4K81A

Crystal structure of the grb14 ra and ph domains in complex with gtp-loaded h-ras
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
251
structure length
244
Chain Sequence
KKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSAAPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the interaction of the adaptor protein grb14 with activated ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Growth factor receptor-bound protein 14
total genus 57
structure length 244
sequence length 251
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4k81A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4k81A01
2PE9A 3V6EB 1RAXA 1V81A 4MT7A 3EFUA 3H1UA 1XQQA 2K39A 4EEWA 4BVUC 3BY4B 1Q67A 2NS5A 1YQBA 2WX0A 1WMHB 2KTRB 4FADA 3QBVB 3P7ZA 2VRRB 2O2VB 3SDLC 2MKRA 1Y19B 4GSWA 1ZM0A 4KHBB 3PSEB 2PJHA 5DPTA 2MFQA 1UNQA 1WYWB 4A5KA 2BF8B 2MW5A 1E7UA 1OEYJ 2NBUA 2R2QA 3A4SC 1WGGA 5J18A 1U4AA 2LVPA 1PMSA 4ZRIA 4ANUA 2IY1B 1X86A 2MCNB 2RSGA 1Y8RC 4HAZB 1NTYA 2KTFA 1MG8A 4KDLB 2LOXA 3WALA 5D7GA 2AL6A 1OMWA 2CR5A 2HE7A 1L7YA 1WZ0A 4B95A 3KYCD 2MP2B 4IC7B 2CKHB 2ZVNA 4WSFA 4B6HA 4LCDE 5AZGA 1V5OA 3VXWA 4MJSB 1MIZB 2NR2A 1H10A 1U5EA 1YX6B 1OTRB 3VFKA 4WAAA 1XODA 2ZZPB 3PHWB 1V5PA 3UZTA 5AZFA 2KJHB 2MDXA 1DROA 4JIOU 3WAOA 2GS0A 1M94A 5CHWA 1S1QB 1U2BA 3VUXA 1FAOA 1DYNA 1YIWA 2UWQA 2G4SA 2G3QB 4HAXB 4I6PA 4TQ1A 4MJSA 2KVRA 2C60A 2ADZA 2LRWA 3PVWA 2R09A 1F9JA 3A9KA 2V4LA 4LDTD 3ZTCA 2DFKA 2YS5A 4EJNA 1WXAA 1Z2MA 2RVBB 3TVVA 2M4NA 2RR9A 2C7NB 3ML8A 1HE8A 3NZUA 2VKIA 2KXJA 2GCLA 2JZZA 1C3TA 1EF1A 3SO6A 1OGWA 1N3HA 2PPHA 1I35A 4HPLB 4GIVA 4NY0A 1OY2A 1XR0B 2KJRA 1E8XA 2N9EB 4TYZA 3PP2A 4Y94A 3MDBC 1SIFA 3PREA 5FR6A 3UINB 4A6FB 5FI1A 4EFOA 3UQBA 2IO1B 2MBOA 3U7DA 3N30A 1IYFA 2KQ7A 2YLMA 1DDWA 2RGNB 3JSVB 4W9EA 4MGKE 2DYOA 2GCJA 1SGHA 3C0RB 4G11A 4G50A 2M17A 1MK7B 1RJ2A 2P8VA 3ULCA 2NVUI 3PLVA 4MGIE 2NBVB 5BO4B 1MIXA 1B55A 2CAYA 4CHMA 4IWPA 2P0FA 4K7SA 2K00A 3QCAA 3QAQA 4A20A 1WJ1A 1WGHA 4HVBA 3UIPB 1KZ7A 1FHWA 2CY4A 2PE6B 1FHOA 4HCPB 2FAZA 5D94A 3VIAA 2YS1A 1I42A 4HWIB 2MWNB 2ZVOA 3DXDA 2Z0EB 1XX0A 2FIDA 5KHOA 2DX1A 3CIKA 3O96A 4W9CA 1OQNA 2D9XA 2G35A 3L10B 3ALBA 3H6NA 2M8SA 4KHOA 3LJUX 2KOXA 4HAVB 4K2PA 3IBEA 3M95A 2BCJA 4A6HA 4GDLB 2W2XD 5CLQB 4WJNA 4BFRA 2KTRA 4W9JA 3R7RA 4RM9A 1JRUA 2KD0A 4Z2MB 4Z2NA 2GBKA 3MTNB 5DIFB 2DYNA 1UZXB 3NY5A 4IUMB 5DHAB 1Z5SB 2RD0A 1IRSA 3SHQA 5D3VA 2AYOB 3KZ1A 1WXSA 4NPNA 3SNHA 2L1CA 4IW0A 3A33B 3T06A 3ZIMA 1V6EA 1Q5WB 5J2RA 1V61A 4NQLB 3CSTA 3JYUA 1WMHA 3ODXA 3ML9A 4K7UA 4C0AA 1OQYA 5EDSA 1W1DA 1BTNA 5DH9B 2J0JA 2OOBB 3HK0A 4G3XB 4TQ0A 3VUYA 1YJ1A 3BINA 1WXMA 2N4FA 3H7PB 2IYDB 1G6JA 1MKEA 2BYVE 2KDFB 3A9JA 1BWNA 1T0YA 4MEMA 5HE2A 4WJOA 4F1SA 1FGYA 2M14A 2RUKB 2JRHA 4I6NB 3P2BA 4XC2A 2LVQA 3UIOB 1Y5OA 1QQGA 4HDOA 4GU2A 1V89A 5G55A 3UF8A 3X0WA 4URKA 2XBBC 3KRWA 1WE7A 3M62B 2BWES 2G45B 1UGMA 3KUZA 2KZRA 1FXTB 4WWNA 2HTHA 1E8ZA 3QA8A 2OQBA 3P6AA 1DDMA 3V5WA 4KIKA 3HM6X 4MGYE 3GYPA 4DX90 5L81A 2Z0OA 1EAZA 2K6DB 3K9PB 2FCSA 2C7HA 1K5DB 2KFKB 2KJ6A 2KHWB 4H8SA 1WR1A 3DBLI 3VDZA 2P0HA 2JF5A 4KZ0A 4E3CA 4A3OA 3F0WA 3L08A 2KFKA 3N3KB 5AEKB 2I5FA 1M7RA 1FGZA 1Q1OA 2KANA 4IWOA 3DOWA 2K2UA 2JRIB 5GMVA 2ELAA 3NOBA 3ZO5B 5DCNA 4B6WA 1WM2A 1TZ1A 4HDQA 1V5TA 1AARA 2LXAA 2ZPNA 4HAYB 2HD5B 5DPWA 3VOQA 4PYUA 1NBFC 4L6EA 1UPQA 1UPRA 2AEHA 5DI9B 3QARA 2E2XA 4GDKA 2H7DA 3WA0A 3HQCA 3QQ8B 1TTNA 2KC2A 4KZCA 2L7RA 2Y8GA 3F5RA 4HB0B 1WZ3A 1OEYA 4K17A 2MBEA 4HATB 4BKTA 3MPXA 3TW1A 2D9YA 2LKOA 2V3SA 4W9DA 2IY0B 2OJRA 2L05A 1GC7A 5D3WA 2A4ZA 4JLCA 4W9FA 4CO7A 5AZHA 3X23A 1J0WA 2D9ZA 3L0WB 4W9KA 3A8PA 1WGDA 2C5LC 2AL3A 5KQ4A 4HXDA 1UBIA 4F7ZA 4DHJD 4HAUB 5JZEB 5D6JB 1WGQA 1WVHA 1WFYA 4IG7B 2M0XA 2IO3B 1BTKA 1PLSA 2Q13A 3PS6A 1KZGA 3ML4A 4IFSA 2KO3A 1SE9A 3JW0X 2XK5A 3EHVA 5DPRA 1U29A 1LB1A 4G0NB 1E8YA 3SV1A 3EECA 4PYZA 4ZYNA 1WIAA 5CX3A 3AI5A 2EKEC 1KI1B 3M1IB 3GYOA 3K9OB 2I1JA 1XCGA 2YT1A 1P1AA 1WXVA 1WF9A 2LGXA 2ZNVC 3L13A 4HK2A 1R4MI 4GMVA 1I7AA 3PV1A 4OVUA 2DZJA 4LJPB 1P9DU 4M0WB 2N23A 4HB3B 3IVFA 4GDLA 4A3PA 4EOYA 5J17A 3PRPB 3AULA 4JL9A 5L95C 1WR6E 3VHTC 2DHKA 2KNBA 1J8CA 4X57B 2RPQA 4NAWA 4K7WA 4PS3A 5HE3A 2M1MA 3BJIA 1R4NI 2GOWA 5IAAC 3Q3JA 3A1QB 3ULBA 1H8CA 4DX8A 2MBHA 5JHAA 3PLUA 2D07B 2KWCA 3KUCB 4ICUA 3AJ4A 2FCNA 2WWZA 3KW5B 5HE1A 2GMIC 3CF6E 1X05A 4GN1A 4MDKE 4NAWB 1KLVA 1NTVA 3L17A 2NCNA 4K1RB 2NMBA 4BOZB 2HTHB 4YL8A 2NPTA 3WYFB 2LZ6A 2MSED 2KDIA 2RGFA 1WX9A 2K25A 3D8FA 4ASWC 2IO0B 4XZ4A 2N1WA 3Q3FA 4LJOB 3RULA 3ZNZB 4FN2A 3TO1A 1KOTA 3SYXA 3B0AA 2L0FA 3KYDD 1KJTA 3RUIB 3W1SA 2YS3A 1H4RA 1LM8B 2WYQA 3GOEA 2N7EA 2ZPYA 1WJ6A 1X1FA 2N7DA 1FHXA 1LQBA 2BGFA 3WANA 3QC8B 3PG7A 4MY6A 4WWPA 5C79A 1C1YB 3OAWA 4PS7A 4KV2A 2KWUB 4E74A 3AU5A 2GBRA 2D3GA 2L3ZA 2P0DA 3DVGX 3KVFB 5KHQA 1GJZA 1K5GB 5C1ZA 2CODA 3PVUA 1WX7A 3DBSA 4EZJA 1FB8A 3PRMB 3O65B 3RD2A 4NSWA 4WQOB 2G4DB 2YVCA 3VTVA 2QHOA 4F7HA 2KX0A 3DDCB 4FULA 4HCNB 3D32A 2MA9B 3SD5A 1EVHA 1PFJA 1S3SG 1TQZA 2Y8FA 2LVOA 4JGHB 3PPAA 1V86A 1U5DA 2RNRB 4HB2B 2JP2A 1L2NA 1W1HA 3R66C 3T9LA 5J3TA 2R0DA 2MRPA 1EF5A 2DHZA 1WGRA 2IO2B 5D2MB 1UELA 2KGXB 1D3ZA 1DDVA 2Y7BA 3QWMA 2XK5B 5EFXA 2IBIB 4DK5A 3APDA 4DHZB 1V2YA 3ECIA 5LONB 4KHAA 3NS8A 1GNUA 3DQVA 3QJZA 4BBKA 1TJ6A 3B1LX 3W1SC 4IM0A 3AXCA 2COCA 2ELBA 3VVWB 2W2XC 2Z0DB 3B08A 2I5CA 4HAWB 1Z87A 2CS4A 2L0TA 1V5UA 1RFAA 4BKGA 2DHJA 2KQSA 1X1GA 5E6OA 3U30A 2O6VA 2JUOA 1V88A 4FHKA 4N9F4 1VCBA 3VH3B 5LXIB 2VSZA 1P3RA 3I3TB 2H7EA 3LJ3A 3JVZX 2L76A 2KMCA 3SUZA 1EO6A 2N9PC 3PZDA 3ZNGC 4AOFA 3PVLA 5D3XA 2JZ3B 1WE6A 2DZIA 4ZRJA 2DYMA 2IYBA 1PQSA 1TGZB 5HKHA 1M7EA 1ZGUB 1WJ4A 3DVNV 3QWZB 3ZUNA 3V61A 4PNKA 3FM8C 4BOSC 4WJ7A 3D8DA 2JPHA 4FJVB 2D11A 4ICVA 2B3AA 3TFMA 2MBQA 2ROZB 3PSCA 4AUQC 4MELA 4EKUA 5JLJB 3DXCA 4KSLC 2LJ5A 1U27A 1YD8U 5C5BB 1GC6A 2DZKA 3QK0A 1W1GA 3MJWA 3TIXA 2DX5A 2M38A 3HM3A 2BKFA 5JP4A 2GBNA 3MHSD 4KDIC 2FUHB 2BYFA 3PTFC 4FLHA 4TV3A 3DPDA 2D4QA 4GPTB 3KRXA 4GMXB 3QIJA 1RLFA 1WM3A 2KDBA 2REXA 3A9KB 3KUDB 3ONSA 3H7SA 4DDGD 4E71A 2EMTA 4GXBA 4FHJA 4W9LA 2MP2A 2J0MA 3RZWC 1WG7A 3N32A 2BWFA 4IAPA 2JWZA 3D8EA 4BKSD 4BKSA 1U5FA 4TUUA 2ZEQA 4CHKA 2DYBA 3APCA 5G2NA 2NZ8B 4WVFB 4D0NB 2K2JA 2W2WA 3RCZA 2XQNM 5IA7A 2DZMA 3M63B 4II2B 1X11A 3DVGY 1WRDB 2FJLA 3T8MA 4MGZE 3QHTA 1EGXA 2CHZA 2KK8A 3CMMB 2BPSA 3WAPA 3A9JB 3ENEA 3ZKJC 3TL5A 2KLGA 2YF0A 4ZDVA 5C23A 2KN5A 3L54A 1BAKA 2BKRB 2DA0A 2FIFA 2MLBA 5JH5C 1AQCA 2V76A 1X1MA 3RCPA 1E90A 5E6NA 4TKNA 3RYTA 1SHCA 1VD2A 1E5WA 4M8NA 3PRZA 3V6CB 3ZW3A 2UVMA 1EUVB 2A5UA 4ANVA 1WI1A 1IPGA 4EZLA 5L83A 3ODOA 2IZVB 3L16A 2O6VD 2L2IA 1UBQA 4W9HA 2DKQA 5CTRC 3VUWA 1XKEA 1XD4A 1FOEA 2J59M 3KY9A 1CMXB 2N9XA 1TBEA 4AP4C 4MSMB 3NHEB 3IHPC 4EMOA 2LOZA 2QKMA 2L00B 3GZNI 3PHXB 4IM3A 4LDTB 1WGUA 4DHZE 3A8QA 3R7QA 4DHJB 4A6KA 1UNPA 5TR5A 3ZDMC 2D9VA 1V9JA 2O6VB 3DBHI 1RRBA 1AWEA 4NQKE 1E7VA 4MH0E 1I2HA 5KCVA 3R3MA 4A6FA 2K8HA 1NDDA 1ZW7A 3OJ3A 2CRFA 2Z0QA 2NBWB 1MPHA 3ZTDA 2YRYA 2X18A 2COFA 3PEGA 3ZNHB 2JT4B 4PS8A 5LLIA 2C7MB 3TMPB 4IM2A 2Y5BB 4FJYA 4F7GA 3G9WA 4NNJB 3UGBB 1WJMA 2LI5A 4BBNC 2DN6A 3KSYA 3VTWA 1KM7A 2ZCBA 4HJKA 4RM8A 4FA6A 1WY8A 3VAWA 1WI0A 3H7PA 1ZVRA 1U5GA 4ANXA 2N0YA 5C6RA 2ASQA 3HHMA 4ZRKA 4WJPA 5DPSA 3SU8X 4WJQA 1TXDA 4K2OA 1V5MA 2DAFA 2DYQA 2JY6A 2V1YA 4BBNF 2LULA 3VTUA 4ANWA 5C5BA 2MQJA 3M3JA 3W1YA 4XWXA 1ZC4B 2C9WB 1WJNA 1RRPB 4EZKA 2YT0A 2LRUA 4KIKB 5HE0A 4HB4B 4B9KA 2AWTA 5J3YA 4PQ0A 4GGQA 1ISNA 1GG3A 2VRWB 1YX5B 2JXXA 2COAA 1XD3B 1UH6A 3V62A 4AWJA 1ZKHA 4FBJB 2CY5A 5DHFB 4F8CB 4I6LB 1P3QU 2D2QA 4GZUA 2QKLA 3FSSA 1P6SA 3ZDTA 2BYEA 2K8BA 2W9NA 1V80A 2Z59B 2ZNVB 2DX5B 1MK9B 4K81A 3NZSA 3DVNU 5E6PA 2I1KA 3ODWA 5J3QA 4AJWA 2KX3A 4CHJA 1UD7A 2J7QB 4IWQA 2CHXA 2KWVB 2ZCCA 5CHVC 1NI2A 5CLLB 3TJPA 3V60A 3WAMA 1UEFA 4HHVA 3TCAA 1GUAB 4W9GA 2OTXA 1Q0WB 3WIMA 5KQ1A 2MWSB 2UZRA 3A1QA 4GDKB 1IP9A 3CXBB 4MK0A 4AJYB 5JHGA 1ZSQA 2LUEA 3PGEA 3ZNID 4NJ6A 2RLOA 2YSZA 2KDEB 4WWOA 2JVCA 3OLMD 1A5RA 2DTCA 1V49A 2DKPA 2KKCA 2DHIA 3CSFA 3DBRI 3NSUA 2K1FA 2EMSA 2KUPA 2NPTB 4CYEA 3LDZE 3TBLD 1NU2A 3DCGA 4MSQB 3A98B 2L8JA 2UZSA 1WJUA 3ZLZA 3S2AA 2FNJB 1QC6A 1UNRA 2HJ8A 3OJ4B 2D10A 3FEHA 1J0GA 5C16A 4NJ7A 2LWPA 1WX8A 2K6QA 4GB9A 2J0KA 2DAJA 2D9WA 4GOCA 1P0RA 4II3B 3PT2B 2LYDA 1DBHA 4RMAA 5D27A 2LD9A 3JSVA 2PZ1A 4KSKC 2LASA 2WDTB 3APFA 3HW2B 1BT0A 2RSUA 4P7IA 1LFDA 4XX5A 2GJYA 3DXEA 4EUTA 2EC1A 1QZEA 2CU1A 2N1VA 3A4RA 3RT3B 2DLWA 2KFJA 4IOYX 4MM3A 2FCMA 1P5TA 3QX1A 3ZRFA 4OVVA 4YONA 4DDID 3KH0A 4FJZA 1WGYA 5LXHA 3ZVRA 4M8MA 2LXCA 1XT9B 5JHBA 3ZVVA 3HIZA 2GBMA 4HPMB 3AU4A 2LGDA 2Z0PA 2IFSA 2ZJDA 2LG1A 1E8WA 3IFWB 3RZFA 3VH4B 4HLEA 2R2OA 3H9DA 5LOPB 3UQAA 1MAIA 3EC8A 4W9IA 1ZC3B 2EJ8A 2KCJA 4KAXB 4DXAB 2FCQA 2MX2A 4KVGB 1K8RB 2MBBB 2XEWA 5GOWB 2ROVA 2DENB 3U8ZA 2GBJA 5D3YA 2WX1A 1LW3A 3N7CA 2CHWA 1WH3A 2KMAA 2LGYA 2KLCA 3IG3A 3VQIA 3ZRCA 5CHFA 2PEAA 3OANA 1LXDA 2UYZB 4J6IA 1J19A 2K8CA 5FI0A 1P98A 5JHHA 2O2VA 4F7UP 2KC1A 4DWFA 4DBBA 4DBGA 4JQWC
chains in the Genus database with same CATH superfamily
3SEBA 2PE9A 5I2MA 3H1UA 2ACZB 1YQBA 2WX0A 2VRRB 2MKRA 2PJHA 5DPTA 4A5KA 1OEYJ 2NBUA 2R2QA 2LVPA 3IT4B 2IY1B 1AW7A 1EU3A 1NTYA 1UWMA 2AL6A 2CR5A 1PFDA 4IC7B 4WSFA 1QLBB 2WNMA 3N1YC 4MJSB 4RGTA 2LEKA 1YX6B 4WAAA 2ZZPB 3WAOA 1EU4A 1TY0A 2GS0A 1U2BA 2PVGC 1FAOA 1DYNA 1CQVA 1DYQA 4MJSA 2KVRA 4PK1A 2YEPF 4LDTD 5D3IB 2YS5A 1D5XC 2MJEA 2VKIA 2KXJA 3SFDB 2JZZA 3SO6A 2PPHA 1N3HA 2XNAC 4M02A 1QOGA 1XR0B 2KJRA 1E8XA 4TYZA 4OHJA 3N30A 2ON8A 4W9EA 4JE3B 2GCJA 1NYQA 3C0RB 4G50A 1WRIA 2P0FA 3QCAA 3HUIA 2KUQA 3UIPB 2FAZA 3SR6A 3VIAA 4HWIB 2FIDA 3N9YC 5KHOA 2DX1A 1IBXA 3AE2B 3MHZA 3L10B 2G35A 2M8SA 5D7GA 3KQ4A 3IBEA 4A6HA 2W2XD 5CLQB 4ZRPA 2KTRA 2KD0A 3DWMA 2GBKA 3MTNB 1SJED 3KZ1A 1WXSA 2GI9A 4YT0B 1XLQA 3A33B 1RYJA 3JYUA 1WMHA 3ODXA 3P42A 1QT9A 3N1XC 5EDSA 1W1DA 2MJDA 1GOZA 1WXMA 2IYDB 1BWNA 5HE2A 4WJOA 1J7CA 1FGYA 3FKYA 2LVQA 3UIOB 4URKA 3KRWA 1WE7A 2J53A 2KZRA 4WWNA 2OQBA 1DDMA 2K6DB 3K9PB 2C7HA 4H8SA 1N6ZA 4E3CA 4DXGA 1FRDA 3GE3C 4IWOA 2K2UA 2IPKD 2ELAA 4B6WA 1TZ1A 2LXAA 2JZPA 5DPWA 3QARA 3HQCA 3GP7A 1WZ3A 1OEYA 2ZW1A 3W2DA 5G5HA 3MPXA 1HTQA 2OJRA 5D3WA 4JLCA 4CO7A 1SBBB 4DIXA 2D9ZA 4W9KA 1V97A 1I4GA 1UBIA 3U4EG 1ZPSA 2QIEB 4RGOS 2XK5A 3EHVA 5M4YB 5DPRA 1U29A 2R2YA 1E8YA 4JWSC 1AYFA 2EKEC 1KI1B 3M1IB 1TJEA 3TEXA 1K50A 1WF9A 2Z8LA 1R4MI 4GMVA 1I7AA 4GDLA 3IVFA 1J7AA 5J17A 5H92C 3PRPB 3AULA 4JL9A 3RMKC 2KNBA 2LMCA 2RRFA 5HE3A 5IAAC 1SSNA 1XCQL 3A1QB 4DX8A 1XXGA 3PLUA 2WWZA 5HE1A 4MDKE 1NTVA 3NRZA 3NVZA 3D8FA 2D3CA 3Q3FA 1V1OA 3SYXA 3RUIB 2YS3A 1I7HA 3GOEA 3N1ZC 2D3BA 3AEEB 4YXDB 2OJWA 1LQBA 1EWYC 3QC8B 5C79A 3AM9A 1D4BA 4OSNA 4NSWA 4C56C 4WQOB 1YQ3B 2V9HA 5BYQA 2PMVA 1BXTA 3D32A 3MC8A 1LO5D 1TQZA 1U5DA 2RNRB 3HIEA 4CQNA 3R66C 1EF5A 2DHZA 1UELA 1D3ZA 4DXFA 4L2YA 5EFXA 2IBIB 2L52A 1P7EA 2V3PA 2K22A 1BUIC 3W1SC 1QF6A 1F77A 2W2XC 1TIFA 2Z0DB 3B08A 2WLBA 2DHJA 4KHBA 4FHKA 1VCBA 5LXIB 2J52A 2SAKA 3HVDA 3BVZA 1OQQA 2KMCA 2N9PC 4AOFA 3PZDA 2JZ3B 1WE6A 3AE1B 2DZIA 5HKHA 1D5ZC 1M7EA 1WJ4A 3V61A 4PNKA 2B76B 4FJVB 2B3AA 3TFMA 1YJIA 4YSZB 2MBQA 1SE3A 3ZQ4A 3ZGZA 1VZ8A 4OZBA 2LJ5A 1U27A 5IP4D 1I4RA 2DZKA 3QK0A 4JX1C 3MJWA 2BKFA 4WQMA 2FUHB 4EE2A 1QKZA 1E10A 4GPTB 3A9KB 4US9A 4DDGD 3KUDB 2EMTA 4FHJA 4MACA 2J0MA 2JWZA 3PZ8A 3PO0A 1U5FA 4TUUA 4CHKA 5G2NA 1PGBA 2W2WA 2Z4DA 4LTUA 3T8MA 2LJIA 4QXAB 2KK8A 3A9JB 1JALA 3PZ7A 5BMIA 2KN5A 2MLBA 1EM7A 1VLBA 5T8IA 3BVGA 4TKNA 3ZW3A 1E5WA 2EKIA 3KWVA 4O1NA 2PTLA 1WYGA 1UBQA 4W9HA 2DKQA 3VUWA 3CWIA 1PGAA 2N9XA 2QMTA 4AP4C 1TBEA 3NHEB 4N6EB 3PHXB 5TR5A 2O6VB 4MH0E 1JW9D 3ZJVA 2HDEA 2JT4B 4USAA 1GPXA 2Y5BB 4HJGE 1SIJA 2BW2A 3VTWA 1KM7A 2ZCBA 4FA6A 1WY8A 1WI0A 1DOIA 4ZRKA 3Q14C 4WJQA 1N61A 1TS4A 2DAFA 2JY6A 2MH7A 3LB8C 1UWXA 3U7ZA 3BYTB 2VRWB 3NWDA 2BVCA 4D2KA 4I6LB 1YOVB 2D2QA 2QKLA 2W9NA 5E6PA 1L5PA 2I1KA 3I57A 4CHJA 4IWQA 3V60A 3TJPA 1NI2A 5CLLB 1UEFA 4W9GA 2OTXA 5KQ1A 2UZRA 3NWFA 1IP9A 3AE8B 5JHGA 1KLGD 1A5RA 3NZ3A 4NJ6A 2YSZA 1SB3C 2KDEB 3OLMD 2DTCA 2WP9B 2K1FA 4CYEA 1CK1A 3A98B 3Q3OC 2QSDA 1QC6A 3W9CB 4NJ7A 2LWPA 3FVCA 2Q5WD 2LYDA 2LD9A 2PZ1A 3HW2B 4XYCA 3DXEA 1QZEA 3AE9B 1RWSA 4S0RA 4ZRQA 4R3DA 3ZRFA 5BYSA 4PT5A 5LXHA 2W3SA 3ZVVA 3I5JC 3RZFA 3VR8B 2R2OA 3H9DA 4P6VF 4OVZA 3OJ4B 2MX2A 4KVGB 2MBBB 5GOWB 3R7RA 2DENB 3U8ZA 2WX1A 2KMAA 3N7CA 4ZHOA 3AEFB 3ZRCA 3NWAA 1D6EC 1NEKB 1P98A 1WWTA 4REZA 5BO4B 4MT7A 1LGRA 4BVUC 4NAMA 4XWWA 3P7ZA 1VZ6A 4HSIA 1ZXHA 3NUHB 1TZOA 4ACFA 1WGGA 3RNEC 1PMSA 4ZRIA 4ANUA 4HKQA 4D6WA 1X86A 2MCNB 1ET6A 1C4AA 4KDLB 2GRIA 1SXTA 3P4SB 1L7YA 5I4DA 3EA6A 2ZVNA 3BK2A 2Z13A 2L32A 3VXWA 2NR2A 3VFKA 1XODA 4AS1A 4QJ3B 5AZFA 2KJHB 1S1QB 1YIWA 4I6PA 4TQ1A 4DQOC 2ZKMX 2C60A 1MFWA 2LRWA 1F9JA 4OZAA 2V4LA 3ZTCA 1Z2MA 1N5WA 2M4NA 2RVBB 2X38A 2WU2B 2C7NB 1I35A 1XEEA 1OY2A 2IGGA 2N9EB 4Y94A 2ICIA 3BIID 4A6FB 5FI1A 4EFOA 3UQBA 1IYFA 1GAQB 2RGNB 1SGHA 4G11A 2LUMA 2JSVX 3RNCC 1MIXA 4CHMA 2H89B 1WJ1A 1WGHA 4RF1A 1KZ7A 2PE6B 4LNNA 4HKZE 1FHOA 1HA5A 4HCPB 2ZVOA 1XX0A 3O96A 2CJNA 4W9CA 3Q8EA 4HPPA 3O13A 3H6NA 1MJDA 2KOXA 1JRPA 1HZ6A 4W9JA 4RM9A 1ZP0B 1UZXB 4IUMB 2RD0A 1Z5SB 4US8A 3SNHA 2QILA 4M01A 3ZIMA 1V61A 3CSTA 3ML9A 4ZHPA 1IUEA 2J0JA 2OOBB 3HK0A 3ZJTA 1YJ1A 2BQQA 3H7PB 1MKEA 4GOUA 4F1SA 4XC2A 3P2BA 3Q3MC 1Y5OA 3NVYA 3X0WA 3KUZA 2HTHA 3QA8A 4KIKA 4WIPA 1NI3A 4A8XC 4MGYE 1FD6A 3HM6X 3GYPA 1YN5A 2FCSA 2KFKB 1ENFA 2P0HA 1PDXA 3J9CA 1M7RA 3Q8BA 3DOWA 5GMVA 3AN1A 3L4PA 1L0XB 3VOQA 4PYUA 4L6EA 1WGKA 1T0SC 1YMHE 4GDKA 2H7DA 1KRHA 1TTNA 4KZCA 2Y8GA 2HJ1A 4BKTA 2V3SA 2D9YA 2INPE 4W9FA 2L05A 1GC7A 3AEAB 1FXAA 3L0WB 2C5LC 1IBXB 2WXJA 3LYYA 2XN9C 1WGQA 1WVHA 1WFYA 3SFEB 1E6EB 1BTKA 2KO3A 1SE9A 3NS1A 5BMHA 1ZXIA 3IAM1 4G0NB 4ZYNA 3SV1A 3EECA 1WIAA 3T3OA 2BBCA 3GYOA 5CHFA 2ZNVC 1WXVA 2WXNA 1ZDVA 1JROA 2AQ1B 2DZJA 4M0WB 1TKEA 4A3PA 4RNAA 3Q3NC 5L95C 1FFVA 3OWEB 4X57B 5D3DA 3RN9C 4RGMA 2M1MA 3BJIA 2PIAA 3ULBA 2LHEA 4ICUA 2HTME 3AJ4A 2FCNA 3CF6E 1X05A 4GN1A 1I4XA 4TMAB 3FC4A 4YL8A 2NPTA 3WYFB 2RGFA 3RI7C 2IO0B 3RULA 2K8EA 3W1SA 1FFUA 2ZPYA 1WJ6A 1FHXA 1T77A 2GB1A 2WU5B 2WXRA 2J42A 1SE2A 2D3GA 2CODA 3PVUA 3DBSA 1FPYA 3PRMB 3RD2A 3RNGC 4C4VA 2N0SB 4FULA 2MA9B 1S3SG 4JGHB 3PPAA 2JP2A 5IO9A 4QJ4B 4H2AA 1J7BA 1E9MA 1WGRA 2KGXB 3EGRA 2WXLA 2Y7BA 1ZDXA 4KGTA 4N58A 4DK5A 3DWGC 3ECIA 4C7ZA 3NVWA 1L0VB 4KKIA 4BBKA 4RGNA 3VVWB 2I5CA 2I38A 4HAWB 1Z87A 1HEZE 2CS4A 2L0TA 1RFAA 4BKGA 5E6OA 1MHHE 3VH3B 1V88A 1I4HA 5HHDG 1F0ZA 1RFKA 3PVLA 5D3XA 1XLOA 3B2GA 4WJ7A 1Q10A 1XLPA 5IKCM 3HSAA 4AUQC 5JLJB 3DXCA 4KSLC 5C5BB 1GC6A 1JQ4A 1OFFA 3TIXA 2DBYA 2GBNA 5JP4A 3MHSD 5H8YE 1MG4A 1C76A 3H7SA 4GXBA 2WS3B 3N32A 2J4XA 4IAPA 5AUKA 4LNOA 3Q2AC 4BKSA 3AE3B 3RFZB 3NJTA 4WVFB 4KX6B 2DZMA 3M63B 1X11A 3DVGY 3CIRB 1PYWD 2KN4A 3WAPA 3CMMB 2BPSA 2WQYB 3ENEA 3ZKJC 1GB1A 3TL5A 4ZDVA 5C23A 3L54A 2BKRB 2FIFA 1AQCA 2V76A 1N62A 3RNBC 5E6NA 1E90A 3V6CB 3U52E 2UVMA 2D3AA 1WI1A 1IPGA 4EZLA 3ODOA 2IZVB 2W55A 3L16A 2O6VD 2L2IA 1XKEA 1JWMD 1FOEA 2PLPA 4EMOA 2LOZA 1ROEA 2WXPA 1WGUA 3A8QA 4A6KA 5E6JA 2KQ4X 3DBHI 1AWEA 4NQKE 1E7VA 4A6FA 2BB5A 3OJ3A 1C9FA 2NBWB 4BZAA 3PEGA 2COFA 3G9WA 4NNJB 3GZNB 2LI5A 2DN6A 1FCLA 1ZVRA 1U5GA 2N0YA 5C6RA 5DPSA 3B77A 4YTNB 3A58A 2DYQA 1K53A 2NMQA 3W1YA 2LRUA 4B9KA 5EE1A 5J3YA 4PQ0A 4GGQA 1ZUD2 2JXXA 1GG3A 4A9AA 3BZDB 1UH6A 1DOXA 1N60A 4FBJB 2CY5A 5DHFB 4F8CB 1P3QU 3ZDTA 1B1ZA 2BYEA 2DX5B 3NZSA 3DVNU 5J3QA 4AJWA 1XLNA 1UD7A 3WAMA 3TCAA 1GUAB 2MWSB 3CXBB 2V0GA 4AJYB 2LUEA 1UF0A 1I4PA 3DBRI 1TT5B 4J3OD 3TBLD 4MSQB 4B0EA 1WJUA 1N5XA 1YQ4B 2HJ8A 2KDMA 3FEHA 5C16A 2INCC 3TEZA 3ABVB 1YN3A 2PKOA 1DBHA 2WDTB 2RSUA 1BT0A 4XX5A 4P7IA 1LFDA 4EUTA 2DLWA 4MM3A 2Y5CA 4YONA 3VRAB 1HTOA 5HFYA 2IFSA 1E8WA 2VH1A 4XE0A 4W9IA 5MPOA 1MI1A 4KAXB 2CHWA 2PEAA 2UYZB 2M19A 1ACCA 5FI0A 5JHHA 1AN8A 3FILB 4RCOA 4B0MA 3BY4B 1Q67A 2NS5A 4WWMA 1WMHB 3E56A 3QBVB 3W5VB 3P63A 1Y19B 1ZM0A 1L4DB 2MFQA 1UNQA 4ARCA 2MW5A 2V4IB 1E7UA 5J18A 1U4AA 2RSGA 1Y8RC 4HAZB 4LLGM 2Y5PA 5EE3A 4B95A 3MC0B 2CKHB 2AQ3B 2WXOA 4GLSC 2K5PA 1FXIA 3IT6B 1H8CA 3UZTA 2MDXA 1KF6B 5CHWA 1VJKA 3VUXA 2CJOA 2UWQA 2G3QB 4CSQA 4QJ5B 2ADZA 2L1AA 2R09A 4JWUC 2QC8A 4EJNA 3TVVA 2RR9A 1HE8A 3NZUA 1T0QC 1F1HA 1OGWA 4HPLB 4GIVA 4NY0A 3PREA 2IO1B 2MBOA 3U7DA 1C78A 3Q8FA 3JSVB 2DYOA 1WSPA 2M17A 3ULCA 3P4PB 4MGIE 2NBVB 4WH4A 1B55A 4IWPA 2MHJA 3I63C 4K7SA 1FNWA 2BS3B 3QAQA 2N9KA 4XDDA 2CY4A 1YNTE 2MWNB 3DXDA 2Z0EB 3KLSX 1TKYA 1OQNA 4M00A 3ALBA 4K7UA 4KHOA 3LJUX 3M95A 4GDLB 5C2TB 3BK1A 2K3UA 1JRUA 4Z2MB 2DYNA 5DHAB 5D3VA 2AYOB 4NPNA 2L1CA 3TEWA 1Q5WB 1TS5A 4NQLB 1OQYA 4G3XB 5DH9B 3MJ5A 3H8HA 1DGJA 2N4FA 2BYVE 4MEMA 3A9JA 4L23A 4JPSA 1YJJA 2JRHA 2M14A 1XCTL 4S17A 1QQGA 4HDOA 3UF8A 2N9LA 2BWES 5G5GA 1FXTB 2RDBC 3P6AA 2WXMA 4DX90 5L81A 2WXKA 2KJ6A 3Q8AA 3HRDD 3VDZA 3DBLI 5LG4B 2QJLA 3L08A 2KFKA 3N3KB 1F2RC 1Q1OA 2KANA 3MFGA 5HG2A 2VZKB 4MH8A 3ZO5B 5DCNA 3R2IA 1KTKA 1V5TA 4RFBA 2N7JA 4HAYB 2HD5B 5DI9B 1UPQA 1UPRA 2AEHA 2QEJC 3GB1A 1VRAB 4FXCA 3HVZA 2KC2A 2L7RA 5C3JB 1C4PA 2MBEA 4HATB 3TW1A 1STEA 2LKOA 2IY0B 5AZHA 1D5MC 1J0WA 1IGDA 3A8PA 1WGDA 2AL3A 1YN4A 5BYRA 4IG7B 2IO3B 3PS6A 1KZGA 3ML4A 2M0AA 3JW0X 1LB1A 3DHGC 3K9OB 2I1JA 1XCGA 1P1AA 4HK2A 4OVUA 1ET9A 1FM0D 3PV1A 2SEBD 4LJPB 2N23A 1WR6E 1JMLA 3N20C 2MEKA 1T3QA 1XF5L 1R4NI 2GOWA 3Q3JA 3P1MA 2MBHA 5JHAA 2JU6X 2D07B 2KWCA 4KKJA 3V3XA 2GMIC 1KLVA 3L17A 4K1RB 5FK9C 2NMBA 2HTHB 2K25A 4ASWC 2N1WA 4FN2A 2PVOD 3B0AA 3KYDD 1KOTA 1H4RA 2N7EA 1SE4A 1X1FA 2LGSA 4P1BC 1L6VA 1UGJA 4MY6A 4WWPA 1C1YB 4PS7A 3AU5A 3DVGX 1KLUD 2L3ZA 5GXGB 2WGSA 4XDCA 1K5GB 1WX7A 4A6QA 2V3NA 4EZJA 1BMLC 2KR0A 2K49A 1FNUA 3Q6BA 2R61A 2BYTA 2QHOA 1MI0A 4C4VB 1Y56A 4NJCA 4ZYSA 1EVHA 2Y8FA 1V86A 1L2NA 3T9LA 5J3TA 2R0DA 1K51A 2MRPA 2IO2B 2WXGA 2XK5B 2NTTA 4KGSA 2GLSA 4DHZB 1V2YA 5LONB 3AEDB 3EUB2 4KHAA 3NS8A 3QJZA 1XO3A 1TJ6A 2ELBA 1A70A 3B9JA 2Z14A 3MP9A 2KQSA 3MC9A 4LNFA 3U30A 2JUOA 4MM3B 1C4CA 1GB4A 2VSZA 2K0PA 3JVZX 3VR9B 3SUZA 3ZNGC 2G1EA 4ZRJA 2IYBA 3DCXA 3TEYA 3FM8C 4BOSC 3D8DA 2D11A 1UUPA 4ICVA 2LHDA 4MELA 4EKUA 1W1GA 2M38A 3HM3A 4KDIC 3PTFC 4TV3A 2DNFA 2REXA 3U12A 2KDBA 4E71A 3ONSA 2MP2A 2BWFA 4BKSD 2KT7A 4UDUC 2ZEQA 3APCA 3RCZA 1FMAD 4II2B 2FJLA 1EGXA 3ZXRA 2KLGA 2G9HD 4MT5A 2DA0A 5JH5C 3RCPA 4RF0A 1FO4A 3RYTA 3PRZA 1FNVA 1EUVB 2A5UA 2FUG1 5HI1A 5L83A 1E7PB 1XD4A 2FE8A 2J59M 3KY9A 5JXVA 1CZPA 4C00A 3IHPC 2L00B 4DHZE 4IM3A 3AECB 1UNPA 2D9VA 1V9JA 1RRBA 5KCVA 2K8HA 1NDDA 2CRFA 2RDGA 2X18A 4HEA1 5LLIA 2C7MB 2L83A 3TMPB 4IM2A 4FJYA 3RNFC 3UGBB 2NBVA 4RM8A 3VAWA 3H7PA 4ANXA 3HHMA 4WJPA 3SU8X 1MHXA 4K2OA 4BBNF 3URYA 1RM6C 2V1YA 2LULA 4ANWA 5C5BA 2MQJA 4IKGA 3M3JA 1N63A 1WJNA 1RRPB 3OG5A 4KIKB 5HE0A 4HB4B 2AWTA 2LFIA 3IXSA 1KFYB 1XD3B 1HQRD 4GNKB 4AWJA 4LNIA 1ZKHA 1QOBA 1R4NB 1P7FA 4GZUA 2ZNVB 2AQ2B 1V80A 4K81A 1AWDA 2RPVA 1TKGA 2AX5A 2KX3A 1PUTA 1JWBD 2J7QB 2KWVB 2ZCCA 5CHVC 4HHVA 4XGAB 3DHIC 2W3RA 2EELA 1Q0WB 3WIMA 4GDKB 3A1QA 3B2FA 4MK0A 1ZSQA 3PGEA 2RLOA 2FBWB 1WXQA 2DHIA 3NSUA 3AE5B 3DCGA 2L8JA 3ZLZA 2FNJB 1UNRA 2D10A 1WX8A 2K6QA 2MJ3A 4GB9A 2J0KA 4GOCA 3ETRA 4HROA 3ZJUA 5D27A 4KSKC 2LASA 2EC1A 3A4RA 5I2SA 2CU1A 3RPFC 3RT3B 2IGHA 2FCMA 4OVVA 1VDVA 1FEHA 1WGYA 1F2RI 3ZVRA 5JHBA 2GBMA 4HPMB 2WDVB 3IFWB 2LG1A 3VH4B 2D5GA 4HLEA 3UI3A 5LOPB 2INNE 1MAIA 3NW8A 3EC8A 2FCQA 2XEWA 2KCJA 4DXAB 2GBJA 5D3YA 3IG3A 1LW3A 2LGYA 2NTSA 1E0ZA 2KLCA 2QDFA 4J6IA 3OANA 1LXDA 2O2VA 1M4VA 4F7UP 3DBRB 1VD2A 4DBGA 3V6EB 1RAXA 1V81A 3EFUA 4EEWA 1XQQA 2K39A 3AE4B 2KMMA 2PW9A 2KTRB 4FADA 2JX5A 2O2VB 3SDLC 3AE7B 4GSWA 4KHBB 3PSEB 1CJEA 1WYWB 2BF8B 1V1PA 3A4SC 1NVID 5EE0A 2KTFA 1MG8A 2LOXA 3IAS1 3WALA 1OMWA 2HE7A 1WZ0A 3KYCD 2MP2B 4B6HA 4LCDE 5AZGA 1V5OA 1MIZB 1H10A 1U5EA 1I4QA 1OTRB 3PHWB 4YWGG 1V5PA 2JYEA 1DROA 3ZXVA 4JIOU 1M94A 2G4SA 4HAXB 5BMGA 1ZE3D 3A9KA 3PVWA 4LNKA 2DFKA 1WXAA 2VH2A 2DWQA 5IRSA 3OAWA 4K3BA 3ML8A 1C3TA 3P4QB 2GCLA 3OHMB 4XWTA 1EF1A 3W5UB 1B9RA 3PP2A 5FR6A 3MDBC 1SIFA 3UINB 1QOFA 1L6UA 5AUIA 2KQ7A 2YLMA 1DDWA 4KGRA 2BB6A 4MGKE 2DLBA 1IGCA 1MK7B 1RJ2A 2P8VA 2NVUI 3PLVA 2CAYA 2K00A 4A20A 1FHWA 1K52A 5D94A 1F52A 2YS1A 1I42A 2QCZA 3CIKA 2D9XA 3DBHB 2WXQA 4HAVB 4K2PA 1EWCA 4WJNA 2BCJA 4P16A 2H88B 4BFRA 2WHIA 1V8CA 1UNSA 2KIEA 4Z2NA 5DIFB 1ZOYB 2BS4B 3NY5A 3SHQA 1IRSA 3Q69A 3NG0A 4IW0A 3T06A 5J2RA 1V6EA 2X8XX 4C0AA 1JWUD 1BTNA 1C79A 2BS2B 4TQ0A 3VUYA 3BINA 3DBLB 2KDFB 1T0YA 2RUKB 4I6NB 1KH0A 4GU2A 1V89A 5G55A 2XBBC 3M62B 2G45B 1UGMA 2UU7A 1E8ZA 3V5WA 2VZKD 2Z0OA 1EAZA 1K5DB 2KHWB 4AQ7A 1WR1A 2JF5A 3Q8CA 4KZ0A 4A3OA 3F0WA 5AEKB 2OHFA 4RH6A 2I5FA 1FGZA 2JRIB 4IOIE 3NOBA 2IGDA 1WM2A 4HDQA 1AARA 2ZPNA 1NBFC 2OEDA 2I2YA 2E2XA 3WA0A 3QQ8B 2BTEA 4HB0B 3F5RA 4K17A 2WDQB 4W9DA 3BYYB 2A4ZA 3LXFA 1C77A 3X23A 5KQ4A 4HXDA 4F7ZA 4DHJD 4HAUB 5JZEB 5D6JB 2JWUA 5EE9A 4OT1A 2M0XA 1PLSA 2Q13A 1TYGB 4IFSA 1FCCC 1SEBD 2LGIA 4BAXA 4PYZA 5CX3A 3AI5A 2LGXA 2YT1A 3L13A 3C19A 1P9DU 4HB3B 2INDC 4EOYA 1MPEA 4YSXB 3VHTC 2DHKA 3GS2A 1J8CA 3AEBB 2RPQA 4NAWA 4K7WA 4PS3A 2K9XA 2ONQA 3KUCB 1V1PB 3KW5B 4NAWB 2NCNA 4BOZB 2LZ6A 2MSED 2KDIA 1WX9A 4XZ4A 4LJOB 3ZNZB 3WCQA 3TO1A 1PGXA 2L0FA 1KJTA 2WYQA 1LM8B 1TS2A 1L0YB 2N7DA 4C7YA 2KWDA 2BGFA 3WANA 3PG7A 4KV2A 2KWUB 4WAFA 4E74A 2GBRA 3KVFB 5KHQA 2P0DA 1GJZA 2Y3AA 3TSSA 5C1ZA 2JQRB 3I9V1 1FB8A 3O65B 4YSYB 2M56B 2G4DB 2YVCA 3VTVA 4ZOHC 4F7HA 2KX0A 3DDCB 4HCNB 3SD5A 2LVOA 1PFJA 2WXFA 3BVMA 4HB2B 3AEGB 1W1HA 4LK0M 5D2MB 3AMZA 1DDVA 3QWMA 1QILA 3APDA 3BWUD 3P4RB 3AV8A 1GNUA 3DQVA 1ZYIA 3B1LX 4IM0A 3AXCA 2COCA 1FIQA 3AH7A 1V5UA 1X1GA 2O6VA 4N9F4 2WXHA 1P3RA 3R8BA 3I3TB 1R4MB 2H7EA 3LJ3A 2L76A 1EO6A 3TUOA 2KVZA 1JCKB 2DYMA 1PQSA 1TGZB 1ZGUB 3DVNV 3QWZB 3ZUNA 2JPHA 2CU3A 3RNAC 4IDIA 2ROZB 3PSCA 5LNK1 2RMMA 1ESFA 1T5XD 2KIGA 2BT6A 1YD8U 2JXTA 4HVBA 2DX5A 4N59A 2BYFA 4FLHA 3DPDA 2D4QA 1FRRA 1WM3A 3KRXA 4GMXB 3QIJA 1RLFA 4W9LA 4A90A 3RZWC 1WG7A 2E6XA 3D8EA 4OZCA 3KWLA 2DYBA 2NZ8B 4D0NB 2K2JA 2XQNM 5IA7A 3EFCA 1WRDB 2IDYA 2WDRB 4MGZE 3QHTA 2CHZA 2YF0A 4HRSA 1BAKA 1X1MA 4YTMB 1SHCA 4M8NA 1QQRA 4ANVA 2YEPB 3T3NA 3ZYYX 5IN7A 4TSSA 5CTRC 4WURA 1CMXB 4MSMB 4LDTB 3GZNI 2QKMA 2W54A 3R7QA 4DHJB 3ZDMC 2TSSA 1VZ7A 2WXIA 1I2HA 3R3MA 1ZW7A 3NVVA 2Z0QA 4P1CC 1MPHA 3ZTDA 2YRYA 2IJ0A 3ZNHB 1HZ5A 4PS8A 1DOYA 3C8YA 4F7GA 1T6BX 1WJMA 4BBNC 3AE6B 3KSYA 4HJKA 1SJHD 2ASQA 1TXDA 1V5MA 2GUMA 4L1BA 1HXYD 4Q2JA 3VTUA 1QOAA 4XWXA 1ZC4B 2C9WB 2W82A 4NZLB 4EZKA 2E3TA 2YT0A 2YT2A 1G6JA 1ISNA 1YX5B 2KAJA 2COAA 3V62A 3FILA 1VR9A 1MVKA 3FSSA 2K8BA 2Z59B 1P6SA 1T0RC 4M0WA 1TS3A 1MK9B 3ODWA 1NENB 3VRBB 2CHXA 4OW0A 5FKAC 5IOIA 2Z59A 1SF0A 3ZNID 3GE8C 2ZW0A 4WWOA 2JVCA 1V49A 2DKPA 2JYTA 2KKCA 3CSFA 3FAHA 2EMSA 2KUPA 2NPTB 3LDZE 1R7SA 4C80A 1NU2A 1TY2A 4L1RA 2UZSA 3DHHC 2FJUB 5FR3A 3U2SC 3S2AA 4ARIA 1L4ZB 1J0GA 4YTPB 2DAJA 2D9WA 1P0RA 4II3B 3PT2B 4K3CA 3AB5A 4RMAA 3JSVA 1JWAD 3APFA 3R2TA 2GJYA 2N1VA 2KFJA 4IOYX 1P5TA 3QX1A 2KACA 4DDID 3KH0A 4FJZA 4M8MA 2LXCA 1XT9B 2KYWA 3HIZA 3AU4A 1OQRA 2LGDA 1JWSD 2Z0PA 2ZJDA 5TSSA 3UQAA 3E9SA 4ITKA 1ZC3B 2EJ8A 1K8RB 2RDHA 2ROVA 3VQIA 4A55A 1WH3A 1NYRA 4QAYA 1J19A 2K8CA 3V05A 2KC1A 4DWFA 4DBBA 4JQWC
chains in the Genus database with same CATH topology
2PE9A 3V6EB 1RAXA 1V81A 4MT7A 3EFUA 3H1UA 1XQQA 2K39A 4EEWA 4BVUC 3BY4B 1Q67A 2NS5A 1YQBA 2WX0A 1WMHB 2KTRB 4FADA 3QBVB 3P7ZA 2VRRB 2O2VB 3SDLC 2MKRA 1Y19B 4GSWA 1ZM0A 4KHBB 3PSEB 2PJHA 5DPTA 2MFQA 1UNQA 1WYWB 4A5KA 2BF8B 2MW5A 1E7UA 1OEYJ 2NBUA 2R2QA 3A4SC 1WGGA 5J18A 1U4AA 2LVPA 1PMSA 4ZRIA 4ANUA 2IY1B 1X86A 2MCNB 2RSGA 1Y8RC 4HAZB 1NTYA 2KTFA 1MG8A 4KDLB 2LOXA 3WALA 5D7GA 2AL6A 1OMWA 2CR5A 2HE7A 1L7YA 1WZ0A 4B95A 3KYCD 2MP2B 4IC7B 2CKHB 2ZVNA 4WSFA 4B6HA 4LCDE 5AZGA 1V5OA 3VXWA 4MJSB 1MIZB 2NR2A 1H10A 1U5EA 1YX6B 1OTRB 3VFKA 4WAAA 1XODA 2ZZPB 3PHWB 1V5PA 3UZTA 5AZFA 2KJHB 2MDXA 1DROA 4JIOU 3WAOA 2GS0A 1M94A 5CHWA 1S1QB 1U2BA 3VUXA 1FAOA 1DYNA 1YIWA 2UWQA 2G4SA 2G3QB 4HAXB 4I6PA 4TQ1A 4MJSA 2KVRA 2C60A 2ADZA 2LRWA 3PVWA 2R09A 1F9JA 3A9KA 2V4LA 4LDTD 3ZTCA 2DFKA 2YS5A 4EJNA 1WXAA 1Z2MA 2RVBB 3TVVA 2M4NA 2RR9A 2C7NB 3ML8A 1HE8A 3NZUA 2VKIA 2KXJA 2GCLA 2JZZA 1C3TA 1EF1A 3SO6A 1OGWA 1N3HA 2PPHA 1I35A 4HPLB 4GIVA 4NY0A 1OY2A 1XR0B 2KJRA 1E8XA 2N9EB 4TYZA 3PP2A 4Y94A 3MDBC 1SIFA 3PREA 5FR6A 3UINB 4A6FB 5FI1A 4EFOA 3UQBA 2IO1B 2MBOA 3U7DA 3N30A 1IYFA 2KQ7A 2YLMA 1DDWA 2RGNB 3JSVB 4W9EA 4MGKE 2DYOA 2GCJA 1SGHA 3C0RB 4G11A 4G50A 2M17A 1MK7B 1RJ2A 2P8VA 3ULCA 2NVUI 3PLVA 4MGIE 2NBVB 5BO4B 1MIXA 1B55A 2CAYA 4CHMA 4IWPA 2P0FA 4K7SA 2K00A 3QCAA 3QAQA 4A20A 1WJ1A 1WGHA 4HVBA 3UIPB 1KZ7A 1FHWA 2CY4A 2PE6B 1FHOA 4HCPB 2FAZA 5D94A 3VIAA 2YS1A 1I42A 4HWIB 2MWNB 2ZVOA 3DXDA 2Z0EB 1XX0A 2FIDA 5KHOA 2DX1A 3CIKA 3O96A 4W9CA 1OQNA 2D9XA 2G35A 3L10B 3ALBA 3H6NA 2M8SA 4KHOA 3LJUX 2KOXA 4HAVB 4K2PA 3IBEA 3M95A 2BCJA 4A6HA 4GDLB 2W2XD 5CLQB 4WJNA 4BFRA 2KTRA 4W9JA 3R7RA 4RM9A 1JRUA 2KD0A 4Z2MB 4Z2NA 2GBKA 3MTNB 5DIFB 2DYNA 1UZXB 3NY5A 4IUMB 5DHAB 1Z5SB 2RD0A 1IRSA 3SHQA 5D3VA 2AYOB 3KZ1A 1WXSA 4NPNA 3SNHA 2L1CA 4IW0A 3A33B 3T06A 3ZIMA 1V6EA 1Q5WB 5J2RA 1V61A 4NQLB 3CSTA 3JYUA 1WMHA 3ODXA 3ML9A 4K7UA 4C0AA 1OQYA 5EDSA 1W1DA 1BTNA 5DH9B 2J0JA 2OOBB 3HK0A 4G3XB 4TQ0A 3VUYA 1YJ1A 3BINA 1WXMA 2N4FA 3H7PB 2IYDB 1G6JA 1MKEA 2BYVE 2KDFB 3A9JA 1BWNA 1T0YA 4MEMA 5HE2A 4WJOA 4F1SA 1FGYA 2M14A 2RUKB 2JRHA 4I6NB 3P2BA 4XC2A 2LVQA 3UIOB 1Y5OA 1QQGA 4HDOA 4GU2A 1V89A 5G55A 3UF8A 3X0WA 4URKA 2XBBC 3KRWA 1WE7A 3M62B 2BWES 2G45B 1UGMA 3KUZA 2KZRA 1FXTB 4WWNA 2HTHA 1E8ZA 3QA8A 2OQBA 3P6AA 1DDMA 3V5WA 4KIKA 3HM6X 4MGYE 3GYPA 4DX90 5L81A 2Z0OA 1EAZA 2K6DB 3K9PB 2FCSA 2C7HA 1K5DB 2KFKB 2KJ6A 2KHWB 4H8SA 1WR1A 3DBLI 3VDZA 2P0HA 2JF5A 4KZ0A 4E3CA 4A3OA 3F0WA 3L08A 2KFKA 3N3KB 5AEKB 2I5FA 1M7RA 1FGZA 1Q1OA 2KANA 4IWOA 3DOWA 2K2UA 2JRIB 5GMVA 2ELAA 3NOBA 3ZO5B 5DCNA 4B6WA 1WM2A 1TZ1A 4HDQA 1V5TA 1AARA 2LXAA 2ZPNA 4HAYB 2HD5B 5DPWA 3VOQA 4PYUA 1NBFC 4L6EA 1UPQA 1UPRA 2AEHA 5DI9B 3QARA 2E2XA 4GDKA 2H7DA 3WA0A 3HQCA 3QQ8B 1TTNA 2KC2A 4KZCA 2L7RA 2Y8GA 3F5RA 4HB0B 1WZ3A 1OEYA 4K17A 2MBEA 4HATB 4BKTA 3MPXA 3TW1A 2D9YA 2LKOA 2V3SA 4W9DA 2IY0B 2OJRA 2L05A 1GC7A 5D3WA 2A4ZA 4JLCA 4W9FA 4CO7A 5AZHA 3X23A 1J0WA 2D9ZA 3L0WB 4W9KA 3A8PA 1WGDA 2C5LC 2AL3A 5KQ4A 4HXDA 1UBIA 4F7ZA 4DHJD 4HAUB 5JZEB 5D6JB 1WGQA 1WVHA 1WFYA 4IG7B 2M0XA 2IO3B 1BTKA 1PLSA 2Q13A 3PS6A 1KZGA 3ML4A 4IFSA 2KO3A 1SE9A 3JW0X 2XK5A 3EHVA 5DPRA 1U29A 1LB1A 4G0NB 1E8YA 3SV1A 3EECA 4PYZA 4ZYNA 1WIAA 5CX3A 3AI5A 2EKEC 1KI1B 3M1IB 3GYOA 3K9OB 2I1JA 1XCGA 2YT1A 1P1AA 1WXVA 1WF9A 2LGXA 2ZNVC 3L13A 4HK2A 1R4MI 4GMVA 1I7AA 3PV1A 4OVUA 2DZJA 4LJPB 1P9DU 4M0WB 2N23A 4HB3B 3IVFA 4GDLA 4A3PA 4EOYA 5J17A 3PRPB 3AULA 4JL9A 5L95C 1WR6E 3VHTC 2DHKA 2KNBA 1J8CA 4X57B 2RPQA 4NAWA 4K7WA 4PS3A 5HE3A 2M1MA 3BJIA 1R4NI 2GOWA 5IAAC 3Q3JA 3A1QB 3ULBA 1H8CA 4DX8A 2MBHA 5JHAA 3PLUA 2D07B 2KWCA 3KUCB 4ICUA 3AJ4A 2FCNA 2WWZA 3KW5B 5HE1A 2GMIC 3CF6E 1X05A 4GN1A 4MDKE 4NAWB 1KLVA 1NTVA 3L17A 2NCNA 4K1RB 2NMBA 4BOZB 2HTHB 4YL8A 2NPTA 3WYFB 2LZ6A 2MSED 2KDIA 2RGFA 1WX9A 2K25A 3D8FA 4ASWC 2IO0B 4XZ4A 2N1WA 3Q3FA 4LJOB 3RULA 3ZNZB 4FN2A 3TO1A 1KOTA 3SYXA 3B0AA 2L0FA 3KYDD 1KJTA 3RUIB 3W1SA 2YS3A 1H4RA 1LM8B 2WYQA 3GOEA 2N7EA 2ZPYA 1WJ6A 1X1FA 2N7DA 1FHXA 1LQBA 2BGFA 3WANA 3QC8B 3PG7A 4MY6A 4WWPA 5C79A 1C1YB 3OAWA 4PS7A 4KV2A 2KWUB 4E74A 3AU5A 2GBRA 2D3GA 2L3ZA 2P0DA 3DVGX 3KVFB 5KHQA 1GJZA 1K5GB 5C1ZA 2CODA 3PVUA 1WX7A 3DBSA 4EZJA 1FB8A 3PRMB 3O65B 3RD2A 4NSWA 4WQOB 2G4DB 2YVCA 3VTVA 2QHOA 4F7HA 2KX0A 3DDCB 4FULA 4HCNB 3D32A 2MA9B 3SD5A 1EVHA 1PFJA 1S3SG 1TQZA 2Y8FA 2LVOA 4JGHB 3PPAA 1V86A 1U5DA 2RNRB 4HB2B 2JP2A 1L2NA 1W1HA 3R66C 3T9LA 5J3TA 2R0DA 2MRPA 1EF5A 2DHZA 1WGRA 2IO2B 5D2MB 1UELA 2KGXB 1D3ZA 1DDVA 2Y7BA 3QWMA 2XK5B 5EFXA 2IBIB 4DK5A 3APDA 4DHZB 1V2YA 3ECIA 5LONB 4KHAA 3NS8A 1GNUA 3DQVA 3QJZA 4BBKA 1TJ6A 3B1LX 3W1SC 4IM0A 3AXCA 2COCA 2ELBA 3VVWB 2W2XC 2Z0DB 3B08A 2I5CA 4HAWB 1Z87A 2CS4A 2L0TA 1V5UA 1RFAA 4BKGA 2DHJA 2KQSA 1X1GA 5E6OA 3U30A 2O6VA 2JUOA 1V88A 4FHKA 4N9F4 1VCBA 3VH3B 5LXIB 2VSZA 1P3RA 3I3TB 2H7EA 3LJ3A 3JVZX 2L76A 2KMCA 3SUZA 1EO6A 2N9PC 3PZDA 3ZNGC 4AOFA 3PVLA 5D3XA 2JZ3B 1WE6A 2DZIA 4ZRJA 2DYMA 2IYBA 1PQSA 1TGZB 5HKHA 1M7EA 1ZGUB 1WJ4A 3DVNV 3QWZB 3ZUNA 3V61A 4PNKA 3FM8C 4BOSC 4WJ7A 3D8DA 2JPHA 4FJVB 2D11A 4ICVA 2B3AA 3TFMA 2MBQA 2ROZB 3PSCA 4AUQC 4MELA 4EKUA 5JLJB 3DXCA 4KSLC 2LJ5A 1U27A 1YD8U 5C5BB 1GC6A 2DZKA 3QK0A 1W1GA 3MJWA 3TIXA 2DX5A 2M38A 3HM3A 2BKFA 5JP4A 2GBNA 3MHSD 4KDIC 2FUHB 2BYFA 3PTFC 4FLHA 4TV3A 3DPDA 2D4QA 4GPTB 3KRXA 4GMXB 3QIJA 1RLFA 1WM3A 2KDBA 2REXA 3A9KB 3KUDB 3ONSA 3H7SA 4DDGD 4E71A 2EMTA 4GXBA 4FHJA 4W9LA 2MP2A 2J0MA 3RZWC 1WG7A 3N32A 2BWFA 4IAPA 2JWZA 3D8EA 4BKSD 4BKSA 1U5FA 4TUUA 2ZEQA 4CHKA 2DYBA 3APCA 5G2NA 2NZ8B 4WVFB 4D0NB 2K2JA 2W2WA 3RCZA 2XQNM 5IA7A 2DZMA 3M63B 4II2B 1X11A 3DVGY 1WRDB 2FJLA 3T8MA 4MGZE 3QHTA 1EGXA 2CHZA 2KK8A 3CMMB 2BPSA 3WAPA 3A9JB 3ENEA 3ZKJC 3TL5A 2KLGA 2YF0A 4ZDVA 5C23A 2KN5A 3L54A 1BAKA 2BKRB 2DA0A 2FIFA 2MLBA 5JH5C 1AQCA 2V76A 1X1MA 3RCPA 1E90A 5E6NA 4TKNA 3RYTA 1SHCA 1VD2A 1E5WA 4M8NA 3PRZA 3V6CB 3ZW3A 2UVMA 1EUVB 2A5UA 4ANVA 1WI1A 1IPGA 4EZLA 5L83A 3ODOA 2IZVB 3L16A 2O6VD 2L2IA 1UBQA 4W9HA 2DKQA 5CTRC 3VUWA 1XKEA 1XD4A 1FOEA 2J59M 3KY9A 1CMXB 2N9XA 1TBEA 4AP4C 4MSMB 3NHEB 3IHPC 4EMOA 2LOZA 2QKMA 2L00B 3GZNI 3PHXB 4IM3A 4LDTB 1WGUA 4DHZE 3A8QA 3R7QA 4DHJB 4A6KA 1UNPA 5TR5A 3ZDMC 2D9VA 1V9JA 2O6VB 3DBHI 1RRBA 1AWEA 4NQKE 1E7VA 4MH0E 1I2HA 5KCVA 3R3MA 4A6FA 2K8HA 1NDDA 1ZW7A 3OJ3A 2CRFA 2Z0QA 2NBWB 1MPHA 3ZTDA 2YRYA 2X18A 2COFA 3PEGA 3ZNHB 2JT4B 4PS8A 5LLIA 2C7MB 3TMPB 4IM2A 2Y5BB 4FJYA 4F7GA 3G9WA 4NNJB 3UGBB 1WJMA 2LI5A 4BBNC 2DN6A 3KSYA 3VTWA 1KM7A 2ZCBA 4HJKA 4RM8A 4FA6A 1WY8A 3VAWA 1WI0A 3H7PA 1ZVRA 1U5GA 4ANXA 2N0YA 5C6RA 2ASQA 3HHMA 4ZRKA 4WJPA 5DPSA 3SU8X 4WJQA 1TXDA 4K2OA 1V5MA 2DAFA 2DYQA 2JY6A 2V1YA 4BBNF 2LULA 3VTUA 4ANWA 5C5BA 2MQJA 3M3JA 3W1YA 4XWXA 1ZC4B 2C9WB 1WJNA 1RRPB 4EZKA 2YT0A 2LRUA 4KIKB 5HE0A 4HB4B 4B9KA 2AWTA 5J3YA 4PQ0A 4GGQA 1ISNA 1GG3A 2VRWB 1YX5B 2JXXA 2COAA 1XD3B 1UH6A 3V62A 4AWJA 1ZKHA 4FBJB 2CY5A 5DHFB 4F8CB 4I6LB 1P3QU 2D2QA 4GZUA 2QKLA 3FSSA 1P6SA 3ZDTA 2BYEA 2K8BA 2W9NA 1V80A 2Z59B 2ZNVB 2DX5B 1MK9B 4K81A 3NZSA 3DVNU 5E6PA 2I1KA 3ODWA 5J3QA 4AJWA 2KX3A 4CHJA 1UD7A 2J7QB 4IWQA 2CHXA 2KWVB 2ZCCA 5CHVC 1NI2A 5CLLB 3TJPA 3V60A 3WAMA 1UEFA 4HHVA 3TCAA 1GUAB 4W9GA 2OTXA 1Q0WB 3WIMA 5KQ1A 2MWSB 2UZRA 3A1QA 4GDKB 1IP9A 3CXBB 4MK0A 4AJYB 5JHGA 1ZSQA 2LUEA 3PGEA 3ZNID 4NJ6A 2RLOA 2YSZA 2KDEB 4WWOA 2JVCA 3OLMD 1A5RA 2DTCA 1V49A 2DKPA 2KKCA 2DHIA 3CSFA 3DBRI 3NSUA 2K1FA 2EMSA 2KUPA 2NPTB 4CYEA 3LDZE 3TBLD 1NU2A 3DCGA 4MSQB 3A98B 2L8JA 2UZSA 1WJUA 3ZLZA 3S2AA 2FNJB 1QC6A 1UNRA 2HJ8A 3OJ4B 2D10A 3FEHA 1J0GA 5C16A 4NJ7A 2LWPA 1WX8A 2K6QA 4GB9A 2J0KA 2DAJA 2D9WA 4GOCA 1P0RA 4II3B 3PT2B 2LYDA 1DBHA 4RMAA 5D27A 2LD9A 3JSVA 2PZ1A 4KSKC 2LASA 2WDTB 3APFA 3HW2B 1BT0A 2RSUA 4P7IA 1LFDA 4XX5A 2GJYA 3DXEA 4EUTA 2EC1A 1QZEA 2CU1A 2N1VA 3A4RA 3RT3B 2DLWA 2KFJA 4IOYX 4MM3A 2FCMA 1P5TA 3QX1A 3ZRFA 4OVVA 4YONA 4DDID 3KH0A 4FJZA 1WGYA 5LXHA 3ZVRA 4M8MA 2LXCA 1XT9B 5JHBA 3ZVVA 3HIZA 2GBMA 4HPMB 3AU4A 2LGDA 2Z0PA 2IFSA 2ZJDA 2LG1A 1E8WA 3IFWB 3RZFA 3VH4B 4HLEA 2R2OA 3H9DA 5LOPB 3UQAA 1MAIA 3EC8A 4W9IA 1ZC3B 2EJ8A 2KCJA 4KAXB 4DXAB 2FCQA 2MX2A 4KVGB 1K8RB 2MBBB 2XEWA 5GOWB 2ROVA 2DENB 3U8ZA 2GBJA 5D3YA 2WX1A 1LW3A 3N7CA 2CHWA 1WH3A 2KMAA 2LGYA 2KLCA 3IG3A 3VQIA 3ZRCA 5CHFA 2PEAA 3OANA 1LXDA 2UYZB 4J6IA 1J19A 2K8CA 5FI0A 1P98A 5JHHA 2O2VA 4F7UP 2KC1A 4DWFA 4DBBA 4DBGA 4JQWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PE9 A;  3V6E B;  1RAX A;  1V81 A;  4MT7 A;  3EFU A;  3H1U A;  1XQQ A;  2K39 A;  4EEW A;  4BVU C;  3BY4 B;  1Q67 A;  2NS5 A;  1YQB A;  2WX0 A;  1WMH B;  2KTR B;  4FAD A;  3QBV B;  3P7Z A;  2VRR B;  2O2V B;  3SDL C;  2MKR A;  1Y19 B;  4GSW A;  1ZM0 A;  4KHB B;  3PSE B;  2PJH A;  5DPT A;  2MFQ A;  1UNQ A;  1WYW B;  4A5K A;  2BF8 B;  2MW5 A;  1E7U A;  1OEY J;  2NBU A;  2R2Q A;  3A4S C;  1WGG A;  5J18 A;  1U4A A;  2LVP A;  1PMS A;  4ZRI A;  4ANU A;  2IY1 B;  1X86 A;  2MCN B;  2RSG A;  1Y8R C;  4HAZ B;  1NTY A;  2KTF A;  1MG8 A;  4KDL B;  2LOX A;  3WAL A;  5D7G A;  2AL6 A;  1OMW A;  2CR5 A;  2HE7 A;  1L7Y A;  1WZ0 A;  4B95 A;  3KYC D;  2MP2 B;  4IC7 B;  2CKH B;  2ZVN A;  4WSF A;  4B6H A;  4LCD E;  5AZG A;  1V5O A;  3VXW A;  4MJS B;  1MIZ B;  2NR2 A;  1H10 A;  1U5E A;  1YX6 B;  1OTR B;  3VFK A;  4WAA A;  1XOD A;  2ZZP B;  3PHW B;  1V5P A;  3UZT A;  5AZF A;  2KJH B;  2MDX A;  1DRO A;  4JIO U;  3WAO A;  2GS0 A;  1M94 A;  5CHW A;  1S1Q B;  1U2B A;  3VUX A;  1FAO A;  1DYN A;  1YIW A;  2UWQ A;  2G4S A;  2G3Q B;  4HAX B;  4I6P A;  4TQ1 A;  4MJS A;  2KVR A;  2C60 A;  2ADZ A;  2LRW A;  3PVW A;  2R09 A;  1F9J A;  3A9K A;  2V4L A;  4LDT D;  3ZTC A;  2DFK A;  2YS5 A;  4EJN A;  1WXA A;  1Z2M A;  2RVB B;  3TVV A;  2M4N A;  2RR9 A;  2C7N B;  3ML8 A;  1HE8 A;  3NZU A;  2VKI A;  2KXJ A;  2GCL A;  2JZZ A;  1C3T A;  1EF1 A;  3SO6 A;  1OGW A;  1N3H A;  2PPH A;  1I35 A;  4HPL B;  4GIV A;  4NY0 A;  1OY2 A;  1XR0 B;  2KJR A;  1E8X A;  2N9E B;  4TYZ A;  3PP2 A;  4Y94 A;  3MDB C;  1SIF A;  3PRE A;  5FR6 A;  3UIN B;  4A6F B;  5FI1 A;  4EFO A;  3UQB A;  2IO1 B;  2MBO A;  3U7D A;  3N30 A;  1IYF A;  2KQ7 A;  2YLM A;  1DDW A;  2RGN B;  3JSV B;  4W9E A;  4MGK E;  2DYO A;  2GCJ A;  1SGH A;  3C0R B;  4G11 A;  4G50 A;  2M17 A;  1MK7 B;  1RJ2 A;  2P8V A;  3ULC A;  2NVU I;  3PLV A;  4MGI E;  2NBV B;  5BO4 B;  1MIX A;  1B55 A;  2CAY A;  4CHM A;  4IWP A;  2P0F A;  4K7S A;  2K00 A;  3QCA A;  3QAQ A;  4A20 A;  1WJ1 A;  1WGH A;  4HVB A;  3UIP B;  1KZ7 A;  1FHW A;  2CY4 A;  2PE6 B;  1FHO A;  4HCP B;  2FAZ A;  5D94 A;  3VIA A;  2YS1 A;  1I42 A;  4HWI B;  2MWN B;  2ZVO A;  3DXD A;  2Z0E B;  1XX0 A;  2FID A;  5KHO A;  2DX1 A;  3CIK A;  3O96 A;  4W9C A;  1OQN A;  2D9X A;  2G35 A;  3L10 B;  3ALB A;  3H6N A;  2M8S A;  4KHO A;  3LJU X;  2KOX A;  4HAV B;  4K2P A;  3IBE A;  3M95 A;  2BCJ A;  4A6H A;  4GDL B;  2W2X D;  5CLQ B;  4WJN A;  4BFR A;  2KTR A;  4W9J A;  3R7R A;  4RM9 A;  1JRU A;  2KD0 A;  4Z2M B;  4Z2N A;  2GBK A;  3MTN B;  5DIF B;  2DYN A;  1UZX B;  3NY5 A;  4IUM B;  5DHA B;  1Z5S B;  2RD0 A;  1IRS A;  3SHQ A;  5D3V A;  2AYO B;  3KZ1 A;  1WXS A;  4NPN A;  3SNH A;  2L1C A;  4IW0 A;  3A33 B;  3T06 A;  3ZIM A;  1V6E A;  1Q5W B;  5J2R A;  1V61 A;  4NQL B;  3CST A;  3JYU A;  1WMH A;  3ODX A;  3ML9 A;  4K7U A;  4C0A A;  1OQY A;  5EDS A;  1W1D A;  1BTN A;  5DH9 B;  2J0J A;  2OOB B;  3HK0 A;  4G3X B;  4TQ0 A;  3VUY A;  1YJ1 A;  3BIN A;  1WXM A;  2N4F A;  3H7P B;  2IYD B;  1G6J A;  1MKE A;  2BYV E;  2KDF B;  3A9J A;  1BWN A;  1T0Y A;  4MEM A;  5HE2 A;  4WJO A;  4F1S A;  1FGY A;  2M14 A;  2RUK B;  2JRH A;  4I6N B;  3P2B A;  4XC2 A;  2LVQ A;  3UIO B;  1Y5O A;  1QQG A;  4HDO A;  4GU2 A;  1V89 A;  5G55 A;  3UF8 A;  3X0W A;  4URK A;  2XBB C;  3KRW A;  1WE7 A;  3M62 B;  2BWE S;  2G45 B;  1UGM A;  3KUZ A;  2KZR A;  1FXT B;  4WWN A;  2HTH A;  1E8Z A;  3QA8 A;  2OQB A;  3P6A A;  1DDM A;  3V5W A;  4KIK A;  3HM6 X;  4MGY E;  3GYP A;  4DX9 0;  5L81 A;  2Z0O A;  1EAZ A;  2K6D B;  3K9P B;  2FCS A;  2C7H A;  1K5D B;  2KFK B;  2KJ6 A;  2KHW B;  4H8S A;  1WR1 A;  3DBL I;  3VDZ A;  2P0H A;  2JF5 A;  4KZ0 A;  4E3C A;  4A3O A;  3F0W A;  3L08 A;  2KFK A;  3N3K B;  5AEK B;  2I5F A;  1M7R A;  1FGZ A;  1Q1O A;  2KAN A;  4IWO A;  3DOW A;  2K2U A;  2JRI B;  5GMV A;  2ELA A;  3NOB A;  3ZO5 B;  5DCN A;  4B6W A;  1WM2 A;  1TZ1 A;  4HDQ A;  1V5T A;  1AAR A;  2LXA A;  2ZPN A;  4HAY B;  2HD5 B;  5DPW A;  3VOQ A;  4PYU A;  1NBF C;  4L6E A;  1UPQ A;  1UPR A;  2AEH A;  5DI9 B;  3QAR A;  2E2X A;  4GDK A;  2H7D A;  3WA0 A;  3HQC A;  3QQ8 B;  1TTN A;  2KC2 A;  4KZC A;  2L7R A;  2Y8G A;  3F5R A;  4HB0 B;  1WZ3 A;  1OEY A;  4K17 A;  2MBE A;  4HAT B;  4BKT A;  3MPX A;  3TW1 A;  2D9Y A;  2LKO A;  2V3S A;  4W9D A;  2IY0 B;  2OJR A;  2L05 A;  1GC7 A;  5D3W A;  2A4Z A;  4JLC A;  4W9F A;  4CO7 A;  5AZH A;  3X23 A;  1J0W A;  2D9Z A;  3L0W B;  4W9K A;  3A8P A;  1WGD A;  2C5L C;  2AL3 A;  5KQ4 A;  4HXD A;  1UBI A;  4F7Z A;  4DHJ D;  4HAU B;  5JZE B;  5D6J B;  1WGQ A;  1WVH A;  1WFY A;  4IG7 B;  2M0X A;  2IO3 B;  1BTK A;  1PLS A;  2Q13 A;  3PS6 A;  1KZG A;  3ML4 A;  4IFS A;  2KO3 A;  1SE9 A;  3JW0 X;  2XK5 A;  3EHV A;  5DPR A;  1U29 A;  1LB1 A;  4G0N B;  1E8Y A;  3SV1 A;  3EEC A;  4PYZ A;  4ZYN A;  1WIA A;  5CX3 A;  3AI5 A;  2EKE C;  1KI1 B;  3M1I B;  3GYO A;  3K9O B;  2I1J A;  1XCG A;  2YT1 A;  1P1A A;  1WXV A;  1WF9 A;  2LGX A;  2ZNV C;  3L13 A;  4HK2 A;  1R4M I;  4GMV A;  1I7A A;  3PV1 A;  4OVU A;  2DZJ A;  4LJP B;  1P9D U;  4M0W B;  2N23 A;  4HB3 B;  3IVF A;  4GDL A;  4A3P A;  4EOY A;  5J17 A;  3PRP B;  3AUL A;  4JL9 A;  5L95 C;  1WR6 E;  3VHT C;  2DHK A;  2KNB A;  1J8C A;  4X57 B;  2RPQ A;  4NAW A;  4K7W A;  4PS3 A;  5HE3 A;  2M1M A;  3BJI A;  1R4N I;  2GOW A;  5IAA C;  3Q3J A;  3A1Q B;  3ULB A;  1H8C A;  4DX8 A;  2MBH A;  5JHA A;  3PLU A;  2D07 B;  2KWC A;  3KUC B;  4ICU A;  3AJ4 A;  2FCN A;  2WWZ A;  3KW5 B;  5HE1 A;  2GMI C;  3CF6 E;  1X05 A;  4GN1 A;  4MDK E;  4NAW B;  1KLV A;  1NTV A;  3L17 A;  2NCN A;  4K1R B;  2NMB A;  4BOZ B;  2HTH B;  4YL8 A;  2NPT A;  3WYF B;  2LZ6 A;  2MSE D;  2KDI A;  2RGF A;  1WX9 A;  2K25 A;  3D8F A;  4ASW C;  2IO0 B;  4XZ4 A;  2N1W A;  3Q3F A;  4LJO B;  3RUL A;  3ZNZ B;  4FN2 A;  3TO1 A;  1KOT A;  3SYX A;  3B0A A;  2L0F A;  3KYD D;  1KJT A;  3RUI B;  3W1S A;  2YS3 A;  1H4R A;  1LM8 B;  2WYQ A;  3GOE A;  2N7E A;  2ZPY A;  1WJ6 A;  1X1F A;  2N7D A;  1FHX A;  1LQB A;  2BGF A;  3WAN A;  3QC8 B;  3PG7 A;  4MY6 A;  4WWP A;  5C79 A;  1C1Y B;  3OAW A;  4PS7 A;  4KV2 A;  2KWU B;  4E74 A;  3AU5 A;  2GBR A;  2D3G A;  2L3Z A;  2P0D A;  3DVG X;  3KVF B;  5KHQ A;  1GJZ A;  1K5G B;  5C1Z A;  2COD A;  3PVU A;  1WX7 A;  3DBS A;  4EZJ A;  1FB8 A;  3PRM B;  3O65 B;  3RD2 A;  4NSW A;  4WQO B;  2G4D B;  2YVC A;  3VTV A;  2QHO A;  4F7H A;  2KX0 A;  3DDC B;  4FUL A;  4HCN B;  3D32 A;  2MA9 B;  3SD5 A;  1EVH A;  1PFJ A;  1S3S G;  1TQZ A;  2Y8F A;  2LVO A;  4JGH B;  3PPA A;  1V86 A;  1U5D A;  2RNR B;  4HB2 B;  2JP2 A;  1L2N A;  1W1H A;  3R66 C;  3T9L A;  5J3T A;  2R0D A;  2MRP A;  1EF5 A;  2DHZ A;  1WGR A;  2IO2 B;  5D2M B;  1UEL A;  2KGX B;  1D3Z A;  1DDV A;  2Y7B A;  3QWM A;  2XK5 B;  5EFX A;  2IBI B;  4DK5 A;  3APD A;  4DHZ B;  1V2Y A;  3ECI A;  5LON B;  4KHA A;  3NS8 A;  1GNU A;  3DQV A;  3QJZ A;  4BBK A;  1TJ6 A;  3B1L X;  3W1S C;  4IM0 A;  3AXC A;  2COC A;  2ELB A;  3VVW B;  2W2X C;  2Z0D B;  3B08 A;  2I5C A;  4HAW B;  1Z87 A;  2CS4 A;  2L0T A;  1V5U A;  1RFA A;  4BKG A;  2DHJ A;  2KQS A;  1X1G A;  5E6O A;  3U30 A;  2O6V A;  2JUO A;  1V88 A;  4FHK A;  4N9F 4;  1VCB A;  3VH3 B;  5LXI B;  2VSZ A;  1P3R A;  3I3T B;  2H7E A;  3LJ3 A;  3JVZ X;  2L76 A;  2KMC A;  3SUZ A;  1EO6 A;  2N9P C;  3PZD A;  3ZNG C;  4AOF A;  3PVL A;  5D3X A;  2JZ3 B;  1WE6 A;  2DZI A;  4ZRJ A;  2DYM A;  2IYB A;  1PQS A;  1TGZ B;  5HKH A;  1M7E A;  1ZGU B;  1WJ4 A;  3DVN V;  3QWZ B;  3ZUN A;  3V61 A;  4PNK A;  3FM8 C;  4BOS C;  4WJ7 A;  3D8D A;  2JPH A;  4FJV B;  2D11 A;  4ICV A;  2B3A A;  3TFM A;  2MBQ A;  2ROZ B;  3PSC A;  4AUQ C;  4MEL A;  4EKU A;  5JLJ B;  3DXC A;  4KSL C;  2LJ5 A;  1U27 A;  1YD8 U;  5C5B B;  1GC6 A;  2DZK A;  3QK0 A;  1W1G A;  3MJW A;  3TIX A;  2DX5 A;  2M38 A;  3HM3 A;  2BKF A;  5JP4 A;  2GBN A;  3MHS D;  4KDI C;  2FUH B;  2BYF A;  3PTF C;  4FLH A;  4TV3 A;  3DPD A;  2D4Q A;  4GPT B;  3KRX A;  4GMX B;  3QIJ A;  1RLF A;  1WM3 A;  2KDB A;  2REX A;  3A9K B;  3KUD B;  3ONS A;  3H7S A;  4DDG D;  4E71 A;  2EMT A;  4GXB A;  4FHJ A;  4W9L A;  2MP2 A;  2J0M A;  3RZW C;  1WG7 A;  3N32 A;  2BWF A;  4IAP A;  2JWZ A;  3D8E A;  4BKS D;  4BKS A;  1U5F A;  4TUU A;  2ZEQ A;  4CHK A;  2DYB A;  3APC A;  5G2N A;  2NZ8 B;  4WVF B;  4D0N B;  2K2J A;  2W2W A;  3RCZ A;  2XQN M;  5IA7 A;  2DZM A;  3M63 B;  4II2 B;  1X11 A;  3DVG Y;  1WRD B;  2FJL A;  3T8M A;  4MGZ E;  3QHT A;  1EGX A;  2CHZ A;  2KK8 A;  3CMM B;  2BPS A;  3WAP A;  3A9J B;  3ENE A;  3ZKJ C;  3TL5 A;  2KLG A;  2YF0 A;  4ZDV A;  5C23 A;  2KN5 A;  3L54 A;  1BAK A;  2BKR B;  2DA0 A;  2FIF A;  2MLB A;  5JH5 C;  1AQC A;  2V76 A;  1X1M A;  3RCP A;  1E90 A;  5E6N A;  4TKN A;  3RYT A;  1SHC A;  1VD2 A;  1E5W A;  4M8N A;  3PRZ A;  3V6C B;  3ZW3 A;  2UVM A;  1EUV B;  2A5U A;  4ANV A;  1WI1 A;  1IPG A;  4EZL A;  5L83 A;  3ODO A;  2IZV B;  3L16 A;  2O6V D;  2L2I A;  1UBQ A;  4W9H A;  2DKQ A;  5CTR C;  3VUW A;  1XKE A;  1XD4 A;  1FOE A;  2J59 M;  3KY9 A;  1CMX B;  2N9X A;  1TBE A;  4AP4 C;  4MSM B;  3NHE B;  3IHP C;  4EMO A;  2LOZ A;  2QKM A;  2L00 B;  3GZN I;  3PHX B;  4IM3 A;  4LDT B;  1WGU A;  4DHZ E;  3A8Q A;  3R7Q A;  4DHJ B;  4A6K A;  1UNP A;  5TR5 A;  3ZDM C;  2D9V A;  1V9J A;  2O6V B;  3DBH I;  1RRB A;  1AWE A;  4NQK E;  1E7V A;  4MH0 E;  1I2H A;  5KCV A;  3R3M A;  4A6F A;  2K8H A;  1NDD A;  1ZW7 A;  3OJ3 A;  2CRF A;  2Z0Q A;  2NBW B;  1MPH A;  3ZTD A;  2YRY A;  2X18 A;  2COF A;  3PEG A;  3ZNH B;  2JT4 B;  4PS8 A;  5LLI A;  2C7M B;  3TMP B;  4IM2 A;  2Y5B B;  4FJY A;  4F7G A;  3G9W A;  4NNJ B;  3UGB B;  1WJM A;  2LI5 A;  4BBN C;  2DN6 A;  3KSY A;  3VTW A;  1KM7 A;  2ZCB A;  4HJK A;  4RM8 A;  4FA6 A;  1WY8 A;  3VAW A;  1WI0 A;  3H7P A;  1ZVR A;  1U5G A;  4ANX A;  2N0Y A;  5C6R A;  2ASQ A;  3HHM A;  4ZRK A;  4WJP A;  5DPS A;  3SU8 X;  4WJQ A;  1TXD A;  4K2O A;  1V5M A;  2DAF A;  2DYQ A;  2JY6 A;  2V1Y A;  4BBN F;  2LUL A;  3VTU A;  4ANW A;  5C5B A;  2MQJ A;  3M3J A;  3W1Y A;  4XWX A;  1ZC4 B;  2C9W B;  1WJN A;  1RRP B;  4EZK A;  2YT0 A;  2LRU A;  4KIK B;  5HE0 A;  4HB4 B;  4B9K A;  2AWT A;  5J3Y A;  4PQ0 A;  4GGQ A;  1ISN A;  1GG3 A;  2VRW B;  1YX5 B;  2JXX A;  2COA A;  1XD3 B;  1UH6 A;  3V62 A;  4AWJ A;  1ZKH A;  4FBJ B;  2CY5 A;  5DHF B;  4F8C B;  4I6L B;  1P3Q U;  2D2Q A;  4GZU A;  2QKL A;  3FSS A;  1P6S A;  3ZDT A;  2BYE A;  2K8B A;  2W9N A;  1V80 A;  2Z59 B;  2ZNV B;  2DX5 B;  1MK9 B;  4K81 A;  3NZS A;  3DVN U;  5E6P A;  2I1K A;  3ODW A;  5J3Q A;  4AJW A;  2KX3 A;  4CHJ A;  1UD7 A;  2J7Q B;  4IWQ A;  2CHX A;  2KWV B;  2ZCC A;  5CHV C;  1NI2 A;  5CLL B;  3TJP A;  3V60 A;  3WAM A;  1UEF A;  4HHV A;  3TCA A;  1GUA B;  4W9G A;  2OTX A;  1Q0W B;  3WIM A;  5KQ1 A;  2MWS B;  2UZR A;  3A1Q A;  4GDK B;  1IP9 A;  3CXB B;  4MK0 A;  4AJY B;  5JHG A;  1ZSQ A;  2LUE A;  3PGE A;  3ZNI D;  4NJ6 A;  2RLO A;  2YSZ A;  2KDE B;  4WWO A;  2JVC A;  3OLM D;  1A5R A;  2DTC A;  1V49 A;  2DKP A;  2KKC A;  2DHI A;  3CSF A;  3DBR I;  3NSU A;  2K1F A;  2EMS A;  2KUP A;  2NPT B;  4CYE A;  3LDZ E;  3TBL D;  1NU2 A;  3DCG A;  4MSQ B;  3A98 B;  2L8J A;  2UZS A;  1WJU A;  3ZLZ A;  3S2A A;  2FNJ B;  1QC6 A;  1UNR A;  2HJ8 A;  3OJ4 B;  2D10 A;  3FEH A;  1J0G A;  5C16 A;  4NJ7 A;  2LWP A;  1WX8 A;  2K6Q A;  4GB9 A;  2J0K A;  2DAJ A;  2D9W A;  4GOC A;  1P0R A;  4II3 B;  3PT2 B;  2LYD A;  1DBH A;  4RMA A;  5D27 A;  2LD9 A;  3JSV A;  2PZ1 A;  4KSK C;  2LAS A;  2WDT B;  3APF A;  3HW2 B;  1BT0 A;  2RSU A;  4P7I A;  1LFD A;  4XX5 A;  2GJY A;  3DXE A;  4EUT A;  2EC1 A;  1QZE A;  2CU1 A;  2N1V A;  3A4R A;  3RT3 B;  2DLW A;  2KFJ A;  4IOY X;  4MM3 A;  2FCM A;  1P5T A;  3QX1 A;  3ZRF A;  4OVV A;  4YON A;  4DDI D;  3KH0 A;  4FJZ A;  1WGY A;  5LXH A;  3ZVR A;  4M8M A;  2LXC A;  1XT9 B;  5JHB A;  3ZVV A;  3HIZ A;  2GBM A;  4HPM B;  3AU4 A;  2LGD A;  2Z0P A;  2IFS A;  2ZJD A;  2LG1 A;  1E8W A;  3IFW B;  3RZF A;  3VH4 B;  4HLE A;  2R2O A;  3H9D A;  5LOP B;  3UQA A;  1MAI A;  3EC8 A;  4W9I A;  1ZC3 B;  2EJ8 A;  2KCJ A;  4KAX B;  4DXA B;  2FCQ A;  2MX2 A;  4KVG B;  1K8R B;  2MBB B;  2XEW A;  5GOW B;  2ROV A;  2DEN B;  3U8Z A;  2GBJ A;  5D3Y A;  2WX1 A;  1LW3 A;  3N7C A;  2CHW A;  1WH3 A;  2KMA A;  2LGY A;  2KLC A;  3IG3 A;  3VQI A;  3ZRC A;  5CHF A;  2PEA A;  3OAN A;  1LXD A;  2UYZ B;  4J6I A;  1J19 A;  2K8C A;  5FI0 A;  1P98 A;  5JHH A;  2O2V A;  4F7U P;  2KC1 A;  4DWF A;  4DBB A;  4DBG A;  4JQW C; 
#chains in the Genus database with same CATH topology
 3SEB A;  2PE9 A;  5I2M A;  3H1U A;  2ACZ B;  1YQB A;  2WX0 A;  2VRR B;  2MKR A;  2PJH A;  5DPT A;  4A5K A;  1OEY J;  2NBU A;  2R2Q A;  2LVP A;  3IT4 B;  2IY1 B;  1AW7 A;  1EU3 A;  1NTY A;  1UWM A;  2AL6 A;  2CR5 A;  1PFD A;  4IC7 B;  4WSF A;  1QLB B;  2WNM A;  3N1Y C;  4MJS B;  4RGT A;  2LEK A;  1YX6 B;  4WAA A;  2ZZP B;  3WAO A;  1EU4 A;  1TY0 A;  2GS0 A;  1U2B A;  2PVG C;  1FAO A;  1DYN A;  1CQV A;  1DYQ A;  4MJS A;  2KVR A;  4PK1 A;  2YEP F;  4LDT D;  5D3I B;  2YS5 A;  1D5X C;  2MJE A;  2VKI A;  2KXJ A;  3SFD B;  2JZZ A;  3SO6 A;  2PPH A;  1N3H A;  2XNA C;  4M02 A;  1QOG A;  1XR0 B;  2KJR A;  1E8X A;  4TYZ A;  4OHJ A;  3N30 A;  2ON8 A;  4W9E A;  4JE3 B;  2GCJ A;  1NYQ A;  3C0R B;  4G50 A;  1WRI A;  2P0F A;  3QCA A;  3HUI A;  2KUQ A;  3UIP B;  2FAZ A;  3SR6 A;  3VIA A;  4HWI B;  2FID A;  3N9Y C;  5KHO A;  2DX1 A;  1IBX A;  3AE2 B;  3MHZ A;  3L10 B;  2G35 A;  2M8S A;  5D7G A;  3KQ4 A;  3IBE A;  4A6H A;  2W2X D;  5CLQ B;  4ZRP A;  2KTR A;  2KD0 A;  3DWM A;  2GBK A;  3MTN B;  1SJE D;  3KZ1 A;  1WXS A;  2GI9 A;  4YT0 B;  1XLQ A;  3A33 B;  1RYJ A;  3JYU A;  1WMH A;  3ODX A;  3P42 A;  1QT9 A;  3N1X C;  5EDS A;  1W1D A;  2MJD A;  1GOZ A;  1WXM A;  2IYD B;  1BWN A;  5HE2 A;  4WJO A;  1J7C A;  1FGY A;  3FKY A;  2LVQ A;  3UIO B;  4URK A;  3KRW A;  1WE7 A;  2J53 A;  2KZR A;  4WWN A;  2OQB A;  1DDM A;  2K6D B;  3K9P B;  2C7H A;  4H8S A;  1N6Z A;  4E3C A;  4DXG A;  1FRD A;  3GE3 C;  4IWO A;  2K2U A;  2IPK D;  2ELA A;  4B6W A;  1TZ1 A;  2LXA A;  2JZP A;  5DPW A;  3QAR A;  3HQC A;  3GP7 A;  1WZ3 A;  1OEY A;  2ZW1 A;  3W2D A;  5G5H A;  3MPX A;  1HTQ A;  2OJR A;  5D3W A;  4JLC A;  4CO7 A;  1SBB B;  4DIX A;  2D9Z A;  4W9K A;  1V97 A;  1I4G A;  1UBI A;  3U4E G;  1ZPS A;  2QIE B;  4RGO S;  2XK5 A;  3EHV A;  5M4Y B;  5DPR A;  1U29 A;  2R2Y A;  1E8Y A;  4JWS C;  1AYF A;  2EKE C;  1KI1 B;  3M1I B;  1TJE A;  3TEX A;  1K50 A;  1WF9 A;  2Z8L A;  1R4M I;  4GMV A;  1I7A A;  4GDL A;  3IVF A;  1J7A A;  5J17 A;  5H92 C;  3PRP B;  3AUL A;  4JL9 A;  3RMK C;  2KNB A;  2LMC A;  2RRF A;  5HE3 A;  5IAA C;  1SSN A;  1XCQ L;  3A1Q B;  4DX8 A;  1XXG A;  3PLU A;  2WWZ A;  5HE1 A;  4MDK E;  1NTV A;  3NRZ A;  3NVZ A;  3D8F A;  2D3C A;  3Q3F A;  1V1O A;  3SYX A;  3RUI B;  2YS3 A;  1I7H A;  3GOE A;  3N1Z C;  2D3B A;  3AEE B;  4YXD B;  2OJW A;  1LQB A;  1EWY C;  3QC8 B;  5C79 A;  3AM9 A;  1D4B A;  4OSN A;  4NSW A;  4C56 C;  4WQO B;  1YQ3 B;  2V9H A;  5BYQ A;  2PMV A;  1BXT A;  3D32 A;  3MC8 A;  1LO5 D;  1TQZ A;  1U5D A;  2RNR B;  3HIE A;  4CQN A;  3R66 C;  1EF5 A;  2DHZ A;  1UEL A;  1D3Z A;  4DXF A;  4L2Y A;  5EFX A;  2IBI B;  2L52 A;  1P7E A;  2V3P A;  2K22 A;  1BUI C;  3W1S C;  1QF6 A;  1F77 A;  2W2X C;  1TIF A;  2Z0D B;  3B08 A;  2WLB A;  2DHJ A;  4KHB A;  4FHK A;  1VCB A;  5LXI B;  2J52 A;  2SAK A;  3HVD A;  3BVZ A;  1OQQ A;  2KMC A;  2N9P C;  4AOF A;  3PZD A;  2JZ3 B;  1WE6 A;  3AE1 B;  2DZI A;  5HKH A;  1D5Z C;  1M7E A;  1WJ4 A;  3V61 A;  4PNK A;  2B76 B;  4FJV B;  2B3A A;  3TFM A;  1YJI A;  4YSZ B;  2MBQ A;  1SE3 A;  3ZQ4 A;  3ZGZ A;  1VZ8 A;  4OZB A;  2LJ5 A;  1U27 A;  5IP4 D;  1I4R A;  2DZK A;  3QK0 A;  4JX1 C;  3MJW A;  2BKF A;  4WQM A;  2FUH B;  4EE2 A;  1QKZ A;  1E10 A;  4GPT B;  3A9K B;  4US9 A;  4DDG D;  3KUD B;  2EMT A;  4FHJ A;  4MAC A;  2J0M A;  2JWZ A;  3PZ8 A;  3PO0 A;  1U5F A;  4TUU A;  4CHK A;  5G2N A;  1PGB A;  2W2W A;  2Z4D A;  4LTU A;  3T8M A;  2LJI A;  4QXA B;  2KK8 A;  3A9J B;  1JAL A;  3PZ7 A;  5BMI A;  2KN5 A;  2MLB A;  1EM7 A;  1VLB A;  5T8I A;  3BVG A;  4TKN A;  3ZW3 A;  1E5W A;  2EKI A;  3KWV A;  4O1N A;  2PTL A;  1WYG A;  1UBQ A;  4W9H A;  2DKQ A;  3VUW A;  3CWI A;  1PGA A;  2N9X A;  2QMT A;  4AP4 C;  1TBE A;  3NHE B;  4N6E B;  3PHX B;  5TR5 A;  2O6V B;  4MH0 E;  1JW9 D;  3ZJV A;  2HDE A;  2JT4 B;  4USA A;  1GPX A;  2Y5B B;  4HJG E;  1SIJ A;  2BW2 A;  3VTW A;  1KM7 A;  2ZCB A;  4FA6 A;  1WY8 A;  1WI0 A;  1DOI A;  4ZRK A;  3Q14 C;  4WJQ A;  1N61 A;  1TS4 A;  2DAF A;  2JY6 A;  2MH7 A;  3LB8 C;  1UWX A;  3U7Z A;  3BYT B;  2VRW B;  3NWD A;  2BVC A;  4D2K A;  4I6L B;  1YOV B;  2D2Q A;  2QKL A;  2W9N A;  5E6P A;  1L5P A;  2I1K A;  3I57 A;  4CHJ A;  4IWQ A;  3V60 A;  3TJP A;  1NI2 A;  5CLL B;  1UEF A;  4W9G A;  2OTX A;  5KQ1 A;  2UZR A;  3NWF A;  1IP9 A;  3AE8 B;  5JHG A;  1KLG D;  1A5R A;  3NZ3 A;  4NJ6 A;  2YSZ A;  1SB3 C;  2KDE B;  3OLM D;  2DTC A;  2WP9 B;  2K1F A;  4CYE A;  1CK1 A;  3A98 B;  3Q3O C;  2QSD A;  1QC6 A;  3W9C B;  4NJ7 A;  2LWP A;  3FVC A;  2Q5W D;  2LYD A;  2LD9 A;  2PZ1 A;  3HW2 B;  4XYC A;  3DXE A;  1QZE A;  3AE9 B;  1RWS A;  4S0R A;  4ZRQ A;  4R3D A;  3ZRF A;  5BYS A;  4PT5 A;  5LXH A;  2W3S A;  3ZVV A;  3I5J C;  3RZF A;  3VR8 B;  2R2O A;  3H9D A;  4P6V F;  4OVZ A;  3OJ4 B;  2MX2 A;  4KVG B;  2MBB B;  5GOW B;  3R7R A;  2DEN B;  3U8Z A;  2WX1 A;  2KMA A;  3N7C A;  4ZHO A;  3AEF B;  3ZRC A;  3NWA A;  1D6E C;  1NEK B;  1P98 A;  1WWT A;  4REZ A;  5BO4 B;  4MT7 A;  1LGR A;  4BVU C;  4NAM A;  4XWW A;  3P7Z A;  1VZ6 A;  4HSI A;  1ZXH A;  3NUH B;  1TZO A;  4ACF A;  1WGG A;  3RNE C;  1PMS A;  4ZRI A;  4ANU A;  4HKQ A;  4D6W A;  1X86 A;  2MCN B;  1ET6 A;  1C4A A;  4KDL B;  2GRI A;  1SXT A;  3P4S B;  1L7Y A;  5I4D A;  3EA6 A;  2ZVN A;  3BK2 A;  2Z13 A;  2L32 A;  3VXW A;  2NR2 A;  3VFK A;  1XOD A;  4AS1 A;  4QJ3 B;  5AZF A;  2KJH B;  1S1Q B;  1YIW A;  4I6P A;  4TQ1 A;  4DQO C;  2ZKM X;  2C60 A;  1MFW A;  2LRW A;  1F9J A;  4OZA A;  2V4L A;  3ZTC A;  1Z2M A;  1N5W A;  2M4N A;  2RVB B;  2X38 A;  2WU2 B;  2C7N B;  1I35 A;  1XEE A;  1OY2 A;  2IGG A;  2N9E B;  4Y94 A;  2ICI A;  3BII D;  4A6F B;  5FI1 A;  4EFO A;  3UQB A;  1IYF A;  1GAQ B;  2RGN B;  1SGH A;  4G11 A;  2LUM A;  2JSV X;  3RNC C;  1MIX A;  4CHM A;  2H89 B;  1WJ1 A;  1WGH A;  4RF1 A;  1KZ7 A;  2PE6 B;  4LNN A;  4HKZ E;  1FHO A;  1HA5 A;  4HCP B;  2ZVO A;  1XX0 A;  3O96 A;  2CJN A;  4W9C A;  3Q8E A;  4HPP A;  3O13 A;  3H6N A;  1MJD A;  2KOX A;  1JRP A;  1HZ6 A;  4W9J A;  4RM9 A;  1ZP0 B;  1UZX B;  4IUM B;  2RD0 A;  1Z5S B;  4US8 A;  3SNH A;  2QIL A;  4M01 A;  3ZIM A;  1V61 A;  3CST A;  3ML9 A;  4ZHP A;  1IUE A;  2J0J A;  2OOB B;  3HK0 A;  3ZJT A;  1YJ1 A;  2BQQ A;  3H7P B;  1MKE A;  4GOU A;  4F1S A;  4XC2 A;  3P2B A;  3Q3M C;  1Y5O A;  3NVY A;  3X0W A;  3KUZ A;  2HTH A;  3QA8 A;  4KIK A;  4WIP A;  1NI3 A;  4A8X C;  4MGY E;  1FD6 A;  3HM6 X;  3GYP A;  1YN5 A;  2FCS A;  2KFK B;  1ENF A;  2P0H A;  1PDX A;  3J9C A;  1M7R A;  3Q8B A;  3DOW A;  5GMV A;  3AN1 A;  3L4P A;  1L0X B;  3VOQ A;  4PYU A;  4L6E A;  1WGK A;  1T0S C;  1YMH E;  4GDK A;  2H7D A;  1KRH A;  1TTN A;  4KZC A;  2Y8G A;  2HJ1 A;  4BKT A;  2V3S A;  2D9Y A;  2INP E;  4W9F A;  2L05 A;  1GC7 A;  3AEA B;  1FXA A;  3L0W B;  2C5L C;  1IBX B;  2WXJ A;  3LYY A;  2XN9 C;  1WGQ A;  1WVH A;  1WFY A;  3SFE B;  1E6E B;  1BTK A;  2KO3 A;  1SE9 A;  3NS1 A;  5BMH A;  1ZXI A;  3IAM 1;  4G0N B;  4ZYN A;  3SV1 A;  3EEC A;  1WIA A;  3T3O A;  2BBC A;  3GYO A;  5CHF A;  2ZNV C;  1WXV A;  2WXN A;  1ZDV A;  1JRO A;  2AQ1 B;  2DZJ A;  4M0W B;  1TKE A;  4A3P A;  4RNA A;  3Q3N C;  5L95 C;  1FFV A;  3OWE B;  4X57 B;  5D3D A;  3RN9 C;  4RGM A;  2M1M A;  3BJI A;  2PIA A;  3ULB A;  2LHE A;  4ICU A;  2HTM E;  3AJ4 A;  2FCN A;  3CF6 E;  1X05 A;  4GN1 A;  1I4X A;  4TMA B;  3FC4 A;  4YL8 A;  2NPT A;  3WYF B;  2RGF A;  3RI7 C;  2IO0 B;  3RUL A;  2K8E A;  3W1S A;  1FFU A;  2ZPY A;  1WJ6 A;  1FHX A;  1T77 A;  2GB1 A;  2WU5 B;  2WXR A;  2J42 A;  1SE2 A;  2D3G A;  2COD A;  3PVU A;  3DBS A;  1FPY A;  3PRM B;  3RD2 A;  3RNG C;  4C4V A;  2N0S B;  4FUL A;  2MA9 B;  1S3S G;  4JGH B;  3PPA A;  2JP2 A;  5IO9 A;  4QJ4 B;  4H2A A;  1J7B A;  1E9M A;  1WGR A;  2KGX B;  3EGR A;  2WXL A;  2Y7B A;  1ZDX A;  4KGT A;  4N58 A;  4DK5 A;  3DWG C;  3ECI A;  4C7Z A;  3NVW A;  1L0V B;  4KKI A;  4BBK A;  4RGN A;  3VVW B;  2I5C A;  2I38 A;  4HAW B;  1Z87 A;  1HEZ E;  2CS4 A;  2L0T A;  1RFA A;  4BKG A;  5E6O A;  1MHH E;  3VH3 B;  1V88 A;  1I4H A;  5HHD G;  1F0Z A;  1RFK A;  3PVL A;  5D3X A;  1XLO A;  3B2G A;  4WJ7 A;  1Q10 A;  1XLP A;  5IKC M;  3HSA A;  4AUQ C;  5JLJ B;  3DXC A;  4KSL C;  5C5B B;  1GC6 A;  1JQ4 A;  1OFF A;  3TIX A;  2DBY A;  2GBN A;  5JP4 A;  3MHS D;  5H8Y E;  1MG4 A;  1C76 A;  3H7S A;  4GXB A;  2WS3 B;  3N32 A;  2J4X A;  4IAP A;  5AUK A;  4LNO A;  3Q2A C;  4BKS A;  3AE3 B;  3RFZ B;  3NJT A;  4WVF B;  4KX6 B;  2DZM A;  3M63 B;  1X11 A;  3DVG Y;  3CIR B;  1PYW D;  2KN4 A;  3WAP A;  3CMM B;  2BPS A;  2WQY B;  3ENE A;  3ZKJ C;  1GB1 A;  3TL5 A;  4ZDV A;  5C23 A;  3L54 A;  2BKR B;  2FIF A;  1AQC A;  2V76 A;  1N62 A;  3RNB C;  5E6N A;  1E90 A;  3V6C B;  3U52 E;  2UVM A;  2D3A A;  1WI1 A;  1IPG A;  4EZL A;  3ODO A;  2IZV B;  2W55 A;  3L16 A;  2O6V D;  2L2I A;  1XKE A;  1JWM D;  1FOE A;  2PLP A;  4EMO A;  2LOZ A;  1ROE A;  2WXP A;  1WGU A;  3A8Q A;  4A6K A;  5E6J A;  2KQ4 X;  3DBH I;  1AWE A;  4NQK E;  1E7V A;  4A6F A;  2BB5 A;  3OJ3 A;  1C9F A;  2NBW B;  4BZA A;  3PEG A;  2COF A;  3G9W A;  4NNJ B;  3GZN B;  2LI5 A;  2DN6 A;  1FCL A;  1ZVR A;  1U5G A;  2N0Y A;  5C6R A;  5DPS A;  3B77 A;  4YTN B;  3A58 A;  2DYQ A;  1K53 A;  2NMQ A;  3W1Y A;  2LRU A;  4B9K A;  5EE1 A;  5J3Y A;  4PQ0 A;  4GGQ A;  1ZUD 2;  2JXX A;  1GG3 A;  4A9A A;  3BZD B;  1UH6 A;  1DOX A;  1N60 A;  4FBJ B;  2CY5 A;  5DHF B;  4F8C B;  1P3Q U;  3ZDT A;  1B1Z A;  2BYE A;  2DX5 B;  3NZS A;  3DVN U;  5J3Q A;  4AJW A;  1XLN A;  1UD7 A;  3WAM A;  3TCA A;  1GUA B;  2MWS B;  3CXB B;  2V0G A;  4AJY B;  2LUE A;  1UF0 A;  1I4P A;  3DBR I;  1TT5 B;  4J3O D;  3TBL D;  4MSQ B;  4B0E A;  1WJU A;  1N5X A;  1YQ4 B;  2HJ8 A;  2KDM A;  3FEH A;  5C16 A;  2INC C;  3TEZ A;  3ABV B;  1YN3 A;  2PKO A;  1DBH A;  2WDT B;  2RSU A;  1BT0 A;  4XX5 A;  4P7I A;  1LFD A;  4EUT A;  2DLW A;  4MM3 A;  2Y5C A;  4YON A;  3VRA B;  1HTO A;  5HFY A;  2IFS A;  1E8W A;  2VH1 A;  4XE0 A;  4W9I A;  5MPO A;  1MI1 A;  4KAX B;  2CHW A;  2PEA A;  2UYZ B;  2M19 A;  1ACC A;  5FI0 A;  5JHH A;  1AN8 A;  3FIL B;  4RCO A;  4B0M A;  3BY4 B;  1Q67 A;  2NS5 A;  4WWM A;  1WMH B;  3E56 A;  3QBV B;  3W5V B;  3P63 A;  1Y19 B;  1ZM0 A;  1L4D B;  2MFQ A;  1UNQ A;  4ARC A;  2MW5 A;  2V4I B;  1E7U A;  5J18 A;  1U4A A;  2RSG A;  1Y8R C;  4HAZ B;  4LLG M;  2Y5P A;  5EE3 A;  4B95 A;  3MC0 B;  2CKH B;  2AQ3 B;  2WXO A;  4GLS C;  2K5P A;  1FXI A;  3IT6 B;  1H8C A;  3UZT A;  2MDX A;  1KF6 B;  5CHW A;  1VJK A;  3VUX A;  2CJO A;  2UWQ A;  2G3Q B;  4CSQ A;  4QJ5 B;  2ADZ A;  2L1A A;  2R09 A;  4JWU C;  2QC8 A;  4EJN A;  3TVV A;  2RR9 A;  1HE8 A;  3NZU A;  1T0Q C;  1F1H A;  1OGW A;  4HPL B;  4GIV A;  4NY0 A;  3PRE A;  2IO1 B;  2MBO A;  3U7D A;  1C78 A;  3Q8F A;  3JSV B;  2DYO A;  1WSP A;  2M17 A;  3ULC A;  3P4P B;  4MGI E;  2NBV B;  4WH4 A;  1B55 A;  4IWP A;  2MHJ A;  3I63 C;  4K7S A;  1FNW A;  2BS3 B;  3QAQ A;  2N9K A;  4XDD A;  2CY4 A;  1YNT E;  2MWN B;  3DXD A;  2Z0E B;  3KLS X;  1TKY A;  1OQN A;  4M00 A;  3ALB A;  4K7U A;  4KHO A;  3LJU X;  3M95 A;  4GDL B;  5C2T B;  3BK1 A;  2K3U A;  1JRU A;  4Z2M B;  2DYN A;  5DHA B;  5D3V A;  2AYO B;  4NPN A;  2L1C A;  3TEW A;  1Q5W B;  1TS5 A;  4NQL B;  1OQY A;  4G3X B;  5DH9 B;  3MJ5 A;  3H8H A;  1DGJ A;  2N4F A;  2BYV E;  4MEM A;  3A9J A;  4L23 A;  4JPS A;  1YJJ A;  2JRH A;  2M14 A;  1XCT L;  4S17 A;  1QQG A;  4HDO A;  3UF8 A;  2N9L A;  2BWE S;  5G5G A;  1FXT B;  2RDB C;  3P6A A;  2WXM A;  4DX9 0;  5L81 A;  2WXK A;  2KJ6 A;  3Q8A A;  3HRD D;  3VDZ A;  3DBL I;  5LG4 B;  2QJL A;  3L08 A;  2KFK A;  3N3K B;  1F2R C;  1Q1O A;  2KAN A;  3MFG A;  5HG2 A;  2VZK B;  4MH8 A;  3ZO5 B;  5DCN A;  3R2I A;  1KTK A;  1V5T A;  4RFB A;  2N7J A;  4HAY B;  2HD5 B;  5DI9 B;  1UPQ A;  1UPR A;  2AEH A;  2QEJ C;  3GB1 A;  1VRA B;  4FXC A;  3HVZ A;  2KC2 A;  2L7R A;  5C3J B;  1C4P A;  2MBE A;  4HAT B;  3TW1 A;  1STE A;  2LKO A;  2IY0 B;  5AZH A;  1D5M C;  1J0W A;  1IGD A;  3A8P A;  1WGD A;  2AL3 A;  1YN4 A;  5BYR A;  4IG7 B;  2IO3 B;  3PS6 A;  1KZG A;  3ML4 A;  2M0A A;  3JW0 X;  1LB1 A;  3DHG C;  3K9O B;  2I1J A;  1XCG A;  1P1A A;  4HK2 A;  4OVU A;  1ET9 A;  1FM0 D;  3PV1 A;  2SEB D;  4LJP B;  2N23 A;  1WR6 E;  1JML A;  3N20 C;  2MEK A;  1T3Q A;  1XF5 L;  1R4N I;  2GOW A;  3Q3J A;  3P1M A;  2MBH A;  5JHA A;  2JU6 X;  2D07 B;  2KWC A;  4KKJ A;  3V3X A;  2GMI C;  1KLV A;  3L17 A;  4K1R B;  5FK9 C;  2NMB A;  2HTH B;  2K25 A;  4ASW C;  2N1W A;  4FN2 A;  2PVO D;  3B0A A;  3KYD D;  1KOT A;  1H4R A;  2N7E A;  1SE4 A;  1X1F A;  2LGS A;  4P1B C;  1L6V A;  1UGJ A;  4MY6 A;  4WWP A;  1C1Y B;  4PS7 A;  3AU5 A;  3DVG X;  1KLU D;  2L3Z A;  5GXG B;  2WGS A;  4XDC A;  1K5G B;  1WX7 A;  4A6Q A;  2V3N A;  4EZJ A;  1BML C;  2KR0 A;  2K49 A;  1FNU A;  3Q6B A;  2R61 A;  2BYT A;  2QHO A;  1MI0 A;  4C4V B;  1Y56 A;  4NJC A;  4ZYS A;  1EVH A;  2Y8F A;  1V86 A;  1L2N A;  3T9L A;  5J3T A;  2R0D A;  1K51 A;  2MRP A;  2IO2 B;  2WXG A;  2XK5 B;  2NTT A;  4KGS A;  2GLS A;  4DHZ B;  1V2Y A;  5LON B;  3AED B;  3EUB 2;  4KHA A;  3NS8 A;  3QJZ A;  1XO3 A;  1TJ6 A;  2ELB A;  1A70 A;  3B9J A;  2Z14 A;  3MP9 A;  2KQS A;  3MC9 A;  4LNF A;  3U30 A;  2JUO A;  4MM3 B;  1C4C A;  1GB4 A;  2VSZ A;  2K0P A;  3JVZ X;  3VR9 B;  3SUZ A;  3ZNG C;  2G1E A;  4ZRJ A;  2IYB A;  3DCX A;  3TEY A;  3FM8 C;  4BOS C;  3D8D A;  2D11 A;  1UUP A;  4ICV A;  2LHD A;  4MEL A;  4EKU A;  1W1G A;  2M38 A;  3HM3 A;  4KDI C;  3PTF C;  4TV3 A;  2DNF A;  2REX A;  3U12 A;  2KDB A;  4E71 A;  3ONS A;  2MP2 A;  2BWF A;  4BKS D;  2KT7 A;  4UDU C;  2ZEQ A;  3APC A;  3RCZ A;  1FMA D;  4II2 B;  2FJL A;  1EGX A;  3ZXR A;  2KLG A;  2G9H D;  4MT5 A;  2DA0 A;  5JH5 C;  3RCP A;  4RF0 A;  1FO4 A;  3RYT A;  3PRZ A;  1FNV A;  1EUV B;  2A5U A;  2FUG 1;  5HI1 A;  5L83 A;  1E7P B;  1XD4 A;  2FE8 A;  2J59 M;  3KY9 A;  5JXV A;  1CZP A;  4C00 A;  3IHP C;  2L00 B;  4DHZ E;  4IM3 A;  3AEC B;  1UNP A;  2D9V A;  1V9J A;  1RRB A;  5KCV A;  2K8H A;  1NDD A;  2CRF A;  2RDG A;  2X18 A;  4HEA 1;  5LLI A;  2C7M B;  2L83 A;  3TMP B;  4IM2 A;  4FJY A;  3RNF C;  3UGB B;  2NBV A;  4RM8 A;  3VAW A;  3H7P A;  4ANX A;  3HHM A;  4WJP A;  3SU8 X;  1MHX A;  4K2O A;  4BBN F;  3URY A;  1RM6 C;  2V1Y A;  2LUL A;  4ANW A;  5C5B A;  2MQJ A;  4IKG A;  3M3J A;  1N63 A;  1WJN A;  1RRP B;  3OG5 A;  4KIK B;  5HE0 A;  4HB4 B;  2AWT A;  2LFI A;  3IXS A;  1KFY B;  1XD3 B;  1HQR D;  4GNK B;  4AWJ A;  4LNI A;  1ZKH A;  1QOB A;  1R4N B;  1P7F A;  4GZU A;  2ZNV B;  2AQ2 B;  1V80 A;  4K81 A;  1AWD A;  2RPV A;  1TKG A;  2AX5 A;  2KX3 A;  1PUT A;  1JWB D;  2J7Q B;  2KWV B;  2ZCC A;  5CHV C;  4HHV A;  4XGA B;  3DHI C;  2W3R A;  2EEL A;  1Q0W B;  3WIM A;  4GDK B;  3A1Q A;  3B2F A;  4MK0 A;  1ZSQ A;  3PGE A;  2RLO A;  2FBW B;  1WXQ A;  2DHI A;  3NSU A;  3AE5 B;  3DCG A;  2L8J A;  3ZLZ A;  2FNJ B;  1UNR A;  2D10 A;  1WX8 A;  2K6Q A;  2MJ3 A;  4GB9 A;  2J0K A;  4GOC A;  3ETR A;  4HRO A;  3ZJU A;  5D27 A;  4KSK C;  2LAS A;  2EC1 A;  3A4R A;  5I2S A;  2CU1 A;  3RPF C;  3RT3 B;  2IGH A;  2FCM A;  4OVV A;  1VDV A;  1FEH A;  1WGY A;  1F2R I;  3ZVR A;  5JHB A;  2GBM A;  4HPM B;  2WDV B;  3IFW B;  2LG1 A;  3VH4 B;  2D5G A;  4HLE A;  3UI3 A;  5LOP B;  2INN E;  1MAI A;  3NW8 A;  3EC8 A;  2FCQ A;  2XEW A;  2KCJ A;  4DXA B;  2GBJ A;  5D3Y A;  3IG3 A;  1LW3 A;  2LGY A;  2NTS A;  1E0Z A;  2KLC A;  2QDF A;  4J6I A;  3OAN A;  1LXD A;  2O2V A;  1M4V A;  4F7U P;  3DBR B;  1VD2 A;  4DBG A;  3V6E B;  1RAX A;  1V81 A;  3EFU A;  4EEW A;  1XQQ A;  2K39 A;  3AE4 B;  2KMM A;  2PW9 A;  2KTR B;  4FAD A;  2JX5 A;  2O2V B;  3SDL C;  3AE7 B;  4GSW A;  4KHB B;  3PSE B;  1CJE A;  1WYW B;  2BF8 B;  1V1P A;  3A4S C;  1NVI D;  5EE0 A;  2KTF A;  1MG8 A;  2LOX A;  3IAS 1;  3WAL A;  1OMW A;  2HE7 A;  1WZ0 A;  3KYC D;  2MP2 B;  4B6H A;  4LCD E;  5AZG A;  1V5O A;  1MIZ B;  1H10 A;  1U5E A;  1I4Q A;  1OTR B;  3PHW B;  4YWG G;  1V5P A;  2JYE A;  1DRO A;  3ZXV A;  4JIO U;  1M94 A;  2G4S A;  4HAX B;  5BMG A;  1ZE3 D;  3A9K A;  3PVW A;  4LNK A;  2DFK A;  1WXA A;  2VH2 A;  2DWQ A;  5IRS A;  3OAW A;  4K3B A;  3ML8 A;  1C3T A;  3P4Q B;  2GCL A;  3OHM B;  4XWT A;  1EF1 A;  3W5U B;  1B9R A;  3PP2 A;  5FR6 A;  3MDB C;  1SIF A;  3UIN B;  1QOF A;  1L6U A;  5AUI A;  2KQ7 A;  2YLM A;  1DDW A;  4KGR A;  2BB6 A;  4MGK E;  2DLB A;  1IGC A;  1MK7 B;  1RJ2 A;  2P8V A;  2NVU I;  3PLV A;  2CAY A;  2K00 A;  4A20 A;  1FHW A;  1K52 A;  5D94 A;  1F52 A;  2YS1 A;  1I42 A;  2QCZ A;  3CIK A;  2D9X A;  3DBH B;  2WXQ A;  4HAV B;  4K2P A;  1EWC A;  4WJN A;  2BCJ A;  4P16 A;  2H88 B;  4BFR A;  2WHI A;  1V8C A;  1UNS A;  2KIE A;  4Z2N A;  5DIF B;  1ZOY B;  2BS4 B;  3NY5 A;  3SHQ A;  1IRS A;  3Q69 A;  3NG0 A;  4IW0 A;  3T06 A;  5J2R A;  1V6E A;  2X8X X;  4C0A A;  1JWU D;  1BTN A;  1C79 A;  2BS2 B;  4TQ0 A;  3VUY A;  3BIN A;  3DBL B;  2KDF B;  1T0Y A;  2RUK B;  4I6N B;  1KH0 A;  4GU2 A;  1V89 A;  5G55 A;  2XBB C;  3M62 B;  2G45 B;  1UGM A;  2UU7 A;  1E8Z A;  3V5W A;  2VZK D;  2Z0O A;  1EAZ A;  1K5D B;  2KHW B;  4AQ7 A;  1WR1 A;  2JF5 A;  3Q8C A;  4KZ0 A;  4A3O A;  3F0W A;  5AEK B;  2OHF A;  4RH6 A;  2I5F A;  1FGZ A;  2JRI B;  4IOI E;  3NOB A;  2IGD A;  1WM2 A;  4HDQ A;  1AAR A;  2ZPN A;  1NBF C;  2OED A;  2I2Y A;  2E2X A;  3WA0 A;  3QQ8 B;  2BTE A;  4HB0 B;  3F5R A;  4K17 A;  2WDQ B;  4W9D A;  3BYY B;  2A4Z A;  3LXF A;  1C77 A;  3X23 A;  5KQ4 A;  4HXD A;  4F7Z A;  4DHJ D;  4HAU B;  5JZE B;  5D6J B;  2JWU A;  5EE9 A;  4OT1 A;  2M0X A;  1PLS A;  2Q13 A;  1TYG B;  4IFS A;  1FCC C;  1SEB D;  2LGI A;  4BAX A;  4PYZ A;  5CX3 A;  3AI5 A;  2LGX A;  2YT1 A;  3L13 A;  3C19 A;  1P9D U;  4HB3 B;  2IND C;  4EOY A;  1MPE A;  4YSX B;  3VHT C;  2DHK A;  3GS2 A;  1J8C A;  3AEB B;  2RPQ A;  4NAW A;  4K7W A;  4PS3 A;  2K9X A;  2ONQ A;  3KUC B;  1V1P B;  3KW5 B;  4NAW B;  2NCN A;  4BOZ B;  2LZ6 A;  2MSE D;  2KDI A;  1WX9 A;  4XZ4 A;  4LJO B;  3ZNZ B;  3WCQ A;  3TO1 A;  1PGX A;  2L0F A;  1KJT A;  2WYQ A;  1LM8 B;  1TS2 A;  1L0Y B;  2N7D A;  4C7Y A;  2KWD A;  2BGF A;  3WAN A;  3PG7 A;  4KV2 A;  2KWU B;  4WAF A;  4E74 A;  2GBR A;  3KVF B;  5KHQ A;  2P0D A;  1GJZ A;  2Y3A A;  3TSS A;  5C1Z A;  2JQR B;  3I9V 1;  1FB8 A;  3O65 B;  4YSY B;  2M56 B;  2G4D B;  2YVC A;  3VTV A;  4ZOH C;  4F7H A;  2KX0 A;  3DDC B;  4HCN B;  3SD5 A;  2LVO A;  1PFJ A;  2WXF A;  3BVM A;  4HB2 B;  3AEG B;  1W1H A;  4LK0 M;  5D2M B;  3AMZ A;  1DDV A;  3QWM A;  1QIL A;  3APD A;  3BWU D;  3P4R B;  3AV8 A;  1GNU A;  3DQV A;  1ZYI A;  3B1L X;  4IM0 A;  3AXC A;  2COC A;  1FIQ A;  3AH7 A;  1V5U A;  1X1G A;  2O6V A;  4N9F 4;  2WXH A;  1P3R A;  3R8B A;  3I3T B;  1R4M B;  2H7E A;  3LJ3 A;  2L76 A;  1EO6 A;  3TUO A;  2KVZ A;  1JCK B;  2DYM A;  1PQS A;  1TGZ B;  1ZGU B;  3DVN V;  3QWZ B;  3ZUN A;  2JPH A;  2CU3 A;  3RNA C;  4IDI A;  2ROZ B;  3PSC A;  5LNK 1;  2RMM A;  1ESF A;  1T5X D;  2KIG A;  2BT6 A;  1YD8 U;  2JXT A;  4HVB A;  2DX5 A;  4N59 A;  2BYF A;  4FLH A;  3DPD A;  2D4Q A;  1FRR A;  1WM3 A;  3KRX A;  4GMX B;  3QIJ A;  1RLF A;  4W9L A;  4A90 A;  3RZW C;  1WG7 A;  2E6X A;  3D8E A;  4OZC A;  3KWL A;  2DYB A;  2NZ8 B;  4D0N B;  2K2J A;  2XQN M;  5IA7 A;  3EFC A;  1WRD B;  2IDY A;  2WDR B;  4MGZ E;  3QHT A;  2CHZ A;  2YF0 A;  4HRS A;  1BAK A;  1X1M A;  4YTM B;  1SHC A;  4M8N A;  1QQR A;  4ANV A;  2YEP B;  3T3N A;  3ZYY X;  5IN7 A;  4TSS A;  5CTR C;  4WUR A;  1CMX B;  4MSM B;  4LDT B;  3GZN I;  2QKM A;  2W54 A;  3R7Q A;  4DHJ B;  3ZDM C;  2TSS A;  1VZ7 A;  2WXI A;  1I2H A;  3R3M A;  1ZW7 A;  3NVV A;  2Z0Q A;  4P1C C;  1MPH A;  3ZTD A;  2YRY A;  2IJ0 A;  3ZNH B;  1HZ5 A;  4PS8 A;  1DOY A;  3C8Y A;  4F7G A;  1T6B X;  1WJM A;  4BBN C;  3AE6 B;  3KSY A;  4HJK A;  1SJH D;  2ASQ A;  1TXD A;  1V5M A;  2GUM A;  4L1B A;  1HXY D;  4Q2J A;  3VTU A;  1QOA A;  4XWX A;  1ZC4 B;  2C9W B;  2W82 A;  4NZL B;  4EZK A;  2E3T A;  2YT0 A;  2YT2 A;  1G6J A;  1ISN A;  1YX5 B;  2KAJ A;  2COA A;  3V62 A;  3FIL A;  1VR9 A;  1MVK A;  3FSS A;  2K8B A;  2Z59 B;  1P6S A;  1T0R C;  4M0W A;  1TS3 A;  1MK9 B;  3ODW A;  1NEN B;  3VRB B;  2CHX A;  4OW0 A;  5FKA C;  5IOI A;  2Z59 A;  1SF0 A;  3ZNI D;  3GE8 C;  2ZW0 A;  4WWO A;  2JVC A;  1V49 A;  2DKP A;  2JYT A;  2KKC A;  3CSF A;  3FAH A;  2EMS A;  2KUP A;  2NPT B;  3LDZ E;  1R7S A;  4C80 A;  1NU2 A;  1TY2 A;  4L1R A;  2UZS A;  3DHH C;  2FJU B;  5FR3 A;  3U2S C;  3S2A A;  4ARI A;  1L4Z B;  1J0G A;  4YTP B;  2DAJ A;  2D9W A;  1P0R A;  4II3 B;  3PT2 B;  4K3C A;  3AB5 A;  4RMA A;  3JSV A;  1JWA D;  3APF A;  3R2T A;  2GJY A;  2N1V A;  2KFJ A;  4IOY X;  1P5T A;  3QX1 A;  2KAC A;  4DDI D;  3KH0 A;  4FJZ A;  4M8M A;  2LXC A;  1XT9 B;  2KYW A;  3HIZ A;  3AU4 A;  1OQR A;  2LGD A;  1JWS D;  2Z0P A;  2ZJD A;  5TSS A;  3UQA A;  3E9S A;  4ITK A;  1ZC3 B;  2EJ8 A;  1K8R B;  2RDH A;  2ROV A;  3VQI A;  4A55 A;  1WH3 A;  1NYR A;  4QAY A;  1J19 A;  2K8C A;  3V05 A;  2KC1 A;  4DWF A;  4DBB A;  4JQW C; 
#chains in the Genus database with same CATH homology
 2PE9 A;  3V6E B;  1RAX A;  1V81 A;  4MT7 A;  3EFU A;  3H1U A;  1XQQ A;  2K39 A;  4EEW A;  4BVU C;  3BY4 B;  1Q67 A;  2NS5 A;  1YQB A;  2WX0 A;  1WMH B;  2KTR B;  4FAD A;  3QBV B;  3P7Z A;  2VRR B;  2O2V B;  3SDL C;  2MKR A;  1Y19 B;  4GSW A;  1ZM0 A;  4KHB B;  3PSE B;  2PJH A;  5DPT A;  2MFQ A;  1UNQ A;  1WYW B;  4A5K A;  2BF8 B;  2MW5 A;  1E7U A;  1OEY J;  2NBU A;  2R2Q A;  3A4S C;  1WGG A;  5J18 A;  1U4A A;  2LVP A;  1PMS A;  4ZRI A;  4ANU A;  2IY1 B;  1X86 A;  2MCN B;  2RSG A;  1Y8R C;  4HAZ B;  1NTY A;  2KTF A;  1MG8 A;  4KDL B;  2LOX A;  3WAL A;  5D7G A;  2AL6 A;  1OMW A;  2CR5 A;  2HE7 A;  1L7Y A;  1WZ0 A;  4B95 A;  3KYC D;  2MP2 B;  4IC7 B;  2CKH B;  2ZVN A;  4WSF A;  4B6H A;  4LCD E;  5AZG A;  1V5O A;  3VXW A;  4MJS B;  1MIZ B;  2NR2 A;  1H10 A;  1U5E A;  1YX6 B;  1OTR B;  3VFK A;  4WAA A;  1XOD A;  2ZZP B;  3PHW B;  1V5P A;  3UZT A;  5AZF A;  2KJH B;  2MDX A;  1DRO A;  4JIO U;  3WAO A;  2GS0 A;  1M94 A;  5CHW A;  1S1Q B;  1U2B A;  3VUX A;  1FAO A;  1DYN A;  1YIW A;  2UWQ A;  2G4S A;  2G3Q B;  4HAX B;  4I6P A;  4TQ1 A;  4MJS A;  2KVR A;  2C60 A;  2ADZ A;  2LRW A;  3PVW A;  2R09 A;  1F9J A;  3A9K A;  2V4L A;  4LDT D;  3ZTC A;  2DFK A;  2YS5 A;  4EJN A;  1WXA A;  1Z2M A;  2RVB B;  3TVV A;  2M4N A;  2RR9 A;  2C7N B;  3ML8 A;  1HE8 A;  3NZU A;  2VKI A;  2KXJ A;  2GCL A;  2JZZ A;  1C3T A;  1EF1 A;  3SO6 A;  1OGW A;  1N3H A;  2PPH A;  1I35 A;  4HPL B;  4GIV A;  4NY0 A;  1OY2 A;  1XR0 B;  2KJR A;  1E8X A;  2N9E B;  4TYZ A;  3PP2 A;  4Y94 A;  3MDB C;  1SIF A;  3PRE A;  5FR6 A;  3UIN B;  4A6F B;  5FI1 A;  4EFO A;  3UQB A;  2IO1 B;  2MBO A;  3U7D A;  3N30 A;  1IYF A;  2KQ7 A;  2YLM A;  1DDW A;  2RGN B;  3JSV B;  4W9E A;  4MGK E;  2DYO A;  2GCJ A;  1SGH A;  3C0R B;  4G11 A;  4G50 A;  2M17 A;  1MK7 B;  1RJ2 A;  2P8V A;  3ULC A;  2NVU I;  3PLV A;  4MGI E;  2NBV B;  5BO4 B;  1MIX A;  1B55 A;  2CAY A;  4CHM A;  4IWP A;  2P0F A;  4K7S A;  2K00 A;  3QCA A;  3QAQ A;  4A20 A;  1WJ1 A;  1WGH A;  4HVB A;  3UIP B;  1KZ7 A;  1FHW A;  2CY4 A;  2PE6 B;  1FHO A;  4HCP B;  2FAZ A;  5D94 A;  3VIA A;  2YS1 A;  1I42 A;  4HWI B;  2MWN B;  2ZVO A;  3DXD A;  2Z0E B;  1XX0 A;  2FID A;  5KHO A;  2DX1 A;  3CIK A;  3O96 A;  4W9C A;  1OQN A;  2D9X A;  2G35 A;  3L10 B;  3ALB A;  3H6N A;  2M8S A;  4KHO A;  3LJU X;  2KOX A;  4HAV B;  4K2P A;  3IBE A;  3M95 A;  2BCJ A;  4A6H A;  4GDL B;  2W2X D;  5CLQ B;  4WJN A;  4BFR A;  2KTR A;  4W9J A;  3R7R A;  4RM9 A;  1JRU A;  2KD0 A;  4Z2M B;  4Z2N A;  2GBK A;  3MTN B;  5DIF B;  2DYN A;  1UZX B;  3NY5 A;  4IUM B;  5DHA B;  1Z5S B;  2RD0 A;  1IRS A;  3SHQ A;  5D3V A;  2AYO B;  3KZ1 A;  1WXS A;  4NPN A;  3SNH A;  2L1C A;  4IW0 A;  3A33 B;  3T06 A;  3ZIM A;  1V6E A;  1Q5W B;  5J2R A;  1V61 A;  4NQL B;  3CST A;  3JYU A;  1WMH A;  3ODX A;  3ML9 A;  4K7U A;  4C0A A;  1OQY A;  5EDS A;  1W1D A;  1BTN A;  5DH9 B;  2J0J A;  2OOB B;  3HK0 A;  4G3X B;  4TQ0 A;  3VUY A;  1YJ1 A;  3BIN A;  1WXM A;  2N4F A;  3H7P B;  2IYD B;  1G6J A;  1MKE A;  2BYV E;  2KDF B;  3A9J A;  1BWN A;  1T0Y A;  4MEM A;  5HE2 A;  4WJO A;  4F1S A;  1FGY A;  2M14 A;  2RUK B;  2JRH A;  4I6N B;  3P2B A;  4XC2 A;  2LVQ A;  3UIO B;  1Y5O A;  1QQG A;  4HDO A;  4GU2 A;  1V89 A;  5G55 A;  3UF8 A;  3X0W A;  4URK A;  2XBB C;  3KRW A;  1WE7 A;  3M62 B;  2BWE S;  2G45 B;  1UGM A;  3KUZ A;  2KZR A;  1FXT B;  4WWN A;  2HTH A;  1E8Z A;  3QA8 A;  2OQB A;  3P6A A;  1DDM A;  3V5W A;  4KIK A;  3HM6 X;  4MGY E;  3GYP A;  4DX9 0;  5L81 A;  2Z0O A;  1EAZ A;  2K6D B;  3K9P B;  2FCS A;  2C7H A;  1K5D B;  2KFK B;  2KJ6 A;  2KHW B;  4H8S A;  1WR1 A;  3DBL I;  3VDZ A;  2P0H A;  2JF5 A;  4KZ0 A;  4E3C A;  4A3O A;  3F0W A;  3L08 A;  2KFK A;  3N3K B;  5AEK B;  2I5F A;  1M7R A;  1FGZ A;  1Q1O A;  2KAN A;  4IWO A;  3DOW A;  2K2U A;  2JRI B;  5GMV A;  2ELA A;  3NOB A;  3ZO5 B;  5DCN A;  4B6W A;  1WM2 A;  1TZ1 A;  4HDQ A;  1V5T A;  1AAR A;  2LXA A;  2ZPN A;  4HAY B;  2HD5 B;  5DPW A;  3VOQ A;  4PYU A;  1NBF C;  4L6E A;  1UPQ A;  1UPR A;  2AEH A;  5DI9 B;  3QAR A;  2E2X A;  4GDK A;  2H7D A;  3WA0 A;  3HQC A;  3QQ8 B;  1TTN A;  2KC2 A;  4KZC A;  2L7R A;  2Y8G A;  3F5R A;  4HB0 B;  1WZ3 A;  1OEY A;  4K17 A;  2MBE A;  4HAT B;  4BKT A;  3MPX A;  3TW1 A;  2D9Y A;  2LKO A;  2V3S A;  4W9D A;  2IY0 B;  2OJR A;  2L05 A;  1GC7 A;  5D3W A;  2A4Z A;  4JLC A;  4W9F A;  4CO7 A;  5AZH A;  3X23 A;  1J0W A;  2D9Z A;  3L0W B;  4W9K A;  3A8P A;  1WGD A;  2C5L C;  2AL3 A;  5KQ4 A;  4HXD A;  1UBI A;  4F7Z A;  4DHJ D;  4HAU B;  5JZE B;  5D6J B;  1WGQ A;  1WVH A;  1WFY A;  4IG7 B;  2M0X A;  2IO3 B;  1BTK A;  1PLS A;  2Q13 A;  3PS6 A;  1KZG A;  3ML4 A;  4IFS A;  2KO3 A;  1SE9 A;  3JW0 X;  2XK5 A;  3EHV A;  5DPR A;  1U29 A;  1LB1 A;  4G0N B;  1E8Y A;  3SV1 A;  3EEC A;  4PYZ A;  4ZYN A;  1WIA A;  5CX3 A;  3AI5 A;  2EKE C;  1KI1 B;  3M1I B;  3GYO A;  3K9O B;  2I1J A;  1XCG A;  2YT1 A;  1P1A A;  1WXV A;  1WF9 A;  2LGX A;  2ZNV C;  3L13 A;  4HK2 A;  1R4M I;  4GMV A;  1I7A A;  3PV1 A;  4OVU A;  2DZJ A;  4LJP B;  1P9D U;  4M0W B;  2N23 A;  4HB3 B;  3IVF A;  4GDL A;  4A3P A;  4EOY A;  5J17 A;  3PRP B;  3AUL A;  4JL9 A;  5L95 C;  1WR6 E;  3VHT C;  2DHK A;  2KNB A;  1J8C A;  4X57 B;  2RPQ A;  4NAW A;  4K7W A;  4PS3 A;  5HE3 A;  2M1M A;  3BJI A;  1R4N I;  2GOW A;  5IAA C;  3Q3J A;  3A1Q B;  3ULB A;  1H8C A;  4DX8 A;  2MBH A;  5JHA A;  3PLU A;  2D07 B;  2KWC A;  3KUC B;  4ICU A;  3AJ4 A;  2FCN A;  2WWZ A;  3KW5 B;  5HE1 A;  2GMI C;  3CF6 E;  1X05 A;  4GN1 A;  4MDK E;  4NAW B;  1KLV A;  1NTV A;  3L17 A;  2NCN A;  4K1R B;  2NMB A;  4BOZ B;  2HTH B;  4YL8 A;  2NPT A;  3WYF B;  2LZ6 A;  2MSE D;  2KDI A;  2RGF A;  1WX9 A;  2K25 A;  3D8F A;  4ASW C;  2IO0 B;  4XZ4 A;  2N1W A;  3Q3F A;  4LJO B;  3RUL A;  3ZNZ B;  4FN2 A;  3TO1 A;  1KOT A;  3SYX A;  3B0A A;  2L0F A;  3KYD D;  1KJT A;  3RUI B;  3W1S A;  2YS3 A;  1H4R A;  1LM8 B;  2WYQ A;  3GOE A;  2N7E A;  2ZPY A;  1WJ6 A;  1X1F A;  2N7D A;  1FHX A;  1LQB A;  2BGF A;  3WAN A;  3QC8 B;  3PG7 A;  4MY6 A;  4WWP A;  5C79 A;  1C1Y B;  3OAW A;  4PS7 A;  4KV2 A;  2KWU B;  4E74 A;  3AU5 A;  2GBR A;  2D3G A;  2L3Z A;  2P0D A;  3DVG X;  3KVF B;  5KHQ A;  1GJZ A;  1K5G B;  5C1Z A;  2COD A;  3PVU A;  1WX7 A;  3DBS A;  4EZJ A;  1FB8 A;  3PRM B;  3O65 B;  3RD2 A;  4NSW A;  4WQO B;  2G4D B;  2YVC A;  3VTV A;  2QHO A;  4F7H A;  2KX0 A;  3DDC B;  4FUL A;  4HCN B;  3D32 A;  2MA9 B;  3SD5 A;  1EVH A;  1PFJ A;  1S3S G;  1TQZ A;  2Y8F A;  2LVO A;  4JGH B;  3PPA A;  1V86 A;  1U5D A;  2RNR B;  4HB2 B;  2JP2 A;  1L2N A;  1W1H A;  3R66 C;  3T9L A;  5J3T A;  2R0D A;  2MRP A;  1EF5 A;  2DHZ A;  1WGR A;  2IO2 B;  5D2M B;  1UEL A;  2KGX B;  1D3Z A;  1DDV A;  2Y7B A;  3QWM A;  2XK5 B;  5EFX A;  2IBI B;  4DK5 A;  3APD A;  4DHZ B;  1V2Y A;  3ECI A;  5LON B;  4KHA A;  3NS8 A;  1GNU A;  3DQV A;  3QJZ A;  4BBK A;  1TJ6 A;  3B1L X;  3W1S C;  4IM0 A;  3AXC A;  2COC A;  2ELB A;  3VVW B;  2W2X C;  2Z0D B;  3B08 A;  2I5C A;  4HAW B;  1Z87 A;  2CS4 A;  2L0T A;  1V5U A;  1RFA A;  4BKG A;  2DHJ A;  2KQS A;  1X1G A;  5E6O A;  3U30 A;  2O6V A;  2JUO A;  1V88 A;  4FHK A;  4N9F 4;  1VCB A;  3VH3 B;  5LXI B;  2VSZ A;  1P3R A;  3I3T B;  2H7E A;  3LJ3 A;  3JVZ X;  2L76 A;  2KMC A;  3SUZ A;  1EO6 A;  2N9P C;  3PZD A;  3ZNG C;  4AOF A;  3PVL A;  5D3X A;  2JZ3 B;  1WE6 A;  2DZI A;  4ZRJ A;  2DYM A;  2IYB A;  1PQS A;  1TGZ B;  5HKH A;  1M7E A;  1ZGU B;  1WJ4 A;  3DVN V;  3QWZ B;  3ZUN A;  3V61 A;  4PNK A;  3FM8 C;  4BOS C;  4WJ7 A;  3D8D A;  2JPH A;  4FJV B;  2D11 A;  4ICV A;  2B3A A;  3TFM A;  2MBQ A;  2ROZ B;  3PSC A;  4AUQ C;  4MEL A;  4EKU A;  5JLJ B;  3DXC A;  4KSL C;  2LJ5 A;  1U27 A;  1YD8 U;  5C5B B;  1GC6 A;  2DZK A;  3QK0 A;  1W1G A;  3MJW A;  3TIX A;  2DX5 A;  2M38 A;  3HM3 A;  2BKF A;  5JP4 A;  2GBN A;  3MHS D;  4KDI C;  2FUH B;  2BYF A;  3PTF C;  4FLH A;  4TV3 A;  3DPD A;  2D4Q A;  4GPT B;  3KRX A;  4GMX B;  3QIJ A;  1RLF A;  1WM3 A;  2KDB A;  2REX A;  3A9K B;  3KUD B;  3ONS A;  3H7S A;  4DDG D;  4E71 A;  2EMT A;  4GXB A;  4FHJ A;  4W9L A;  2MP2 A;  2J0M A;  3RZW C;  1WG7 A;  3N32 A;  2BWF A;  4IAP A;  2JWZ A;  3D8E A;  4BKS D;  4BKS A;  1U5F A;  4TUU A;  2ZEQ A;  4CHK A;  2DYB A;  3APC A;  5G2N A;  2NZ8 B;  4WVF B;  4D0N B;  2K2J A;  2W2W A;  3RCZ A;  2XQN M;  5IA7 A;  2DZM A;  3M63 B;  4II2 B;  1X11 A;  3DVG Y;  1WRD B;  2FJL A;  3T8M A;  4MGZ E;  3QHT A;  1EGX A;  2CHZ A;  2KK8 A;  3CMM B;  2BPS A;  3WAP A;  3A9J B;  3ENE A;  3ZKJ C;  3TL5 A;  2KLG A;  2YF0 A;  4ZDV A;  5C23 A;  2KN5 A;  3L54 A;  1BAK A;  2BKR B;  2DA0 A;  2FIF A;  2MLB A;  5JH5 C;  1AQC A;  2V76 A;  1X1M A;  3RCP A;  1E90 A;  5E6N A;  4TKN A;  3RYT A;  1SHC A;  1VD2 A;  1E5W A;  4M8N A;  3PRZ A;  3V6C B;  3ZW3 A;  2UVM A;  1EUV B;  2A5U A;  4ANV A;  1WI1 A;  1IPG A;  4EZL A;  5L83 A;  3ODO A;  2IZV B;  3L16 A;  2O6V D;  2L2I A;  1UBQ A;  4W9H A;  2DKQ A;  5CTR C;  3VUW A;  1XKE A;  1XD4 A;  1FOE A;  2J59 M;  3KY9 A;  1CMX B;  2N9X A;  1TBE A;  4AP4 C;  4MSM B;  3NHE B;  3IHP C;  4EMO A;  2LOZ A;  2QKM A;  2L00 B;  3GZN I;  3PHX B;  4IM3 A;  4LDT B;  1WGU A;  4DHZ E;  3A8Q A;  3R7Q A;  4DHJ B;  4A6K A;  1UNP A;  5TR5 A;  3ZDM C;  2D9V A;  1V9J A;  2O6V B;  3DBH I;  1RRB A;  1AWE A;  4NQK E;  1E7V A;  4MH0 E;  1I2H A;  5KCV A;  3R3M A;  4A6F A;  2K8H A;  1NDD A;  1ZW7 A;  3OJ3 A;  2CRF A;  2Z0Q A;  2NBW B;  1MPH A;  3ZTD A;  2YRY A;  2X18 A;  2COF A;  3PEG A;  3ZNH B;  2JT4 B;  4PS8 A;  5LLI A;  2C7M B;  3TMP B;  4IM2 A;  2Y5B B;  4FJY A;  4F7G A;  3G9W A;  4NNJ B;  3UGB B;  1WJM A;  2LI5 A;  4BBN C;  2DN6 A;  3KSY A;  3VTW A;  1KM7 A;  2ZCB A;  4HJK A;  4RM8 A;  4FA6 A;  1WY8 A;  3VAW A;  1WI0 A;  3H7P A;  1ZVR A;  1U5G A;  4ANX A;  2N0Y A;  5C6R A;  2ASQ A;  3HHM A;  4ZRK A;  4WJP A;  5DPS A;  3SU8 X;  4WJQ A;  1TXD A;  4K2O A;  1V5M A;  2DAF A;  2DYQ A;  2JY6 A;  2V1Y A;  4BBN F;  2LUL A;  3VTU A;  4ANW A;  5C5B A;  2MQJ A;  3M3J A;  3W1Y A;  4XWX A;  1ZC4 B;  2C9W B;  1WJN A;  1RRP B;  4EZK A;  2YT0 A;  2LRU A;  4KIK B;  5HE0 A;  4HB4 B;  4B9K A;  2AWT A;  5J3Y A;  4PQ0 A;  4GGQ A;  1ISN A;  1GG3 A;  2VRW B;  1YX5 B;  2JXX A;  2COA A;  1XD3 B;  1UH6 A;  3V62 A;  4AWJ A;  1ZKH A;  4FBJ B;  2CY5 A;  5DHF B;  4F8C B;  4I6L B;  1P3Q U;  2D2Q A;  4GZU A;  2QKL A;  3FSS A;  1P6S A;  3ZDT A;  2BYE A;  2K8B A;  2W9N A;  1V80 A;  2Z59 B;  2ZNV B;  2DX5 B;  1MK9 B;  4K81 A;  3NZS A;  3DVN U;  5E6P A;  2I1K A;  3ODW A;  5J3Q A;  4AJW A;  2KX3 A;  4CHJ A;  1UD7 A;  2J7Q B;  4IWQ A;  2CHX A;  2KWV B;  2ZCC A;  5CHV C;  1NI2 A;  5CLL B;  3TJP A;  3V60 A;  3WAM A;  1UEF A;  4HHV A;  3TCA A;  1GUA B;  4W9G A;  2OTX A;  1Q0W B;  3WIM A;  5KQ1 A;  2MWS B;  2UZR A;  3A1Q A;  4GDK B;  1IP9 A;  3CXB B;  4MK0 A;  4AJY B;  5JHG A;  1ZSQ A;  2LUE A;  3PGE A;  3ZNI D;  4NJ6 A;  2RLO A;  2YSZ A;  2KDE B;  4WWO A;  2JVC A;  3OLM D;  1A5R A;  2DTC A;  1V49 A;  2DKP A;  2KKC A;  2DHI A;  3CSF A;  3DBR I;  3NSU A;  2K1F A;  2EMS A;  2KUP A;  2NPT B;  4CYE A;  3LDZ E;  3TBL D;  1NU2 A;  3DCG A;  4MSQ B;  3A98 B;  2L8J A;  2UZS A;  1WJU A;  3ZLZ A;  3S2A A;  2FNJ B;  1QC6 A;  1UNR A;  2HJ8 A;  3OJ4 B;  2D10 A;  3FEH A;  1J0G A;  5C16 A;  4NJ7 A;  2LWP A;  1WX8 A;  2K6Q A;  4GB9 A;  2J0K A;  2DAJ A;  2D9W A;  4GOC A;  1P0R A;  4II3 B;  3PT2 B;  2LYD A;  1DBH A;  4RMA A;  5D27 A;  2LD9 A;  3JSV A;  2PZ1 A;  4KSK C;  2LAS A;  2WDT B;  3APF A;  3HW2 B;  1BT0 A;  2RSU A;  4P7I A;  1LFD A;  4XX5 A;  2GJY A;  3DXE A;  4EUT A;  2EC1 A;  1QZE A;  2CU1 A;  2N1V A;  3A4R A;  3RT3 B;  2DLW A;  2KFJ A;  4IOY X;  4MM3 A;  2FCM A;  1P5T A;  3QX1 A;  3ZRF A;  4OVV A;  4YON A;  4DDI D;  3KH0 A;  4FJZ A;  1WGY A;  5LXH A;  3ZVR A;  4M8M A;  2LXC A;  1XT9 B;  5JHB A;  3ZVV A;  3HIZ A;  2GBM A;  4HPM B;  3AU4 A;  2LGD A;  2Z0P A;  2IFS A;  2ZJD A;  2LG1 A;  1E8W A;  3IFW B;  3RZF A;  3VH4 B;  4HLE A;  2R2O A;  3H9D A;  5LOP B;  3UQA A;  1MAI A;  3EC8 A;  4W9I A;  1ZC3 B;  2EJ8 A;  2KCJ A;  4KAX B;  4DXA B;  2FCQ A;  2MX2 A;  4KVG B;  1K8R B;  2MBB B;  2XEW A;  5GOW B;  2ROV A;  2DEN B;  3U8Z A;  2GBJ A;  5D3Y A;  2WX1 A;  1LW3 A;  3N7C A;  2CHW A;  1WH3 A;  2KMA A;  2LGY A;  2KLC A;  3IG3 A;  3VQI A;  3ZRC A;  5CHF A;  2PEA A;  3OAN A;  1LXD A;  2UYZ B;  4J6I A;  1J19 A;  2K8C A;  5FI0 A;  1P98 A;  5JHH A;  2O2V A;  4F7U P;  2KC1 A;  4DWF A;  4DBB A;  4DBG A;  4JQW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...