4K8AA

Fragment-based discovery of focal adhesion kinase inhibitors
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
251
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Fragment-based discovery of focal adhesion kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 251
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k8aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k8aA01
2HZIA 1BX6A 3RHKA 1ZARA 3EQFA 2RG6A 3DT1A 4PMTA 4W8DA 3V01A 1FOTA 3EQRA 3GU8A 1IG1A 3A8WA 3HMMA 4DH3A 4HCVA 4E6DA 3C5IA 3RALA 2XM8A 3P23A 1UU8A 3PY0A 4RX5A 2G15A 4OTRA 3M1SA 3NUUA 5J1VA 4QYEA 3D5UA 3L9MA 2WMBA 1Q4LA 1O6LA 4I4EA 3R8VA 5J1WA 3ZM9A 3GB2A 4JI9A 4NH1A 2GNLA 3ZXTA 4FKTA 2C5XA 2W1CA 5JGBA 2C69A 4QP6A 5LVPA 5CWZA 4CV8A 4MD7E 1PMVA 5HOAA 5LMBA 2UZUE 3NNVA 3R0TA 4FSUA 2LAVA 3SKCA 4G1WA 5TO8A 2R3HA 3R8LA 2BHEA 4Q5EA 4E1ZA 4XS2A 3NNXA 2BRBA 3UMWA 2JBOA 3Q2MA 4LFIA 4U8ZA 3EQBA 2C6TA 4FOBA 4UY9A 4QTEA 4L53A 2G9XA 3C4ZA 3GUBA 5HE3A 2ETKA 3EJ1A 1R78A 3UNJA 3HYHA 2QU6A 3Q5ZA 4JBPA 3T8OA 5J79A 2GHMA 2NP8A 2ZB1A 3WF5A 4XP2A 4FA2A 1ZZLA 3Q9XA 2A0CX 4K8AA 5FBOA 3P78A 4MBJA 1O9UA 3R01A 3E7OA 3IO7A 2QO7A 5KMKA 2O0UA 5CSWA 3JY0A 3FE3A 3E63A 1H4LA 3BYVA 4WA9A 3DJ6A 4IAAA 4XV2A 3HNGA 4IZYA 1FBNA 1KE9A 3NCZA 5DN3A 4EOSA 3QQGA 4RA5A 2QG7A 4L42A 5G6VA 2VN9A 1R3CA 4QD6A 3AT4A 4EOLA 4MF0A 4CT2A 2WMSA 4WO5A 3FXXA 4D9UA 4FTNA 3U51A 1YDRE 3CPBA 3MPAA 1OITA 2HCKA 3MA3A 2VTTA 3PZEA 2UZNA 2ERZE 3PYYA 4ITIA 4K33A 3F2RA 1BI7A 2ESMA 4IM3A 2GNGA 3A60A 3AC4A 3WARA 4ERKA 5JT2A 4R8QA 3MPMA 5D1JA 3V8WA 4HVIA 3IW6A 1XBCA 4EQUA 4GUEA 3F5UA 3HMOA 4L00A 5AR8A 4E73A 4U81A 2XRWA 2YWPA 1SMHA 1JAMA 1J1CA 2YM3A 3O23A 3OMVA 3PVGA 3QTIA 4H1JA 3EFKA 4O2ZA 4J8MA 4MBIA 4QQCA 4QP3A 4MD8E 4RJ3A 5DRDA 4EBWA 4FV1A 3NW6A 4KRCA 4GIIA 4F99A 4FV3A 5DR2A 3L9NA 4RJ8A 4GYIA 3T9IA 5FQDC 1V0PA 3R8ZA 2FO0A 5HBHA 4GL9A 2VTRA 2CNVA 4QO9A 3HX4A 2VWVA 4KD1A 5H8GA 4ZSAA 4YPSA 2J50A 2OU7A 2R0UA 5CASA 1FVVA 3BU6A 5L6PA 2XNOA 4YLKA 3DJ5A 4TNBA 4P4CA 3KRLA 4QMMA 4RVKA 2W4KA 4KIKA 3EQHA 4XJ0A 4ANOA 3UC4A 4TRLA 3CD3A 4QQTA 2B9FA 2BFYA 3Q9YA 4QP8A 5DPVA 5EM6A 4Q5HA 4J71A 5AUTA 2QCSA 2YLEA 4O2PA 1OIYA 4RMZA 5DYJA 1JOWB 4Y5HA 4E26A 4F7LA 3U9CA 1KUTA 3T3UA 4ANBA 2OZOA 1NY3A 5D41A 2YAAA 3VJOA 2X8IA 3RPRA 1O6KA 2OH0E 5I3OA 3R00A 3LJ2A 3OW3A 5ETIA 4ITJA 2WB8A 3DLZA 4AX8A 5BVDA 3E62A 4L3LA 2W5HA 4IZ5A 3GBZA 1DS5A 5HZNA 3LKMA 4O0TA 3VW8A 4B0GA 5I0BA 3FKOA 3ZC6A 2NPQA 3ANQA 3CKWA 3EZRA 4AACA 2I0YA 4L46A 5IU2A 4NJDA 4IC7A 3W33A 5JH6A 3FXWA 5H3QA 3DDPA 4TPTA 5TR6A 3GU5A 4FK3A 3S2PA 4LGHA 1WBWA 4A9RA 2C0IA 3DBFA 3F3VA 5L3AA 4FZ6A 4RC3A 4OTWA 4Y85A 4FKUA 2XZSA 2XP2A 5CEQA 4HGEA 3A2CA 4G3EA 3ZSIA 3PPJA 5AUVA 2R5TA 5EM7A 4O83A 3TKHA 3K5UA 3TUCA 2ITUA 3ETAA 3HDMA 4P7EA 4H05A 3U54A 3QKLA 3AC3A 5FBNC 3L8XA 4IADA 4BDBA 3FY0A 4EOKA 4BCMA 1TQMA 1OPLA 2O65A 1K9AA 1OI9A 2W1FA 4FI1A 4EBVA 4EORA 3QWKA 5J87A 3EQPA 4FV0A 2WMXA 2XKEA 4YJRA 5IEXA 2XS0A 2OJGA 4J53A 1M2QA 3V51A 2GQSA 4GJ3A 2W0JA 4ARKA 1NVRA 5A3XA 5FG8A 4CQGA 2JAVA 3EYGA 5BUIA 4C34A 3PE2A 4EOPA 3DJ7A 5IA3A 4PWNA 5LOHA 4BDDA 4G9CA 3NMUF 4WT6A 5I9ZA 2Z8CA 3L1SA 3FXZA 5HG5A 1A9UA 3F3UA 5CNNA 3SHEA 3V3VA 4KIPA 4PMSA 5JK3A 4L3PA 1ZAOA 4F1OA 3QRJA 4O0UA 5HIDA 3P4KA 3RK7A 2H8HA 3LVPA 3S00A 1V1KA 1OMWA 3AT2A 3I79A 4DH1A 4XV1A 3W2SA 1IAJA 5JN2A 1ZYJA 4I22A 2YFXA 4ZAUA 3FBVA 2QODA 1Q8TA 1OM1A 3TTIA 4DCAA 1OL7A 4CLJA 3NUSA 1YOMA 4GT3A 1UV5A 3KA0A 4R6VA 5DE2A 2YLFA 4FGBA 1B39A 5AP0A 4ZZMA 4F70A 5ANDA 3VHKA 4FTTA 1IAHA 3KXHA 5KBRA 4BBEA 1RQQA 4J1RA 5I4NA 2VGOA 2WU6A 2BAJA 4J97A 4YJOA 4DG0E 4YNEA 4Z9LA 3Q96A 3G0FA 2ITQA 3QX2A 2XYNA 4O6EA 2QO9A 2V55A 2YDJA 2ZMCA 3CC6A 1OUKA 2QKRA 4E4LA 2XH5A 4I0TA 2YN8A 4FTRA 4DEHA 4IANA 4AU8A 5BYZA 3VBTA 4FIJA 2O3PA 3ZCLA 2ETRA 3I5NA 4BCGA 4X2NA 4PNKA 2QOQA 1Y8GA 2ONLC 4AW5A 3FLQA 2CGUA 2FB8A 3OEFX 2WTJA 4FSTA 2XJ0A 3WZJA 3QCSA 4KA3A 1H0WA 1U59A 2VWBA 1E9HA 1OVEA 4YJTA 5I5ZA 4PDYA 3R30A 2ITPA 3PJCA 1U46A 4L68A 4O0WA 4JDHA 4HNFA 3MGYA 5J5TA 3BHUA 4EKKA 3B2WA 5EYCA 4HVDA 1ZYLA 3Q32A 5H9BA 2O64A 4D9TA 2QHNA 3VF8A 3VW6A 5DEWA 5EW9A 2CGXA 4GK4A 1M7QA 3VBQA 3VQHA 3TJDA 4QOXA 5HI2A 4NIFA 1VEBA 2WO6A 4PRJA 5AA9A 5IISA 1KE8A 1OBGA 4FKPA 3FHRA 2PPQA 4BRXA 3ATTA 3OXIA 4J7BA 2CGVA 3AD4A 1JBPE 1QMZA 5KKRC 3W18A 3DXQA 5BUJA 4A9TA 2WQEA 2VGPA 3R7YA 1JLUE 2QOFA 3G51A 3LCDA 5FP6A 3VS3A 4C3FA 3EL7A 4YZMA 4KBKA 4QNAA 3RI1A 4F1MA 5A4QA 1UU9A 4UEUA 2QR7A 3O7LD 2J0JA 2QOOA 5LXMA 3TNWA 3UZRA 2JDVA 4FT7A 2E9NA 1Y6AA 3QD3A 4XNEA 4Z7HA 3TUBA 3CTJA 3HMIA 3MY5A 2VTPA 3DBDA 4R1VA 5LCKA 4C4HA 4EZ5A 5KKRB 1PMNA 2QO2A 4I5PA 2VV9A 4JIKA 2JD5A 5M4IA 5H8BA 1AD5A 3KMWA 1Q5KA 4I6BA 3Q6WA 4UXQA 5CI6A 3THBA 5GIOE 2YZLA 4M0ZA 3F5GA 5GJGA 5HLWA 4DHFA 4GFGA 3RGFA 5AIKA 1OL1A 5AP2A 4GRBA 2BMCA 5IDPA 5B2KA 4Y46A 3KGAA 5CEIA 1HOWA 2UZVA 3RPVA 3U6HA 3ORIA 3BU5A 4BCQA 5DR6A 3HP5A 1DI8A 4J96A 1IR3A 4LOOA 4PMMA 2BALA 2OF4A 3OG7A 3QQUA 5IG1A 5LQFA 1ZYSA 3JS2A 2PK9A 4JXFA 3R8PA 4BTMA 3D7ZA 3CY2A 3RZBA 3QHRA 4E5AX 4R5SA 5ANKA 3LQ5A 1ND4A 4OBPA 2ITWA 4GIHA 4CNHA 4YGAA 3LPBA 2C4GA 3UNKA 2OGVA 1ZRZA 4JJRA 4DT9A 3D4QA 4IVBA 3V5QA 4FEWA 2OI4X 2OZAA 3AXWA 1ZMVA 1Y8YA 3O96A 5DA3A 4CFFA 5KUPA 3SC1A 3UO4A 4UV0A 4IWOA 4ANSA 3F66A 4EC9A 1YI3A 3FQHA 3VHEA 3D5XA 4Z55A 2WMRA 4R3RA 4B7TA 3I7BA 4ZEGA 5I9XA 3DXNA 3LJ1A 4IDTA 4W8EA 4L44A 2XKFA 5IQHA 1P4OA 2CMWA 4OT6A 5A4TA 3NWWA 4FV7A 4BZDA 2J5EA 2X4ZA 1FMKA 4DH7A 2XJ2A 1IEPA 4NJ3A 3A61A 3D94A 4RFMA 5T6KA 5EHLA 3UO5A 5AR4A 2YM7A 3TXOA 4I1ZA 2DS1A 4PNIA 5AMNA 4C4IA 3TV6A 4BHZA 2GTNA 4BYIA 3LFNA 4BWKA 2RFSA 5E8TA 2JDTA 3CGOA 4IAKA 5TT7A 3ZYAA 4AE9A 3HL7A 1BMKA 2C0TA 3CXWA 4OBOA 3SXRA 4BHNA 4CYJA 1PXJA 5J9LA 5EQPA 2PUUA 3PPZA 3R6XA 4U7ZA 3TV7A 5A4LA 3GC7A 2XK3A 3FSFA 4PF4A 5JFSA 4BYJA 4I5MA 2YWVA 4N0SA 4NYEA 1ZMUA 5M4FA 2YCFA 3K5VA 4QTCA 3I4BA 5BX0A 3FPMA 2XIYA 4I0RA 3LFEA 4JAIA 2UVXA 2XKDA 3FLZA 5IA5A 3C9WA 3G9LX 3QZIA 2ZV8A 4FIIA 4MWHA 3ROYA 3U4UA 4C59A 4EH7A 4MAOA 4MXZA 3KK8A 3NUNA 2RGPA 3SGCA 3BV2A 4G2FA 3UYTA 3EYHA 4FV9A 1F5QA 1PY5A 5C8NA 5GINE 2I7QA 2Z60A 3U6IA 3R1QA 3TM0A 3FUPA 4DYMA 3W2CA 4EOIA 4XP0A 5EI2A 5FTQA 4EI4A 3R8UA 3RK5A 3W10A 3POOA 2ZB0A 3D7TB 4PL5A 4U79A 3VBWA 2PUIA 3LCOA 4FG9A 2GHLA 1NVSA 4UB7A 4AA0A 4F7NA 1GJOA 3GU4A 3L8VA 3QYWA 4TYJA 2UW7A 1YWVA 4LM5A 3VRZA 4AA5A 5T3QA 2BFXA 3ZFXA 5HHWA 2VO3A 3ZHPC 4TWOA 5BMMA 4FUYA 3DKOA 4MYGA 4MNEA 5HGIA 3UOLA 4E6QA 5L8KA 2X7GA 4ZSJA 5CZIA 3LIJA 4L01A 1XBBA 5C8MA 4FKJA 1PXPA 1SZMA 2BAQA 2UZLA 3HV5A 4RC2A 3VUIA 4R78A 5FTGA 3ZLYA 2E9VA 5CU3A 3P7BA 5FGKA 4YP8A 1K2PA 4ACGA 1J7UA 1G8SA 2PL0A 5E8UA 2E9UA 3TV4A 4G17A 4DEBA 2RL5A 5IDNA 2Q0NA 3CR0A 4AA4A 4ZTSA 2VO0A 2JDRA 4AFJA 1MP8A 1T45A 1WVWA 1CTPE 3QA0A 5CF5A 5IH4A 1YOJA 3IECA 3WE8A 4FV5A 4GT5A 4MEDA 2C5NA 1GY3A 2R3IA 4D55A 2WHBA 3K3JA 4YTFA 2VX0A 4AOIA 3C7QA 2F4JA 4NIFB 1MRYA 5GJFA 3R7IA 2B4SB 3TI1A 1YXVA 2I1MA 2JKQA 3FMHA 5BVFA 3FAAA 4IAFA 2XK7A 4I0SA 3TEIA 1CKJA 4O27B 4C35A 3BLHA 3KCFA 2YIRA 3HV6A 4AOTA 4E6AA 4GS6A 5AP6A 3RHXA 3MV5A 4G6NA 1FVRA 3MFTA 3FMLA 3HMNA 1XH9A 3D2IA 5KMOA 2CNUA 3DDQA 5CENA 2ITOA 1XH5A 2VTJA 3PIZA 2YM8A 3Q6UA 5E8SA 4EONA 4XP3A 2OLCA 5IA1A 3BWJA 3UPXA 2HAKA 3GOPA 5F4NA 4EWQA 1QPJA 4FL2A 1BLXA 2PVYA 3UPZA 2WXVA 4BIBA 3MJ1A 4IQ6A 4DEAA 1SVGA 3QUEA 3HMPA 4EH2A 4RVTA 4YTIA 2LGCA 2X39A 1NA7A 1ZLTA 2QQ7A 3BBWA 3R7EA 5CAUA 4JLCA 4D1XA 4ID7A 5FWKK 4HVGA 3NVMB 3ELJA 4CFWA 5HU3A 5JQ5A 4FF8A 2DUVA 3QRIA 5IA4A 3DOGA 2UW4A 3QC4A 4E8AA 2P2IA 5A4EA 2X4FA 3BX5A 4DFBA 3TKUA 2VZ6A 4EOMA 4F63A 2CLQA 3LLTA 3QFVA 3QLFA 4D5KA 5FD2A 4N57A 4YHFA 4FT0A 2RIOA 3OWLA 3VC4A 5C9CA 4ASZA 3OCTA 1WVYA 4ONAA 3NAYA 2IG7A 1G5SA 3Q2JA 4CG9A 2IZTA 3SW7A 4JVGA 4BTKA 4AW0A 1ZXEA 5CY3A 4I5CA 3DFCB 3FZSA 3TDVA 4KIQA 4HGSA 2R3PA 4RJ6A 4UALA 4W9XA 5CU2A 5TKDA 4DGNA 5FP5A 4V01A 4FTIA 2OSCA 3TZ7A 4QPSA 3V5TA 3IDBA 4LGGA 4R1YA 3CQEA 4R3CA 3R1NA 3E7VA 2HY81 4K18A 4FZDB 3ZU7A 3QUPA 2GNJA 2WQMA 3PFQA 3QHWA 5AUZA 2A27A 5LMAA 5JGDA 4BDKA 4O0SA 3QWJA 4KWPA 2W96B 1TVOA 4OTHA 4L7FA 2JFLA 3MH1A 3HAVA 1M17A 3HP2A 3KRJA 4AFEA 3HGKA 3PVWA 2VTLA 5JSMA 2QOKA 4FKWA 4X3FA 4D0WA 2QI8A 2B9IA 2FSOX 5HNBA 3VUTA 3WF7A 5K9IA 1YKRA 4BL1A 3NW5A 4V04A 3QKMA 4FV2A 4ZSEA 4ZMFA 3FEGA 2XK8A 5I9WA 2UW8A 1SNXA 3LFCA 3EN9A 2X9FA 4UBAA 4WNOA 3Q4CA 2V7OA 4IFGA 4X2KA 1SM2A 3IG7A 4XRJA 3EL8A 4FKQA 5AV3A 1H1PA 3C5UA 3OZ6A 4BF2A 1BYGA 1SVHA 3NNWA 4XOYA 4DBXA 4KABA 4FICA 2JGZA 2XA4A 2VTQA 5L8JA 3KXXA 1W7HA 3QGWA 3OWPA 4PPCA 4WNPA 3GU7A 5EW8A 3SX9A 3ZO3A 4D1SA 5B7VA 4EYMA 4LV8A 3MPTA 3ROCA 3DK3A 4M15A 5CU0A 4V05A 4CVAA 2GFSA 2IZUA 2CCHA 1APME 3QZGA 4FTKA 3RZFA 4DEDA 3TNHA 1OIQA 4ZP5A 3KRRA 4IJ9A 3CE3A 4RGJA 3NUAA 4HPUE 3BYOA 2XEYA 4IE9A 4NKAA 3BIZA 3F2NA 3LFDA 4M69A 4FUXA 5CVFA 5ITAA 3HVCA 4FKVA 2JEDA 4L43A 5EM8A 3QXPA 5CT7A 2R3QA 4AE6A 4O7RA 4XG4A 4B8LA 2IWIA 2XM9A 3IS5A 3NGAA 3U87A 4TKSA 4JDIA 4RIWB 3ZUVA 4RWLA 4JRNA 3ZONA 4AN3A 4IJPA 4NUSA 5ETFA 2P55A 5AWMA 3CPCA 4IX6A 2IVTA 1H8FA 3QTWA 3VUHA 5IMEA 3D14A 3GT8A 3MTLA 4ZLYA 4F9WA 2ZV7A 2UZDA 4RIOA 2PVLA 1IASA 4FEQA 4LUEA 3RMFA 2PVRA 4FV6A 4U3ZA 4BTFA 2W4JA 2WMUA 3NLBA 4YJPA 2H9VA 2JITA 1TKIA 3QX4A 4WBOA 4MWIA 2WGJA 3OW4A 3RKBA 2XK4A 5JRSA 2YCRA 3O2MA 4HJOA 4IIRA 4MNEB 5J95A 2J51A 1ZOEA 2HK5A 4AZVA 3EQDA 2VTAA 1B6CB 2VTOA 4KB8A 4UMQA 1GNGA 4GFOA 4IVAA 3TG1A 3WILA 2PSQA 4BCPA 3LCKA 4O96A 4EHEA 3UJGA 3EOCA 5AAFA 5BVOA 4WNMA 3O7LB 3BBTB 2OBJA 3OOMA 1STCE 5DG5A 3WZKA 1BKXA 1QL6A 1PXOA 3FYKX 4BZNA 4ZY6A 2ZVAA 4BDCA 3RP9A 3R73A 3BQCA 2CGWA 2R7BA 3RCJA 5FUTA 4U6RA 3ZZWA 4QPMA 4AWIA 4XV3A 4PL4A 4U45A 2EB3A 3HRBA 4IVCA 4DEGA 4NSTA 4HVHA 3C51A 3R2BA 3LFSA 1Q3DA 1VYZA 4KS8A 4UWYA 4LL0A 4I6HA 2X2MA 5GNKA 2F9GA 1MRVA 3KF7A 3WZUA 4XG3A 3FC1X 3R9RA 1U54A 2ITYA 1LR4A 4PY1A 4UXLA 1YOLA 4ZOGA 5HO6A 5D11A 3H10A 3RAWA 3FI2A 5E1SA 1M52A 3W8QA 4XBUA 1H1QA 2OG8A 3O71A 5KCVA 2W1EA 5EQYA 1NXKA 3L8PA 2R2PA 4E4MA 4MTAA 5AX3A 4F0IA 3QC9A 4QP1A 4EHGA 3F6XA 4FKGA 3R71A 1UVRA 3ORMA 4U0IA 5AM6A 3Q52A 5K4IA 4FODA 2C6EA 3DFAA 3E93A 3EQIA 4XV9A 1T46A 3JYAA 4HYUA 4ALWA 2OJFE 3QD2B 4LMUA 1JVPP 4F9YA 5CQUA 1W0XC 2FVDA 3QQKA 4CSVA 2C5OA 5DT3A 2XBJA 5FXQA 2VWXA 2R3FA 5HKMA 4RVLA 2CN8A 1OKVA 3UQGA 4YJSA 5KE0A 3MVHA 3H4JA 3MYGA 3KC3A 3AC8A 4L8MA 3LM0A 2QOIA 3BE9A 3ZLWA 4D2TA 2IN6A 4TW9A 3Q4TA 4I20A 3LHJA 3COKA 4Q9ZA 3LMGA 1VZOA 4YJUA 5ETCA 2NRYA 4MCVA 4Q2AA 4EQMA 3SOAA 3OHTA 4C37A 4AZEA 1W84A 4YJQA 2JDSA 3TNQB 5EKNA 4JG6A 3ZUUA 5L4QA 1VJYA 4PDOA 4CXAA 3MVLA 2X2KA 4FNXA 4ZTHA 4EK3A 5E4HA 5CVGA 3ORKA 1M14A 4G9RA 4GEOA 3PRIA 2QKWB 4L6QA 4RZVA 5A9UA 3MFSA 3BCEA 4Y72A 2JDOA 2XNMA 3F82A 4QNYA 4QTDA 2ZOQA 4A4XA 2W06A 3HV3A 2OJ9A 1Y57A 3KCKA 4GW8A 5H8EA 1R0PA 5IA2A 2BZHB 3AC5A 4YO6A 1PYEA 3BKBA 1GIJA 2PTKA 4DH5A 4JBOA 3FMNA 4GG5A 1ZMWA 5AR7A 3VBYA 3II5A 3OXTA 4FBXA 5AV2A 3QCXA 4EK4A 2C6IA 4E93A 2YAKA 3OCGA 4BCHA 4FTUA 3A4PA 3KKVA 4CRSA 5C26A 2GS6A 3T3VA 1YXTA 3HV4A 1WFCA 3GOKA 1XH4A 2GQGA 2OK1A 4X3FB 1URWA 3DCVA 5I9VA 1PJKA 1YXXA 4FSMA 3I6UA 5E92A 3CQWA 2C6DA 3Q04A 5M06A 4F7SA 4RIXA 2ITVA 3UTOA 1FINA 2W1GA 1DM2A 4AN9A 2X6EA 3IONA 4FL3A 4O0RA 4JG7A 3W2QA 2CKOA 3E3BX 2I40A 1Y91A 3UNZA 1PRYA 4CMTA 3IOPA 1JSTA 1CMKE 4RRVA 5EDRA 2DYLA 1XO2B 1LEWA 5F1ZA 4AP7A 2W9FB 3BWFA 2C6OA 1GIHA 2HYYA 2AC3A 2WTWA 2XCHA 4FG7A 3UOKA 2VTSA 4OAVB 2A1AB 4R7BA 5IUHA 2FH9A 1YHWA 4FZAB 4NKSA 3IGOA 1FGIA 3BGQA 3B8QA 2E9OA 4IAIA 5ANGA 2PZYA 3H9FA 1WBNA 2R3KA 5K5NA 2C6LA 2J2IB 4H36A 4FNYA 3WIGA 4XG9A 4E4NA 2WMVA 4PP7A 4JX3A 3DBQA 3LLAA 3QTSA 3OC1A 1X8BA 2AC5A 3FY2A 2WU7A 5TF9A 2GPHA 2PVJA 1H25A 1JSVA 2JKKA 4JL9A 3ACJA 2NNWB 1YWRA 2CDZA 2VWWA 3LOKA 3P0MA 1E1VA 2BRHA 2UZEA 2PY3A 2X81A 4M14A 5H2UA 4AAAA 3ENMA 2OXYA 4P90A 3ORNA 2UW0A 4WBBB 4NM0A 4O7YA 5D7AA 5LMKA 4WHZA 3O8TA 5CANA 3PIYA 4I24A 1KOAA 1ZZ2A 2W5BA 2WEIA 2IVSA 3SRVA 2FSLX 4IDVA 4GH2A 3FWQA 3NYNA 3RPOA 1YXUA 4BFMA 1UKIA 3FC2A 4G3CA 1PMUA 2UW9A 3HRCA 4WSYA 3ACKA 3VN9A 5CNOA 3MY1A 5EOLA 3CLYA 3AC1A 3VO3A 4F9CA 4ZY4A 3RAIA 2BKKA 4YSJA 3SXFA 3BLQA 3PXZA 4NCTA 1R1WA 3MSSA 3G6GA 4AG8A 3PG1A 4R7IA 4C2VA 4FG8A 4XG8A 4BKZA 4DTAA 5M51A 1BL6A 4JR7A 3A99A 4JBVA 3BEGA 4AT3A 4YMJA 4RWIA 2WZJA 4EUTA 1U5QA 2R3LA 4IM0A 3BE2A 4RLLA 3D5VA 5IH5A 1I09A 3CTHA 5DT4A 5KZ0A 2YM5A 3A7HA 4UMUA 5G1XA 4RX7A 3R7VA 4EHVA 5B2LA 2VWIA 2OFVA 1PXNA 3FDNA 3FZPA 3KN6A 3TT0A 4YLLA 4TYIA 3HV7A 3NUYA 5AAEA 1V0BA 3GP0A 1YW2A 5HTIA 5DH3A 1EH4A 3SQQA 3SOCA 3ZBFA 3DB8A 4X2FA 4LL5A 3DKCA 2ZM1A 3AMBA 4ZIMA 4APCA 3DTWA 4GT4A 3RNYA 4EJ7A 3I0OA 4OTFA 2PYWA 4FZFB 2W4OA 3BQRA 4IACA 2QNJA 3LFFA 4UN0C 2JLDA 2P4IA 3GCPA 4D58A 3MN3A 2WTKC 3S95A 4CLIA 4CCBA 2WTVA 5CSXA 4EEVA 3OBGA 1HCLA 4FL1A 3VNTA 5ANEA 4GUBA 1F0QA 3FLYA 4YHTA 2W99B 2VX3A 5CXHA 5D7VA 4W9WA 3MTFA 2JIIA 4LOQA 1OKZA 1Q8UA 2WTKB 3QRTA 4LYNA 5EI6A 3UG2A 4ALVA 4TWCA 4B9DA 3B8RA 4NM7A 5JQ8A 3GQLA 2UZOA 4JR3A 5E8YA 3W16A 2P2HA 4CKRA 2BZIB 3QTZA 3GC9A 4IZ7A 4QMSA 2XIKA 1NW1A 3JR1A 1OECA 2OIQA 3GNIB 4ANLA 2OJJA 3P1AA 3FSKA 2J6MA 4ZY5A 4QP7A 4TYHA 5AUXA 1OUYA 3CGFA 2W9ZB 4Y83A 4XMOA 5A14A 5CXZA 5CEKA 4MQ2A 4XBRA 4DFLA 4WRSA 4PV0A 1PYXA 3C0GA 5CVHA 3BHYA 2OKRA 3GQIA 3O51A 4E5WA 3OTVA 5HVYA 5KZIA 4MXXA 4MD9E 2F57A 2YDIA 3NCGA 4O7ZA 5HD7A 2J9MA 4ZLOA 4PTCA 1OB3A 1H00A 4G3DA 3PTGA 4H39A 2I6LA 2H96A 1QPEA 2C3IB 4QRCA 4ORKA 2R0IA 3MVJA 3SG8A 2FYSA 3KMUA 1YDSE 1I44A 2CKPA 4C61A 4C3PA 3PE1A 1BL7A 3W55A 4DITA 2UW6A 3DY7A 3G33A 3PJ2A 1L3RE 3SW4A 4EL9A 3LQ3A 4D1ZA 2UZTA 3QYZA 4IB0A 5BVKA 3RWPA 4FR4A 4D4RA 2VAGA 1OIRA 2J0IA 4WRGA 3K2LA 2BIKB 2YIQA 3NRMA 2W17A 4HGLA 3VS4A 4E20A 4FKOA 5HO7A 1REKA 3TWJA 3L9LA 1FPUA 2X7OA 3QD0A 2F49A 4QP2A 2ZAZA 5GHVA 5AJQA 3OBJA 3CBLA 4AF3A 4DFZE 1JWHA 3PSBA 4LOPA 2Z7LA 3FMDA 4KIKB 3BEAA 5FEEA 3BHHA 2A2AA 3IDCA 2JKOA 4QMXA 3A7JA 5E9EA 4K1BA 5DIAA 1REJA 3IPHA 4P5QA 1XKKA 2EXEA 3PIXA 4FTJA 5CAQA 5KNJA 2VRXA 4JT3A 5HIBA 2I0EA 4WD5A 3DB6A 1PMEA 3HUCA 4GVAA 3G0EA 4EH9A 4MXOA 5M44A 3NS9A 2CJMA 1JKTA 3FMEA 4YHJA 3ALNA 5DBXA 4FT3A 5DNRA 3SD0A 5ACKA 4ZJIA 3WZEA 3E87A 2FSTX 3QTUA 4O91A 4W4XA 5E1EA 3VS0A 1URCA 4QMUA 2I0HA 3W2OA 4A9UA 1Q8ZA 3VULA 3WZDA 2X6DA 3IW4A 4BI1A 2WIHA 5F9EA 4GMYA 3L9PA 5HNGA 4PPAA 1H28A 5BMSA 4NL0A 3EKNA 2HY0A 2YZAA 3FJQE 2GDOA 2J0MB 3DKGA 2C6KA 2XB7A 1Q24A 3E8EA 4IWQA 4QP9A 4YZBA 3S3IA 1KWPA 2XKCA 3TTJA 4CEGA 4KSPA 2JIVA 4LGDA 3QQFA 3ZC5A 5L8LA 3SRVB 3B2TA 3EN5A 4FE2A 3FMKA 1FQ1B 2QU5A 2X9EA 3PXFA 5JZNA 4D4VA 1CKIA 5E8XA 1Z9XA 2XUUA 4ZK5A 3P7CA 2B55A 2VO7A 4O1PA 5F20A 3FQEA 4M0YA 5AR5A 5JFVA 2Y6MA 3POZA 5AV4A 3WYXA 5DI1A 3ZXZA 2JKMA 4DFYA 3COHA 4DN5A 1JKLA 4O7VA 2XK9A 4O6LA 5AFVA 3NZ0A 4JDJA 4M97A 4YC8A 3CSVA 3RM6A 4NW6A 5HICA 4D2SA 3F9NA 3PXQA 4RWJA 2G2IA 4P5ZA 4Y8DA 3QXOA 3TZ8A 4EH6A 3FI3A 2XNPA 4L52A 3AD6A 5M55A 3D15A 2Y6OA 4FIFA 4H3BA 4OAUC 4X21A 4YR8A 1H01A 2EXMA 3PXRA 3JXWA 4F7JA 4A07A 5AA8A 3FYJX 4TY1A 4AZSA 3TUDA 2WOUA 5HG9A 3QALE 4F9BA 2BRGA 2XBAA 3EQGA 3QZFA 3AT3A 5DGZA 3VS5A 4TZRA 4AS0A 5AR2A 4X6QC 3FKNA 4I5HA 3OUNB 5C27A 4OTQA 4CTBA 4PQNA 4IAZA 4OBQA 2REIA 4EZ3A 4UMPA 5K5XA 3CJGA 1J7LA 4GSBA 4U44A 1WCCA 2IVUA 1PXKA 4TYEA 4MXAA 3WF6A 3SXSA 5AV1A 2B52A 2J0LA 2ITZA 2XEZA 4JBQA 4TN6A 2PZPA 3EMGA 2WNTA 3EFLA 3GCSA 4HOKA 5IUIA 1KV2A 4ZXTA 4YJNA 3C50A 3MB6A 1M2RA 2GHGA 5D12A 2PZRA 4D5HA 3ORXA 4JAJA 5M07A 3HA8A 2FA2A 2X0GA 4IH8A 3QTRA 2VX1A 4D4SA 2UZWE 4KAOA 2B0QA 4BCOA 4YNOA 3EB0A 3KRXA 5EDPA 4HYIA 5E8WA 5EOBA 4N6ZA 3TJCA 4X6RA 4BWXA 5FLFA 1LEZA 5CYIA 4EOOA 3G9NA 4QMWA 4FKSA 3L8SA 2WIPA 3D5WA 2YCQA 4PTGA 2WEVA 2IO6A 4ZSGA 3KRWA 4TYHB 3BYMA 2JC6A 4QPAA 1JNKA 3A7GA 4LMNA 2CKEA 3F5XA 3BYSA 1XH8A 1FGKA 2AYPA 5CEOA 2OF2A 3K3IA 4EOJA 4O22A 3VAPA 2IJMA 3WE4A 3HRFA 4UWBA 3F3ZA 2GQRA 5CT0A 2PUPA 3DK7A 3VQUA 2YERA 3F3TA 2QLUA 4L7SA 2WMQA 1L8TA 3BHVA 4Y95A 3QQLA 5EKOA 4C33A 3PJ3A 4RSSA 2QOLA 3DLSA 4BI2A 4DH8A 5CF4A 4BGQA 3RAHA 4XG2A 1A48A 1KE6A 3SAYA 4BIDA 3PDTA 2JFMA 2P33A 4OT5A 3UYSA 4B99A 3AD5A 4C4FA 3P9JA 4OUCA 5CAPA 5L2IA 4EK6A 4X2GA 3FHIA 4TXCA 2BVAA 4C38A 3EWHA 3FQSA 4LRJA 4M84A 3ZSGA 2GNHA 4EKLA 2C68A 4FSRA 4RFZA 4XG6A 3PUPA 3C4XA 3KULA 4FTLA 1NVQA 3PVBA 4I21A 3Q9ZA 4XCUA 4D2WA 3UOJA 3C4WA 3MI9A 2BILB 5IUGA 3G5DA 3QD4A 4U97A 4C62A 4O21A 2Y7JA 1A06A 4UMTA 5GZAA 3QTXA 3AC2A 4S31A 1P14A 3ZDIA 3GC0A 3PA3A 3R28A 2IZSA 3ITZA 3P86A 3IGGA 4C36A 2C3JA 4IB1A 3ZRLA 4F64A 2YJRA 4FSNA 1Q3WA 3UVQA 2GMXA 3HLLA 5D10A 1H0VA 3GGFA 3H9OA 4ALUA 4USEA 2J7TA 3KF4A 4RVMA 2W05A 1YQJA 4ZTLA 2OXDA 5CTPA 2UVYA 3BYUA 3GC8A 3QU0A 4PTEA 2W1HA 2R3NA 4O0VA 5E90A 4HCTA 4A9YA 4D2PA 1VR2A 3G6HA 4R5YA 4EC8A 3BELA 4II5A 3OCBA 4WUAA 3R9DA 2EXCX 3S1HA 4DFNA 3M42A 4GK3A 3TZMA 4I4FA 1SNUA 5HX6A 5HQ0A 4RA4A 5GJDA 5BVNA 5IF1A 3C4EA 4J99A 4YTHA 2OZAB 1H08A 3CTQA 3OOGA 2VNWA 4JG8A 4QMOA 5F95A 4A9SA 1GOLA 3TACA 5L2TA 5M57A 4RX8A 2QD9A 2JIUA 3DGKA 5HE0A 4XLIA 3ZDUA 3VS2A 3C4CA 2XVDA 2C1AA 3OEZA 2PMIA 2HIWA 4FSQA 3UODA 5KMNA 3NIEA 4YSMA 1QPDA 3U8WA 4RX9A 4WUNA 3TL8A 3NW7A 2QC6A 2YCSA 5T68A 4IEBA 4YBJA 2CNQA 3D9VA 3QUDA 4RWKA 2OFUA 5KMIA 4EK8A 2V5QA 3KEXA 4GCJA 3GCUA 4CZUA 5TOZA 4WIHA 5KMMA 3M11A 4FTMA 2VD5A 4BY9E 3VBXA 4BCFA 5IQFA 3DBCA 3VS7A 2CLXA 4KBCA 2YEXA 3ZTXA 4RT7A 1XQZA 2Z7QA 1FMOE 4FTAA 2FSMX 4AOJA 1GAGA 3LMIA 2W1IA 2O8YA 2YIYA 4BCNA 3PA4A 4BVUA 3R04A 3QGYA 4UYNA 3U9NA 3DZOA 4FSZA 4ZJVA 4O7NA 2R4BA 5HVKA 2VWZA 2UW5A 5DEYA 5TE0A 5BQ0A 5M09A 5AP4A 2XF0A 5AV0A 4O84A 1RW8A 5IEVA 4DLJA 1M7NA 5BYYA 3GFWA 3ENHA 3LFAA 5J7HA 4ACDA 1MQBA 4C2WA 3W2PA 1JPAA 5AM7A 3PWDA 2RG5A 2B7AA 2G1TA 2Y4IB 3PY3A 3DAKA 4XLVA 5CAOA 2C3KA 2ZJWA 3NPCA 5EYDA 2RFEA 1CM8A 3JUHA 1YHVA 4M7IA 2WPAA 2PZ5A 4JNWA 4NEUA 1GZKA 4BDAA 3TNPC 5GIPE 2Z7RA 5C01A 4E3CA 5HBJA 3ZO2A 5A54A 2PE2A 3JVRA 4EWHA 3PA5A 3UOHA 3MW1A 5K0XA 4F9AA 2HZ0A 4JQ8A 4I41A 5AP1A 4CFMA 5JRQA 5JZJA 3LXNA 3KN5A 3O17A 2PZIA 3ODYX 3QCQA 4L3JA 2C6MA 4MXYA 3CS9A 3GI3A 5EYMA 3LM5A 3GXLA 2CPKE 3C0HA 4FOCA 1WBTA 4FVPA 5ETAA 3LFBA 5CX9A 4G34A 4JS8A 2BPMA 3LCSA 3KXGA 1E1XA 2WFYA 3O8UA 4U5JA 5HE1A 1JKKA 3AQVA 2GCDA 4IXPA 4NT4A 3UIUA 2WMTA 2YITA 4OTGA 4RZWA 3G2FA 2BROA 5AUYA 3HZTA 4F0FA 2OW3A 3VUGA 4DE4A 2VTNA 2WAJA 3NEWA 3QRUA 5AX9A 1H24A 3U55A 1Q8WA 4AW2A 3CY3A 4UMRA 2QG5A 3O50A 4AGWA 3UG1A 4FNWA 3V5PA 1QCFA 4JIAA 4DG3E 2C1BA 4YJVA 4C58A 5C4KA 4GG7A 2PWLA 1YI4A 2E9PA 4BDIA 5KO1A 3TKIA 1W82A 4H3QA 3MBLA 3MH3A 4NTTA 3IW5A 3DNEA 4J95A 4ERWA 3PLAE 2VNYA 5ANJA 1H27A 3F88A 4L45A 2IW8A 3LAUA 4X3JA 4G31A 4NFNA 2PVNA 3VJNA 4CKJA 4G5JA 4DBNA 3KL8A 4WG3A 1UKHA 1PHKA 4BIEA 3AOXA 4FIGA 4I23A 1TQIA 2VWYA 2WQBA 5CU6A 3FPQA 5HTCA 3MFUA 3BV3A 3ZS5A 5CS6A 4GKHA 2EU9A 4NWMA 5KX8A 4CZTA 1H07A 1UA2A 3I1AA 3NUXA 1OPKA 5I9UA 3MVMA 3U4WA 4F09A 1M2PA 4DT8A 3AMYA 4APPA 2WOTA 3OWKA 3KULB 2QONA 5LWNA 4AUAA 4C4JA 3FMJA 3R63A 4H3PA 5LVNA 4F08A 4D28A 2XIXA 4RIYA 3OWJA 2XYUA 3BGPA 1Q41A 1CSNA 4BDGA 5BYLA 4BCIA 2KULA 2ACXA 1XH6A 3N51A 3QKKA 3QQHA 3CCNA 4JX7A 2XRUA 4KKEA 4AZFA 1LUFA 1AGWA 1XH7A 2RFNA 4OR5A 4UZHA 5CSHA 4BCJA 3HEGA 1HCKA 2R3GA 3DNDA 5IA0A 5C1QB 3FKLA 4M12A 5HCXA 5CEPA 3A62A 3AGMA 4ZTMA 4FYOA 4EYJA 2GNIA 4G5PA 3F5PA 1P2AA 4RPVA 3SG9A 3MA6A 3KU2A 4FC0A 3ZFYA 4GKIA 4J98A 4HPTE 4O7SA 4V0GA 4MX9A 5A6NA 4S33A 5HESA 2DQ7X 4FIHA 5JFWA 1PW2A 5AP5A 1GZOA 4PDPA 3T9TA 3N4TA 4U42A 2BHHA 3PPKA 4K2RA 3PZHA 1OZ1A 3VUDA 2YABA 4X3FC 4CD0A 2GS7A 3OUKA 2O63A 1RDQE 5LARA 3WF8A 4BDEA 4DGMA 2BDFA 1YXSA 3PP0A 4ZJJA 3LFQA 4NK9A 2PMNX 4XEYA 2E2BA 4QP4A 4DEEA 3QTQA 4IX5A 5HX8A 4BGGA 5CQWA 3E88A 2HZNA 3AG9A 2OIDA 3H9RA 4HYHA 4RFYA 4AXAA 3R02A 3WIKA 4BBFA 2AUHA 3VVHA 2ONLA 3MB7A 4D4YA 1IA9A 5J9YA 1OBDA 3Q3BA 2PMLX 3SA0A 3EFWA 5IMXA 4OLIA 1WBVA 3KQ7A 3DZQA 3LJ0A 4KSQA 4OTPA 5LWMA 3ZFMA 2F7ZE 4ASEA 3CD8A 3F7ZA 2W5AA 5HE2A 3ULZA 3KMMA 5IQBA 4O81A 2W7XA 1J1BA 5E91A 5B0XA 4KRDA 3PRFA 3R1SA 4AN2A 1PXLA 2RSVA 4FNZA 2BCJA 1WBSA 4W4WA 4XHKB 2ITNA 2GSFA 3EHAA 2VUWA 3VIDA 4YPDA 4GU9A 3I81A 5C8KA 4RBLA 3PXKA 5KBQA 2V0DA 2SRCA 3V6RA 3R2YA 4ZTNA 3RK9A 2PMOX 2B9JA 3EH9A 3WOWA 5BNJA 4O7LA 4FYNA 3DV3A 4HCUA 5A4CA 3FZ1A 4IHPA 3NAXA 2YM6A 4PL3A 4M69B 4CKIA 4M13A 5CALA 4C4GA 5LVOA 3I7CA 4EOQA 5IQEA 4K0YA 1ZOGA 2EB2A 2OH4A 4BC6A 3V04A 3I0QA 2P0CA 4A4OA 2Y9QA 3SVVA 2FGIA 1JQHA 1PXIA 2R9SA 3VUKA 2BZKB 2XMYA 3I60A 3R9OA 4MNFA 4JQ7A 2WTCA 5IH6A 3UC3A 2Y8OA 2ZM3A 4BBMA 2V22A 2VO6A 1MUOA 5DHJA 2V7AA 3I5ZA 4YU2A 4IZAA 3NUPA 5IPJA 4I92A 2GS2A 4DC2A 4DCEA 3SV0A 1SVEA 4CQEA 3R21A 2OXXA 4FTCA 4CMOA 5FDPA 5EM5A 2C5VA 2YJSA 3ERKA 2X7FA 4W4YA 4BDFA 4JRVA 4QTBA 3EN7A 2WTIA 1G3NA 3UIXA 3V8SA 2XJ1A 4ACHA 4DA5A 1XJDA 3W1FA 4XG7A 2X8EA 2BZJA 4DF3A 3R7GA 1FVTA 4C8BA 3RAKA 3LXKA 3H0ZA 4ZS4A 2C30A 3ZOSA 4S30A 5HD4A 4H1MA 5C03A 4S34A 3ZLXA 3K54A 5EG3A 5AUUA 5KMLA 3EKKA 1DI9A 1Q61A 3FZRA 3NSZA 1OIUA 4FVQA 4S32A 5EH0A 3RPYA 3UZPA 3PY1A 5JGAA 4DFXE 2C3LA 5AP3A 3COIA 2PVHA 3FZOA 3IDPA 4PDSA 5A46A 5L6WL 3UZTA 3HKOA 4DGGA 4F6WA 4MF1A 4DG2E 3G90X 1ZY5A 4O0XA 5GZ9A 1U54B 5L6OA 3OS3A 4WSQA 4NFMA 4ANQA 5JEBA 1UU3A 2NRUA 2YM4A 4LRKA 3BZ3A 4FX3A 3JVSA 3EZVA 2YHVA 4YBKA 4I6QA 2HZ4A 4ZS0A 4TYGA 4USFA 1G8AA 4QMYA 1WVXA 5FXSA 1ZYCA 5HBEA 2J5FA 3FZTA 4FKRA 3UVRA 3WF9A 1ZWSA 3PWYA 4FKLA 4C57A 5HCYA 3QBNA 4F4PA 3UP7A 4CV9A 4G6LA 4DEIA 4ZTRA 4ANNA 5EK7A 2BKZA 4BI0A 2QLQA 3M2WA 1J91A 4RIYB 4U80A 2HW6A 4O7TA 4E6CA 3GCQA 4YZCA 5J9ZA 1V0OA 2P3GX 1JKSA 2XNNA 4WG4A 4ZZOA 1KSWA 5GZ8A 2WQOA 4D2VA 4KS7A 5DWRA 3DBEA 3IQ7A 2HENA 4GYGA 5L2SA 3KB7A 4HW7A 5FXRA 3Q53A 1PKGA 3E8DA 3ZO1A 5A6OA 2F7XE 4D0XA 4XRLA 3UGCA 3A7IA 4LV5A 4LG4A 2WMWA 1CDKA 1Q97A 4CTCA 3D7TA 4CG8A 4KBAA 3OY1A 4TWNA 2C5YA 2ZDTA 3PXYA 4ASDA 1KE5A 1Q8YA 3AMAA 4V0GB 4BKJA 3OROA 4RC4A 5JFXA 3PVUA 2BRNA 5IQAA 5HCZA 4QMQA 1WBPA 3ZRKA 4YZNA 3P7AA 2WTDA 5ACBC 1XBAA 5D9HA 4RG0A 5HVJA 5HU9A 3REPA 4FT9A 3C13A 4RJ4A 3G15A 1B38A 3VBVA 3MS9A 3PSDA 4MH7A 2Q0BA 5M08A 3COMA 3IKAA 3E8NA 5FDXA 4C02A 1O6YA 5IZFA 5KHXA 4EUUA 2IW6A 3EN4A 4E4XA 3ZUTA 1Q99A 3NYOA 4Y73A 4R3PA 5ANOA 3UQFA 2YDKA 2Y0AA 5FM3A 3UP2A 3MESA 2QHMA 4CCUA 1W83A 1XR1A 2XNBA 5DVRA 3KVXA 2HOGA 4NU1A 3F3WA 4HZRA 4QMTA 4AZTA 2C47A 4RLKA 3QCYA 3R83A 5M4UA 4QT1A 4USDA 3VWAA 4RIXB 4IB3A 2I0VA 4Q9SA 2OIBA 4L67A 5HG7A 4FV8A 4QYGA 2XNEA 2B9HA 5CLPA 4YURA 4ZTQA 3KFAA 3ZM4A 4M66A 5EHOA 3ZRMA 3LZBA 3P5KA 5IQCA 3CIKA 4RJ5A 4MQ1A 2GNFA 3WBLA 2UUEA 4LI5A 2F2UA 4TWPA 1W98A 4IX4A 5BVWA 3RTPA 2XCKA 2J0KA 5CF8A 4CFVA 3HDNA 3UE4A 1OGUA 4MKCA 3UQCA 1ZY4A 3DAEA 4FEUA 5AUWA 3R7OA 4OGRA 2IZRA 1OL5A 3IW7A 1ZYDA 3A8XA 4M3QA 1WMKA 3KXNA 3W32A 2PE0A 4BB4A 4C7TA 3MIAA 3VF9A 2X1NA 5LMKC 3TNIA 3ZBXA 2BR1A 3V8TA 2PU8A 4I94A 4FMQA 2W1ZA 4RJ7A 4TNDA 4DINA 2QR8A 1P4FA 3RWQA 5KHWA 3DQXA 1H1WA 4A06A 5LJJA 4WG5A 3ORTA 4O86A 1NT2A 3LXPA 3R1YA 4OTDA 5EHYA 5HG8A 3MIYA 5HEZA 5IQDA 4K77A 3PSCA 3FMMA 4UZDA 4BDHA 4YUQA 3DKFA 3ORLA 4IX3A 3NIZA 3RBWA 3CJFA 4DTKA 4NCTC 5JKGA 2B1PA 3C0IA 3ATSA 2F7EE 3JPVA 4ASXA 3FLNC 1JSUA 3QLGA 3SLSA 4W4VA 5IKWA 1OL2A 4GVJA 3PJ8A 3KK9A 4FSYA 4QQ5A 5EW3A 3RCDA 3ANRA 3MDYA 4IMYA 5LVMA 5IQIA 4JQEA 4GJ2A 3BI6A 1R0EA 3GENA 4ACCA 2BTSA 3DK6A 2UVZA 2Z02A 4KKGA 4B6LA 2HWPA 3ID6C 2YA9A 4WKQA 4FZ7A 3UO6A 3VUMA 4DGOA 4U40A 2A4LA 3E64A 3TZ9A 4CFUA 3N4UA 5HNIX 5CEMA 1MRUA 2H6DA 4N6YA 2ZDUA 1UU7A 3QZHA 5HIEA 5IEYA 2BUJA 2HXLA 3MY0A 3W2RA 4TL0A 4ZZNA 4F1TA 1J7IA 3A4OX 3HUBA 4HZSA 3MJ2A 3V5WA 4ZSLA 3LXLA 4FVRA 4CFXA 4DTBA 4O7WA 3FI4A 4FTQA 1Z57A 1RJBA 2VTMA 5C4LA 4DGLC 4LRMA 5BUEA 4QMZA 5IQGA 3GCVA 3UMXA 3TIZA 3FLWA 5HORA 1OPJA 4EH5A 2G2FA 2UV2A 1DAYA 2HW7A 2QVSE 3C1XA 3N4VA 4O82A 3LE6A 4KINA 4HVSA 5LVLA 2UZBA 3KVWA 3NDMA 4CGAA 4AZWA 2G01A 1PKDA 1AQ1A 4G6OA 4IB5A 4MK0A 1GZNA 1CKPA 5L2WA 4G3FA 3F2AA 3C4FA 3LW0A 2R3OA 3MWUA 3R22A 4LQMA 3DA6A 2IPXA 3NVKI 3R8MA 2PE1A 2VTIA 3DTCA 4NM5A 4R77A 3BLRA 4U43A 1QPCA 3BRBA 3Q4UA 3KXMA 5DMZA 2BTRA 5CSVA 3OP5A 3TIYA 4U41A 5EDQA 4CMUA 5EYKA 1S9JA 4OTIA 3ORPA 1P5EA 4O0YA 2QOBA 2QURA 2HWOA 4B4LA 4I93A 2WELA 2B54A 3VS6A 4IWPA 1YRPA 4RIWA 4BN1A 2ZM4A 4N4SA 1WBOA 2WKMA 1SYKA 5AR3A 4U9AA 2J4ZA 5HLNA 3F7WA 3P79A 2GU8A 3S4QA 4MVFA 4WOVA 4AQCA 5HTBA 5AEPA 2Q83A 5K0KA 3H0YA 2OJIA 2BDWA 3QQJA 4IW0A 3V6SA 4XH6A 4BR3A 4ENXA 1KOBA 4QQJA 1DAWA 5HLPA 5FRIA 4FEVA 5DRBA 4O1OA 3P08A 4K9YA 4FT5A 2JAMA 2PVKA 3LCTA 3ZSHA 2JBPA 3EFJA 3OCSA 2PUNA 3FI8A 3V5LA 3ORZA 4QMVA 3BHTA 5DR9A 5K3YA 4YTCA 4A4LA 4MXCA 4LUDA 2ITTA 3D0EA 3GEQA 2GFCA 2J90A 3FLSA 3MFRA 4IFCA 2ZV2A 2H34A 2PVFA 5CZHA 3UBDA 3ZO4A 2XIRA 4E7WA 4N70A 1BUHA 1ATPE 4AGUA 4BKYA 3D83A 3OT3A 3EN6A 3UDBA 1LPUA 5EI8A 2CKQA 1MQ4A 3ZH8A 3FL4A 1ZOHA 2BDJA 2O2UA 4IVDA 3RPSA 3VRYA 5J5SA 5J8IA 4MHAA 5FEQA 4CYIA 2WMAA 2RF9A 3EIDA 3UIMA 2GTMA 4F65A 2EVAA 4WNKA 4B8MA 2OWBA 2R64A 4EK5A 2CSNA 3MH2A 4C0TA 4YZDA 5K4JA 2Y4PA 2YIXA 1RE8A 4EJNA 3V5JA 4FEXA 4NZWB 3MH0A 4AT5A 4CFNA 1GIIA 3ZMMA 2EUFB 4UX9A 3F61A 5FM2A 4JDKA 3CQUA 1YHSA 3CKXA 5AADA 2YACA 3ET7A 2CHLA 3E8CA 3TCPA 3QF9A 4ANMA 4AW1A 4F6SA 3PLSA 3R9HA 3KREA 2OO8X 3GFEA 4TT7A 5DOSA 1Q62A 3ZZEA 4QYHA 4I6FA 4R7HA 4G16A 4NM3A 1XHAA 4YC6A 4ZMEA 3KXZA 4UYAA 4M68A 4KIOA 3PP1A 4QMNA 4MBLA 4DAWA 1YI6A 3EQCA 3ZEPA 2XNGA 4GU6A 3OXZA 4EH3A 4D2RA 4RQKA 5CSPA 4DFUA 3BU3A 4IM2A 3QL8A 4K6ZA 4H58A 3DPKA 5DLSA 4C3RA 3R7UA 1YDTE 3UVPA 3IW8A 3LQ8A 4FK6A 3Q5IA 4Y5QA 4G3GA 3CEKA 4Z7GA 4ENYA 3JY9A 2R7IA 3U6JA 4IAYA 3RVGA 1H1SA 1KV1A 3ULIA 1BI8A 3NR9A 3RINA 4IWDA 3OY3A 5F94A 3R9NA 4YLJA 1PF8A 4FSWA 5ANIA 4EZ7A 3IK3A 4BGHA 3PG3A 4AGCA 3D2KA 3HA6A 2YISA 1TQPA 2KTYA 2VTHA 3IOKA 5E7RA 5DT0A 3QRKA 3HAMA 5BPYA 1Z5MA 1U5RA 3RNIA 1IA8A 3GU6A 3UIBA 4F0GA 3ZEWA 5E8VA 1U4DA 4FKIA 1OKYA 5FTOA 5AP7A 4ACMA 1K3AA 3QA8A 4J52A 4BCKA 4X2JA 2W1DA 1R39A 3NYXA 1F3MC 2NO3A 3ALOA 3Q60A 2O5KA 4FTOA 1WZYA 3E92A 5M56A 1XWSA 4PPBA 3W8LA 4PP9A 4P2KA 2ZV9A 2XIZA 3O0GA 2CN5A 2R3MA 4GFMA 4EQCA 2ERKA 4QTAA 4BWPA 5L2QA 5I3RA 2IVVA 3NYVA 2Y4IC 3DXPA 1S9IA 5HO8A 4XOZA 5AAGA 2X8DA 3OF0A 2HXQA 3N9XA 2VWUA 2ZMDA 3DS6A 4IC8A 4NTSA 4XX9A 3RJCA 4BTJA 4PMPA 4KKHA 4NW5A 4EHZA 2BAKA 2B53A 1H26A 4DLIA 3DAJA 2OICA 4HNIA 3WYYA 3O8PA 4HGTA 4L9IA 5KMJA 2CCIA 4M8TA 2UW3A 5M4CA 2RFDA 3ZLSA 2G2HA 4GV1A 5AIRA 3TDWA 4ITHA 4XYFA 4AGDA 3KY2A 4EH8A 4YO4A 4X7QA 3DQWA 3F69A 3Q4ZA 4YZ9A 3RM7A 3OFMA 4FGRA 2QOHA 4QYYA 2ZYBA 3OT8A 3WI6A 1Y6BA 3NNUA 4YC3A 4Z3VA 1KE7A 2RKUA 4PUZA 3HECA 1UNHA 4FV4A 4CRLA 1IRKA 5ICPA 2WD1A 3I6WA 2QOCA 4A7CA 2ITXA 4J8NA 4M67A 5CAVA 4IBMA 3CP9A 5EFQA 2HELA 2EWAA 4JOAA 4AT4A 4BICA 3PJ1A 3VS1A 3E3PA 2PULA 3NX8A 3GVUA 2C0OA 2Z7SA 1YWNA 3Q9WA 2BIYA 4GK2A 4FIEA 4KUJA 2YIWA 2ETMA 4PX6A 5BVEA 1LP4A 2IW9A 4RQVA 4Z16A 3BGZA 4CT1A 1UWJA 4ZLZA 4F6UA 1OKWA 4KNBA 3ODZX 3A7FA 5M53A 4K11A 1YVJA 4O38A 3TN8A 4QMPA 2WQNA 2BRMA 3DU8A 1W8CA 3H30A 4BZOA 4U3YA 4OW8A 2Z2WA 3BPRA 4X0MA 4C4EA 5CU4A 2A19B 3OTUA 5DFPA 5LCJA 5E8ZA 3SDJA 1UNGA 4S2ZA 2V62A 3FL5A 2PHKA 3E5AA 2R3RA 5EQEA 4XUFA 3AGLA 2X2LA 4QMLA 5JMSA 4UWCA 1VYWA 1OL6A 1WAKA 1UNLA 3QAME 2R3JA 3FV8A 2VU3A 4HYSA 3OD6X 5FEDA 5CF6A 5J7BA 2DWBA 2F2CB 3LMHA 4CZYB 1ERKA 2XK6A 4BDJA 4EH4A 1J3HA 1GZ8A 1UWHA 1PXMA 2FUMA 2PVMA 3S0OA 4E5BA 4I3ZA 4QYFA 5I9YA 3H3CA 1H1RA 5B2MA 4TTHB 5CI7A 3OVVA
chains in the Genus database with same CATH superfamily
2HZIA 1BX6A 3RHKA 1ZARA 3EQFA 2RG6A 3DT1A 4PMTA 4W8DA 3NFFB 3V01A 1XMLA 1FOTA 3EQRA 3GU8A 1IG1A 3A8WA 3HMMA 4DH3A 4HCVA 4E6DA 3C5IA 3RALA 2XM8A 3P23A 1UU8A 3PY0A 4RX5A 2G15A 4OTRA 3M1SA 3NUUA 5J1VA 4QYEA 3D5UA 3L9MA 2WMBA 1Q4LA 1O6LA 4I4EA 3R8VA 5J1WA 3ZM9A 3GB2A 4JI9A 4NH1A 2GNLA 3ZXTA 4FKTA 2C5XA 2W1CA 5JGBA 2C69A 4QP6A 5LVPA 5CWZA 4CV8A 4MD7E 1PMVA 5HOAA 5LMBA 2UZUE 3NNVA 3R0TA 4FSUA 2LAVA 3SKCA 4G1WA 5TO8A 2R3HA 3R8LA 2BHEA 4Q5EA 4E1ZA 4XS2A 3NNXA 2BRBA 3UMWA 2JBOA 3Q2MA 4LFIA 4U8ZA 3EQBA 2C6TA 4FOBA 4UY9A 4QTEA 4L53A 2G9XA 3C4ZA 3GUBA 5HE3A 3AKKA 2ETKA 3EJ1A 1R78A 3UNJA 3HYHA 2QU6A 3Q5ZA 4JBPA 3T8OA 5J79A 2GHMA 2NP8A 2ZB1A 3WF5A 4XP2A 4FA2A 1ZZLA 3Q9XA 2A0CX 4K8AA 5FBOA 3P78A 4MBJA 1O9UA 3R01A 3E7OA 3IO7A 2QO7A 5KMKA 2O0UA 5CSWA 3JY0A 3FE3A 2X0PA 3E63A 1H4LA 3BYVA 4WA9A 3DJ6A 4IAAA 4XV2A 3HNGA 4IZYA 1FBNA 1KE9A 3NCZA 5DN3A 4EOSA 3QQGA 4RA5A 2QG7A 4L42A 5G6VA 2VN9A 1R3CA 4QD6A 3AT4A 4EOLA 4MF0A 4CT2A 2WMSA 4WO5A 3FXXA 4D9UA 4FTNA 3U51A 1YDRE 3CPBA 3MPAA 1OITA 2HCKA 3MA3A 2VTTA 3PZEA 2UZNA 2ERZE 3PYYA 4ITIA 4K33A 1VLRA 1BI7A 2ESMA 3F2RA 4IM3A 2GNGA 3A60A 3AC4A 3WARA 4ERKA 5JT2A 4R8QA 3MPMA 5D1JA 3V8WA 4HVIA 3IW6A 1XBCA 4EQUA 4GUEA 3F5UA 3HMOA 4L00A 5AR8A 4E73A 4U81A 2XRWA 2YWPA 1SMHA 1JAMA 1J1CA 2YM3A 3O23A 3OMVA 3PVGA 3QTIA 4H1JA 3EFKA 4O2ZA 4J8MA 4MBIA 4QQCA 4QP3A 4MD8E 4RJ3A 5DRDA 4EBWA 4FV1A 3NW6A 4KRCA 4GIIA 4F99A 4FV3A 5DR2A 3L9NA 4RJ8A 4GYIA 3T9IA 4DHZA 5FQDC 1V0PA 3R8ZA 2FO0A 5HBHA 4GL9A 2VTRA 2CNVA 4QO9A 3HX4A 2VWVA 4KD1A 5H8GA 4ZSAA 4YPSA 2J50A 2OU7A 2R0UA 5CASA 1FVVA 3BU6A 5L6PA 2XNOA 4YLKA 3DJ5A 4TNBA 1ST0A 4P4CA 3KRLA 4QMMA 4RVKA 2W4KA 4KIKA 3EQHA 4XJ0A 4ANOA 3UC4A 4TRLA 3CD3A 4QQTA 2B9FA 2BFYA 3Q9YA 4QP8A 5DPVA 5EM6A 4Q5HA 1W2CA 4J71A 5AUTA 2QCSA 2YLEA 4O2PA 1OIYA 4RMZA 5DYJA 1JOWB 4Y5HA 4E26A 4F7LA 3U9CA 1KUTA 3T3UA 4ANBA 3UDSA 2OZOA 1NY3A 5D41A 2YAAA 3VJOA 2XARA 2X8IA 3RPRA 1O6KA 2OH0E 5I3OA 3R00A 3LJ2A 3OW3A 5ETIA 4ITJA 2WB8A 1W2FA 3DLZA 4AX8A 3E62A 5BVDA 4L3LA 2W5HA 4IZ5A 3GBZA 1DS5A 5HZNA 3LKMA 4O0TA 3VW8A 4B0GA 5I0BA 3FKOA 3ZC6A 2NPQA 3ANQA 3CKWA 3EZRA 4AACA 2I0YA 4L46A 5IU2A 4NJDA 4IC7A 3W33A 5JH6A 3FXWA 5H3QA 3DDPA 4TPTA 5TR6A 3GU5A 4FK3A 3S2PA 4LGHA 1WBWA 4A9RA 2C0IA 3DBFA 3F3VA 5L3AA 4FZ6A 4RC3A 4OTWA 4Y85A 4FKUA 2XZSA 2XP2A 5CEQA 4HGEA 3A2CA 4G3EA 3ZSIA 3PPJA 5AUVA 2R5TA 5EM7A 4O83A 3TKHA 3K5UA 3TUCA 2ITUA 3ETAA 3HDMA 4P7EA 4H05A 3U54A 3QKLA 3AC3A 5FBNC 3L8XA 4IADA 4BDBA 3FY0A 4EOKA 4BCMA 1TQMA 1OPLA 2O65A 1K9AA 1OI9A 2W1FA 4FI1A 4EBVA 4EORA 3QWKA 5J87A 3EQPA 4FV0A 2WMXA 2XKEA 4YJRA 5IEXA 2XS0A 2OJGA 4J53A 1M2QA 3V51A 2GQSA 4GJ3A 2W0JA 4ARKA 1NVRA 5A3XA 5FG8A 4CQGA 2JAVA 3EYGA 5BUIA 4C34A 3PE2A 4EOPA 3DJ7A 5IA3A 4PWNA 5LOHA 4BDDA 4G9CA 3NMUF 4WT6A 5I9ZA 2Z8CA 3L1SA 3FXZA 5HG5A 1A9UA 3F3UA 5CNNA 3SHEA 3V3VA 4KIPA 4PMSA 5JK3A 4L3PA 1ZAOA 4F1OA 3QRJA 4O0UA 5HIDA 3P4KA 3RK7A 2H8HA 3LVPA 3S00A 1V1KA 1OMWA 3VONA 3AT2A 3I79A 4DH1A 4XV1A 3W2SA 1IAJA 5JN2A 1ZYJA 4I22A 2YFXA 4ZAUA 3FBVA 2QODA 3AKJA 1Q8TA 1OM1A 3TTIA 4DCAA 1OL7A 4CLJA 3NUSA 1YOMA 4GT3A 1UV5A 3KA0A 4R6VA 5DE2A 2YLFA 4FGBA 1B39A 5AP0A 4ZZMA 4F70A 3NFGB 5ANDA 3VHKA 4FTTA 1IAHA 3KXHA 5KBRA 4BBEA 1RQQA 4J1RA 5I4NA 2VGOA 2WU6A 2BAJA 4J97A 4YJOA 4DG0E 4YNEA 4Z9LA 3Q96A 3G0FA 2ITQA 3QX2A 2XYNA 4O6EA 2QO9A 2V55A 2YDJA 2ZMCA 4QEBA 3CC6A 1OUKA 2QKRA 4E4LA 2XH5A 4I0TA 2YN8A 4FTRA 4DEHA 4IANA 4AU8A 5BYZA 3VBTA 4FIJA 2O3PA 3ZCLA 2ETRA 3I5NA 4BCGA 4X2NA 4PNKA 2QOQA 1Y8GA 2ONLC 4AW5A 3FLQA 2CGUA 2FB8A 3OEFX 2WTJA 4FSTA 2XJ0A 3WZJA 3QCSA 4KA3A 1H0WA 1U59A 2VWBA 1E9HA 1OVEA 4YJTA 5I5ZA 4PDYA 3R30A 2ITPA 3PJCA 1U46A 4L68A 4O0WA 4JDHA 4HNFA 3MGYA 5J5TA 3BHUA 4EKKA 3B2WA 5EYCA 4HVDA 1ZYLA 3Q32A 5H9BA 2O64A 4D9TA 2QHNA 3VF8A 3VW6A 5DEWA 5EW9A 2CGXA 4GK4A 1M7QA 3VBQA 3VQHA 3TJDA 4QOXA 5HI2A 4NIFA 1VEBA 2WO6A 4PRJA 5AA9A 5IISA 1KE8A 1OBGA 4FKPA 3FHRA 2PPQA 4BRXA 3ATTA 3OXIA 4J7BA 2CGVA 3AD4A 1JBPE 1QMZA 5KKRC 3W18A 3DXQA 5BUJA 4A9TA 2WQEA 2VGPA 3R7YA 1JLUE 2QOFA 3G51A 3LCDA 5FP6A 3VS3A 4C3FA 3EL7A 4YZMA 4KBKA 4QNAA 3RI1A 4F1MA 5A4QA 1UU9A 4UEUA 4LDTA 2QR7A 3O7LD 2J0JA 2QOOA 5LXMA 3TNWA 3UZRA 2JDVA 4FT7A 2E9NA 1Y6AA 3QD3A 4XNEA 4Z7HA 3TUBA 3CTJA 3HMIA 3MY5A 2VTPA 3DBDA 4R1VA 5LCKA 4C4HA 4EZ5A 5KKRB 1PMNA 2QO2A 4I5PA 2VV9A 4JIKA 2JD5A 5M4IA 5H8BA 1AD5A 3KMWA 1Q5KA 4I6BA 3Q6WA 4UXQA 5CI6A 3THBA 5GIOE 2YZLA 4M0ZA 3F5GA 5GJGA 5HLWA 4DHFA 4GFGA 3RGFA 5AIKA 1OL1A 5AP2A 4GRBA 2BMCA 5IDPA 5B2KA 4Y46A 3KGAA 5CEIA 1HOWA 2UZVA 3RPVA 3U6HA 3ORIA 3BU5A 4BCQA 5DR6A 3HP5A 1DI8A 4J96A 1IR3A 4LOOA 4PMMA 2BALA 2OF4A 3OG7A 3QQUA 5IG1A 5LQFA 1ZYSA 3JS2A 2PK9A 4JXFA 3R8PA 4BTMA 3D7ZA 3CY2A 3RZBA 3QHRA 4E5AX 4R5SA 5ANKA 3LQ5A 1ND4A 4OBPA 2ITWA 4GIHA 4CNHA 4YGAA 3LPBA 2C4GA 3UNKA 2OGVA 1ZRZA 4JJRA 1TZDA 3D4QA 4IVBA 4DT9A 3V5QA 4FEWA 2OI4X 2OZAA 3AXWA 1ZMVA 1Y8YA 3O96A 5DA3A 4CFFA 5KUPA 3SC1A 3UO4A 4UV0A 4IWOA 4ANSA 3F66A 4EC9A 1YI3A 3FQHA 3VHEA 3D5XA 4Z55A 2WMRA 4R3RA 4B7TA 3I7BA 4ZEGA 5I9XA 3DXNA 3LJ1A 4IDTA 4W8EA 4L44A 2XKFA 5IQHA 1P4OA 2CMWA 4OT6A 5A4TA 3NWWA 4FV7A 4BZDA 2J5EA 2X4ZA 1FMKA 4DH7A 2XJ2A 1IEPA 4NJ3A 3A61A 3D94A 4RFMA 5T6KA 5EHLA 3UO5A 5AR4A 2YM7A 3TXOA 4I1ZA 2DS1A 4PNIA 5AMNA 4C4IA 3TV6A 4BHZA 2GTNA 4BYIA 3LFNA 4BWKA 2RFSA 5E8TA 2JDTA 3CGOA 4IAKA 5TT7A 3ZYAA 4AE9A 3HL7A 1BMKA 2C0TA 3CXWA 4OBOA 3SXRA 4BHNA 4CYJA 1PXJA 5J9LA 5EQPA 2PUUA 3PPZA 3R6XA 4U7ZA 3TV7A 5A4LA 3GC7A 2XK3A 3FSFA 4PF4A 5JFSA 4BYJA 4I5MA 2YWVA 4N0SA 4NYEA 2XANA 1ZMUA 2AQXA 2YCFA 5M4FA 3K5VA 4QTCA 3I4BA 5BX0A 3FPMA 2XIYA 4I0RA 3LFEA 4JAIA 2UVXA 2XKDA 3FLZA 5IA5A 3C9WA 3G9LX 3QZIA 2ZV8A 4FIIA 4MWHA 3ROYA 3U4UA 4C59A 4EH7A 4MAOA 4MXZA 3KK8A 3NUNA 2RGPA 3SGCA 3BV2A 4G2FA 3UYTA 3EYHA 4FV9A 1F5QA 1PY5A 5C8NA 5GINE 2I7QA 2Z60A 3U6IA 3R1QA 3TM0A 3FUPA 4DYMA 3W2CA 4EOIA 4XP0A 5EI2A 5FTQA 4EI4A 3R8UA 3RK5A 3W10A 3POOA 2ZB0A 3D7TB 4PL5A 4U79A 3VBWA 2PUIA 3LCOA 4FG9A 2GHLA 1NVSA 4UB7A 4AA0A 4F7NA 1GJOA 3GU4A 3L8VA 3QYWA 4TYJA 2UW7A 1YWVA 4LM5A 3VRZA 4AA5A 5T3QA 2BFXA 3ZFXA 5HHWA 2VO3A 3ZHPC 4TWOA 5BMMA 4FUYA 3DKOA 4MYGA 4MNEA 5HGIA 3UOLA 4E6QA 5L8KA 2X7GA 4ZSJA 5CZIA 3LIJA 4L01A 1XBBA 5C8MA 4FKJA 1PXPA 1SZMA 2BAQA 2UZLA 3HV5A 4RC2A 3VUIA 4R78A 5FTGA 3ZLYA 2E9VA 5CU3A 3P7BA 5FGKA 4YP8A 1K2PA 4ACGA 1J7UA 1G8SA 2PL0A 5E8UA 2E9UA 4I6LA 3TV4A 4G17A 4DEBA 2RL5A 5IDNA 2Q0NA 3CR0A 4AA4A 4ZTSA 2VO0A 2JDRA 4AFJA 1MP8A 1T45A 1WVWA 1CTPE 3QA0A 5CF5A 5IH4A 1YOJA 3IECA 3WE8A 4FV5A 4GT5A 4MEDA 2C5NA 1GY3A 2R3IA 4D55A 2WHBA 3K3JA 4YTFA 2VX0A 4AOIA 3C7QA 2F4JA 4BJJA 4NIFB 1MRYA 5GJFA 3R7IA 2B4SB 3TI1A 1YXVA 2I1MA 2JKQA 3FMHA 5BVFA 3FAAA 4IAFA 2XK7A 4I0SA 3TEIA 1CKJA 4O27B 4C35A 3BLHA 3KCFA 2YIRA 3HV6A 4AOTA 4E6AA 3W0MA 4GS6A 5AP6A 3RHXA 3MV5A 4G6NA 1FVRA 3MFTA 3FMLA 3HMNA 1XH9A 3D2IA 5KMOA 2CNUA 3DDQA 5CENA 2ITOA 1XH5A 2VTJA 3PIZA 2YM8A 1G8JA 3Q6UA 5E8SA 4EONA 4XP3A 2OLCA 5IA1A 3BWJA 2ZFYA 3UPXA 2HAKA 3GOPA 5F4NA 4EWQA 1QPJA 4FL2A 1BLXA 2PVYA 3UPZA 2WXVA 4BIBA 3MJ1A 3BLAA 4IQ6A 4DEAA 1SVGA 3QUEA 3HMPA 4EH2A 4RVTA 4YTIA 2LGCA 2X39A 1NA7A 1ZLTA 2QQ7A 3BBWA 3R7EA 5CAUA 4JLCA 4D1XA 4ID7A 5FWKK 4HVGA 1ST4A 3NVMB 3ELJA 4CFWA 5HU3A 5JQ5A 4FF8A 2DUVA 3QRIA 5IA4A 3DOGA 2UW4A 3QC4A 4E8AA 2P2IA 5A4EA 2X4FA 3BX5A 4DFBA 3TKUA 2VZ6A 4EOMA 4F63A 2CLQA 3LLTA 3QFVA 3QLFA 4D5KA 5FD2A 4N57A 4YHFA 4FT0A 2RIOA 3OWLA 3VC4A 5C9CA 4ASZA 3OCTA 1WVYA 4ONAA 3NAYA 2IG7A 1G5SA 3Q2JA 4CG9A 2IZTA 3SW7A 4JVGA 4BTKA 4AW0A 1ZXEA 5CY3A 4I5CA 3DFCB 3FZSA 3TDVA 4KIQA 4HGSA 2R3PA 4RJ6A 4UALA 4W9XA 5CU2A 5TKDA 4DGNA 4O4FA 5FP5A 5BV3A 4V01A 4FTIA 2OSCA 3TZ7A 4QPSA 3V5TA 3IDBA 4LGGA 4R1YA 3CQEA 4R3CA 3R1NA 3E7VA 2HY81 4K18A 4FZDB 3ZU7A 3QUPA 2GNJA 2WQMA 3PFQA 3QHWA 5AUZA 2A27A 5LMAA 5JGDA 4BDKA 4O0SA 3QWJA 4KWPA 2W96B 1TVOA 4OTHA 4L7FA 2JFLA 3MH1A 3HAVA 1M17A 3HP2A 3KRJA 4AFEA 3HGKA 3PVWA 2VTLA 5JSMA 2QOKA 4FKWA 4X3FA 4D0WA 2QI8A 2B9IA 2FSOX 5HNBA 3VUTA 3WF7A 5K9IA 1YKRA 4BL1A 3NW5A 4V04A 3QKMA 4FV2A 4ZSEA 4ZMFA 3FEGA 3KIOC 2XK8A 5I9WA 2UW8A 1SNXA 3LFCA 3EN9A 2X9FA 4UBAA 4WNOA 3Q4CA 2V7OA 4IFGA 4X2KA 1SM2A 3IG7A 4XRJA 3EL8A 4FKQA 5AV3A 1H1PA 3C5UA 3OZ6A 4BF2A 1BYGA 1SVHA 3NNWA 4XOYA 4DBXA 4KABA 4FICA 2JGZA 2XA4A 2VTQA 5L8JA 3KXXA 1W7HA 3QGWA 3OWPA 4PPCA 4WNPA 3GU7A 5EW8A 3SX9A 3ZO3A 4D1SA 5B7VA 4EYMA 4LV8A 3MPTA 3ROCA 3DK3A 4M15A 5CU0A 4V05A 4CVAA 2GFSA 2IZUA 2CCHA 4DHJA 1APME 3QZGA 4FTKA 3RZFA 4DEDA 3TNHA 1OIQA 4ZP5A 3KRRA 4IJ9A 3CE3A 4RGJA 3NUAA 3TYKA 4HPUE 3BYOA 2XEYA 4IE9A 4NKAA 3BIZA 3F2NA 3LFDA 4M69A 4FUXA 5CVFA 5ITAA 3HVCA 4FKVA 2JEDA 4L43A 5EM8A 3QXPA 5CT7A 2R3QA 4AE6A 4O7RA 4XG4A 4B8LA 2IWIA 2XM9A 3IS5A 3NGAA 3U87A 4TKSA 4JDIA 4RIWB 3ZUVA 4RWLA 4JRNA 3ZONA 4AN3A 4IJPA 4NUSA 5ETFA 2P55A 3PFYA 5AWMA 3CPCA 4IX6A 2IVTA 1H8FA 3QTWA 3VUHA 5IMEA 3D14A 3GT8A 3MTLA 4ZLYA 4F9WA 2ZV7A 2UZDA 4RIOA 2PVLA 1IASA 4FEQA 4LUEA 3RMFA 2PVRA 4FV6A 4U3ZA 4BTFA 2W4JA 2WMUA 3NLBA 4YJPA 2H9VA 2JITA 1TKIA 3QX4A 4WBOA 4MWIA 2WGJA 3OW4A 3RKBA 2XK4A 5JRSA 2YCRA 3O2MA 4HJOA 4IIRA 4MNEB 5J95A 2J51A 1ZOEA 2HK5A 4AZVA 3EQDA 2VTAA 1B6CB 2VTOA 4KB8A 4UMQA 1GNGA 4GFOA 4IVAA 3TG1A 3WILA 2PSQA 4BCPA 3LCKA 4O96A 4EHEA 3UJGA 3EOCA 5AAFA 5BVOA 4WNMA 3O7LB 3BBTB 2OBJA 3OOMA 1STCE 5DG5A 3WZKA 1BKXA 1QL6A 1PXOA 3FYKX 4BZNA 4ZY6A 2ZVAA 4BDCA 3RP9A 3R73A 3BQCA 2CGWA 2R7BA 3RCJA 5FUTA 4U6RA 3ZZWA 4QPMA 4AWIA 4XV3A 4PL4A 4U45A 2EB3A 3HRBA 4IVCA 4DEGA 4NSTA 4HVHA 3C51A 3R2BA 3LFSA 1Q3DA 1VYZA 4KS8A 3UDZA 4UWYA 4LL0A 4I6HA 2X2MA 5GNKA 2F9GA 1MRVA 3KF7A 3WZUA 4XG3A 3FC1X 3R9RA 1U54A 2ITYA 1LR4A 4PY1A 4UXLA 1YOLA 4ZOGA 5HO6A 5D11A 3H10A 3RAWA 3FI2A 5E1SA 1M52A 3W8QA 4XBUA 1H1QA 2OG8A 3O71A 5KCVA 2W1EA 5EQYA 1NXKA 3L8PA 2R2PA 4E4MA 4MTAA 5AX3A 4F0IA 3QC9A 4QP1A 4EHGA 3F6XA 4FKGA 3R71A 1UVRA 3ORMA 4U0IA 5AM6A 3Q52A 5K4IA 4FODA 2C6EA 3DFAA 3E93A 3EQIA 4XV9A 1T46A 3JYAA 4HYUA 4ALWA 2OJFE 3QD2B 4LMUA 1JVPP 4F9YA 5CQUA 1W0XC 2FVDA 3QQKA 4CSVA 2C5OA 5DT3A 2XBJA 5FXQA 2VWXA 2R3FA 5HKMA 4RVLA 2CN8A 1OKVA 3UQGA 4YJSA 5KE0A 3MVHA 3H4JA 3MYGA 3KC3A 3AC8A 4L8MA 3LM0A 2QOIA 3BE9A 3ZLWA 4D2TA 2IN6A 4TW9A 3Q4TA 4I20A 3LHJA 3COKA 4Q9ZA 3LMGA 1VZOA 4YJUA 5ETCA 2NRYA 4MCVA 4Q2AA 4EQMA 3SOAA 3OHTA 4C37A 4AZEA 1W84A 4YJQA 2JDSA 3TNQB 5EKNA 4JG6A 3ZUUA 5L4QA 1VJYA 4PDOA 4CXAA 3MVLA 2X2KA 4FNXA 4ZTHA 4EK3A 5E4HA 5CVGA 3ORKA 1M14A 4G9RA 4GEOA 3PRIA 2QKWB 4L6QA 4RZVA 5A9UA 3MFSA 3BCEA 4Y72A 2JDOA 2XNMA 3F82A 4QNYA 4QTDA 2ZOQA 4A4XA 2W06A 3HV3A 2OJ9A 1Y57A 3KCKA 4GW8A 5H8EA 1R0PA 5IA2A 2BZHB 3AC5A 4YO6A 1PYEA 3BKBA 1GIJA 2PTKA 4DH5A 4JBOA 3FMNA 4GG5A 1ZMWA 5AR7A 3VBYA 3II5A 3OXTA 4FBXA 5AV2A 3QCXA 4EK4A 2C6IA 4E93A 2YAKA 3OCGA 4BCHA 4FTUA 3A4PA 3KKVA 4CRSA 5C26A 2GS6A 3T3VA 3P5JC 1YXTA 3HV4A 1WFCA 3GOKA 1XH4A 2GQGA 2OK1A 4X3FB 1URWA 3DCVA 5I9VA 1PJKA 1YXXA 4FSMA 3I6UA 5E92A 3CQWA 2C6DA 3Q04A 5M06A 4F7SA 4RIXA 2ITVA 3UTOA 1FINA 2W1GA 1DM2A 4AN9A 2X6EA 3IONA 4FL3A 4O0RA 4JG7A 3W2QA 2CKOA 3E3BX 2I40A 1Y91A 3UNZA 1PRYA 4CMTA 3IOPA 1JSTA 1CMKE 4RRVA 5EDRA 2DYLA 1XO2B 1LEWA 5F1ZA 4AP7A 2W9FB 3BWFA 2C6OA 1GIHA 2HYYA 2AC3A 2WTWA 2XCHA 4FG7A 3UOKA 2VTSA 4OAVB 2A1AB 4R7BA 5IUHA 2FH9A 1YHWA 4FZAB 4NKSA 3IGOA 1FGIA 3BGQA 3B8QA 2E9OA 4IAIA 5ANGA 2PZYA 3H9FA 1WBNA 2R3KA 5K5NA 2C6LA 2J2IB 4H36A 4FNYA 3WIGA 4XG9A 3W0RA 4E4NA 2WMVA 4PP7A 4JX3A 3DBQA 3LLAA 3QTSA 3OC1A 1X8BA 2AC5A 3FY2A 2WU7A 5TF9A 2GPHA 2PVJA 1H25A 1JSVA 2JKKA 4JL9A 3ACJA 2NNWB 1YWRA 2CDZA 2VWWA 3LOKA 3P0MA 1E1VA 2BRHA 2UZEA 2PY3A 2X81A 4M14A 5H2UA 4AAAA 3ENMA 2OXYA 4P90A 3ORNA 2UW0A 4WBBB 4NM0A 4O7YA 5D7AA 5LMKA 4WHZA 3O8TA 5CANA 3PIYA 4I24A 1KOAA 1ZZ2A 2W5BA 2WEIA 2IVSA 3SRVA 2FSLX 4IDVA 4GH2A 3FWQA 3NYNA 3RPOA 1YXUA 4BFMA 1UKIA 3FC2A 4G3CA 1PMUA 2UW9A 3HRCA 4WSYA 3ACKA 3VN9A 5CNOA 3MY1A 5EOLA 3CLYA 3AC1A 3VO3A 4F9CA 4ZY4A 3RAIA 2BKKA 4YSJA 3SXFA 3BLQA 3PXZA 4NCTA 1R1WA 3MSSA 3G6GA 4AG8A 3PG1A 4R7IA 4C2VA 4FG8A 4XG8A 4BKZA 4DTAA 5M51A 1BL6A 4JR7A 3A99A 4JBVA 3BEGA 4AT3A 4YMJA 4RWIA 2WZJA 4EUTA 1U5QA 2R3LA 4IM0A 3BE2A 4RLLA 2NYAA 3D5VA 5IH5A 1I09A 3CTHA 5DT4A 5KZ0A 2YM5A 3A7HA 4UMUA 5G1XA 4RX7A 3R7VA 4EHVA 5B2LA 2VWIA 2OFVA 1PXNA 3FDNA 3FZPA 3KN6A 3TT0A 4YLLA 4TYIA 4O4BB 3HV7A 3NUYA 5AAEA 1V0BA 3GP0A 1YW2A 5HTIA 5DH3A 1EH4A 3SQQA 3SOCA 3ZBFA 3DB8A 4X2FA 4LL5A 3DKCA 2ZM1A 3AMBA 4ZIMA 4APCA 3DTWA 4GT4A 3RNYA 4EJ7A 3I0OA 4OTFA 2PYWA 4FZFB 2W4OA 3BQRA 4IACA 2QNJA 3LFFA 4UN0C 2JLDA 2P4IA 3GCPA 4D58A 3MN3A 2WTKC 4AXCA 3S95A 4CLIA 4CCBA 2WTVA 5CSXA 4EEVA 3OBGA 1HCLA 4FL1A 3VNTA 5ANEA 4GUBA 1F0QA 3FLYA 4YHTA 2W99B 2VX3A 5CXHA 5D7VA 4W9WA 3MTFA 2JIIA 4LOQA 1OKZA 1Q8UA 2WTKB 3QRTA 4LYNA 5EI6A 3UG2A 4ALVA 4TWCA 4B9DA 3B8RA 4NM7A 5JQ8A 3GQLA 2UZOA 4JR3A 5E8YA 3W16A 2P2HA 4CKRA 2BZIB 3QTZA 3GC9A 4IZ7A 4QMSA 2XIKA 1NW1A 3JR1A 1OECA 2OIQA 3GNIB 4ANLA 2OJJA 3P1AA 3FSKA 2J6MA 4ZY5A 4QP7A 4TYHA 5AUXA 1OUYA 3CGFA 3PUFC 2W9ZB 4Y83A 4XMOA 5A14A 5CXZA 5CEKA 4MQ2A 4XBRA 4DFLA 4WRSA 4PV0A 1PYXA 3C0GA 5CVHA 3BHYA 2OKRA 3GQIA 3O51A 4E5WA 3OTVA 5HVYA 5KZIA 4MXXA 4MD9E 2F57A 2YDIA 3NCGA 4AAYA 4O7ZA 5HD7A 2J9MA 4ZLOA 3O5AA 4PTCA 1OB3A 1H00A 4O4CA 4G3DA 3PTGA 4H39A 2I6LA 2H96A 1QPEA 2C3IB 4QRCA 4ORKA 2R0IA 3MVJA 3SG8A 2FYSA 3KMUA 1YDSE 1I44A 2CKPA 4C61A 4C3PA 3PE1A 1BL7A 3W55A 4DITA 2UW6A 3DY7A 3G33A 3PJ2A 1L3RE 3SW4A 4EL9A 3LQ3A 4D1ZA 2UZTA 3QYZA 4IB0A 5BVKA 3RWPA 4FR4A 4D4RA 2VAGA 1OIRA 2J0IA 4WRGA 3K2LA 2BIKB 2YIQA 3NRMA 2W17A 4HGLA 3VS4A 4E20A 4FKOA 5HO7A 1REKA 3TWJA 3L9LA 1FPUA 2X7OA 3QD0A 2F49A 4QP2A 2ZAZA 5GHVA 5AJQA 3OBJA 3CBLA 4AF3A 4DFZE 1JWHA 3PSBA 4LOPA 2Z7LA 3FMDA 4KIKB 3BEAA 5FEEA 3BHHA 2A2AA 3IDCA 2JKOA 4QMXA 3A7JA 5E9EA 4K1BA 5DIAA 1REJA 3IPHA 4P5QA 1XKKA 2EXEA 3PIXA 4FTJA 5CAQA 5KNJA 2VRXA 4JT3A 5HIBA 2I0EA 4WD5A 3DB6A 1PMEA 3HUCA 4GVAA 3G0EA 4EH9A 4MXOA 5M44A 3NS9A 2CJMA 1JKTA 3FMEA 4YHJA 3ALNA 5DBXA 4FT3A 5DNRA 3SD0A 5ACKA 4ZJIA 3WZEA 3E87A 2FSTX 3QTU