1CMX B;  3H1U A;  4IUM B;  4ZRI A;  1M7R A;  1EAZ A;  4ICV A;  4EFO A;  2EMT A;  2H7D A;  5DHA B;  1VD2 A;  1P9D U;  2L05 A;  4GXB A;  4IOY X;  3ZNG C;  4KIK A;  1X11 A;  2RD0 A;  2Y8F A;  2N1V A;  3L10 B;  1V49 A;  1X1G A;  2UVM A;  2ELA A;  4GOC A;  2K6D B;  4PYU A;  2DFK A;  2C9W B;  1X86 A;  1TBE A;  4HB0 B;  3ZRC A;  2MP2 B;  3UIO B;  3RCP A;  2KDE B;  2PJH A;  4MSQ B;  4FHK A;  2LXC A;  4GDK A;  2V4L A;  4KDI C;  4FJY A;  4Y94 A;  5EFX A;  3KY9 A;  1WIA A;  3RYT A;  2PE9 A;  3PHW B;  4FHJ A;  2CHX A;  4MGI E;  2P0F A;  4I6L B;  2CAY A;  1BTN A;  2L1C A;  2CHZ A;  3W1S A;  4MEM A;  4WWO A;  5DIF B;  2MRP A;  3R66 C;  3KUD B;  4AJW A;  2XBB C;  2JRI B;  2FCN A;  5KHQ A;  3PGE A;  3QJZ A;  4ANW A;  1HE8 A;  2BYE A;  2C7M B;  3QQ8 B;  3PEG A;  4LJO B;  2Y5B B;  4F7Z A;  1UBQ A;  2WX1 A;  2RR9 A;  3TO1 A;  5CHW A;  1YX5 B;  2NR2 A;  2N7D A;  2KLC A;  1C1Y B;  2Y7B A;  2DZJ A;  2W2W A;  1WE7 A;  2DHI A;  4HAY B;  4EJN A;  1ZC4 B;  1P3R A;  3A4S C;  5JHB A;  4MJS A;  4KHB B;  1P0R A;  3V60 A;  4EMO A;  3AU4 A;  2DZM A;  2A4Z A;  3WAN A;  2DHJ A;  3VTV A;  3PRM B;  3VUY A;  3ZTD A;  4PYZ A;  2N23 A;  2RGF A;  5KHO A;  2ROV A;  4HAT B;  2LGY A;  1SE9 A;  2REX A;  3DPD A;  3UGB B;  1WG7 A;  2RPQ A;  1IRS A;  2K8C A;  2D9Z A;  3DBL I;  5DI9 B;  4F8C B;  2KO3 A;  2KD0 A;  2AL3 A;  2DA0 A;  5D6J B;  2BGF A;  2KK8 A;  2KQS A;  4TUU A;  2ADZ A;  3L13 A;  1KI1 B;  1ZC3 B;  3SO6 A;  3QBV B;  3PHX B;  2ASQ A;  2C7N B;  4A3O A;  1D3Z A;  3KVF B;  1RJ2 A;  1V5U A;  2K8B A;  2MX2 A;  2LRW A;  2ZPY A;  4HB3 B;  2XK5 B;  3V62 A;  3SNH A;  1MK9 B;  2MFQ A;  2JWZ A;  4KHO A;  2BKR B;  5C1Z A;  2ZCB A;  4TQ0 A;  3I3T B;  4F7G A;  2KMA A;  3ZUN A;  1V5T A;  1OEY J;  2NBW B;  3LJ3 A;  2MCN B;  4BKS D;  5G55 A;  4GDL A;  3PZD A;  2I5F A;  3GZN I;  2YSZ A;  1WFY A;  1TQZ A;  3RD2 A;  1QC6 A;  3PRZ A;  2M14 A;  2VRR B;  4YON A;  3VQI A;  1U2B A;  1WZ3 A;  1TGZ B;  1I7A A;  1ZGU B;  4MM3 A;  2BYF A;  5D94 A;  1P6S A;  3VH3 B;  1WVH A;  1KM7 A;  3BY4 B;  4HK2 A;  1Z5S B;  3P7Z A;  1P3Q U;  1WXA A;  4HB4 B;  4BFR A;  4PS7 A;  3F5R A;  1UPR A;  3T9L A;  4NQK E;  2IFS A;  4HVB A;  3A4R A;  3TIX A;  1Q0W B;  4LDT D;  1WJ1 A;  4IM3 A;  2JY6 A;  2D9X A;  1GC7 A;  3ML8 A;  1X05 A;  2DEN B;  4GU2 A;  2YS3 A;  3MPX A;  1AQC A;  1WMH A;  3N32 A;  2MSE D;  3PT2 B;  3KYD D;  4M8N A;  1NI2 A;  1V89 A;  2XQN M;  2R2O A;  1ZVR A;  2KKC A;  3IFW B;  2L76 A;  4F1S A;  4D0N B;  2Z0O A;  2DHK A;  4KHA A;  2M4N A;  2V76 A;  3B0A A;  3ODW A;  2JZ3 B;  4GZU A;  5DPR A;  2B3A A;  4A20 A;  4HHV A;  1GNU A;  3R3M A;  1M7E A;  2NS5 A;  5J3Y A;  1L2N A;  3H7P A;  1EGX A;  3TVV A;  1MAI A;  2K1F A;  4K7U A;  3OJ4 B;  4MH0 E;  2RLO A;  1WRD B;  5D3V A;  1W1D A;  3KUC B;  3V5W A;  2M38 A;  1WR6 E;  3X23 A;  3EEC A;  5D3X A;  1M94 A;  1WJU A;  1V5P A;  3M1I B;  1S3S G;  1U5D A;  1RFA A;  3MHS D;  3TW1 A;  4BOS C;  2ZNV B;  3R7Q A;  5AZH A;  1DDV A;  2CU1 A;  1V5O A;  2YS1 A;  2D10 A;  2ZZP B;  1WJM A;  2DX5 A;  1TZ1 A;  4MEL A;  4BKT A;  4W9G A;  5J3T A;  1PMS A;  2ZVN A;  2RNR B;  3PS6 A;  3PP2 A;  2L00 B;  4N9F 4;  1FOE A;  3PRP B;  3PV1 A;  4IW0 A;  1FB8 A;  3ZNH B;  2NPT B;  3DBH I;  5AEK B;  3VH4 B;  5GOW B;  1AWE A;  2O6V B;  3K9O B;  4KV2 A;  2DTC A;  3PTF C;  4TKN A;  2XEW A;  4EZL A;  3NY5 A;  1PQS A;  3ZO5 B;  1WGU A;  3QHT A;  5FI0 A;  4IC7 B;  3VUX A;  4FLH A;  4DHZ E;  1V9J A;  4FAD A;  1SIF A;  4II3 B;  1WGQ A;  5CHV C;  4NAW A;  4FA6 A;  3JYU A;  2O2V A;  4KDL B;  3RUL A;  2LD9 A;  1FHO A;  1E90 A;  1RRP B;  4HPL B;  3P2B A;  2COF A;  4W9K A;  3A9K A;  3FM8 C;  1UH6 A;  2I5C A;  3PVU A;  2GBM A;  2N9P C;  3CMM B;  4E3C A;  1I2H A;  1WH3 A;  2BWE S;  1K8R B;  4IWQ A;  3A33 B;  4A3P A;  2BF8 B;  3L0W B;  2FCM A;  2KMC A;  4W9I A;  4GSW A;  4URK A;  1XQQ A;  2P8V A;  2ROZ B;  5D3Y A;  2KTR A;  1IP9 A;  1XD3 B;  4G50 A;  4GIV A;  1MPH A;  5L83 A;  3UQA A;  1FGY A;  4RM8 A;  4C0A A;  2KFK A;  4CYE A;  4BBK A;  5LON B;  3ZTC A;  2Z0E B;  1TTN A;  4JIO U;  2K2J A;  4GDK B;  5C5B A;  2LGD A;  1WI0 A;  1WJN A;  3LDZ E;  2HD5 B;  3UIP B;  2C60 A;  1OY2 A;  3VTW A;  2E2X A;  3CIK A;  2AWT A;  1LXD A;  2MLB A;  5JLJ B;  2BYV E;  1IYF A;  2QKL A;  1EVH A;  4CHK A;  1WX7 A;  2Q13 A;  2N9E B;  3DQV A;  3OLM D;  2DAF A;  4M8M A;  3QC8 B;  5J18 A;  4DHJ B;  2AEH A;  2J0K A;  1E8W A;  1OQY A;  3ONS A;  4K7S A;  3KRW A;  1E7U A;  1XKE A;  1MK7 B;  4DWF A;  4ANX A;  1YIW A;  2KVR A;  3QK0 A;  1YX6 B;  4HXD A;  4I6P A;  2PEA A;  2JRH A;  4IAP A;  2IO2 B;  4ZYN A;  3CXB B;  4JL9 A;  4MJS B;  4AP4 C;  1VCB A;  1U29 A;  1FHW A;  3VOQ A;  2N9X A;  2LG1 A;  3U30 A;  5D27 A;  5J17 A;  4ANV A;  3X0W A;  3ZDM C;  3VIA A;  3ZNI D;  2MW5 A;  4BBN C;  2DYN A;  3VXW A;  3KZ1 A;  2MWS B;  1WGG A;  3MJW A;  4ASW C;  1LFD A;  3ENE A;  2YLM A;  1WE6 A;  2ZCC A;  4HCP B;  3ALB A;  2I1J A;  2UZS A;  1EF5 A;  1N3H A;  1KLV A;  1U4A A;  3ZLZ A;  4BOZ B;  3OAW A;  2LOZ A;  4ZRJ A;  1XOD A;  2MBH A;  2KTF A;  3A8Q A;  1E8Z A;  2ZEQ A;  3JVZ X;  4HAW B;  4Z2N A;  2EJ8 A;  2KDB A;  2LYD A;  2L3Z A;  3D8D A;  2KHW B;  3HQC A;  2KC1 A;  5JHH A;  2DZI A;  2GBJ A;  3DBS A;  2OQB A;  2P0H A;  4PQ0 A;  1WGH A;  1XD4 A;  2WYQ A;  3N7C A;  3RUI B;  4MSM B;  5FI1 A;  2P0D A;  4MDK E;  1UNR A;  2CY5 A;  4GDL B;  5C23 A;  4GN1 A;  2VRW B;  4MK0 A;  4FBJ B;  2KJH B;  2DN6 A;  1XT9 B;  4G11 A;  3KH0 A;  3U8Z A;  3ZDT A;  5JZE B;  3DVN V;  2K2U A;  2GMI C;  3WYF B;  3WAM A;  1NDD A;  1XX0 A;  1KZ7 A;  4K7W A;  3NHE B;  5DPT A;  1BTK A;  3NS8 A;  3G9W A;  1B55 A;  3GYO A;  1OQN A;  3PG7 A;  3IVF A;  5HE0 A;  3DDC B;  3ZW3 A;  3PPA A;  4A6F A;  3AUL A;  5DPS A;  2QHO A;  2KDI A;  3UQB A;  3VVW B;  2GJY A;  5C6R A;  4WWP A;  1QQG A;  1R4M I;  4IM2 A;  5JHA A;  4X57 B;  3T8M A;  1H4R A;  2Z0P A;  4F7H A;  1WGR A;  1L7Y A;  4DBG A;  2MA9 B;  5J3Q A;  1WI1 A;  3SD5 A;  2KX3 A;  1E5W A;  5D2M B;  1V80 A;  3M95 A;  1WXV A;  2R2Q A;  4HAV B;  4XZ4 A;  4A5K A;  2JPH A;  1ISN A;  4BKS A;  1YJ1 A;  1WX8 A;  1OGW A;  1V6E A;  3TL5 A;  2DLW A;  1NTY A;  3L17 A;  3QIJ A;  3KRX A;  2G45 B;  2IY0 B;  3WAO A;  5C16 A;  1EUV B;  2COC A;  2N1W A;  2COD A;  3D32 A;  3ECI A;  3L54 A;  2KLG A;  2GCL A;  2D11 A;  2C5L C;  2NBV B;  3O96 A;  5E6P A;  4RM9 A;  4B95 A;  4W9L A;  3H7P B;  3W1Y A;  1UEL A;  2KUP A;  3QCA A;  4WAA A;  4EEW A;  4DDG D;  2N0Y A;  3IG3 A;  2L2I A;  2VKI A;  2Z59 B;  3CSF A;  1X1M A;  3VHT C;  4M0W B;  1U5G A;  2NZ8 B;  3RZW C;  2ZNV C;  1WGD A;  4RMA A;  3V6E B;  2V1Y A;  1WM3 A;  2OTX A;  1SHC A;  2W2X C;  3SDL C;  5CTR C;  4IM0 A;  5CLL B;  1U5E A;  2A5U A;  2DYQ A;  2RUK B;  3WA0 A;  3FSS A;  2LJ5 A;  2DX5 B;  1W1G A;  4OVV A;  1V86 A;  2GBN A;  2RSG A;  1XR0 B;  2LVO A;  2J59 M;  3SU8 X;  2WX0 A;  5HKH A;  2HTH A;  3K9P B;  3N3K B;  2KWC A;  2N4F A;  1IPG A;  4W9E A;  4HDO A;  3VFK A;  2ELB A;  3PSC A;  2CRF A;  4HCN B;  3D8E A;  2GCJ A;  1R4N I;  4WJN A;  1BT0 A;  4NPN A;  2D3G A;  2LUL A;  2PZ1 A;  4NAW B;  2JF5 A;  4P7I A;  3PLU A;  3C0R B;  3KW5 B;  3APF A;  3PSE B;  2O2V B;  3ML9 A;  1UZX B;  1EO6 A;  1H10 A;  3KYC D;  4ZDV A;  3QWM A;  2NBU A;  2G3Q B;  2N7E A;  1DBH A;  4MY6 A;  4WSF A;  5LXI B;  2NVU I;  2WDT B;  5LOP B;  2YT0 A;  2ZJD A;  3A1Q A;  4K2O A;  3GYP A;  2KZR A;  2KOX A;  5HE2 A;  2LKO A;  5G2N A;  3JW0 X;  3BIN A;  4MT7 A;  1WJ6 A;  5FR6 A;  1GUA B;  5JP4 A;  2CY4 A;  2KTR B;  3DVG Y;  3JSV A;  3PLV A;  1UEF A;  3T06 A;  4B6H A;  3GOE A;  4YL8 A;  2KFK B;  5KCV A;  1U5F A;  5DH9 B;  1P98 A;  2J0M A;  1FXT B;  1FAO A;  3UZT A;  5C5B B;  4HAZ B;  1RLF A;  4LJP B;  2L7R A;  2BKF A;  2KCJ A;  3W1S C;  3SV1 A;  2KFJ A;  4IWP A;  2YT1 A;  2L0F A;  2CKH B;  3L16 A;  4DHZ B;  2IYD B;  4FUL A;  2JUO A;  1GG3 A;  5C79 A;  3UIN B;  1XCG A;  2W2X D;  2M17 A;  4KVG B;  1H8C A;  4KIK B;  4TQ1 A;  1WR1 A;  3L08 A;  2MBE A;  1NU2 A;  2J0J A;  2K25 A;  2O6V D;  3ZNZ B;  4B9K A;  4KZ0 A;  1Y5O A;  4OVU A;  1UNQ A;  3H6N A;  2EMS A;  4NJ6 A;  1DRO A;  3S2A A;  2UZR A;  1JRU A;  1DYN A;  2LGX A;  2FCQ A;  4L6E A;  3EFU A;  4I6N B;  4K17 A;  2DKP A;  2R0D A;  3DXC A;  2K6Q A;  3NZU A;  2YRY A;  3RZF A;  2KN5 A;  4NNJ B;  3A8P A;  3RCZ A;  4DXA B;  3A9J A;  1WXS A;  4TYZ A;  1YD8 U;  3O65 B;  2FAZ A;  5CX3 A;  3F0W A;  1PLS A;  3MTN B;  4MGK E;  2HJ8 A;  3DVN U;  2UYZ B;  2KNB A;  2RVB B;  4EZK A;  1LM8 B;  2LWP A;  4FJV B;  2DAJ A;  4KAX B;  2BPS A;  3N30 A;  2IY1 B;  2OJR A;  2GOW A;  3ZVV A;  2Z0D B;  1OTR B;  4PNK A;  1Y19 B;  1EF1 A;  4ZRK A;  4DX8 A;  3B08 A;  2KAN A;  4WWN A;  5CLQ B;  4HDQ A;  2MWN B;  3CST A;  4NSW A;  2DHZ A;  1I42 A;  5HE3 A;  3PRE A;  3VAW A;  1YQB A;  3DOW A;  1KZG A;  2AYO B;  1UNP A;  1UPQ A;  1ZM0 A;  1E8Y A;  3WAL A;  2MBQ A;  2LOX A;  1RAX A;  1K5G B;  4BBN F;  3TMP B;  1BAK A;  3ZIM A;  3FEH A;  3QWZ B;  3OAN A;  2M8S A;  1ZW7 A;  1A5R A;  1KJT A;  1LQB A;  3DXD A;  2PPH A;  2KQ7 A;  4E71 A;  3AU5 A;  4A6F B;  2HE7 A;  4DHJ D;  4DBB A;  4WQO B;  2G35 A;  5EDS A;  1E7V A;  4GMX B;  4HB2 B;  5IA7 A;  1J19 A;  4DK5 A;  3M62 B;  3B1L X;  2PE6 B;  2G4D B;  1X1F A;  4G0N B;  3PVL A;  3VUW A;  4JQW C;  5DPW A;  5KQ4 A;  1DDW A;  2MP2 A;  4LCD E;  1V88 A;  3DBR I;  2ZPN A;  1WYW B;  2JP2 A;  4W9J A;  1ZSQ A;  3LJU X;  1Z2M A;  2FNJ B;  2YS5 A;  2I1K A;  3D8F A;  4KSK C;  1E8X A;  2YVC A;  3DVG X;  4DDI D;  3ULC A;  2FIF A;  2LZ6 A;  3NSU A;  2W9N A;  1V61 A;  4GMV A;  3APC A;  4FN2 A;  5IAA C;  1K5D B;  1OMW A;  4JGH B;  4HLE A;  3PVW A;  3V61 A;  1J0W A;  3SHQ A;  4WVF B;  5KQ1 A;  4HAU B;  1OEY A;  4GB9 A;  3AXC A;  4LDT B;  3KUZ A;  2DYB A;  5L81 A;  2RSU A;  4Z2M B;  5TR5 A;  2KJ6 A;  2LRU A;  4HPM B;  3RT3 B;  2L8J A;  2AL6 A;  1KOT A;  2M1M A;  1WMH B;  2MKR A;  3WAP A;  1NBF C;  2DZK A;  2M0X A;  3SYX A;  4G3X B;  5CHF A;  2K39 A;  4H8S A;  2EKE C;  1RRB A;  1WF9 A;  5DCN A;  4AOF A;  3ML4 A;  2COA A;  4F7U P;  4WJP A;  2JT4 B;  4XX5 A;  3QX1 A;  4EZJ A;  3EC8 A;  3QA8 A;  3BJI A;  2HTH B;  1AAR A;  4NQL B;  1P5T A;  3VDZ A;  2NMB A;  3R7R A;  3IBE A;  1TJ6 A;  4JLC A;  1J0G A;  3TFM A;  3OJ3 A;  5AZF A;  1WXM A;  5JHG A;  3HK0 A;  4ANU A;  1W1H A;  3P6A A;  5AZG A;  2MQJ A;  4CHM A;  4A6K A;  2WWZ A;  1GJZ A;  1WY8 A;  2KWV B;  4A6H A;  4K81 A;  4IWO A;  2LVQ A;  1S1Q B;  3ZRF A;  1NTV A;  2K00 A;  1Q1O A;  4WJQ A;  3NOB A;  2D9Y A;  2XK5 A;  2K8H A;  2GBK A;  3UF8 A;  3QAQ A;  2UWQ A;  5DHF B;  3EHV A;  2YF0 A;  1GC6 A;  4W9F A;  1WX9 A;  5GMV A;  2JZZ A;  2KDF B;  2LUE A;  4NY0 A;  2D07 B;  4MGZ E;  1Z87 A;  5L95 C;  3HHM A;  1FHX A;  1Q67 A;  1UGM A;  2D2Q A;  2IYB A;  1P1A A;  2G4S A;  2C7H A;  2KGX B;  2LI5 A;  2NCN A;  4FJZ A;  1MG8 A;  3A1Q B;  2GS0 A;  3V6C B;  4W9H A;  1V5M A;  1WJ4 A;  3ZKJ C;  3DXE A;  1DDM A;  3TJP A;  2MDX A;  2KJR A;  1FGZ A;  2KXJ A;  2MBO A;  1T0Y A;  3JSV B;  4J6I A;  3M3J A;  2L0T A;  2GBR A;  3VTU A;  4AWJ A;  2D4Q A;  3QAR A;  1UD7 A;  2H7E A;  2CHW A;  4PS8 A;  3H7S A;  4AUQ C;  2R09 A;  1LB1 A;  5E6O A;  2V3S A;  1MIZ B;  3KSY A;  4BKG A;  3ULB A;  1PFJ A;  5D3W A;  3A9K B;  1F9J A;  3ZVR A;  3IHP C;  2VSZ A;  4EUT A;  4E74 A;  2D9W A;  3TBL D;  2KC2 A;  4B6W A;  4HWI B;  3SUZ A;  1G6J A;  2QKM A;  4CO7 A;  2IZV B;  4DX9 0;  2LXA A;  2DX1 A;  4K2P A;  2D9V A;  4PS3 A;  3DCG A;  2MBB B;  5LLI A;  1MIX A;  1ZKH A;  2RGN B;  3Q3F A;  4AJY B;  3A98 B;  3ODX A;  2CR5 A;  4KSL C;  4EKU A;  3ODO A;  3M63 B;  3HW2 B;  3NZS A;  3HM3 A;  2FUH B;  3HIZ A;  3Q3J A;  1TXD A;  4II2 B;  2J7Q B;  3APD A;  5D7G A;  2IO0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...