4K8BA

Crystal structure of hcv ns3/4a protease complexed with inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
177
structure length
177
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand bioactive conformation plays a critical role in the design of drugs that target the hepatitis C virus NS3 protease.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NS3 protease
total genus 47
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4k8bA01
1L1GA 2BZ6H 5BPEA 1P9SA 1FIZA 3VFEA 1N6YA 1GI5A 1V2ST 3GICB 4UFDH 2WPHS 2STBE 3BIUH 4JZ1A 1FNIA 3HK6B 3ATMA 3ZZ7A 2JKHA 1W14U 1NU7B 1QR3E 3TH3H 1G3DA 2AIQA 5GWZA 1AI8H 1XUFA 3KF2A 3SBKA 4B1TA 2B0FA 2BDYA 1FONA 1L0ZA 3Q3YA 6CHAB 1HAXB 3PMHB 5AFZH 1SOZA 3M7QA 3BIVH 1ELGA 1KXFA 1QJ1B 1HV7A 3TU7H 3URCA 2AFQB 1A7SA 1SPJA 2Y80A 1QRZA 3HK3B 3NKKA 1TMBH 1GHWH 4ZROA 3RUOA 3AASA 1TOCB 3RXMA 3BV9B 1Q31A 2JH6D 1ESTA 2THFB 3GCNA 2RA0A 4X6NA 1EPTB 1GBLA 5A0CA 4TY7A 1YKTA 2XBXA 3UWIA 1SI5H 5FX6A 1UK3A 2G5VA 1BT7A 1FY8E 1AUJA 4SGBE 4X0WU 2GCTB 4WH6A 2SFAA 1K1JA 1O2MA 3MI4A 1TGNA 3VEQB 4DOQA 1XMNB 2G8TA 2ZECA 5SGAE 2VVUA 5TCAA 3KN2A 3QTOH 1P2IA 1SG8B 1OWDA 1H8IH 1AO5A 7KMEH 2ZGBH 2BD9A 4AN7A 3U1IB 1C1MA 1O3JA 1C1RA 1EJMA 3VXFH 3RXAA 3UPEA 1MU6B 4X1RU 5C1YA 3P6ZB 3V0XA 1QJ6B 2VNTA 2ZHEH 5DJ7A 1FY4A 3UUZA 4E7NA 1ELCA 4DVAU 1LHCH 1GBBA 3SNBA 1TWXB 4KGAA 3G01A 5J4QA 4Y8YA 1CBWB 4FUCA 4FVBA 1IOEA 1PYTC 2UWOA 5JB8S 1UHBB 1DY9A 1EP6A 2M5TA 1CO7E 1O2IA 2G5NA 4X1PU 1JMOH 1OYQA 1ELDE 5EOKA 2H5DA 1SGRE 3KQEA 1SLUB 1GJ9B 3K6ZA 5DP8A 3SQEE 5F8TA 1C1UH 1FI8A 3EQ0H 2VVVA 6LPRA 4FU7A 1TQ0B 3FZZA 5AF9H 1WYKA 1TONA 1S85A 4MVNA 4VGCB 1ELVA 1P3EA 2BD3A 3UNQA 1GI7B 1P2KA 4QT8C 4Q7ZA 1O37A 1GHZA 3V12A 3M3SA 1KXBA 2ZU2A 1IQFA 2UUYA 2BY7X 3SJ8A 1UCYH 1NPMA 1W10U 1YPJH 2V6NA 3ZZ5A 1LHDH 4B75A 7LPRA 2F4LA 1SQOA 1TNIA 1QIXB 3RXDA 1ID5H 1VITF 1IHSH 1FUJA 3T62A 1LKAA 4OGXA 1MCVA 3SQHE 3Q3XA 2Z9KA 1SGCA 1XUKA 1C4U2 4X2XA 1L4ZA 1LVOA 1BTYA 1ESBA 4K69A 4JZEH 1ZHPA 5EW1H 5C1UA 1GVZA 1MZAA 1GI8B 5T6DA 4KKDA 4BNRA 4BTTB 3LPRA 1IQJA 1WTGH 2WV5A 1A5GH 3F1SB 3SHAH 2W3KA 2FODA 1QURH 1IQHA 2V3OH 5HGGA 4I8JA 1T8MA 3P8OA 2PWXA 1V2KT 5A8YA 4CRCA 2ZFRH 3RXTA 2XC0A 2OQUA 1OWEA 2HOBA 2ZCKP 1QA0A 3NUMA 1WOFA 4ZHMU 3A7ZA 4OS7A 3I78A 5A0AE 1CU1A 3SU2A 1C1SA 2QF0A 4AFQA 1K9OE 5GXPA 5ABWA 8LPRA 3VPKA 3O8BA 1AWFH 1A1RA 1B7XB 1O3MA 2C8XB 1N1LA 1PQ7A 2A1DB 5E0JA 6GCHF 2A4RA 3S9AA 1Z8GA 1GG6B 3MWIU 4IGDA 1TGBA 1EZQA 4NIXA 3SUDA 1C1NA 3URDA 1HIAA 3PTBA 4INHA 1P09A 3OY5U 1CSOE 1MU8B 1TA2A 2QAAA 1ZRBA 4IMQA 3TVJB 4Y76A 1SGPE 1W13U 1KLJH 1ZMLA 2Q1JA 2A7CA 3F9EA 2O9QA 1A0LA 2DE9A 5LPEA 4DG4A 1NFWA 2AGIX 1TX8A 1TMTH 2FX4A 3SW2B 2BD4A 1PPZA 3SGQE 1DUEA 3EYDA 3RU4T 2P16A 1HAOH 1IQLA 4WXIA 2PSYA 3ZZ6A 1SC8U 3Q00A 1DLKB 1BHXF 3ZZ8A 4WMEA 5DP7A 3UREA 1W7XH 3LONA 3MO6A 4DGJA 1D3PB 2HNTC 1ELBA 4D7FA 2FZZA 1K1NA 5GIBA 2ZWLH 1P0SH 2BY8X 1C5WB 4DIIH 1TBRH 4Y11E 2W5EA 2GD4B 1UTJA 3RMOH 3ZVDA 1P8VC 2TGPZ 1AFEH 1ETTH 4UE7H 1SVPA 1O2LA 3F9FA 1E36B 1BUIA 2FDAA 3IG6B 2GKVE 1KIGH 1A2CH 2WUCA 3LGTA 1Z1IA 1DWBH 2OD3B 1RTKA 4IC6A 1A46H 3ODDA 2GDEH 4AFUA 1GCDA 1NO9H 1XUHA 1P01A 2D2DA 4CBNA 3AAUA 3A7WA 1GJ8B 2BYAX 1ZTKA 5ESTE 3C27B 1CE5A 1UTMA 1PYTD 1AZ8A 1A5IA 2CV3A 4RKOB 2ANYA 1OP0A 4ABEA 4D8NA 5GCHF 2PGBB 2GVFA 4X8UH 2CHAC 1XXDA 1PPGE 1GBEA 3OSYA 4ESTE 2FO9A 1GMHG 4B6EA 5CHAC 1T8LA 2BY9X 3MMGA 2JETB 5EXMA 3MU8A 1HIAB 2OTVA 1VR1H 1LHFH 3E3TA 3RMNH 1YP9A 1BBRE 1C5VA 3MU5A 4MG3A 1CA0B 4AFZA 1O2GH 4X1NU 4MPWA 3E8LA 1C5OH 1P05A 3A88A 2ZFTA 1HXFH 3VB4A 5FHTA 4FUBA 3M5NA 1IQKA 1TQ7B 4Y10E 5GJ4B 1E35B 4D76A 1EUFA 3PV4A 4CRAA 1O5FH 1B0FA 1GBHA 1IHTH 1GBAA 5F03A 3ZV9A 4ZHLU 3VB6A 2FOBA 2BB4A 3GCTG 2XRCA 1KLIH 9ESTA 4GHTA 2FEQH 2WINI 2D26C 1G32B 1GGDB 1TNKA 4KP0A 4CHAC 1SGFG 4K3JA 1O5CB 1MKXK 1MAXA 1HYLA 4FUDA 3SJ9A 1NS3A 1FMGA 1GWAA 1OWHA 1UCYE 2BY6X 3BTDE 5E0HA 2D1JA 1ARCA 2VIWA 2EA3A 3BG4C 1ZPBA 4F4OC 2J38A 1HLTH 2RA3A 1P06A 3SU3A 1Y5AT 1WSSH 4ZKOU 1Z1JA 3TIUA 2G00A 3MNCA 1F7ZA 2BDIA 3O8RA 1PPEE 4ABAA 2VIVA 2SGQE 1ACBE 1BRCE 3SNCA 3TJVA 4DCDA 1BMAA 3TJUA 1NESE 1O5BB 2PR3A 2XC4A 1DM4B 1L1NA 4ABGA 3TGKE 3OX7U 3A87A 4NA9H 4TPIZ 4E05H 2VIDA 2F9NA 1K1PA 3I29A 3MTYA 2QXHA 1TRMA 2BTCE 3ZZDA 1W12U 3RC4A 2FS8A 5B6OA 1QNJA 3H7OA 1WAYB 4FXGH 4GHQA 5HM9A 3F9HA 1C2DA 2BVRH 1W3CA 4JYUH 4XBBA 1RS0A 1UK4A 3LOXA 1XVOA 3UOPA 2J4IA 2BD5A 5K0HA 5LGOA 3R0FA 2UWLA 3RMLH 1G3EA 2PFEA 4GVUA 2F9BH 4X2YA 1GJCB 3M5OA 4Y79A 3DD2H 3MH4A 4U01A 3D23A 1EJAA 3HPTB 1S0QA 2H9EH 4CRFA 4HI3A 5CMXH 1V2UT 1MKWH 3SZEA 2Q6DA 2QXGA 3MYWA 4AZ2B 1GI1A 2UUFB 2FOCA 2VIPA 2ODYB 3EA7A 1U6QA 1YPHE 2JH0D 1JIRA 1S83A 2R3UA 4CBOA 2ZDKA 1AB9C 1A0HB 2Z6BD 1BJVA 1O2YA 3E90B 1ETSH 2F9OA 1HRTH 1DPOA 3CS7A 3RXPA 2BD7A 4INKA 4B2AA 1GL0E 3U8RH 1UO6A 5IDKA 3MFJA 3RU4D 4YZUA 2BDBA 2JH5D 3OY6U 8KME2 2C8YB 2FPZA 2ZDNA 1YPKH 1B0EA 1DVAH 3SJOA 1UTNA 1BMLA 1TLDA 4SGAE 2P3TB 2XWBI 3AK5A 3T2NA 1O3DA 2ZGCA 3UR6A 4D9QA 2OC7A 2YOLA 2A7HA 5TJXA 3VB3A 3STJA 1OWJA 1ZR0A 1BMNH 1OOKB 4O3UA 3KHVA 3RXRA 4NZLA 1Y5BT 4YT7H 1ANEA 4AFSA 3EAJA 1XKAC 2IOTA 4PROA 1P2QA 1G30B 4HTCH 1A5HA 1C5ZB 4K1SA 1QB9A 1UVSH 3D49H 4OS1A 1Y5UT 3SUFA 2PTCE 4YLUA 4O03A 3RXOA 1TGSZ 4MPUA 3LC5A 2ZFSA 2OINA 4XBDA 4HGCA 3PWCA 2GCHG 1AVWA 1NZQH 2R9PA 4IN2A 1V2PT 1EQ9A 1AB9B 4K8BA 2FM2A 1HCGA 2O8TA 2VH6A 4I7YH 1GI6A 3P92A 3HGPA 3V13A 2IJOB 3RXKA 2BD2A 3TLOA 4Z0KA 1G3CA 1K21H 1ZPCA 2WZQA 1INCA 2BDCA 1ZRKA 2PKSC 3NPSA 1CGIE 4I8LA 4Z6AH 1GHXH 5FPYA 2NU4E 2Z3EA 2Y81A 1HGTH 1OPHB 1J14A 3LGUA 1YPHC 1HUTH 3SU1A 1TGTA 1GI4A 4NGAH 3SUGA 1LO6A 2ZG0H 4UONA 1C2MA 1O36A 3B9FH 3U69H 1W8BH 1MCTA 1BTPA 2R0LA 5A2MH 2BDGA 1C1QA 2CF9H 2CGAA 1VCWA 3ATWA 4XE4A 4UEHH 3GDSA 3RP2A 1LVMA 1MTUA 3A8CA 3ATKA 4H6SB 1S81A 3U8TH 2BD8A 4BAMB 1WUNH 1H8DH 1VITG 1O2QA 1VJAU 1EAIA 3FP7E 4ISIH 3U8OH 4WWYA 2VINA 3UR9A 2Z3DA 1BHXB 2GP9B 3GY6A 1MKWK 2IJD1 1HAZB 1MTWA 3L33A 1B5GH 4I8KA 1OWKA 4ZKNU 1RIWC 1KYNA 1H9HE 2OCVB 1ESAA 4ZKSU 1E37B 1WU1A 1ANBA 2ZHFH 1MTSA 1YBWA 4THNH 1T4VH 4GSOA 5JPMH 1O3IA 2WPKS 5FBIA 3N7OA 1FLEE 4OS5A 1Z8IB 1C5MD 4DIHH 4A1TA 2C8ZB 1DSTA 2ZGHA 3RDZA 1ZHRA 1LPGB 3PMJA 1K1MA 1O33A 3LH1A 1BBRK 2F9UA 5DP6A 2QV1A 4WJG2 2ZHWH 2TGDA 3M37A 1T4UH 1O2RA 4BAKB 1DWDH 3SV9A 1DDJA 2STAE 3M61U 3SO3A 1DLEA 2FYRA 4B2BA 4OGYA 4AX9H 1Y3VA 5E2OA 1GI3A 1QB1A 4X8TH 1HJ9A 1P3CA 4J1YA 1C4Y2 3BSQA 1TX6A 3CP7A 3OTPA 2A7JA 4YOGA 2OK5A 5L2ZH 4JYTA 1ZYOA 2P94A 1BA8B 3BF6H 2BLQA 3A8BA 1SLVB 3KQBA 3S9CA 5C20A 1RD3B 1E38B 3E91A 4U32A 5ETXA 1O2JA 1HB0B 3I77A 3PB1E 1MTVA 8GCHG 3TK5A 2VH0A 2DE8A 1TNGA 1S82A 3P95A 3SUEA 2A31A 3AW1A 2Z7FE 1SQAA 2SGFE 3FVFB 1A4WH 2A5AA 1AE5A 3A84A 5DO4H 1V2WT 4BTUB 1EAXA 1LVBA 2ZI2H 4WMFA 5I46H 1WCZA 5E2PA 1TBZH 4F49A 1NRRH 4GCHG 2HLCA 1F2SE 1EPTC 2Z9IA 3FP6E 2Q6GA 1O3BA 3P8GA 1HBTH 1GCTC 4NWKA 4NCYA 1CHGA 1NY22 1O5EH 3KIDU 1VCPA 2QXJA 1S6FA 1C4V2 3E0PB 1SGNE 2PSXA 3KQDA 2RCEA 1UVPA 3A89A 2Z9LA 1FPHH 1VGCC 4H42U 1ELAA 3CS0A 4O3TA 3IITA 4TWWA 2ODPA 2GGVB 5F6MA 1YGCH 1QFKH 2ZKSA 3GY3A 5DP4A 3H09A 2ESTE 1QQ4A 4YO9A 3TK9A 1HJAC 1C2LA 1D3TB 2CJIA 1P57B 5GCHG 4GUXA 1LCYA 3U1JB 3ELAH 1C9TA 1BDAA 2VWMA 5JDUB 2FOFA 1G3BA 2FI5E 3T25A 5EQSA 1DICA 1SLWB 2FLRH 2AEIH 1RTLA 2CMYA 5LPRA 4JZIA 2ZIQH 2ZDLA 2PKSB 4MNWA 2C90B 1BRBE 5JBTA 2CF8H 1C5UA 1ETRH 1NM6A 1THPB 2ZFQH 1GMHF 4ISHH 1D6WA 3MH6A 1FIWA 1DT2A 3V3MA 1WQVH 1ABIH 1MMJN 2BLOA 1H4WA 4A5TS 1AU8A 3QDZB 4ABBA 1JRTA 1SGIB 1BB0B 3MO3A 2H6MA 1Y3UA 3BEFB 4Y6DA 3S7KB 3H7TA 5EU8A 2XBWA 2B5TB 3O8CA 3K2UA 1QA7A 4CR5A 1GMCF 4RI0A 2J95A 1O2HA 2WV4A 3FANA 2Y6TA 2ZEBA 3DFJA 3SN8A 1PQAA 2BVSH 1LPZB 3LU9B 4DY7B 2Z9JA 5EODA 5I25A 3O8DA 1WBGB 2GZ9A 1LMWB 5L30H 4IS5A 5FX5A 1G36A 5DP9A 4I31A 3TNTA 1W7GH 3RMMH 2WPLS 3Q76A 2B9LA 1Y3YA 1BRAA 2AGEX 3QLPH 1WV7H 1ZJKA 1FXYA 3NXPA 3PLKA 3T29A 2HNTF 1AGJA 2BDHA 3QTVH 1O31A 3LGWA 3QN7A 3SGAE 2FOGA 2RDLA 1PPFE 2ZU5A 2G52A 1NTPA 4E06H 1RIWB 2ULLA 1O2XA 2NU3E 4K8YA 2BZAA 2BY5X 4I8GA 4GLYA 1O3KA 1UTKA 1SLXB 1EB1H 4M7GA 1GHYH 1O0DH 1O3EA 1ANDA 3PM3A 4H4FA 4O9VA 3SNDA 4NA8A 3T5FH 2PTNA 1C2IA 2BVXH 3BTME 1V6DA 2HNTE 3GY2A 1YF4A 2NU1E 1D9IA 4ZMAH 4H6TA 3TGJE 2QCYA 1VGCB 3W94A 3RM2H 3TPIZ 2F91A 1J16A 1AE8H 3TJNA 1ELTA 1CGJE 3ZZCA 1KXEA 1V3XA 2YNAA 1BITA 1ZZZA 5A8ZA 1BOQA 4OS4A 5HM2A 4UFGH 2GT7A 1ZLRA 4FU9A 3SU0A 2A5KA 2TPIZ 3VB5A 2PUXB 3AW0A 3U9AH 1D6RA 1O3HA 2OBOA 2ZHDA 3ZYEA 4ASHA 3DT0H 2WPJS 1AFQB 2RG3A 3D62A 3EDXB 1XUGA 1YM0A 1Z6EA 1O2PA 3A86A 2VIOA 3M7TA 4CRBA 4NG9H 1GBFA 2AGGX 3RXCA 4X8VH 5L2YH 1TAWA 1TB6H 2OBQA 2I6QA 1UVTH 3UNSA 1HFDA 1RRKA 3MNXA 1KTSB 1HXEH 1AN1E 5H4IB 3QK1A 1THRH 2BOHB 4M9FA 1FY3A 4UD9H 1PQ5A 1YPEH 1D4PB 4ZHAA 1O30A 1SOTA 2C93B 2AYWA 4YT6H 1MD8A 3UFAA 3DHKH 1CT0E 4XBCA 2XW9A 2FIRH 2BDAA 1AD8H 4U2WA 1MD7A 1P03A 1YCPM 1ZGIA 4B73A 4XFQA 3BEUA 2WV9A 4O97A 2P3FH 1SFQB 5A0BA 1RGQA 1T7CA 1K28D 4I32A 1QJ7B 2P3UB 2FESH 2G55A 2A45B 5BRRE 3SYJA 4AYYB 1OXGA 1C2EA 1O2KA 2SNVA 1VJ9U 3RLYH 3LIWA 4DT7B 2ZDAH 1LPKB 2VVCA 2W7UA 1LKBA 1SFIA 3LJOA 2ZCHP 3WY8A 5LH8A 4NIYA 2WHXA 1GBCA 3BN9A 2OQ5A 2PKAA 1P2MA 2QN5T 3PO1C 1GHBF 4OS2A 4DURA 1O2OA 1HNEE 1DXPA 1DS2E 3MOCA 4I8HA 2QGRA 5PTPA 1K2I1 5EPYA 3PO1B 2VGCB 4RKJB 3SJIA 2FOHA 3EGKH 2VBCA 1DY8A 4KTUA 3SJKA 4VGCC 1DFPA 1DXWA 2J34A 1AWHB 4FUEA 3SV8A 2G51A 2A4GA 3QZQA 1GBTA 1FAKH 1QHRB 1Q3XA 3E16B 1ZSLA 4BAHB 3PMAB 1AVXA 4JYVH 1TFXA 3FZDA 4NZQA 3ZVGA 1OYTH 2UWPA 2VWLA 5J4SA 1AQ7A 3SNAA 2XYAA 3AAVA 1ORFA 1MKXH 1HAPH 2Y5FA 1J15A 3RXJA 3UY9A 7GCHG 1Y3WA 2C8WB 4UFFH 2FMJA 1DSUA 3T28A 1LDTT 2EC9H 1QL7A 1EATA 4AOQA 2LPRA 1BJUA 1YPGH 3PLPA 4ZXXH 1EZSC 1SL3A 5HYOA 1G2MA 3B23B 3FP8E 1JBUH 2ZU4A 3HGNA 5TCCA 4FUFA 3C1KA 3BTFE 3M3TA 2XC5A 3MNBA 2ZC9H 5DK1A 1IQMA 2ZPSA 1EJNA 4KTCA 1GBMA 1PFXC 1XUJA 1C9PA 3PWBA 2BXUH 1FN8A 2GT8A 2R2MB 1D3DB 1S0RA 1FDPA 4Y7AA 4MLFB 1SB1H 4TY6A 3ZVCA 8GCHF 1NFYA 1Z71A 3SNEA 2B7DH 1QTFA 5AHGH 1O35A 2AMPA 3UOUA 3TJOA 1TPAE 1VCQA 4YLQH 3GY4A 2XCFA 3E6PH 4FUJA 2GTBA 1KSNA 3BTWE 2D8WA 2WPMS 4U30A 4Q80A 1HDTH 3NZIA 4FUIA 1NC6A 2ANMH 2F9PA 1TE0A 2QIQA 1KDQB 4LOYH 1MUEB 1P04A 5HMAA 3T27A 3S7HB 1E0FD 2K1QA 1HAHH 2IPHA 4D9RA 1GJ5H 4XDEA 1C1WH 5DP5A 2LNCA 4YTAA 2BQ7B 3MU1A 1CVWH 5JBBS 3ENSB 2BHGA 1O2ZA 1Y3XA 3RLWH 2Y82A 1V2MT 1KXAA 2WYGA 1V2JT 5A09A 1SR5C 3SU5A 1ZHMA 4B76A 5LPFA 1GHVH 2R3YA 7GCHF 1P10A 5CE1A 1J17T 2FS9A 3NCLA 4RN6A 3F9GA 2UUKB 4GAWA 4HZHA 2C3SA 3A85A 2ZU1A 1JRSA 3A7VA 1AHTH 5DPAA 4UDWH 3KL6A 1SBWA 2J94A 1FPCH 2Z3CA 3MU4A 2P8OC 5C3NA 3GOVB 1RFNA 1C1PA 1FV9A 1AMHA 2BLWA 3GCHB 3L6PA 1EOLA 2GV7A 1C2KA 5DGJA 1TA6A 3SV2H 4LZ4B 1O38A 2Y5GA 2F83A 2H1UA 4K5ZA 2A2XH 1XX9A 4Y0ZE 3BTTE 1EKBB 1MTNB 2H2ZA 4JK6A 3UNRA 3GISB 1YC0A 4AORA 5C5NA 1GBDA 2O8UA 1WTHD 4B71A 4LXBH 1O3PB 4UFEH 4D7GA 1L4DA 2CXVA 1DANH 2H9HA 3BTHE 3Q77A 4HFPB 5JB9S 1OWIA 3K65B 2BX3A 1YCPH 3MU0A 1IQNA 1A3BH 4Y71A 3BTQE 3M5MA 5DG6A 2W26A 3EA8A 1ARBA 5JBCS 1MAYA 2SGPE 3S9BA 1C5QA 1RJXB 1ZTLA 4FUGA 1KDQA 2GZ8A 3SV6A 2TRMA 5FPSA 3KNXA 3ESTA 2O8LA 2ZF0H 3QZRA 2EI7A 3GCOA 1SMFE 1C1VH 2WPIS 3ZVAA 3EA9A 3GY8A 2C4FH 1FN6A 1BTUA 3SU4A 2A2QH 3RXUA 2H9TH 2NWNA 3SGBE 4AG2A 1BQYA 2W3IA 2P93A 3MH5A 3ZZAA 1SHYA 4WMDA 3B8JA 1V2NT 6ESTA 4CHAB 1HAYB 2J9NA 5L6NH 3OYPA 4ISLA 4MDSA 3ITIA 1A3EH 3LKWA 3UIRA 2XTTB 1P2OA 2SGAA 5FCRA 2AMQA 3U98H 5GNDA 3LH3A 2AMDA 1K1OA 1ZSJA 3RXIA 1EZXC 2P95A 2J92A 4NA7A 1GJBB 4TPYA 3TH2H 5E0GA 2FP7B 2FX6A 3DA9B 4ZXYH 2QXIA 1JOUB 2WYJA 1QGFA 1P2JA 1QB6A 2AH4X 1EASA 3GY7A 1OP2A 2V3HH 3DUXH 4X6PA 2FOMB 2ZNKH 1S84A 2BOKA 1PPCE 2A4QA 2DUCA 2G4TA 2ZQ2A 1SGYE 1TPPA 2NU0E 1GGDC 1HAIH 1LHGH 4R8TB 1C2FA 1VITH 7ESTE 1AKSA 4RSPA 2GX4A 1VZQH 2V0BA 1TMUH 3IWMA 1SGTA 1V2LT 3GCTF 1EX3A 3A82A 1EAUA 4MPXA 4BAOB 2B8OH 1BMMH 1F5KU 1N8OC 1O3OA 1WXRA 1O2NA 2Z94A 3SU6A 2OC8A 1KY9A 1XKBC 4WY3A 5FBEA 1P11E 6CHAC 1N8OB 2ANKH 1F5RA 3R3GB 1QBOA 1OKXA 1SGDE 3LC3A 3LDXH 4AGKA 2QA9E 1G37A 1V2VT 4NWLA 4X1SU 5JYIA 2OC1A 1W0ZU 1AKSB 1RXPA 4IMZA 3K6YA 1UJ1A 2VIQA 1TALA 4KELA 2GMTC 1UVOA 1O32A 1X7AC 1V2RT 2FYQA 2G4UA 2GMTB 1HAVB 4A1VA 1SHHB 2QY0B 5T6GA 1SGQE 1AUTC 1FY5A 1L1JA 4ZUHA 1GMDG 1QY6A 3KGPA 4MTBA 4YOJA 1ZSKA 3HKIB 2BQ6B 2F9VA 4BOHA 2FI4E 3BG8A 5AFYH 3LGIA 1GBIA 1GPZA 4MNXA 1IQGA 3RXBA 5EPNA 3H5CB 4AG1A 1HAGE 3OU0A 1OSSA 5E8EH 3TITA 3MH7A 4A92A 2XBVA 3STIA 2HGTH 3RXFA 2XNIA 3A81A 4Q7YA 5JBAS 2A0QB 2GV6A 1EP5A 2PKAB 1D3QB 1C5PA 4INLA 3QGJA 4MNYA 2A5IA 1K1LA 3TK6A 2VWNA 1ELEE 1QBVH 1JIMA 1FJSA 1L2EA 3BG4B 2VU8E 1CA8B 1QRXA 4Q2KA 2ZGXH 4DJZB 1GJ4H 4XOJA 2V35A 1V2QT 3A7XA 2ASUB 2OP9A 1SQTA 1XUIA 3RXSA 2PHBA 1NRSH 4B6FA 3GDUA 5B6LA 1J9CH 4JZDH 1GBJA 4DW2U 2VJ1A 3SZNA 1TBQH 3NK8A 3P17H 1ZTJA 3GY5A 1YCPK 3VXEH 4AYVB 1OX1A 2I6SA 2ZTZA 4ABIA 3M5LA 2P8OB 4X2WA 1EPTA 4BANB 2XCNA 4BTIB 4CRGA 1EB2A 3JZ2B 2ALVA 3K9XB 1GHBG 1QL8A 4ABFA 4ABHA 1NU9A 1TX7A 3F68H 1NRNH 2JETC 2ZGJA 5T3HA 1FY1A 2GCTC 5EW2H 5DKMA 1CBWC 3LJJA 1DUAA 5EXLA 3V7TA 5DP3A 4A6LA 1NFUA 1BCUH 1QRWA 1BTHH 5C5OA 1FAXA 4GPGA 5ESBA 1EAWA 1ELFA 4NFEA 4A1XA 1J8AA 1C2GA 3ZZBA 1O34A 2HALA 2SNWA 3RC6A 3A7TA 4NIWA 2ZZUH 3PV2A 3TNSA 2J2UA 4GCHF 1MQ5A 1OP8A 1TIOA 3VGCC 1LTOA 4IN1A 1CT4E 2CN0H 2VB0A 3ZVEA 2TBSA 5F8ZA 2BQWB 2Y7ZA 3M3VA 3ZVBA 1TNHA 4WXVA 3E1XB 2CHAB 3PYHA 1C2HA 4AGJA 2FXRA 3RU4E 1GBKA 1O2WA 6GCHG 3GCHC 4ZKRU 4B74A 1F92A 1UK2A 3W95A 1H9IE 5T6FA 1DITH 2ZP0H 2EEKA 3UQVA 1FQ3A 5C1XA 3SI4H 2FLBH 1TPOA 1MH0A 1SSXA 1ZMJA 3MHWU 1GJ7B 4MPVA 1C2JA 5FPTA 1S5SA 2VGCC 1C5XB 1NROH 1GI9B 1MBMA 1MBQA 2Y5HA 1K1IA 1CHOF 1Z6JH 1YPMH 2PLXA 1K22H 1V2TT 4TYDA 3GDVA 1NFXA 1O2SA 1O5AB 1C5LH 3RXVA 1Y8TA 2ZU3A 1QL9A 4X6MA 1GJDB 1FZZA 1S6HA 2AIPA 1GHAF 5FCKA 1HJ8A 3OTJE 1ZJDA 3S69A 1GVKB 3RM0H 2R0KA 1AIXH 1MZDA 3A8AA 1JWTA 1GVLA 1PPHE 3DFLA 3F6UH 3M7UA 4OS6A 1C5RA 1DOJA 4CR9A 3FAOA 1T31A 1GDNA 4YM9A 1GI2A 3ZZ4A 4NIVA 1LQDB 3ZYDA 3RC5A 4FUHA 3PLBA 1AVGH 1XM1A 3TH4H 5EQQA 3RXHA 1PJPA 1TYNA 3P8NA 1DX5M 4CH8B 3KEEA 4WVPE 1KLTA 1GDQA 2KAIB 4FU8A 3UWJH 1G9IE 1NT1A 2FI3E 3RXQA 2WUBA 3A80A 1TRNA 3LT3A 1UTLM 3QWCH 2HWLB 1XVMA 2F3CE 3SORA 1C1OA 1O5DH 4YOIA 1O3LA 1WQSA 3KQCA 2ZDMA 4X2VA 2G81E 2PUQH 2ZCLP 3PV5A 5IYTA 1T8NA 2FTLE 2ZO3H 1Z7KA 4WF8A 5T1VA 2ZDVH 1C5YB 5HXFA 3TGIE 1THSH 4ABDA 1GJAB 1UTPA 2HVXA 3BTGE 5EGMA 1V2OT 1GHAG 1W0YH 1P12E 3SOSA 2XBYA 2GZ7A 4LK4A 1H9LB 4IW4E 1M9UA 4K1TA 3A83A 2A4OA 1W2KH 2PV9B 3LGYA 1E34B 3RXGA 1CHOG 2EI8A 5F8XA 1IAUA 3SI3H 4ISNA 2ODQA 2Y7XA 1BTXA 2A32A 2NU2E 4XSKU 2FOEA 2Z9GA 4LZ1H 1DWEH 1F0TA 1LHEH 2BX4A 1BRUP 3SV7A 3BTEE 2ANWA 1IQIA 4CH2B 9LPRA 3M35A 1AY6H 1P9UA 4X1QU 1GCTB 4WH8A 2BM2A 1JXPA 1GDUA 3HATH 1TRYA 4BXSA 3RXEA 1AFQC 4NFFA 5C67A 1ZMNA 1ABJH 2TGTA 4KTSA 3EE0B 3FFGA 4CREA 3Q3KA 1TABE 4K1EA 1GL1A 1YLDA 1GI0A 1O3CA 1RTFB 2EI6A 2ZQ1A 3A7YA 1KTTB 1ZGVA 2GCHF 1UMAH 5AVDA 3P8FA 3ATIA 3MO9A 4BAQB 8ESTE 1A0JA 1BBRH 3CENA 3RXLA 1NRQH 3ATLA 4K60A 1BTWA 3QX5H 3ZVFA 4IC5A 1C5TA 4Y8XA 4OM9A 1EZUC 1KXCA 5G4BA 3QO6A 1UTOA 1EXFA 4Y8ZA 1ANCA 2HPQH 2AERH 3HKJB 1ZOMA 4ZH8A 1OS8A 1DWCH 1O39A 3E0NB 3T26A 4Y0YE 3L3TA 1O3FA 2ZPQA 5FXLA 3ZZ9A 1QQUA 3KCGH 2OC0A 2ZHQH 1BZXE 5EG4A 4A7IB 3M36A 4BXWA 2YNBA 3GYLB 1SGFA 5A8XA 1A61H 4ABJA 3ODFA 1XXFA 1F5LA 4X8SH 1NRPH 1Z8JB 1F0SA 3SHCH 3VB7A 1C1TA 1C5NH 1P02A 3ZZ3A 2OXSA 1TPSA 1LQEA 1W11U 3VGCB 2QF3A 3LGVA 3MNSA 2ALPA 1BIOA 1Y59T 1O5GH 1HAVA 4CRDA 1TNJA 1YLCA 3AVZA 4JCNA 3S0NA 2TGAA 1HPGA 4MQAA 3GYMA 1UCYK 1TNLA 2P59A 2UUJB 4NSYA 5FAHA 4IBLH 1F0UA 3QGNB 4MNVA 1BTZA 2ZA5A 4YESB 5GDSH 2ZFPH 3PMBB 2O8MA 4I33A 2QC2A 1O3NA 1IQEA 2ZFFH 3A8DA 2KAIA 2HPPH 2PW8H 1N6XA 2PGQB 4NSVA 2QYIA 2BXTH 2OUAA 1T32A 1TOMH 4J2YB 3JZ1B 4JZFH 3BTKE 4AB8A 2W7SA 1GMDF 4R0IA 2H5CA 4JMYA 3P70B 1CA0C 1EOJA 3UTUH 1UHBA 1O2UA 1QCPA 2TIOA 2FOAA 1O3AA 1NN6A 1T8OA 5C2ZA 2OLGA 1ZPZA 5K7RA 1C5SA 5CHAB 2XWAA 1O2VA 1HJAB 1CQQA 2R2WU 1KXDA 1PPBH 4TWYA 4K2YA 1O2TA 1GMCG 4FVDA 4Q7XA 4Y7BA 2Q6FA 1UTQA 1O3GA 1GJ6A 1YPLH 2ILNA 1Z8RA 2IN2A 5GPIB 2SGEE 1G2LA 2ZPRA 5EXNA 1AZZA 4B2CA 2ZTYA 1CGHA 3NWUA 2XXLA 2AS9A 3PROA 3ZV8A 1Q2WA 4X6OA 2FWWA 1CT2E 1SGEE 1QBNA 2VWOA 4AB9A 2FTMA 4ISOA 2SGDE 1MTNC 3BEIB 4E7RG 1DE7H 3UQOA 2O8WA 1UVUH 4JK5A 1H1BA 4ZAEA 2HRVA 5EQRA 1YYY1 1TGCA 3PTNA 1MQ6A 1PQ8A 2ZTXA 1LVYA 2BLVA 1F0RA 1GG6C 2BMGB 1P2NA 3QUMP 3D65E 2GDDA
chains in the Genus database with same CATH superfamily
1L1GA 5IK2D 2BZ6H 5BPEA 1P9SA 1FIZA 3VFEA 1N6YA 1GI5A 1V2ST 4HG6A 3GICB 4UFDH 2WPHS 2STBE 3BIUH 4JZ1A 1FNIA 3HK6B 3ATMA 3ZZ7A 2JKHA 1W14U 1NU7B 5EIYA 1QR3E 3TH3H 1G3DA 2AIQA 5GWZA 1AI8H 1XUFA 3KF2A 3SBKA 4B1TA 2B0FA 2BDYA 1FONA 1L0ZA 3Q3YA 6CHAB 1HAXB 3PMHB 5AFZH 1SOZA 5EJ1A 3M7QA 3BIVH 1ELGA 1KXFA 1QJ1B 1HV7A 3TU7H 3URCA 2AFQB 1A7SA 2KM0A 1SPJA 2Y80A 1QRZA 3HK3B 3NKKA 1TMBH 3EE7A 1GHWH 4ZROA 3RUOA 3AASA 1TOCB 3RXMA 3BV9B 1Q31A 2JH6D 1ESTA 2THFB 3GCNA 2RA0A 4X6NA 1EPTB 1GBLA 5A0CA 4TY7A 1YKTA 2XBXA 3UWIA 1SI5H 5FX6A 1UK3A 2G5VA 2GJGA 1FY8E 1BT7A 1AUJA 4SGBE 4X0WU 2GCTB 4WH6A 2SFAA 1K1JA 1O2MA 2J98A 3MI4A 1TGNA 3VEQB 4DOQA 1XMNB 2G8TA 2ZECA 5SGAE 2VVUA 5TCAA 3KN2A 3QTOH 4RT0A 1P2IA 1SG8B 1OWDA 1H8IH 1AO5A 7KMEH 2ZGBH 2BD9A 4AN7A 3DSPA 3U1IB 1C1MA 1O3JA 1C1RA 1EJMA 3VXFH 3RXAA 3UPEA 1MU6B 4X1RU 5C1YA 3P6ZB 3V0XA 2EQNA 3FN8A 1QJ6B 2VNTA 2ZHEH 2RDEA 5DJ7A 1FY4A 3UUZA 4E7NA 1ELCA 4DVAU 1LHCH 1GBBA 3SNBA 1TWXB 4KGAA 3G01A 5J4QA 4Y8YA 1CBWB 4FUCA 4FVBA 1IOEA 1PYTC 2UWOA 5JB8S 1UHBB 1DY9A 1EP6A 2M5TA 1CO7E 1O2IA 2G5NA 4X1PU 1JMOH 1OYQA 1ELDE 5EOKA 2H5DA 1SGRE 3KQEA 1SLUB 1GJ9B 3K6ZA 5DP8A 3SQEE 5F8TA 1C1UH 1FI8A 3EQ0H 2VVVA 6LPRA 4FU7A 1TQ0B 3FZZA 5AF9H 1WYKA 1TONA 1S85A 3UAIC 4MVNA 4VGCB 1ELVA 1P3EA 2BD3A 3UNQA 1GI7B 1P2KA 2F43B 4QT8C 4Q7ZA 1O37A 1GHZA 3PRDA 3V12A 3M3SA 1KXBA 2ZU2A 1IQFA 2UUYA 2BY7X 3SJ8A 1UCYH 1NPMA 1W10U 1YPJH 2V6NA 3ZZ5A 1LHDH 4B75A 7LPRA 2F4LA 1SQOA 1TNIA 1QIXB 3F3BA 3RXDA 1ID5H 1VITF 1IHSH 1FUJA 3T62A 1LKAA 4OGXA 1MCVA 3SQHE 3Q3XA 2Z9KA 1SGCA 1XUKA 1C4U2 4X2XA 1L4ZA 1LVOA 1BTYA 1ESBA 4K69A 4FETA 4JZEH 1ZHPA 5EW1H 5C1UA 1GVZA 1MZAA 1GI8B 5T6DA 4KKDA 4BNRA 4BTTB 3LPRA 1IQJA 1WTGH 2WV5A 1A5GH 3F1SB 3SHAH 2W3KA 2FODA 1QURH 1IQHA 2V3OH 5HGGA 4I8JA 1T8MA 3P8OA 2PWXA 1V2KT 2JDID 5A8YA 4CRCA 2ZFRH 3RXTA 2XC0A 2OQUA 1OWEA 2HOBA 2ZCKP 1QA0A 3NUMA 1WOFA 4ZHMU 1VKYA 3A7ZA 4OS7A 3I78A 5A0AE 1CU1A 3SU2A 1C1SA 2QF0A 4AFQA 1K9OE 5GXPA 5ABWA 8LPRA 3VPKA 3O8BA 1AWFH 1A1RA 1B7XB 1O3MA 2C8XB 1N1LA 1PQ7A 2A1DB 5E0JA 6GCHF 2A4RA 3S9AA 1Z8GA 1GG6B 3MWIU 4IGDA 1TGBA 1EZQA 4NIXA 3SUDA 4XRNA 1C1NA 3URDA 1HIAA 3PTBA 4INHA 1P09A 3OY5U 1CSOE 1MU8B 1TA2A 2QAAA 1ZRBA 4IMQA 3TVJB 4Y76A 1SGPE 1W13U 1KLJH 1ZMLA 2Q1JA 2A7CA 3F9EA 2O9QA 1A0LA 2DE9A 2L74A 5LPEA 4DG4A 1NFWA 2AGIX 1TX8A 1TMTH 2FX4A 3SW2B 2BD4A 2KCAA 1PPZA 3SGQE 1DUEA 3EYDA 3RU4T 2P16A 2LELA 1HAOH 1IQLA 4WXIA 2WSSD 2PSYA 3ZZ6A 1SC8U 3Q00A 1DLKB 1BHXF 3ZZ8A 4WMEA 2YMSB 5DP7A 3UREA 1W7XH 3LONA 3MO6A 4DGJA 1D3PB 2HNTC 1ELBA 4D7FA 2FZZA 1K1NA 5GIBA 3ZIAD 2ZWLH 1P0SH 2BY8X 1C5WB 4DIIH 1TBRH 5CHBA 4Y11E 2W5EA 2GD4B 1UTJA 3RMOH 3ZVDA 1P8VC 2TGPZ 1AFEH 1ETTH 4UE7H 1SVPA 1O2LA 3F9FA 1E36B 1BUIA 2FDAA 3IG6B 2GKVE 1KIGH 1A2CH 2WUCA 3LGTA 1Z1IA 1DWBH 2OD3B 1RTKA 4IC6A 1A46H 3ODDA 2GDEH 4AFUA 1GCDA 1NO9H 1XUHA 1P01A 2D2DA 1H8ED 4CBNA 3AAUA 3A7WA 1GJ8B 2BYAX 1ZTKA 5ESTE 3C27B 1CE5A 1UTMA 1PYTD 1AZ8A 1A5IA 2CV3A 4RKOB 2ANYA 1OP0A 4ABEA 4D8NA 5GCHF 2PGBB 1NBMD 2GVFA 4X8UH 2PP6A 2CHAC 1PPGE 1XXDA 1GBEA 3OSYA 4B6EA 2FO9A 1GMHG 4ESTE 5CHAC 1T8LA 2BY9X 3MMGA 2JETB 5EXMA 3MU8A 1HIAB 2OTVA 1VR1H 1LHFH 5C17A 3E3TA 5HKKD 2WPDD 3RMNH 1YP9A 1BBRE 1C5VA 3MU5A 4MG3A 3GS9A 1CA0B 4AFZA 1O2GH 3VG8A 4X1NU 4MPWA 3E8LA 1C5OH 1P05A 3A88A 2ZFTA 1HXFH 3VB4A 5FHTA 4FUBA 3M5NA 1IQKA 1TQ7B 4Y10E 5GJ4B 1E35B 4D76A 1EUFA 3PV4A 4CRAA 1O5FH 1B0FA 1GBHA 1IHTH 1GBAA 5F03A 3ZV9A 4ZHLU 3VB6A 2FOBA 2BB4A 3GCTG 1KLIH 2XRCA 9ESTA 4GHTA 2FEQH 2WINI 2D26C 1G32B 5DSFA 1GGDB 1TNKA 4KP0A 4CHAC 1SGFG 4K3JA 1O5CB 1MKXK 1MAXA 1HYLA 2RFKC 4FUDA 3SJ9A 1NS3A 1FMGA 1GWAA 1OWHA 1UCYE 2BY6X 3BTDE 5E0HA 2D1JA 1ARCA 2VIWA 2EA3A 3BG4C 1ZPBA 4F4OC 2J38A 1HLTH 2RA3A 1P06A 3SU3A 1Y5AT 1WSSH 4ZKOU 1Z1JA 3TIUA 2G00A 3MNCA 1F7ZA 2BDIA 3O8RA 1PPEE 4ABAA 2J98B 2VIVA 2SGQE 1ACBE 1BRCE 3SNCA 3TJVA 4DCDA 1BMAA 3TJUA 1NESE 1O5BB 2PR3A 1W0JD 2XC4A 1DM4B 1L1NA 4ABGA 3TGKE 3OX7U 3A87A 4NA9H 4TPIZ 4E05H 2VIDA 2F9NA 1K1PA 3I29A 3MTYA 2QXHA 1TRMA 2HVYB 2BTCE 3ZZDA 1W12U 3RC4A 2FS8A 5B6OA 1QNJA 3H7OA 1WAYB 4FXGH 4GHQA 5HM9A 3F9HA 1C2DA 2BVRH 1W3CA 4JYUH 4XBBA 1RS0A 1UK4A 3LOXA 1XVOA 3UOPA 2J4IA 3WWFA 2BD5A 5K0HA 5LGOA 3R0FA 2UWLA 3RMLH 1G3EA 2PFEA 4GVUA 2F9BH 4X2YA 1GJCB 3M5OA 4Y79A 3DD2H 3MH4A 4U01A 3D23A 1EJAA 3HPTB 1S0QA 2H9EH 4CRFA 4HI3A 5CMXH 1V2UT 1MKWH 3SZEA 2Q6DA 2QXGA 3MYWA 4AZ2B 2QF5A 1GI1A 2UUFB 2FOCA 2VIPA 3OE7D 2ODYB 3EA7A 1U6QA 1YPHE 2JH0D 1JIRA 1S83A 2R3UA 4CBOA 2ZDKA 1AB9C 1A0HB 2Z6BD 1BJVA 1O2YA 3E90B 1ETSH 2F9OA 1HRTH 1DPOA 3CS7A 3RXPA 3FKSD 2BD7A 4INKA 4B2AA 1GL0E 3U8RH 1UO6A 5IDKA 3MFJA 3RU4D 4YZUA 2BDBA 2JH5D 3F0PA 3OY6U 8KME2 4P02A 2C8YB 2FPZA 2ZDNA 1YPKH 1B0EA 1DVAH 3SJOA 1UTNA 1BMLA 1TLDA 4SGAE 2P3TB 2XWBI 3AK5A 3T2NA 1O3DA 2ZGCA 3UR6A 4D9QA 2OC7A 2YOLA 2A7HA 5TJXA 3VB3A 3STJA 1OWJA 1ZR0A 3NRLA 1BMNH 1OOKB 4O3UA 3KHVA 3RXRA 4NZLA 1Y5BT 4YT7H 1ANEA 4AFSA 3EAJA 1XKAC 2IOTA 4PROA 1P2QA 1G30B 4HTCH 1A5HA 1C5ZB 4K1SA 1QB9A 1UVSH 3D49H 4OS1A 1Y5UT 3SUFA 2PTCE 4YLUA 4O03A 4I86A 3RXOA 1TGSZ 4MPUA 3LC5A 2ZFSA 2OINA 4XBDA 4HGCA 3PWCA 2GCHG 1AVWA 1NZQH 2R9PA 4IN2A 1V2PT 1EQ9A 1AB9B 4K8BA 2FM2A 1HCGA 2O8TA 2VH6A 4I7YH 1GI6A 3P92A 3HGPA 3V13A 2IJOB 3RXKA 2BD2A 3TLOA 4Z0KA 1EFRD 1G3CA 1K21H 1ZPCA 2WZQA 1INCA 2BDCA 1ZRKA 2PKSC 3NPSA 1CGIE 4I8LA 4Z6AH 1GHXH 5FPYA 2NU4E 2Z3EA 5C94A 2Y81A 1HGTH 1OPHB 1J14A 3LGUA 1YPHC 1HUTH 3SU1A 1TGTA 1GI4A 4NGAH 3SUGA 1LO6A 2ZG0H 4UONA 1C2MA 1O36A 3B9FH 3U69H 1W8BH 1MCTA 1BTPA 2R0LA 5A2MH 2BDGA 1C1QA 2CF9H 2CGAA 1VCWA 3ATWA 4XE4A 4UEHH 3GDSA 3RP2A 1LVMA 1MTUA 3A8CA 3ATKA 4H6SB 1S81A 3U8TH 2BD8A 4BAMB 1WUNH 1H8DH 1VITG 1O2QA 1VJAU 1EAIA 3FP7E 4ISIH 3U8OH 4WWYA 2VINA 3UR9A 2Z3DA 1NBME 1BHXB 2GP9B 3GY6A 1MKWK 2IJD1 1HAZB 1MTWA 3L33A 5EJZA 1B5GH 4I8KA 1OWKA 3DSOA 4ZKNU 1RIWC 1KYNA 1H9HE 2OCVB 1ESAA 4ZKSU 1E37B 1WU1A 1ANBA 2ZHFH 1MTSA 1YBWA 4THNH 1T4VH 4GSOA 5JPMH 1O3IA 2WPKS 5FBIA 3N7OA 1FLEE 4OS5A 1Z8IB 1C5MD 4DIHH 4A1TA 1KMHB 2C8ZB 1DSTA 2ZGHA 3RDZA 3KYGA 1ZHRA 1LPGB 3PMJA 1K1MA 1O33A 3LH1A 1BBRK 5C0TA 2F9UA 5DP6A 2QV1A 4WJG2 2ZHWH 2TGDA 3M37A 1T4UH 1O2RA 4BAKB 1DWDH 3SV9A 1DDJA 2STAE 3M61U 3SO3A 1DLEA 2FYRA 4B2BA 4OGYA 4AX9H 1Y3VA 5E2OA 1GI3A 1QB1A 4X8TH 1HJ9A 1P3CA 2EY4C 4J1YA 2QE7D 1C4Y2 3BSQA 1TX6A 3CP7A 3OTPA 2A7JA 4YOGA 2OK5A 5L2ZH 4P00A 4JYTA 1ZYOA 2P94A 2XNDD 1BA8B 3BF6H 2BLQA 3A8BA 1SLVB 3KQBA 3S9CA 5C20A 1RD3B 1E38B 3E91A 4U32A 5ETXA 1O2JA 1HB0B 3I77A 3PB1E 1MTVA 8GCHG 3TK5A 2VH0A 2DE8A 1TNGA 3F2FA 1S82A 3P95A 3SUEA 2A31A 3AW1A 2Z7FE 1SQAA 2SGFE 3FVFB 1A4WH 2A5AA 1SQRA 1AE5A 3A84A 5DO4H 1V2WT 4BTUB 1EAXA 1LVBA 2ZI2H 4WMFA 5I46H 2J5UA 1WCZA 5E2PA 1TBZH 4F49A 1NRRH 1E1QD 4GCHG 2HLCA 1F2SE 1EPTC 2Z9IA 3FP6E 2Q6GA 1O3BA 3P8GA 1HBTH 1GCTC 4NWKA 4NCYA 1CHGA 1NY22 1O5EH 3KIDU 1VCPA 2QXJA 1S6FA 1C4V2 3E0PB 1SGNE 2PSXA 3KQDA 2RCEA 1UVPA 3A89A 2Z9LA 1FPHH 1VGCC 4H42U 1ELAA 3CS0A 4O3TA 3IITA 4TWWA 2ODPA 5HIZA 2GGVB 5F6MA 1YGCH 1QFKH 2ZKSA 3GY3A 5DP4A 3H09A 2ESTE 1QQ4A 4YO9A 3TK9A 1HJAC 1C2LA 1D3TB 2CJIA 1P57B 5GCHG 4GUXA 1LCYA 3U1JB 3ELAH 1C9TA 1BDAA 2VWMA 5JDUB 2FOFA 1G3BA 2V7QD 2FI5E 3T25A 5EQSA 1DICA 1SLWB 2FLRH 2AEIH 1RTLA 2CMYA 5LPRA 4JZIA 2ZIQH 2L6OA 1QZ8A 2ZDLA 2HLDD 2PKSB 4MNWA 5HIYA 2C90B 1BRBE 5JBTA 2CF8H 1C5UA 1ETRH 1NM6A 1THPB 2ZFQH 1GMHF 4ISHH 1D6WA 3MH6A 4TSFD 1FIWA 1DT2A 3V3MA 1WQVH 1ABIH 1MMJN 2BLOA 1H4WA 4A5TS 1AU8A 3FOAA 3QDZB 4ABBA 2CK3D 1JRTA 1SGIB 1BB0B 3MO3A 2H6MA 1Y3UA 3BEFB 4Q63A 4Y6DA 3S7KB 3H7TA 5EU8A 2XBWA 2B5TB 3O8CA 3K2UA 1QA7A 4CR5A 1GMCF 4RI0A 2J95A 1O2HA 2WV4A 3FANA 2Y6TA 2KCYA 2ZEBA 3DFJA 3SN8A 1PQAA 2BVSH 1LPZB 3LU9B 4DY7B 2Z9JA 5EODA 2KFWA 5I25A 3O8DA 1WBGB 2GZ9A 1LMWB 5L30H 4IS5A 5FX5A 1G36A 5DP9A 4I31A 3TNTA 1W7GH 3RMMH 2WPLS 3Q76A 2B9LA 1Y3YA 1BRAA 2AGEX 3QLPH 1WV7H 1ZJKA 1FXYA 3NXPA 3PLKA 3T29A 2HNTF 1AGJA 2BDHA 3QTVH 1O31A 3LGWA 3QN7A 3SGAE 2FOGA 2RDLA 1PPFE 2ZU5A 2G52A 1NTPA 4E06H 1RIWB 2ULLA 1O2XA 2NU3E 4K8YA 2BZAA 2BY5X 4I8GA 4GLYA 1O3KA 1UTKA 1SLXB 1EB1H 4M7GA 1GHYH 1O0DH 1O3EA 1ANDA 3PM3A 4H4FA 2W6JD 4O9VA 3SNDA 4NA8A 3T5FH 2PTNA 1C2IA 2BVXH 3BTME 1V6DA 2HNTE 3GY2A 1YF4A 2NU1E 1D9IA 4ZMAH 4H6TA 3TGJE 2QCYA 1VGCB 3W94A 3RM2H 3TPIZ 2F91A 4FOUC 1J16A 1AE8H 3TJNA 1COWD 1ELTA 1CGJE 2KCPA 3ZZCA 1KXEA 1V3XA 2YNAA 1BITA 1ZZZA 5A8ZA 1BOQA 4OS4A 5HM2A 4UFGH 2GT7A 1ZLRA 4FU9A 3SU0A 2A5KA 2TPIZ 3VB5A 2PUXB 3AW0A 3U9AH 1D6RA 1O3HA 2OBOA 2ZHDA 3ZYEA 3UB0A 4ASHA 3DT0H 2YMSD 2WPJS 1AFQB 2RG3A 3D62A 3EDXB 1XUGA 1YM0A 1Z6EA 1O2PA 3A86A 2VIOA 3M7TA 4CRBA 4NG9H 1GBFA 2AGGX 3RXCA 4X8VH 5L2YH 1TAWA 1TB6H 2OBQA 2I6QA 1UVTH 3UNSA 1HFDA 1RRKA 1YLNA 3MNXA 1KTSB 1HXEH 1AN1E 5H4IB 3QK1A 1THRH 2BOHB 4M9FA 1FY3A 4UD9H 1PQ5A 1YPEH 1D4PB 4ZHAA 1O30A 1SOTA 2C93B 2AYWA 4YT6H 1MD8A 3UFAA 3DHKH 1CT0E 4XBCA 2XW9A 2FIRH 2BDAA 1AD8H 4U2WA 1MD7A 1P03A 1YCPM 1ZGIA 4B73A 4XFQA 2WV9A 3BEUA 4O97A 2P3FH 1SFQB 5A0BA 1RGQA 1T7CA 1K28D 4I32A 1QJ7B 2P3UB 2FESH 2QF4A 2G55A 2A45B 5BRRE 3W1EA 3SYJA 4AYYB 1OXGA 1C2EA 1O2KA 2SNVA 1VJ9U 3RLYH 3LIWA 4DT7B 2ZDAH 1LPKB 2VVCA 2W7UA 1LKBA 1SFIA 3LJOA 2ZCHP 3WY8A 5LH8A 2WHXA 4NIYA 1GBCA 2YMSC 3BN9A 2OQ5A 2PKAA 1P2MA 2QN5T 3PO1C 1GHBF 4OS2A 4DURA 1O2OA 1HNEE 1DXPA 1DS2E 3MOCA 4I8HA 2QGRA 5PTPA 1K2I1 5EPYA 3PO1B 2VGCB 3N7EA 4RKJB 3SJIA 2FOHA 3EGKH 2VBCA 1DY8A 4KTUA 3SJKA 4VGCC 2KCOA 1DFPA 3U28C 1DXWA 2J34A 1AWHB 4FUEA 3SV8A 5KGOA 2G51A 2A4GA 3QZQA 1GBTA 1FAKH 1QHRB 1Q3XA 3E16B 1ZSLA 4BAHB 3PMAB 1AVXA 4JYVH 1TFXA 3FZDA 4NZQA 3ZVGA 1OYTH 2KX4A 2UWPA 2VWLA 1AQ7A 3SNAA 5J4SA 2XYAA 3AAVA 1ORFA 1MKXH 1HAPH 2Y5FA 1J15A 3RXJA 3UY9A 7GCHG 1Y3WA 4ZCNA 2C8WB 4UFFH 2FMJA 1DSUA 3T28A 1LDTT 2EC9H 1QL7A 1EATA 4AOQA 2LPRA 1BJUA 1YPGH 3PLPA 4ZXXH 1EZSC 1SL3A 3WW7A 4F55A 1G2MA 5HYOA 3B23B 3FP8E 1JBUH 2ZU4A 3HGNA 5TCCA 4FUFA 3C1KA 3BTFE 3M3TA 2XC5A 3MNBA 2ZC9H 5DK1A 1IQMA 2ZPSA 1EJNA 4KTCA 2W6ID 1GBMA 1PFXC 1XUJA 1C9PA 3PWBA 2BXUH 1FN8A 2GT8A 2R2MB 1D3DB 1S0RA 2K0QA 1FDPA 4Y7AA 4MLFB 1SB1H 4TY6A 3ZVCA 4F48B 8GCHF 1W0KD 1NFYA 1Z71A 3SNEA 2B7DH 1QTFA 5AHGH 1O35A 2AMPA 3UOUA 3TJOA 1TPAE 1VCQA 4YLQH 3GY4A 2XCFA 3E6PH 4FUJA 2GTBA 1KSNA 3BTWE 2D8WA 2V3MA 2WPMS 4U30A 4Q80A 1HDTH 3NZIA 4FUIA 1NC6A 2ANMH 2F9PA 1TE0A 2QIQA 1KDQB 4LOYH 1MUEB 1P04A 3PRBA 5HMAA 3T27A 3S7HB 1E0FD 2K1QA 1HAHH 2IPHA 4D9RA 1GJ5H 1K0HA 4XDEA 1C1WH 5DP5A 2LNCA 2XOKD 4YTAA 2BQ7B 3DCLA 1CVWH 3MU1A 5JBBS 3ENSB 2BHGA 1O2ZA 1Y3XA 3RLWH 2Y82A 4ASUD 1V2MT 1KXAA 2WYGA 1V2JT 5A09A 1SR5C 3SU5A 1ZHMA 3DSGA 4B76A 4AC9A 5LPFA 1GHVH 2R3YA 7GCHF 1P10A 5CE1A 1J17T 2FS9A 3NCLA 4RN6A 3F9GA 2UUKB 4GAWA 4HZHA 2C3SA 3A85A 2ZU1A 1JRSA 3A7VA 1AHTH 5DPAA 4UDWH 3KL6A 1SBWA 2J94A 1FPCH 2Z3CA 3MU4A 2P8OC 5C3NA 3GOVB 1RFNA 1C1PA 1FV9A 1AMHA 1H8HD 2BLWA 3GCHB 3L6PA 1EOLA 2GV7A 1C2KA 5DGJA 1TA6A 3SV2H 4LZ4B 1O38A 2Y5GA 2F83A 2H1UA 4K5ZA 2A2XH 1XX9A 4Y0ZE 3BTTE 1EKBB 1MTNB 2H2ZA 4JK6A 3UNRA 3GISB 1YC0A 2AHME 4AORA 5C5NA 1GBDA 2O8UA 1WTHD 4B71A 4LXBH 1O3PB 4UFEH 4D7GA 1L4DA 2CXVA 1DANH 2H9HA 3BTHE 3Q77A 4HFPB 5JB9S 1OWIA 3K65B 2BX3A 1YCPH 2LP6A 1IQNA 1A3BH 3MU0A 4Y71A 3BTQE 3M5MA 5DG6A 2W26A 3EA8A 1ARBA 5JBCS 1MAYA 2SGPE 3S9BA 1C5QA 1RJXB 1ZTLA 4FUGA 1KDQA 2GZ8A 3SV6A 2TRMA 4ACBA 3CNRA 5FPSA 3KNXA 3ESTA 2O8LA 2ZF0H 3QZRA 5C0UA 2EI7A 3GCOA 1SMFE 1C1VH 5KEDA 2WPIS 1BMFD 3ZVAA 3EA9A 3GY8A 2C4FH 1FN6A 1BTUA 3SU4A 2A2QH 3RXUA 2H9TH 2M2AA 2NWNA 3SGBE 4AG2A 1BQYA 2W3IA 2P93A 3MH5A 3ZZAA 1SHYA 4WMDA 3B8JA 1V2NT 6ESTA 4CHAB 1HAYB 2J9NA 5L6NH 3OYPA 2K8IA 4ISLA 4MDSA 3ITIA 1A3EH 3LKWA 3UIRA 2XTTB 1P2OA 2SGAA 5FCRA 2AMQA 3U98H 5GNDA 3LH3A 2AMDA 1K1OA 1ZSJA 3RXIA 1EZXC 2P95A 2J92A 4NA7A 1GJBB 2JJ1D 4TPYA 3TH2H 5E0GA 2FP7B 2FX6A 3DA9B 4ZXYH 2QXIA 1JOUB 1QGFA 2WYJA 1P2JA 1QB6A 2AH4X 1EASA 3GY7A 1OP2A 2V3HH 3DUXH 4X6PA 2FOMB 2ZNKH 1S84A 2BOKA 1PPCE 2A4QA 2DUCA 2G4TA 2ZQ2A 1SGYE 1TPPA 2NU0E 1GGDC 1HAIH 1LHGH 4R8TB 1C2FA 1VITH 7ESTE 1AKSA 4RSPA 2GX4A 1VZQH 2V0BA 1TMUH 3IWMA 1SGTA 1V2LT 3GCTF 1EX3A 3A82A 1EAUA 4MPXA 3FO8D 4BAOB 2B8OH 1BMMH 1F5KU 1N8OC 1O3OA 1WXRA 1O2NA 2KR7A 2Z94A 3SU6A 2OC8A 1KY9A 1XKBC 4WY3A 5FBEA 1P11E 6CHAC 1N8OB 2ANKH 1F5RA 3R3GB 1QBOA 1OKXA 1SGDE 3LC3A 3LDXH 4AGKA 2QA9E 1G37A 1V2VT 4NWLA 4X1SU 5JYIA 2OC1A 1W0ZU 1AKSB 1RXPA 4IMZA 1E1RD 3K6YA 1UJ1A 2VIQA 1TALA 4KELA 2GMTC 1UVOA 3N7DA 1O32A 1X7AC 1V2RT 2FYQA 2G4UA 2GMTB 1HAVB 4A1VA 1SHHB 2QY0B 5T6GA 1SGQE 1AUTC 1FY5A 1L1JA 4ZUHA 5KECA 1GMDG 1QY6A 3KGPA 4MTBA 4YOJA 1ZSKA 3HKIB 2BQ6B 2F9VA 3KQ5A 4BOHA 2FI4E 3BG8A 5AFYH 3LGIA 3OFND 1GBIA 1GPZA 4MNXA 1IQGA 3RXBA 5EPNA 3H5CB 4AG1A 1HAGE 3OU0A 1OSSA 5E8EH 3TITA 3MH7A 4A92A 2XBVA 3STIA 1FX0B 2HGTH 3RXFA 2XNIA 3A81A 3F2GA 4Q7YA 5JBAS 2A0QB 2GV6A 1EP5A 2PKAB 1D3QB 1C5PA 4INLA 3QGJA 4MNYA 2A5IA 1K1LA 3TK6A 2VWNA 1ELEE 1QBVH 1JIMA 1FJSA 1L2EA 3BG4B 2VU8E 1CA8B 1QRXA 4Q2KA 2ZGXH 4DJZB 1GJ4H 4XOJA 2V35A 1V2QT 3A7XA 2ASUB 2OP9A 1SQTA 1XUIA 3RXSA 2PHBA 1NRSH 4B6FA 3GDUA 5B6LA 1J9CH 4JZDH 1GBJA 4DW2U 2VJ1A 3SZNA 1TBQH 3NK8A 3P17H 1ZTJA 3GY5A 1YCPK 3VXEH 4AYVB 1OX1A 2I6SA 2ZTZA 4ABIA 3M5LA 2P8OB 4X2WA 1EPTA 4BANB 2XCNA 4BTIB 4CRGA 1EB2A 3JZ2B 5EJLA 2ALVA 3K9XB 1GHBG 1QL8A 4ABFA 4ABHA 1NU9A 1TX7A 3F68H 1NRNH 2JETC 2ZGJA 5T3HA 1FY1A 2GCTC 5EW2H 5DKMA 1CBWC 3LJJA 1DUAA 5EXLA 3V7TA 5DP3A 4A6LA 1NFUA 1BCUH 2JIZD 1QRWA 1BTHH 5C5OA 1FAXA 4GPGA 5ESBA 1EAWA 1ELFA 4NFEA 4XD7D 4A1XA 1J8AA 1C2GA 3ZZBA 1O34A 2HALA 2SNWA 3RC6A 3A7TA 4NIWA 2ZZUH 3PV2A 3WWBA 3TNSA 2J2UA 4GCHF 1MQ5A 1OP8A 1TIOA 3VGCC 1LTOA 4IN1A 1CT4E 2CN0H 2VB0A 3ZVEA 2TBSA 5F8ZA 2BQWB 2Y7ZA 3M3VA 3ZVBA 1TNHA 4WXVA 3E1XB 2CHAB 3PYHA 1C2HA 4AGJA 2FXRA 3RU4E 1GBKA 1O2WA 3OAAD 6GCHG 3GCHC 4ZKRU 4B74A 1F92A 1YWUA 1UK2A 3W95A 1H9IE 5T6FA 2J97A 1DITH 2ZP0H 2EEKA 3UQVA 1FQ3A 5C1XA 3SI4H 2FLBH 3KYFA 1TPOA 1MH0A 1SSXA 1ZMJA 3MHWU 1GJ7B 4MPVA 1C2JA 5FPTA 1S5SA 2VGCC 4DT4A 1C5XB 1NROH 1GI9B 1MBMA 1MBQA 2Y5HA 1K1IA 1OHHD 1CHOF 1Z6JH 1YPMH 2PLXA 1K22H 1V2TT 4TYDA 3GDVA 1NFXA 1O2SA 1O5AB 1C5LH 3RXVA 1Y8TA 2ZU3A 1QL9A 4X6MA 1GJDB 1FZZA 1S6HA 2AIPA 1GHAF 5FCKA 1HJ8A 3OTJE 1ZJDA 3S69A 1GVKB 3RM0H 2R0KA 1AIXH 1MZDA 3A8AA 1JWTA 1GVLA 1PPHE 3DFLA 3F6UH 3M7UA 4OS6A 1C5RA 1DOJA 4CR9A 3F2HA 3FAOA 1T31A 1GDNA 4YM9A 1GI2A 3ZZ4A 3N99A 4NIVA 1LQDB 3ZYDA 1YY3A 3RC5A 4FUHA 3PLBA 1UW7A 1AVGH 1XM1A 3TH4H 5EQQA 3RXHA 1PJPA 1TYNA 3P8NA 1DX5M 4CH8B 3KEEA 4WVPE 1KLTA 1GDQA 2KAIB 4FU8A 3UWJH 1G9IE 1NT1A 2FI3E 3RXQA 2WUBA 3A80A 1TRNA 2IPQX 3LT3A 1UTLM 3QWCH 2HWLB 1XVMA 2F3CE 3SORA 1C1OA 1O5DH 4YOIA 1O3LA 1WQSA 3KQCA 2ZDMA 4X2VA 2G81E 2PUQH 2ZCLP 3F0OA 3PV5A 5IYTA 1T8NA 2FTLE 2ZO3H 1Z7KA 4Q4LA 4WF8A 5T1VA 2JJ2D 2ZDVH 1C5YB 5HXFA 3TGIE 1THSH 4ABDA 1GJAB 1UTPA 2HVXA 3BTGE 5EGMA 1V2OT 1GHAG 1W0YH 1P12E 3SOSA 2XBYA 2GZ7A 1SKYE 4LK4A 2KZ4A 1H9LB 4IW4E 1M9UA 4K1TA 3A83A 2A4OA 1W2KH 2PV9B 3LGYA 1E34B 3RXGA 1CHOG 2EI8A 5F8XA 1IAUA 3SI3H 4ISNA 3MQKC 2ODQA 2Y7XA 1BTXA 2A32A 2NU2E 4XSKU 2FOEA 1WDIA 2Z9GA 4LZ1H 1DWEH 1F0TA 1LHEH 2BX4A 1BRUP 3SV7A 3BTEE 2ANWA 1IQIA 4CH2B 9LPRA 3M35A 1AY6H 1P9UA 4X1QU 1GCTB 4WH8A 2BM2A 1JXPA 1GDUA 3HATH 1TRYA 4BXSA 3RXEA 1AFQC 4NFFA 5C67A 1ZMNA 1ABJH 2TGTA 4KTSA 5FL7D 3EE0B 3FFGA 4CREA 1S6LA 3Q3KA 1TABE 4K1EA 1GL1A 1YLDA 1GI0A 1O3CA 1RTFB 2EI6A 2ZQ1A 3A7YA 1KTTB 1ZGVA 2GCHF 1UMAH 5AVDA 3P8FA 3ATIA 3MO9A 4BAQB 8ESTE 1A0JA 1BBRH 3CENA 3RXLA 1NRQH 3ATLA 4K60A 1BTWA 3QX5H 3ZVFA 4IC5A 1C5TA 4Y8XA 4OM9A 1EZUC 1KXCA 5G4BA 3QO6A 1UTOA 1EXFA 4Y8ZA 1MABB 1ANCA 2HPQH 2AERH 3HKJB 1ZOMA 4ZH8A 1OS8A 1DWCH 1O39A 3E0NB 3T26A 3OEHD 4Y0YE 3OEED 3L3TA 1O3FA 2ZPQA 5FXLA 3ZZ9A 1QQUA 3KCGH 2OC0A 2ZHQH 1BZXE 5EG4A 4A7IB 3M36A 4BXWA 2YNBA 3GYLB 1SGFA 5A8XA 4YXWD 1A61H 4ABJA 3ODFA 1XXFA 1F5LA 4X8SH 1NRPH 1Z8JB 1F0SA 3SHCH 3VB7A 1C1TA 1C5NH 1P02A 3ZZ3A 2OXSA 1TPSA 1LQEA 1W11U 3VGCB 2QF3A 3LGVA 3MNSA 2ALPA 1BIOA 1E79D 5CDFE 1Y59T 1O5GH 1HAVA 4CRDA 1TNJA 1YLCA 3AVZA 4JCNA 3S0NA 2TGAA 1HPGA 4MQAA 3GYMA 1UCYK 1TNLA 2P59A 2UUJB 4NSYA 5FAHA 4IBLH 1F0UA 3QGNB 4MNVA 5F53A 1BTZA 2ZA5A 4YESB 5GDSH 2ZFPH 4ACAA 3PMBB 2O8MA 4I33A 2QC2A 1O3NA 1IQEA 2ZFFH 3A8DA 2KAIA 2HPPH 2PW8H 1N6XA 2PGQB 4NSVA 2QYIA 2BXTH 2OUAA 1T32A 1TOMH 4J2YB 3JZ1B 4JZFH 3BTKE 4AB8A 2W7SA 1GMDF 4R0IA 2H5CA 4JMYA 3P70B 1CA0C 1EOJA 3UTUH 1UHBA 1O2UA 1QCPA 2TIOA 2FOAA 1O3AA 1NN6A 1T8OA 5C2ZA 2OLGA 1ZPZA 5K7RA 1C5SA 5CHAB 2XWAA 1O2VA 1HJAB 1CQQA 2R2WU 1KXDA 1PPBH 4TWYA 4K2YA 1O2TA 1GMCG 4FVDA 4Q7XA 4Y7BA 2Q6FA 1UTQA 1O3GA 1GJ6A 4TT3D 1YPLH 2ILNA 1Z8RA 2IN2A 5GPIB 2SGEE 1G2LA 2ZPRA 5EXNA 1AZZA 4RT1A 4B2CA 2ZTYA 1CGHA 3NWUA 2XXLA 2AS9A 3PROA 3ZV8A 1Q2WA 4X6OA 2FWWA 1CT2E 1SGEE 1QBNA 2VWOA 4AB9A 5DN6D 2FTMA 4ISOA 2SGDE 1MTNC 3BEIB 4E7RG 1DE7H 3UQOA 2O8WA 1UVUH 4JK5A 1H1BA 4ZAEA 2HRVA 5EQRA 1YYY1 1TGCA 3PTNA 1MQ6A 1PQ8A 4Z1MD 2ZTXA 1LVYA 2BLVA 1F0RA 1GG6C 2BMGB 1P2NA 3QUMP 3D65E 2GDDA
chains in the Genus database with same CATH topology
1L1GA 5IK2D 2BZ6H 5BPEA 1P9SA 1FIZA 3VFEA 1N6YA 1GI5A 1V2ST 3GICB 4UFDH 2WPHS 2STBE 3BIUH 4JZ1A 1FNIA 3HK6B 3ATMA 3ZZ7A 2JKHA 1W14U 1NU7B 1QR3E 3TH3H 1G3DA 2AIQA 5GWZA 1AI8H 1XUFA 3KF2A 3SBKA 4B1TA 2B0FA 2BDYA 1FONA 1L0ZA 3Q3YA 6CHAB 1HAXB 3PMHB 5AFZH 1SOZA 3M7QA 3BIVH 1ELGA 1KXFA 1QJ1B 1HV7A 3TU7H 3URCA 2AFQB 1A7SA 2KM0A 1SPJA 2Y80A 1QRZA 3HK3B 3NKKA 1TMBH 1GHWH 4ZROA 3RUOA 3AASA 1TOCB 3RXMA 3BV9B 1Q31A 2JH6D 1ESTA 2THFB 3GCNA 2RA0A 4X6NA 1EPTB 1GBLA 5A0CA 4TY7A 1YKTA 2XBXA 3UWIA 1SI5H 5FX6A 1UK3A 2G5VA 1BT7A 1FY8E 1AUJA 4SGBE 4X0WU 2GCTB 4WH6A 2SFAA 1K1JA 1O2MA 3MI4A 1TGNA 3VEQB 4DOQA 1XMNB 2G8TA 2ZECA 5SGAE 2VVUA 5TCAA 3KN2A 3QTOH 1P2IA 1SG8B 1OWDA 1H8IH 1AO5A 7KMEH 2ZGBH 2BD9A 4AN7A 3DSPA 3U1IB 1C1MA 1O3JA 1C1RA 1EJMA 3VXFH 3RXAA 3UPEA 1MU6B 4X1RU 5C1YA 3P6ZB 3V0XA 3FN8A 1QJ6B 2VNTA 2ZHEH 5DJ7A 1FY4A 3UUZA 4E7NA 1ELCA 4DVAU 1LHCH 1GBBA 3SNBA 1TWXB 4KGAA 3G01A 5J4QA 4Y8YA 1CBWB 4FUCA 4FVBA 1IOEA 1PYTC 2UWOA 5JB8S 1UHBB 1DY9A 1EP6A 2M5TA 1CO7E 1O2IA 2G5NA 4X1PU 1JMOH 1OYQA 1ELDE 5EOKA 2H5DA 1SGRE 3KQEA 1SLUB 1GJ9B 3K6ZA 5DP8A 3SQEE 5F8TA 1C1UH 1FI8A 3EQ0H 2VVVA 6LPRA 4FU7A 1TQ0B 3FZZA 5AF9H 1WYKA 1TONA 1S85A 4MVNA 4VGCB 1ELVA 1P3EA 2BD3A 3UNQA 1GI7B 1P2KA 4QT8C 2F43B 4Q7ZA 1O37A 1GHZA 3V12A 3PRDA 3M3SA 1KXBA 2ZU2A 1IQFA 2UUYA 2BY7X 3SJ8A 1UCYH 1NPMA 1W10U 1YPJH 2V6NA 3ZZ5A 1LHDH 4B75A 7LPRA 2F4LA 1SQOA 1TNIA 1QIXB 3F3BA 3RXDA 1ID5H 1VITF 1IHSH 1FUJA 3T62A 1LKAA 4OGXA 1MCVA 3SQHE 3Q3XA 2Z9KA 1SGCA 1XUKA 1C4U2 4X2XA 1L4ZA 1LVOA 1BTYA 1ESBA 4K69A 4FETA 4JZEH 1ZHPA 5EW1H 5C1UA 1GVZA 1MZAA 1GI8B 5T6DA 4KKDA 4BNRA 4BTTB 3LPRA 1IQJA 1WTGH 2WV5A 1A5GH 3F1SB 3SHAH 2W3KA 2FODA 1QURH 1IQHA 2V3OH 5HGGA 4I8JA 1T8MA 3P8OA 2PWXA 1V2KT 5A8YA 2JDID 4CRCA 2ZFRH 3RXTA 2XC0A 2OQUA 1OWEA 2HOBA 2ZCKP 1QA0A 3NUMA 1WOFA 4ZHMU 3A7ZA 4OS7A 3I78A 5A0AE 1CU1A 3SU2A 1C1SA 2QF0A 4AFQA 1K9OE 5GXPA 5ABWA 8LPRA 3VPKA 3O8BA 1AWFH 1A1RA 1B7XB 1O3MA 2C8XB 1N1LA 1PQ7A 2A1DB 5E0JA 6GCHF 2A4RA 3S9AA 1Z8GA 1GG6B 3MWIU 4IGDA 1TGBA 1EZQA 4NIXA 3SUDA 1C1NA 3URDA 1HIAA 3PTBA 4INHA 1P09A 3OY5U 1CSOE 1MU8B 1TA2A 2QAAA 1ZRBA 4IMQA 3TVJB 4Y76A 1SGPE 1W13U 1KLJH 1ZMLA 2Q1JA 2A7CA 3F9EA 2O9QA 1A0LA 2DE9A 5LPEA 4DG4A 1NFWA 2AGIX 1TX8A 1TMTH 2FX4A 3SW2B 2BD4A 2KCAA 1PPZA 3SGQE 1DUEA 3EYDA 3RU4T 2P16A 1HAOH 2LELA 1IQLA 4WXIA 2WSSD 2PSYA 3ZZ6A 1SC8U 3Q00A 1DLKB 1BHXF 3ZZ8A 4WMEA 2YMSB 5DP7A 3UREA 1W7XH 3LONA 3MO6A 4DGJA 1D3PB 2HNTC 1ELBA 4D7FA 2FZZA 1K1NA 5GIBA 3ZIAD 2ZWLH 1P0SH 2BY8X 1C5WB 4DIIH 1TBRH 5CHBA 4Y11E 2W5EA 2GD4B 1UTJA 3RMOH 3ZVDA 1P8VC 2TGPZ 1AFEH 1ETTH 4UE7H 1SVPA 1O2LA 3F9FA 1E36B 1BUIA 2FDAA 3IG6B 2GKVE 1KIGH 1A2CH 2WUCA 3LGTA 1Z1IA 1DWBH 2OD3B 1RTKA 4IC6A 1A46H 3ODDA 2GDEH 4AFUA 1GCDA 1NO9H 1XUHA 1P01A 2D2DA 4CBNA 1H8ED 3AAUA 3A7WA 1GJ8B 2BYAX 1ZTKA 5ESTE 3C27B 1CE5A 1UTMA 1PYTD 1AZ8A 1A5IA 2CV3A 4RKOB 2ANYA 1OP0A 4ABEA 4D8NA 5GCHF 2PGBB 2GVFA 4X8UH 1NBMD 2CHAC 1XXDA 1PPGE 1GBEA 3OSYA 4ESTE 2FO9A 1GMHG 4B6EA 5CHAC 1T8LA 2BY9X 3MMGA 2JETB 5EXMA 3MU8A 1HIAB 2OTVA 1VR1H 1LHFH 5C17A 3E3TA 5HKKD 2WPDD 3RMNH 1YP9A 1BBRE 1C5VA 3MU5A 4MG3A 3GS9A 1CA0B 4AFZA 1O2GH 3VG8A 4X1NU 4MPWA 3E8LA 1C5OH 1P05A 3A88A 2ZFTA 1HXFH 3VB4A 5FHTA 4FUBA 3M5NA 1IQKA 1TQ7B 4Y10E 5GJ4B 1E35B 4D76A 1EUFA 3PV4A 4CRAA 1O5FH 1B0FA 1GBHA 1IHTH 1GBAA 5F03A 3ZV9A 4ZHLU 3VB6A 2FOBA 2BB4A 3GCTG 2XRCA 1KLIH 9ESTA 4GHTA 2FEQH 2WINI 2D26C 1G32B 5DSFA 1GGDB 1TNKA 4KP0A 4CHAC 1SGFG 4K3JA 1O5CB 1MKXK 1MAXA 1HYLA 4FUDA 3SJ9A 1NS3A 1FMGA 1GWAA 1OWHA 1UCYE 2BY6X 3BTDE 5E0HA 2D1JA 1ARCA 2VIWA 2EA3A 3BG4C 1ZPBA 4F4OC 2J38A 1HLTH 2RA3A 1P06A 3SU3A 1Y5AT 1WSSH 4ZKOU 1Z1JA 3TIUA 2G00A 3MNCA 1F7ZA 2BDIA 3O8RA 1PPEE 4ABAA 2VIVA 2SGQE 1ACBE 1BRCE 3SNCA 3TJVA 4DCDA 1BMAA 3TJUA 1NESE 1O5BB 2PR3A 1W0JD 2XC4A 1DM4B 1L1NA 4ABGA 3TGKE 3OX7U 3A87A 4NA9H 4TPIZ 4E05H 2VIDA 2F9NA 1K1PA 3I29A 3MTYA 2QXHA 1TRMA 2BTCE 3ZZDA 1W12U 3RC4A 2FS8A 5B6OA 1QNJA 3H7OA 1WAYB 4FXGH 4GHQA 5HM9A 3F9HA 1C2DA 2BVRH 1W3CA 4JYUH 4XBBA 1RS0A 1UK4A 3LOXA 1XVOA 3UOPA 2J4IA 3WWFA 2BD5A 5K0HA 5LGOA 3R0FA 2UWLA 3RMLH 1G3EA 2PFEA 4GVUA 2F9BH 4X2YA 1GJCB 3M5OA 4Y79A 3DD2H 3MH4A 4U01A 3D23A 1EJAA 3HPTB 1S0QA 2H9EH 4CRFA 4HI3A 5CMXH 1V2UT 1MKWH 3SZEA 2Q6DA 2QXGA 3MYWA 4AZ2B 2QF5A 1GI1A 2UUFB 2FOCA 2VIPA 3OE7D 2ODYB 3EA7A 1U6QA 1YPHE 2JH0D 1JIRA 1S83A 2R3UA 4CBOA 2ZDKA 1AB9C 1A0HB 2Z6BD 1BJVA 1O2YA 3E90B 1ETSH 2F9OA 1HRTH 1DPOA 3CS7A 3RXPA 3FKSD 2BD7A 4INKA 4B2AA 1GL0E 3U8RH 1UO6A 5IDKA 3MFJA 3RU4D 4YZUA 2BDBA 2JH5D 3F0PA 3OY6U 8KME2 2C8YB 2FPZA 2ZDNA 1YPKH 1B0EA 1DVAH 3SJOA 1UTNA 1BMLA 1TLDA 4SGAE 2P3TB 2XWBI 3AK5A 3T2NA 1O3DA 2ZGCA 3UR6A 4D9QA 2OC7A 2YOLA 2A7HA 5TJXA 3VB3A 3STJA 1OWJA 1ZR0A 3NRLA 1BMNH 1OOKB 4O3UA 3KHVA 3RXRA 4NZLA 1Y5BT 4YT7H 1ANEA 4AFSA 3EAJA 1XKAC 2IOTA 4PROA 1P2QA 1G30B 4HTCH 1A5HA 1C5ZB 4K1SA 1QB9A 1UVSH 3D49H 4OS1A 1Y5UT 3SUFA 2PTCE 4YLUA 4O03A 3RXOA 1TGSZ 4MPUA 3LC5A 2ZFSA 2OINA 4XBDA 4HGCA 3PWCA 2GCHG 1AVWA 1NZQH 2R9PA 4IN2A 1V2PT 1EQ9A 1AB9B 4K8BA 2FM2A 1HCGA 2O8TA 2VH6A 4I7YH 1GI6A 3P92A 3HGPA 3V13A 2IJOB 3RXKA 2BD2A 3TLOA 4Z0KA 1EFRD 1G3CA 1K21H 1ZPCA 2WZQA 1INCA 2BDCA 1ZRKA 2PKSC 3NPSA 1CGIE 4I8LA 4Z6AH 1GHXH 5FPYA 2NU4E 2Z3EA 2Y81A 1HGTH 1OPHB 1J14A 3LGUA 1YPHC 1HUTH 3SU1A 1TGTA 1GI4A 4NGAH 3SUGA 1LO6A 2ZG0H 4UONA 1C2MA 1O36A 3B9FH 3U69H 1W8BH 1MCTA 1BTPA 2R0LA 5A2MH 2BDGA 1C1QA 2CF9H 2CGAA 1VCWA 3ATWA 4XE4A 4UEHH 3GDSA 3RP2A 1LVMA 1MTUA 3A8CA 3ATKA 4H6SB 1S81A 3U8TH 2BD8A 4BAMB 1WUNH 1H8DH 1VITG 1O2QA 1VJAU 1EAIA 3FP7E 4ISIH 3U8OH 4WWYA 2VINA 3UR9A 2Z3DA 1NBME 1BHXB 2GP9B 3GY6A 1MKWK 2IJD1 1HAZB 1MTWA 3L33A 1B5GH 4I8KA 1OWKA 4ZKNU 3DSOA 1RIWC 1KYNA 1H9HE 2OCVB 1ESAA 4ZKSU 1E37B 1WU1A 1ANBA 2ZHFH 1MTSA 1YBWA 4THNH 1T4VH 4GSOA 5JPMH 1O3IA 2WPKS 5FBIA 3N7OA 1FLEE 4OS5A 1Z8IB 1C5MD 4DIHH 4A1TA 1KMHB 2C8ZB 1DSTA 2ZGHA 3RDZA 1ZHRA 1LPGB 3PMJA 1K1MA 1O33A 3LH1A 1BBRK 5C0TA 2F9UA 5DP6A 2QV1A 4WJG2 2ZHWH 2TGDA 3M37A 1T4UH 1O2RA 4BAKB 1DWDH 3SV9A 1DDJA 2STAE 3M61U 3SO3A 1DLEA 2FYRA 4B2BA 4OGYA 4AX9H 1Y3VA 5E2OA 1GI3A 1QB1A 4X8TH 1HJ9A 1P3CA 4J1YA 2QE7D 1C4Y2 3BSQA 1TX6A 3CP7A 3OTPA 2A7JA 4YOGA 2OK5A 5L2ZH 4JYTA 1ZYOA 2P94A 2XNDD 1BA8B 3BF6H 2BLQA 3A8BA 1SLVB 3KQBA 3S9CA 5C20A 1RD3B 1E38B 3E91A 4U32A 5ETXA 1O2JA 1HB0B 3I77A 3PB1E 1MTVA 8GCHG 3TK5A 2VH0A 2DE8A 1TNGA 3F2FA 1S82A 3P95A 3SUEA 2A31A 3AW1A 2Z7FE 1SQAA 2SGFE 3FVFB 1A4WH 2A5AA 1AE5A 3A84A 5DO4H 1V2WT 4BTUB 1EAXA 1LVBA 2ZI2H 4WMFA 5I46H 2J5UA 1WCZA 5E2PA 1TBZH 4F49A 1NRRH 1E1QD 4GCHG 2HLCA 1F2SE 1EPTC 2Z9IA 3FP6E 2Q6GA 1O3BA 3P8GA 1HBTH 1GCTC 4NWKA 4NCYA 1CHGA 1NY22 1O5EH 3KIDU 1VCPA 2QXJA 1S6FA 1C4V2 3E0PB 1SGNE 2PSXA 3KQDA 2RCEA 1UVPA 3A89A 2Z9LA 1FPHH 1VGCC 4H42U 1ELAA 3CS0A 4O3TA 3IITA 4TWWA 2ODPA 2GGVB 5F6MA 1YGCH 1QFKH 2ZKSA 3GY3A 5DP4A 3H09A 2ESTE 1QQ4A 4YO9A 3TK9A 1HJAC 1C2LA 1D3TB 2CJIA 1P57B 5GCHG 4GUXA 1LCYA 3U1JB 3ELAH 1C9TA 1BDAA 2VWMA 5JDUB 2FOFA 1G3BA 2V7QD 2FI5E 3T25A 5EQSA 1DICA 1SLWB 2FLRH 2AEIH 1RTLA 2CMYA 5LPRA 4JZIA 2ZIQH 2L6OA 2ZDLA 2HLDD 2PKSB 4MNWA 2C90B 1BRBE 5JBTA 2CF8H 1C5UA 1ETRH 1NM6A 1THPB 2ZFQH 1GMHF 4ISHH 1D6WA 3MH6A 4TSFD 1FIWA 1DT2A 3V3MA 1WQVH 1ABIH 1MMJN 2BLOA 1H4WA 4A5TS 1AU8A 3FOAA 3QDZB 4ABBA 2CK3D 1JRTA 1SGIB 1BB0B 3MO3A 2H6MA 1Y3UA 3BEFB 4Y6DA 4Q63A 3S7KB 3H7TA 5EU8A 2XBWA 2B5TB 3O8CA 3K2UA 1QA7A 4CR5A 1GMCF 4RI0A 2J95A 1O2HA 2WV4A 3FANA 2Y6TA 2KCYA 2ZEBA 3DFJA 3SN8A 1PQAA 2BVSH 1LPZB 3LU9B 4DY7B 2Z9JA 5EODA 5I25A 2KFWA 3O8DA 1WBGB 2GZ9A 1LMWB 5L30H 4IS5A 5FX5A 1G36A 5DP9A 4I31A 3TNTA 1W7GH 3RMMH 2WPLS 3Q76A 2B9LA 1Y3YA 1BRAA 2AGEX 3QLPH 1WV7H 1ZJKA 1FXYA 3NXPA 3PLKA 3T29A 2HNTF 1AGJA 2BDHA 3QTVH 1O31A 3LGWA 3QN7A 3SGAE 2FOGA 2RDLA 1PPFE 2ZU5A 2G52A 1NTPA 4E06H 1RIWB 2ULLA 1O2XA 2NU3E 4K8YA 2BZAA 2BY5X 4I8GA 4GLYA 1O3KA