4K8BA

Crystal structure of hcv ns3/4a protease complexed with inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
177
structure length
177
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease
publication title Ligand bioactive conformation plays a critical role in the design of drugs that target the hepatitis C virus NS3 protease.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4k8bA01
3A7WA 3T26A 1VITF 1CGIE 3KN2A 1CVWH 1GBTA 2GZ8A 2KAIA 4OS7A 2EEKA 2G52A 4D8NA 2XBVA 2ZKSA 5A09A 1P2JA 2BXUH 4MQAA 1EAWA 1PPZA 4AX9H 4Z6AH 2YNAA 3BTHE 3M5LA 4OS5A 1GBLA 4MPXA 4E05H 5EW1H 4K2YA 3FANA 2TIOA 1SHHB 4DIIH 1C1OA 1HBTH 1DY9A 1OPHB 1O2VA 1VCPA 2F91A 4Z0KA 8GCHG 2VIOA 1NRRH 2FOCA 5DP4A 2FM2A 3RLWH 3RLYH 2IJD1 4IN2A 1O38A 2J34A 3RXQA 1GMCG 1KLIH 3R3GB 4UFFH 5EQRA 1C5SA 3RP2A 3GY7A 1V3XA 6GCHG 3FP8E 3UR6A 8ESTE 3Q76A 3TGKE 1XUIA 1AFEH 4CRBA 4O9VA 1OWKA 3SGAE 1ZMLA 1AUTC 1C2DA 3SUFA 2FOAA 3UQOA 2FTLE 3GISB 4X1PU 2UUJB 1MKWH 1O5AB 2F9BH 1HAOH 1Q3XA 1SOZA 2J94A 3RXDA 3OTPA 4QT8C 2EI7A 1MUEB 3U69H 1O2RA 3MYWA 1FY3A 1EXFA 2TGAA 3IG6B 1QURH 3RM2H 2R3YA 1VCWA 1GHZA 2BD8A 2P3FH 1TOCB 2FI3E 2NU4E 1XUGA 3ZYDA 1GJBB 3A8DA 2HNTC 2Z9IA 2PSYA 1UTLM 5L6NH 2VWLA 2F4LA 1O2YA 1NRPH 1L1JA 4AG1A 4UEHH 1YGCH 1P03A 1T8MA 2PW8H 3HGPA 3QK1A 3TJOA 5DGJA 1HJAC 4D9QA 2FTMA 3BEFB 3SN8A 5E2OA 3VEQB 3P70B 1D3TB 2AGGX 1C5UA 3TNTA 2D26C 3GDSA 2CN0H 3TPIZ 1ZR0A 2G5NA 3LGWA 1SFQB 2ZA5A 3ZV9A 1D3DB 1LO6A 5E0HA 1O2GH 3BTWE 2H5DA 2H1UA 1O39A 1YKTA 2BTCE 3UWIA 4D76A 2R2MB 4ISNA 1NFUA 3ATLA 3GOVB 1SOTA 1D3PB 1QB1A 1NFYA 1EJMA 1SLUB 3S7HB 1HPGA 1GI8B 1HXFH 4RKOB 1A4WH 1WQSA 1MKXH 4CRFA 1V2UT 3RXPA 1GBAA 1NFWA 3IWMA 4Y11E 3SW2B 1A0LA 5FHTA 1TNIA 5AHGH 1FAXA 1S83A 2FODA 1NZQH 1VGCC 2FOEA 1HAVA 1BTYA 1V2LT 1AVWA 6CHAB 1BZXE 1V2KT 2KAIB 4ISLA 1CU1A 1NRQH 4MPVA 4DIHH 2EC9H 3SJ8A 6LPRA 2P16A 5C1YA 1Z71A 2RDLA 1WQVH 2R0KA 2ZCKP 3RM0H 1TPSA 1MAYA 1GVLA 1HJAB 1Z6JH 4LK4A 5L2ZH 4CRDA 3K6YA 1NS3A 2H6MA 3SJKA 1T4UH 2I6SA 1PPHE 2R0LA 3OU0A 1H8IH 1GCDA 1FPHH 4MDSA 1THPB 4FUFA 4JZIA 2STBE 1XUHA 1CE5A 2OBOA 1F2SE 4B1TA 3RXFA 1BRBE 1BCUH 1ABJH 2FOGA 2BHGA 2XCFA 1PPEE 1DUAA 1O2XA 2SGEE 1V2ST 4TY7A 4ZKNU 5C20A 2ZIQH 2VNTA 1G3CA 1Y5AT 5C5NA 2J4IA 2XBXA 5DP7A 5E2PA 3SU4A 3LU9B 1GVKB 1YPKH 1N6XA 3C1KA 1Y3UA 2WV5A 1C2IA 4DY7B 1L0ZA 1TNJA 3RXJA 1ANEA 3PWBA 1EZXC 5JBBS 5BPEA 1BMNH 3H09A 2A7HA 2GDDA 2GVFA 3B23B 1S81A 1C2HA 3GY3A 3UQVA 3T25A 1NPMA 3UNRA 1BJUA 1C5WB 1XVMA 4HTCH 1TGBA 2Z9KA 4B2CA 2UUYA 1BUIA 1Z8JB 2Y5GA 4YZUA 1DM4B 1XKBC 2C8WB 4WF8A 3V13A 1DLKB 1V2PT 1AI8H 1SPJA 1LHFH 3EE0B 2FI5E 4GCHF 1QY6A 1XUJA 1HAZB 3Q77A 3EA9A 1K28D 2ZHDA 2XW9A 1W3CA 1GJAB 2DE9A 4BNRA 5T6DA 1LMWB 3MU1A 1CA0C 1GJ7B 2BLVA 4JYVH 3T27A 2ZU4A 4GAWA 1VJAU 3URDA 1AB9B 4FUJA 4ZKRU 2GGVB 3MU8A 2P94A 3ZZ9A 1P2KA 4DG4A 1XKAC 2ZU3A 3UNSA 2GP9B 4CBOA 4H6TA 3M3VA 2Y5FA 3KHVA 2O8MA 1C5PA 5IYTA 5TCCA 1TONA 1NROH 2AH4X 2ANMH 2BVRH 2FEQH 1MTUA 4JYUH 1HLTH 1UK4A 1P04A 2AFQB 1LPKB 4WXVA 4A1XA 1V2TT 5ABWA 1CSOE 2FOFA 1B0EA 1DSUA 7ESTE 2HNTE 1W7GH 4ZUHA 2HLCA 5EQSA 5DO4H 2GZ9A 3SZNA 1GBBA 1THSH 1V2QT 3LGTA 1D3QB 3MU0A 4X2WA 3TH3H 2ZQ2A 1D4PB 4Y71A 1ZRBA 3ZZ5A 1N1LA 4ESTE 1O30A 2A1DB 2BQ7B 1AD8H 3SGQE 1O35A 5G4BA 1IQNA 2FS9A 2GCHF 4CR9A 1HJ9A 8KME2 1DPOA 1BIOA 1GHAG 1TA6A 1Q31A 4ABAA 1F0SA 1EATA 2GV6A 1D6RA 4MNXA 3MO9A 2TBSA 1CA0B 4WXIA 1Y8TA 2BZAA 2QAAA 1HB0B 2ALPA 3B9FH 1C2KA 2BLQA 2UWOA 2ANWA 2ODPA 1OYQA 1V6DA 1T7CA 2O8TA 2ZO3H 1DVAH 4YOGA 1NESE 5GIBA 3TLOA 1L2EA 5FX5A 3N7OA 1GGDB 3ATKA 2YOLA 1XUKA 1LPZB 3PO1C 4O3UA 2D1JA 1L4DA 2VVVA 2VINA 2ALVA 2ZDNA 1NU7B 1QTFA 3SYJA 1Y5UT 3SV8A 1PQ5A 3NK8A 2P95A 4NIYA 3PV4A 5CHAC 4FVBA 1TBZH 2A5AA 3TGIE 2O8LA 2PV9B 4HZHA 1P9SA 2YNBA 2GX4A 5L30H 2AMQA 2G5VA 3ZVFA 2BD7A 1DICA 1W2KH 1TMTH 1GMDG 2WYGA 5EODA 1WYKA 5T1VA 1O5FH 5B6OA 1G3BA 3L6PA 1LVYA 1YPGH 3DHKH 3RC6A 1UCYK 5HGGA 1O2ZA 2PKAB 3S9BA 2ZI2H 4Q7YA 4GHQA 4INHA 4IMQA 3LJJA 1C1SA 1O34A 1O2NA 5TJXA 1C2FA 2ZF0H 1GHBF 3TK5A 3ATIA 1BRCE 3U1IB 3SU2A 3MFJA 1OXGA 4ABJA 1A3EH 4I31A 2WPLS 3MO3A 5A2MH 1Y5BT 1ESAA 3MU4A 1P12E 3SJOA 2VGCB 4GPGA 1TX8A 1QIXB 1A46H 1UCYE 4X8SH 1YF4A 2VH0A 3A89A 3ODFA 1C1NA 3PO1B 5DG6A 1BBRE 3DA9B 4BAQB 4YESB 2ASUB 1Y59T 3W95A 5HMAA 4AG2A 2D2DA 3RDZA 1MQ5A 4BXSA 1A1RA 5EOKA 3O8BA 1VJ9U 1HGTH 4Y8XA 5CHAB 4AN7A 3PMHB 4BANB 4B75A 1SGNE 3NWUA 2FO9A 3UNQA 1U6QA 4K5ZA 3S9CA 2BY9X 2NWNA 2VVCA 4OGXA 4THNH 1C4U2 4ZXXH 1EASA 1SG8B 1GMHG 1HAYB 1O3KA 3F9EA 2WPMS 4A5TS 4K8YA 2BYAX 4Y0ZE 1F5RA 3BG4C 3M37A 1GJ6A 3BIUH 4X1QU 1FMGA 1MKXK 1VR1H 1ZHRA 3MH7A 1VITH 3RXUA 1AVXA 3ZZAA 1KXEA 1W0ZU 4NFFA 3A7ZA 1F7ZA 1UMAH 2WUBA 1KLJH 3ESTA 2BY7X 2OBQA 1ETTH 3ZVGA 1O37A 5DJ7A 4MPWA 2W7SA 1MTVA 2VWNA 1SVPA 1SR5C 4E7RG 4AB9A 2WPJS 3F68H 1SGIB 4LZ4B 2XC5A 1P8VC 3D23A 5H4IB 3D49H 4D7GA 3W94A 4OS2A 3EAJA 1E36B 4X1SU 1O2KA 4X6OA 3Q00A 3RXCA 2CF9H 2OQUA 4I8GA 3FVFB 1ZYOA 3UOUA 1NRNH 2ZDAH 3KQDA 5I46H 3SNAA 1DWBH 1MZDA 1D9IA 1LHCH 2ZTYA 3ZZ4A 5FX6A 1ZHPA 2H9HA 4IS5A 5FBEA 1EUFA 3PROA 2GMTB 3FAOA 4ABGA 5T6FA 3OTJE 1EJNA 3SJ9A 1GBHA 4HFPB 4IC6A 4CBNA 1OOKB 3MI4A 4XBBA 1FAKH 4X0WU 2J2UA 5FPYA 2B5TB 2PGBB 1W8BH 1SGDE 3P17H 3BG4B 5B6LA 1QL8A 3BIVH 3V12A 5EXNA 2A45B 2D8WA 2PFEA 2ILNA 4LXBH 3LGUA 2H5CA 4RSPA 1KXBA 3GY5A 1ARCA 1QHRB 5GDSH 2RCEA 4Q2KA 1BITA 1K1IA 1SLXB 1WU1A 2OP9A 5J4QA 2QXIA 3A84A 2FWWA 2W5EA 5EPYA 3LKWA 1JXPA 3BN9A 4Y8ZA 2ANYA 2ZU1A 1RIWC 3ZVCA 1RTLA 1G3EA 2VVUA 5FCKA 2GKVE 2HPQH 1G37A 3VB5A 1LVMA 1LVBA 4D9RA 1TPPA 1E34B 5IDKA 2A31A 1K22H 3AAVA 1QRXA 1EJAA 2QGRA 4DOQA 2HWLB 1AU8A 3SJIA 1GBFA 4SGAE 3K6ZA 1GJ8B 1W0YH 1J15A 3VXFH 1C1TA 1QJ6B 7GCHF 1O3IA 1P2MA 4HI3A 2ZHWH 1O2OA 2FP7B 2OLGA 1TPOA 1W7XH 1DDJA 1XXFA 1P0SH 1GI0A 1H4WA 1CQQA 1KXAA 4H4FA 4DW2U 2Y80A 2DE8A 1KXCA 3NPSA 3PB1E 2BDIA 2BQ6B 2BX3A 3QX5H 4K60A 4YO9A 2QY0B 2CHAB 3A86A 1DWEH 3P8OA 2SNWA 2ZCLP 3EA7A 3PV2A 1UVTH 2VIPA 1GHWH 3A85A 5PTPA 1TMUH 1SQAA 1O31A 3FP7E 1ZHMA 1ZLRA 1TOMH 4YLUA 1ELEE 1L1GA 2FDAA 2G00A 2V6NA 5F8XA 3TGJE 2SFAA 4Y8YA 4ZKOU 1ARBA 1TX6A 4X2VA 1C4V2 1RIWB 2P3UB 1ID5H 1O3JA 2F83A 2R3UA 4ZKSU 4FUGA 4AOQA 4IBLH 3A8AA 1OSSA 5DKMA 1IQJA 1FIZA 2ZFTA 3AASA 1H9HE 1IQEA 1P06A 3LH3A 4X2XA 2QIQA 4KTUA 4X8UH 1P10A 2Z6BD 4Q80A 1CHOF 1V2OT 2VIWA 3K9XB 3MNSA 3MHWU 1A5IA 3D65E 3P8NA 3A83A 4FXGH 4IN1A 4ABDA 3LGVA 3SHCH 2AERH 4NA8A 4AFUA 4NWLA 1SGTA 2HALA 2TRMA 1SQOA 1O2WA 4JYTA 1P9UA 4YM9A 1TE0A 1DWDH 2ZHFH 2BQWB 1UCYH 5EXMA 1EKBB 4ZHLU 1DY8A 1ZPCA 1P05A 1ABIH 1EB1H 2PKSC 1AN1E 3AK5A 1HFDA 3GCTF 1GBEA 3K2UA 3RXKA 1DE7H 1ZSKA 1GDUA 4UD9H 1HJ8A 4GVUA 2A7JA 1AKSA 2HNTF 1TRNA 3F9FA 1C1WH 3UY9A 2ESTE 6CHAC 2B9LA 2C4FH 3TIUA 2QYIA 1NTPA 3B8JA 3VFEA 2BZ6H 3ITIA 1TFXA 1F0UA 1P2NA 4BAMB 4CRGA 1TGTA 3NKKA 4NFEA 1YP9A 1JMOH 2ZECA 2UUFB 3ZZ6A 5CMXH 2FX4A 4K8BA 3U8OH 3U98H 1HAPH 1O2QA 2PUXB 3M35A 1E38B 2C93B 4WMEA 1SHYA 3AW1A 4BTUB 4X6MA 1F0RA 1JOUB 1KDQB 1TA2A 1Z7KA 3TVJB 3FP6E 1XXDA 1QQUA 2PR3A 1XX9A 4UFEH 2VBCA 4XDEA 5I25A 3ZVEA 1JRTA 2QC2A 2BDHA 1K1PA 5A8ZA 1UHBB 2VJ1A 3KQBA 1LKAA 3V7TA 1W13U 3PLBA 1PPBH 1VITG 3UOPA 1SGFG 1SI5H 1WBGB 5HM9A 1ELVA 1QBVH 1C5OH 1AY6H 2A4GA 3IITA 1IQGA 9ESTA 3KIDU 1B7XB 2BXTH 2FYQA 1AUJA 1F0TA 1O5EH 4M7GA 5LH8A 1GJ9B 3A7YA 5GNDA 2PKSB 4I33A 3SOSA 1GBMA 1UVOA 1AWFH 3SHAH 1SLVB 3TK9A 1GBIA 1TALA 1ZTJA 4AYYB 3M3TA 2VU8E 1O32A 3SU6A 3SGBE 3QO6A 4JZ1A 1BHXB 5T6GA 3GCHC 1FY1A 4BAHB 1VZQH 2J38A 1RS0A 1EAIA 1ZRKA 3RXOA 1BTZA 1O2TA 1EZSC 2IN2A 3ZZ3A 5BRRE 1HAGE 2ZHQH 5FXLA 1GHXH 4ZHAA 3A7TA 3OY6U 1BA8B 4XFQA 3M61U 2A4QA 1YPHC 1GI5A 1C2EA 1O2SA 1TB6H 2ZU5A 4R0IA 2A4OA 1DS2E 2XTTB 2GTBA 1AB9C 1P11E 2HPPH 1YC0A 4UFGH 3GY8A 1KSNA 2PGQB 1EOLA 3VB7A 2W3KA 3KNXA 2PLXA 2ZGJA 3HGNA 2SGPE 2J9NA 3K65B 1RJXB 1O3OA 3GY6A 3URCA 1MD8A 4XSKU 3ZYEA 1MZAA 3RXVA 1OP0A 4ZAEA 1JBUH 3P8FA 2GDEH 3M7UA 1NO9H 3MNCA 1GJ4H 1EOJA 3RXMA 1JWTA 3KF2A 1W14U 1M9UA 1JIRA 1UK3A 3NCLA 3GCHB 2FPZA 3OX7U 1MCTA 2PKAA 3DFJA 1TRMA 1BTXA 1AKSB 3TITA 1ZZZA 1MH0A 2M5TA 4AGKA 3BSQA 3E6PH 4CHAC 1ORFA 2F9VA 4HGCA 1GI7B 2WPIS 1DITH 4MNVA 2PUQH 4FUBA 5ETXA 1YPJH 2FS8A 3LDXH 4U2WA 1QBOA 4TY6A 2Z3CA 3E91A 2H2ZA 3BTGE 1SGEE 2JH5D 3GICB 5F03A 3SNCA 3RXRA 1PJPA 3A87A 3I78A 1P3CA 1SB1H 3QN7A 1MQ6A 5ESTE 1RGQA 3SNDA 3AAUA 1FY8E 1N6YA 2AS9A 2J92A 2XCNA 5L2YH 1HXEH 4TWYA 2ZEBA 5K0HA 3SU0A 1GGDC 1C5YB 3FFGA 5F6MA 1ZJKA 1XUFA 1YLDA 1LQEA 1LVOA 1AO5A 1OYTH 1G36A 1LHDH 4O3TA 1J14A 3RXTA 3PMBB 3BTQE 1THRH 3QZQA 3RUOA 4NWKA 3LOXA 1Z8RA 4K1TA 1GI1A 3QGJA 2BD2A 3FZZA 3I77A 1DXWA 3Q3YA 4CHAB 4K69A 1O3NA 3JZ1B 4FUIA 1FZZA 2Z9LA 1YBWA 1HCGA 1O3BA 1YM0A 4UE7H 2JETC 1TWXB 1WCZA 1C5MD 4JK5A 3RXAA 1FJSA 5K7RA 1C1RA 4BOHA 1ZTLA 4RI0A 1O3AA 3C27B 2FYRA 3MH6A 3GYMA 5GCHF 3A7VA 2VH6A 4BAKB 1EX3A 4JCNA 2BLWA 5EW2H 4AORA 4MVNA 3MNBA 1O33A 1O3FA 4F49A 3D62A 1P09A 1TLDA 3M3SA 2A2QH 2LNCA 2VGCC 4Q7XA 1GCTB 1QL9A 2RG3A 1DXPA 1BRAA 1K1MA 4MPUA 4OS4A 1H1BA 4E06H 3NZIA 1O3GA 1A0HB 1B0FA 3KQEA 4DT7B 1Y3XA 1MBQA 2GCTB 3E8LA 4MLFB 1SQTA 2ZTXA 1K21H 4UDWH 3KCGH 2VIVA 2V35A 3VGCC 4I8KA 1TRYA 4NIWA 2P3TB 1S85A 3TJVA 1SBWA 4I8JA 1QRWA 2A7CA 2AGIX 4IC5A 1GHVH 1TX7A 1XMNB 3HATH 1K1LA 4GCHG 4YTAA 2Z94A 3TU7H 4FVDA 1WUNH 4XBCA 1LQDB 1A3BH 2BDGA 3QTVH 5DP5A 1O3CA 1OP2A 3S9AA 4SGBE 4A92A 4OS6A 4R8TB 1SGYE 3RMMH 4ABHA 2F3CE 2JETB 2VIDA 1BBRK 1OS8A 1BTWA 1ZSJA 3KL6A 1YPHE 1NRSH 2C8YB 1A5GH 2NU1E 2FLRH 2CJIA 2VB0A 2HOBA 1O2IA 3ZZBA 3VB3A 1IHTH 3E0PB 5FPTA 1O2LA 1QCPA 2WINI 1RFNA 1ANBA 1TBQH 4BXWA 1T8LA 5C3NA 3GDUA 2R9PA 3OY5U 1UTMA 1UVPA 3BG8A 2P59A 1CHGA 1PFXC 4LZ1H 5A0BA 1WAYB 1A2CH 4M9FA 3RXHA 1FONA 3A8CA 4ISIH 1KXFA 1KLTA 3HPTB 3PMJA 3VGCB 2A0QB 3S0NA 3ENSB 1ANCA 5JYIA 3H7OA 3F9GA 1O5GH 3UIRA 2H9EH 1IQIA 2C90B 1SGRE 2BY6X 1SC8U 2AGEX 3E16B 1F92A 3QGNB 4UONA 2GMTC 3PLKA 5GJ4B 1J17T 1NM6A 2WYJA 5EPNA 5DP8A 2GCHG 1Z1IA 4AFQA 1C2MA 2O9QA 3SU5A 2A5IA 1ACBE 3MTYA 1J8AA 2CF8H 1O2JA 1BTHH 2Q6FA 2UWLA 2B7DH 1O2UA 1O3MA 1IQKA 3LGYA 1EPTB 3A8BA 2BDYA 1UVSH 4NGAH 1GJ5H 3R0FA 2W3IA 4A1VA 3OSYA 1O2MA 2XC4A 2R2WU 2FOHA 1GG6C 1GVZA 4ASHA 2CMYA 1J16A 4FU9A 1O3PB 3F1SB 5DP9A 4DJZB 3P95A 2ZU2A 1W12U 1P2OA 2VWMA 1QB6A 4OS1A 5JBTA 1KTTB 1JRSA 1OP8A 1SMFE 2F9OA 3A82A 3RC5A 3ZVAA 3SBKA 1GJDB 3F6UH 4KTSA 1K9OE 4B2BA 2FESH 3HKIB 3U8RH 5AVDA 2ZGCA 3S7KB 2C3SA 2BDAA 2AEIH 1UTOA 1K1NA 3BEIB 1CT0E 1DWCH 1MMJN 1FPCH 3F9HA 3I29A 4WH6A 5JB8S 3UUZA 1QNJA 2SGAA 3MWIU 4AB8A 2Y7ZA 5JPMH 2ZFSA 1O36A 3MH4A 1BB0B 3A80A 2ZDVH 1YCPM 2AMDA 1YCPH 5GWZA 2H9TH 8GCHF 4U32A 5DP6A 3UPEA 1GHBG 1AFQB 1NT1A 2A32A 2SGFE 2CHAC 3VB4A 1PPCE 4X2YA 4YT6H 1GMCF 2UWPA 1A5HA 2G4TA 1DSTA 4DURA 1AE8H 4X6NA 4X8TH 2HGTH 4INLA 1WXRA 3GDVA 1PYTC 1IOEA 2ZGBH 6GCHF 4ABIA 1AGJA 2EI6A 1SGFA 4Y76A 4JK6A 1GG6B 4DCDA 1AHTH 1Z6EA 5FBIA 4B6EA 3EDXB 4YOJA 2BDBA 3PTBA 4I7YH 1KY9A 1DANH 2RA0A 1GBKA 3PM3A 4TPIZ 2V0BA 1KDQA 1K2I1 1WTHD 3LIWA 1GBDA 1C1PA 1G2MA 4ABFA 1DLEA 1ELBA 1RRKA 1GI4A 4U30A 4BTTB 3M7TA 1G9IE 4BTIB 3H5CB 1UHBA 4NSVA 1W11U 1NN6A 5LPEA 1BMMH 4LOYH 2ZZUH 7KMEH 5FPSA 4ZMAH 3SUDA 4AGJA 1RTKA 3ATWA 3KGPA 2F9NA 2ZCHP 3U1JB 1TNLA 1Z8GA 4ISOA 3CENA 1MBMA 1X7AC 2JH0D 1B5GH 3P92A 2PHBA 3RXBA 4AFZA 4A6LA 2A4RA 1MU6B 1Y3WA 4TPYA 1FLEE 2V3HH 3KEEA 1ZMNA 1QR3E 1MTWA 2OUAA 4XBDA 4ZROA 3ELAH 4I8LA 1O3HA 1O3EA 1XVOA 1S0QA 2RA3A 3SNEA 1AZ8A 1F5LA 1E37B 1O2HA 3BV9B 2ZP0H 1F5KU 4NIVA 4O97A 4K3JA 2B8OH 1C5VA 3UTUH 5A0CA 2GD4B 2PWXA 4YT7H 3QDZB 2JH6D 3SI4H 3ZZ8A 4NSYA 1T4VH 1T8NA 3RMOH 5JBAS 1SFIA 2TGDA 2OTVA 2OC0A 1NY22 1UTKA 4ZXYH 3HK3B 2QXJA 2ZDLA 4TYDA 1SLWB 1C1QA 1S6FA 2TPIZ 3E3TA 4B71A 2SNVA 3RXSA 3V3MA 1C9PA 1LPGB 1MTNB 4JZFH 2WV9A 1MTSA 1QA0A 3ZVBA 2WPKS 3SORA 5A8YA 1C5LH 3P6ZB 1EP6A 4NZLA 5HM2A 2XYAA 2OK5A 4AFSA 2BD4A 2ODQA 3UREA 2SGDE 3MO6A 3V0XA 4K1EA 2ZFRH 4CH2B 4YLQH 1C1VH 4I32A 3WY8A 2Y5HA 1Y3YA 4WY3A 4Y0YE 1CBWC 2ZGXH 3DUXH 3MU5A 4MNYA 1UTNA 4VGCC 4FUHA 2FOMB 1DT2A 2I6QA 2FXRA 3SO3A 1GWAA 3SNBA 1BBRH 1SSXA 2QA9E 4WMFA 2ANKH 1EZQA 1G3DA 1ESTA 4JZDH 1UK2A 5T3HA 1QJ1B 1GHYH 4WWYA 3LONA 2ZFFH 4WJG2 3GCOA 1C9TA 3LT3A 3GY2A 1BHXF 1UTPA 2QF0A 2WZQA 2GT8A 1ELTA 2A5KA 1C5TA 1C1UH 4Y7AA 5EQQA 5EXLA 4A1TA 2W26A 4E7NA 2QXGA 1NC6A 5LPRA 1BDAA 4GSOA 1MU8B 3DFLA 3T28A 1LDTT 4NA9H 3M5OA 1ETSH 7GCHG 1PPGE 2XRCA 4YOIA 2THFB 1ZGVA 1HYLA 3PTNA 4K1SA 4NA7A 3PLPA 5DK1A 3P8GA 1INCA 4NG9H 4JMYA 1CGJE 4CREA 3TNSA 3QWCH 1IQMA 1G32B 2XWBI 2OQ5A 2K1QA 2LPRA 5E0JA 5LPFA 4Y10E 4FUDA 3E90B 3Q3XA 2B0FA 3NUMA 1CBWB 2XC0A 5C67A 4VGCB 2WUCA 1QBNA 4CRAA 1FI8A 3BTDE 1GDNA 5HXFA 2GZ7A 5F8ZA 1WOFA 2IPHA 4FUCA 3SV9A 1DX5M 1NU9A 1YYY1 1ELCA 1D6WA 3A81A 2Y6TA 2ZPQA 3PMAB 3QTOH 1V2RT 1Y3VA 1CHOG 1H8DH 1S84A 1RD3B 3UFAA 3BTFE 1EAUA 2IJOB 4ABEA 1DOJA 3OYPA 2QCYA 4AZ2B 3CS0A 1UTJA 1FV9A 3RU4T 4O03A 2ZFQH 1PQAA 1EB2A 4BAOB 2P8OC 1N8OC 2BMGB 1S0RA 1TQ0B 1UTQA 3LH1A 3E0NB 4XOJA 3DT0H 3GCTG 1FXYA 5HYOA 4MTBA 5EGMA 1O5CB 2BB4A 1S82A 1GI6A 5CE1A 1BTUA 3A7XA 1O2PA 2BLOA 1QGFA 5DPAA 1QB9A 3RU4E 4Q7ZA 4PROA 4IW4E 1OWHA 1P01A 3RMLH 1GHAF 2FLBH 2F9PA 1ZPBA 4RN6A 1ANDA 3SU3A 2V3OH 1PPFE 2OINA 1K1JA 2O8UA 1RTFB 3BEUA 2ZDMA 3STIA 1E0FD 1WV7H 1CT4E 4NIXA 4ISHH 3CS7A 3ZV8A 1ZPZA 1TNKA 2BD9A 1O5DH 2BVXH 2AIPA 1YCPK 3RXGA 3RXIA 1FN8A 3TK6A 5C2ZA 2BY5X 1VGCB 4X8VH 1JIMA 1HAXB 5JB9S 4FU8A 1SL3A 3ATMA 4A7IB 2G51A 1ELDE 2OC8A 5C5OA 1V2MT 1P02A 1SGCA 3NXPA 8LPRA 1GL0E 1CT2E 4Y6DA 1IQFA 3SU1A 3QZRA 1S5SA 1BMLA 1C5NH 1O0DH 3M5NA 1O5BB 1GPZA 2ZPSA 3H7TA 2P8OB 1N8OB 1TGSZ 1H9IE 5FAHA 2ZDKA 1V2VT 2FI4E 1GMDF 3STJA 1C5QA 1TMBH 4TWWA 1GCTC 3E1XB 3T2NA 3T62A 2PTCE 3DD2H 1ZSLA 2TGTA 3PV5A 2ULLA 4KKDA 1HAHH 1AMHA 2BM2A 1AQ7A 2GCTC 1LKBA 1HIAA 4CRCA 1AIXH 4NZQA 2CGAA 3MOCA 1T31A 3SI3H 2G4UA 4FUEA 2P93A 4WH8A 1DFPA 2DUCA 1LTOA 5GXPA 2G55A 2ZHEH 1BOQA 3SQHE 4ABBA 1PQ7A 2Y81A 1FUJA 1CA8B 3BTTE 5SGAE 2BOHB 3UWJH 1J9CH 1A7SA 1FQ3A 3MMGA 2NU2E 3ZZCA 5TCAA 2ODYB 1EPTA 2NU0E 4KTCA 3S69A 3M36A 1HDTH 4D7FA 2ZC9H 1LHEH 4B2AA 4INKA 2ZGHA 3SZEA 1FDPA 5E8EH 4H42U 4H6SB 5EG4A 2G81E 2BD5A 1UO6A 1BT7A 1KTSB 1HAVB 1KXDA 1FNIA 1AZZA 3G01A 2Q6GA 1V2NT 1BMAA 4IMZA 5FCRA 1E35B 1GMHF 3U8TH 2WHXA 2CXVA 1KYNA 3AW0A 1GI2A 2FZZA 2AIQA 2C8XB 3ZVDA 2OD3B 1A61H 2GT7A 2XNIA 2Y7XA 3ZZ7A 1HRTH 2HVXA 2GV7A 2UUKB 1W10U 2TGPZ 3LJOA 2O8WA 4JZEH 1C2JA 3BTKE 5J4SA 3PYHA 2XBWA 3UR9A 1TABE 4J1YA 1SGQE 3TJUA 4GUXA 1EQ9A 1FIWA 3LC5A 2Z3DA 1OWJA 3Q3KA 1P3EA 1DUEA 3RC4A 1TIOA 4AYVB 3O8DA 4MG3A 2ZPRA 3BF6H 1VCQA 1AWHB 5A8XA 2G8TA 2ZWLH 5JDUB 3QUMP 1OWDA 1GI3A 1EPTC 1HAIH 4GLYA 3SQEE 4CR5A 2BD3A 1OWEA 4Y7BA 3BTME 1GL1A 2FMJA 1TQ7B 1MKWK 4I8HA 4KP0A 1V2WT 4DVAU 1L1NA 1S6HA 3MH5A 1YLCA 1LHGH 1BQYA 1TYNA 4ZH8A 1RXPA 3HK6B 2Z3EA 1FY4A 1IHSH 2J95A 1GBCA 3LPRA 2PSXA 1YPLH 1WTGH 1IQHA 2Y82A 1A0JA 1ZMJA 4Y79A 2BVSH 1HIAB 1MCVA 1C4Y2 2AYWA 1QQ4A 3SUEA 2WPHS 2NU3E 1C5RA 1G2LA 1CO7E 2SGQE 3RXLA 1HUTH 1SGPE 2QF3A 5C1UA 1AE5A 2IOTA 1WSSH 5GCHG 2C8ZB 1AFQC 1EP5A 1YPMH 4RKJB 2Q1JA 2FX6A 3LC3A 3SV7A 1FN6A 2Z9JA 4B73A 3SV2H 1P2IA 1KIGH 1TNGA 2OXSA 1K1OA 2QN5T 4FU7A 1MD7A 4UFDH 2EI8A 4B76A 1L4ZA 3AVZA 2Z9GA 3O8RA 2ZG0H 2XWAA 1Q2WA 1YPEH 4WMDA 5AFYH 3QLPH 5ESBA 1TPAE 3T5FH 7LPRA 1V2JT 2AMPA 2BX4A 2ZNKH 3ODDA 4OM9A 1EAXA 1GI9B 5GPIB 1T32A 1TNHA 1TGNA 2BY8X 1ZOMA 1TBRH 1NFXA 3M5MA 1C2GA 3GCNA 9LPRA 3TH2H 1Z1JA 1C5XB 1Z8IB 1FY5A 1EZUC 1IQLA 5JBCS 1ELAA 1AVGH 1P2QA 3CP7A 1C1MA 3GYLB 3HKJB 2ZQ1A 4WVPE 1PYTD 1ZGIA 4GHTA 1QRZA 2WV4A 3VXEH 5E0GA 1TGCA 1IAUA 2BDCA 3EGKH 1C5ZB 4MNWA 4U01A 1HV7A 5DP3A 2STAE 3ZZDA 5EU8A 3PWCA 3O8CA 6ESTA 1MAXA 2QXHA 2BOKA 3LGIA 2ZTZA 3SUGA 3VB6A 5F8TA 2VWOA 2EA3A 1ZTKA 5AFZH 2OC7A 1UVUH 2PTNA 1T8OA 1P57B 1H9LB 3RMNH 3SV6A 1ELFA 5A0AE 2Q6DA 5C1XA 3L33A 1BTPA 4KGAA 2OCVB 2VIQA 4IGDA 3U9AH 1GDQA 3MNXA 1O3LA 2CV3A 2F9UA 3M7QA 2FIRH 4J2YB 4B6FA 5AF9H 1OWIA 1QA7A 3KQCA 1LCYA 1PQ8A 2A2XH 1TAWA 3TJNA 1MTNC 4X1RU 1ETRH 1QL7A 1O3DA 3RU4D 4B74A 2W7UA 4X1NU 3EQ0H 5LGOA 2JKHA 4KELA 2OC1A 2FOBA 3BTEE 1GJCB 4ZHMU 1ELGA 2XXLA 1GBJA 3T29A 1BRUP 4XE4A 3RXEA 1QFKH 4DGJA 3EYDA 3L3TA 1CGHA 1OX1A 1QJ7B 1ZJDA 1G30B 2XBYA 4NCYA 2ZFPH 2QV1A 2HRVA 1BJVA 3TH4H 1HNEE 3VPKA 1C2LA 3EA8A 4F4OC 3JZ2B 4CH8B 4OGYA 1UJ1A 2Z7FE 1OKXA 1ESBA 1XM1A 3A88A 4X6PA 3FZDA 3GY4A
chains in the Genus database with same CATH superfamily
3A7WA 3T26A 1VITF 1CGIE 3KN2A 1CVWH 1GBTA 2GZ8A 2KAIA 4OS7A 2EEKA 2G52A 4D8NA 2XBVA 2ZKSA 5A09A 1P2JA 2BXUH 4MQAA 1EAWA 1PPZA 4AX9H 4Z6AH 1S6LA 2YNAA 3BTHE 3M5LA 4OS5A 1GBLA 4MPXA 4E05H 5EW1H 4K2YA 3FANA 2TIOA 3UB0A 1SHHB 4DIIH 1C1OA 1HBTH 1DY9A 1OPHB 1O2VA 1VCPA 2F91A 4Z0KA 8GCHG 2VIOA 1NRRH 2FOCA 5DP4A 2FM2A 3RLWH 3RLYH 2IJD1 4IN2A 1O38A 2J34A 3RXQA 1GMCG 1KLIH 1H8HD 3R3GB 4UFFH 5EQRA 1C5SA 3RP2A 3GY7A 1V3XA 6GCHG 3FP8E 3UR6A 8ESTE 3Q76A 3TGKE 1XUIA 1AFEH 4CRBA 4O9VA 1OWKA 3SGAE 3WWBA 1ZMLA 1AUTC 1C2DA 3SUFA 2FOAA 3UQOA 2FTLE 3GISB 4X1PU 2UUJB 1MKWH 1O5AB 2F9BH 1HAOH 1Q3XA 1SOZA 2J94A 3OTPA 3RXDA 4QT8C 2EI7A 1MUEB 3U69H 1O2RA 3MYWA 1FY3A 1EXFA 2TGAA 3IG6B 1QURH 3RM2H 2R3YA 1VCWA 1GHZA 2BD8A 2P3FH 1TOCB 2FI3E 2NU4E 1XUGA 3ZYDA 4RT1A 1GJBB 3A8DA 2HNTC 3CNRA 2XOKD 2Z9IA 2PSYA 1UTLM 2F4LA 2VWLA 5L6NH 1O2YA 1NRPH 1L1JA 4AG1A 4UEHH 2QF5A 1YGCH 1P03A 1T8MA 2PW8H 3HGPA 3QK1A 3TJOA 5DGJA 1HJAC 4D9QA 2FTMA 3BEFB 3SN8A 5E2OA 3VEQB 3P70B 1D3TB 2AGGX 1C5UA 3TNTA 2J5UA 2D26C 3GDSA 2CN0H 1E1RD 3TPIZ 1ZR0A 2G5NA 3LGWA 1SFQB 2ZA5A 3ZV9A 1D3DB 1LO6A 5E0HA 1O2GH 3BTWE 2H5DA 2H1UA 1O39A 1YKTA 2BTCE 3UWIA 4D76A 2R2MB 4ISNA 1NFUA 3ATLA 3GOVB 1SOTA 1D3PB 1QB1A 1NFYA 1EJMA 1SLUB 5IK2D 2CK3D 3S7HB 1HPGA 1GI8B 1HXFH 4RKOB 1A4WH 3DSGA 1WQSA 1MKXH 4CRFA 1V2UT 3RXPA 1GBAA 1NFWA 3IWMA 4Y11E 3SW2B 1A0LA 5FHTA 1TNIA 5AHGH 1FAXA 1S83A 1H8ED 1NZQH 2FODA 1VGCC 2FOEA 1HAVA 1BTYA 1V2LT 1AVWA 6CHAB 1FX0B 2JDID 1BZXE 1V2KT 2KAIB 1BMFD 4ISLA 1CU1A 1NRQH 4MPVA 4DIHH 2EC9H 3SJ8A 6LPRA 2P16A 5C1YA 1Z71A 2RDLA 1WQVH 2R0KA 2ZCKP 3RM0H 1TPSA 1MAYA 1GVLA 1HJAB 1Z6JH 4LK4A 5L2ZH 4CRDA 3K6YA 1NS3A 2H6MA 3SJKA 1T4UH 2I6SA 1PPHE 2R0LA 4Z1MD 4ACBA 3OU0A 1H8IH 1GCDA 1FPHH 4MDSA 1THPB 4FUFA 4JZIA 2STBE 1XUHA 1CE5A 3FO8D 1COWD 2OBOA 1F2SE 1YY3A 4B1TA 3RXFA 1BRBE 1BCUH 1ABJH 2FOGA 2BHGA 2XCFA 1PPEE 1DUAA 1O2XA 2SGEE 1V2ST 4TY7A 4ZKNU 5C20A 2ZIQH 2VNTA 1G3CA 1Y5AT 5C5NA 2J4IA 2XBXA 5DP7A 5E2PA 3SU4A 5DN6D 3LU9B 1GVKB 1YPKH 1N6XA 3C1KA 1Y3UA 2WV5A 1C2IA 4DY7B 1L0ZA 1TNJA 3RXJA 1ANEA 3PWBA 2RFKC 1EZXC 5JBBS 5BPEA 1BMNH 3H09A 2A7HA 2GDDA 2GVFA 3B23B 1S81A 1C2HA 3GY3A 3UQVA 3T25A 1NPMA 3UNRA 1BJUA 1C5WB 1W0KD 1XVMA 4HTCH 3KYGA 1TGBA 2Z9KA 3MQKC 4B2CA 2UUYA 1BUIA 1Z8JB 2Y5GA 1W0JD 4YZUA 1DM4B 1XKBC 2C8WB 4WF8A 3V13A 4YXWD 1DLKB 1V2PT 1AI8H 1SPJA 1LHFH 3EE0B 2FI5E 4GCHF 1QY6A 2YMSD 1XUJA 1HAZB 3Q77A 3EA9A 1K28D 5CDFE 2ZHDA 2XW9A 1W3CA 1GJAB 2DE9A 2M2AA 4BNRA 5T6DA 1LMWB 4F55A 3MU1A 1CA0C 1GJ7B 2BLVA 4JYVH 3T27A 3F2HA 2ZU4A 4GAWA 1VJAU 3URDA 1AB9B 4FUJA 4ZKRU 2GGVB 3MU8A 2P94A 2YMSC 3ZZ9A 1P2KA 4DG4A 1XKAC 2ZU3A 5HIYA 2GP9B 3UNSA 4H6TA 3M3VA 4CBOA 2Y5FA 3KHVA 2O8MA 1C5PA 5IYTA 5TCCA 1TONA 1NROH 2AH4X 2ANMH 2BVRH 2FEQH 1MTUA 4JYUH 1HLTH 1UK4A 1P04A 2AFQB 1LPKB 4WXVA 4A1XA 1V2TT 5ABWA 1CSOE 2FOFA 1B0EA 1DSUA 7ESTE 2HNTE 1W7GH 4ZUHA 2HLCA 5EQSA 2HVYB 5DO4H 2GZ9A 3W1EA 3SZNA 1GBBA 1THSH 1V2QT 3LGTA 1D3QB 3MU0A 4DT4A 3OEED 4X2WA 1UW7A 3TH3H 2ZQ2A 1D4PB 4XRNA 4Y71A 1ZRBA 3ZZ5A 1N1LA 4ESTE 1O30A 2A1DB 2BQ7B 1AD8H 3SGQE 1O35A 5G4BA 1IQNA 2FS9A 2GCHF 4CR9A 1HJ9A 8KME2 1DPOA 1BIOA 1GHAG 1TA6A 1Q31A 4ABAA 1F0SA 1EATA 2GV6A 1D6RA 4MNXA 3MO9A 2TBSA 1CA0B 4WXIA 1Y8TA 2BZAA 2QAAA 1HB0B 2ALPA 3B9FH 1C2KA 2BLQA 2UWOA 2ANWA 2ODPA 1OYQA 1V6DA 1T7CA 2O8TA 2ZO3H 1DVAH 4YOGA 1NESE 5GIBA 3TLOA 1L2EA 5FX5A 3N7OA 3F0OA 1YLNA 1GGDB 3ATKA 2YOLA 1XUKA 1LPZB 3PO1C 4O3UA 2D1JA 1L4DA 2VVVA 2VINA 2ALVA 2ZDNA 1NU7B 1QTFA 3SYJA 1Y5UT 3SV8A 2EQNA 1PQ5A 3PRBA 3NK8A 2P95A 4NIYA 3PV4A 5CHAC 4FVBA 1TBZH 2A5AA 3TGIE 2O8LA 3EE7A 2PV9B 4HZHA 1P9SA 2YNBA 2GX4A 5L30H 2AMQA 2G5VA 3ZVFA 2BD7A 1DICA 1W2KH 1TMTH 1GMDG 2WYGA 5EODA 1WYKA 5T1VA 1O5FH 5B6OA 1G3BA 3L6PA 1LVYA 1YPGH 3DHKH 3RC6A 1UCYK 5HGGA 1O2ZA 2PKAB 3S9BA 2ZI2H 4Q7YA 4GHQA 4INHA 4IMQA 3LJJA 1C1SA 1O34A 1O2NA 5TJXA 5C0UA 1C2FA 2ZF0H 1GHBF 3TK5A 3ATIA 1BRCE 3U1IB 3SU2A 3MFJA 1OXGA 4ABJA 1A3EH 4I31A 2WPLS 3MO3A 5A2MH 1Y5BT 1ESAA 3MU4A 1P12E 3SJOA 2VGCB 4GPGA 1TX8A 1QIXB 1A46H 1UCYE 4X8SH 1YF4A 2VH0A 3A89A 3ODFA 1C1NA 3PO1B 5DG6A 1BBRE 3DA9B 1VKYA 4BAQB 4YESB 2ASUB 1Y59T 2J98A 3DSOA 3W95A 5HMAA 4AG2A 2D2DA 3RDZA 1MQ5A 4BXSA 1A1RA 5EOKA 3O8BA 1VJ9U 1HGTH 4Y8XA 5CHAB 4AN7A 3PMHB 4BANB 4B75A 1SGNE 3NWUA 2FO9A 3UNQA 1U6QA 4K5ZA 3S9CA 2BY9X 2NWNA 2VVCA 4OGXA 4THNH 1C4U2 4ZXXH 1EASA 1SG8B 1GMHG 1HAYB 1O3KA 3F9EA 2WPMS 4A5TS 4K8YA 2BYAX 4Y0ZE 1F5RA 3BG4C 3M37A 1GJ6A 3BIUH 4X1QU 1FMGA 1MKXK 1VR1H 1ZHRA 3MH7A 4XD7D 1VITH 3RXUA 1AVXA 3ZZAA 1KXEA 1W0ZU 4NFFA 3A7ZA 1F7ZA 1UMAH 2WUBA 1KLJH 3ESTA 2BY7X 2OBQA 1ETTH 3OEHD 3ZVGA 1O37A 5DJ7A 4MPWA 2W7SA 1MTVA 2VWNA 1SVPA 1SR5C 4E7RG 4AB9A 2WPJS 1SKYE 3F68H 1SGIB 4LZ4B 2XC5A 1P8VC 3D23A 5H4IB 3D49H 4D7GA 3W94A 4OS2A 3EAJA 1E36B 4X1SU 1O2KA 4X6OA 3Q00A 3RXCA 2CF9H 2OQUA 4I8GA 3FVFB 1ZYOA 3UOUA 1NRNH 2ZDAH 3KQDA 5I46H 3SNAA 1DWBH 1MZDA 1D9IA 1LHCH 1EFRD 2ZTYA 3ZZ4A 5FX6A 1ZHPA 2H9HA 4IS5A 5FBEA 1EUFA 3PROA 2GMTB 3FAOA 2XNDD 5T6FA 3OTJE 4ABGA 1EJNA 3SJ9A 1GBHA 4HFPB 4IC6A 4CBNA 1OOKB 3MI4A 4XBBA 1FAKH 4X0WU 2J2UA 5FPYA 2KCOA 2B5TB 2PGBB 1W8BH 1SGDE 3P17H 3BG4B 5B6LA 1QL8A 3BIVH 3V12A 5EXNA 2A45B 2D8WA 2PFEA 2ILNA 4LXBH 3LGUA 2H5CA 4RSPA 1KXBA 2WPDD 3GY5A 1KMHB 1ARCA 1QHRB 5GDSH 2RCEA 4Q2KA 1BITA 1K1IA 1SLXB 1WU1A 2OP9A 5J4QA 2QXIA 3A84A 2FWWA 2W5EA 5EPYA 3LKWA 1JXPA 3BN9A 4Y8ZA 2ANYA 2ZU1A 1RIWC 3ZVCA 1RTLA 1G3EA 2VVUA 5FCKA 2GKVE 2HPQH 1G37A 3VB5A 1LVMA 1LVBA 4D9RA 1TPPA 1E34B 5IDKA 2A31A 1K22H 3AAVA 1QRXA 1EJAA 2QGRA 4DOQA 2HWLB 1AU8A 3SJIA 1GBFA 4SGAE 3WW7A 3K6ZA 1GJ8B 1W0YH 1J15A 3VXFH 1C1TA 1QJ6B 7GCHF 1O3IA 1P2MA 2W6JD 4HI3A 2ZHWH 1O2OA 2FP7B 2J98B 2OLGA 1TPOA 1W7XH 1DDJA 1XXFA 1P0SH 1GI0A 1H4WA 1CQQA 1KXAA 4H4FA 4DW2U 2Y80A 2DE8A 1KXCA 3NPSA 3PB1E 2BDIA 2BQ6B 2BX3A 3QX5H 4K60A 4YO9A 2QY0B 2CHAB 3A86A 1DWEH 3P8OA 2SNWA 2ZCLP 3EA7A 3PV2A 1UVTH 2VIPA 1GHWH 3A85A 5PTPA 1TMUH 1SQAA 1O31A 3FP7E 4Q63A 1ZHMA 1ZLRA 1TOMH 4YLUA 1ELEE 1L1GA 2FDAA 2G00A 2V6NA 5F8XA 3TGJE 2SFAA 4Y8YA 4ZKOU 1ARBA 1TX6A 4X2VA 3PRDA 1C4V2 1RIWB 2P3UB 1ID5H 3FN8A 1O3JA 3N7EA 2F83A 2R3UA 4ZKSU 4FUGA 4AOQA 4IBLH 3A8AA 1OSSA 3OE7D 1IQJA 1FIZA 2ZFTA 5DKMA 3AASA 1H9HE 1IQEA 1P06A 3LH3A 4X2XA 2QIQA 4KTUA 4X8UH 1P10A 2Z6BD 4Q80A 2J97A 1CHOF 1V2OT 2GJGA 2VIWA 3K9XB 3MNSA 3MHWU 1NBMD 1A5IA 3D65E 3P8NA 3A83A 4FXGH 4IN1A 4ABDA 3LGVA 3SHCH 2EY4C 2AERH 4NA8A 4AFUA 4NWLA 1SGTA 2HALA 2TRMA 1SQOA 1O2WA 4JYTA 1P9UA 2KZ4A 4YM9A 1TE0A 1DWDH 2ZHFH 2BQWB 1UCYH 5EXMA 1EKBB 4ZHLU 1DY8A 1ZPCA 1P05A 1ABIH 1EB1H 2PKSC 1AN1E 3AK5A 1HFDA 3GCTF 1GBEA 3K2UA 3RXKA 1DE7H 1ZSKA 1GDUA 4UD9H 1HJ8A 4GVUA 2A7JA 1AKSA 2HNTF 1TRNA 3F9FA 1C1WH 3UY9A 2ESTE 6CHAC 2B9LA 2C4FH 3TIUA 2QYIA 1NTPA 3B8JA 3VFEA 2BZ6H 3ITIA 1TFXA 1F0UA 1P2NA 4BAMB 4CRGA 1TGTA 3NKKA 4NFEA 1YP9A 1JMOH 2ZECA 2UUFB 3ZZ6A 5CMXH 2FX4A 4K8BA 5DSFA 3U8OH 3U98H 1HAPH 1O2QA 2PUXB 3M35A 1E38B 2C93B 4WMEA 1SHYA 3AW1A 4BTUB 4X6MA 1F0RA 1JOUB 1KDQB 1TA2A 1Z7KA 3TVJB 3FP6E 1XXDA 1QQUA 2PR3A 1XX9A 2VBCA 4UFEH 4XDEA 5I25A 3ZVEA 1JRTA 2QC2A 2BDHA 1K1PA 5A8ZA 1UHBB 2VJ1A 3KQBA 1LKAA 3V7TA 1W13U 3PLBA 1PPBH 1VITG 3UOPA 1SGFG 1SI5H 1WBGB 5HM9A 1ELVA 1QBVH 1C5OH 1AY6H 2A4GA 3IITA 1IQGA 9ESTA 3KIDU 1B7XB 2BXTH 2FYQA 1AUJA 1F0TA 1O5EH 4M7GA 5LH8A 1GJ9B 3A7YA 5GNDA 2PKSB 4I33A 3SOSA 1GBMA 2HLDD 1K0HA 1UVOA 1AWFH 3SHAH 1SLVB 3TK9A 1GBIA 1TALA 1ZTJA 4AYYB 3M3TA 2VU8E 1O32A 3SU6A 3SGBE 3QO6A 4JZ1A 1BHXB 5T6GA 3GCHC 1FY1A 4BAHB 1VZQH 2J38A 1RS0A 1EAIA 3DSPA 1ZRKA 3RXOA 1BTZA 1O2TA 1EZSC 2IN2A 5KGOA 3ZZ3A 5BRRE 1HAGE 2ZHQH 5FXLA 1GHXH 4ZHAA 3A7TA 3OY6U 1BA8B 1YWUA 4XFQA 3M61U 2A4QA 1YPHC 1GI5A 1C2EA 1O2SA 1TB6H 2ZU5A 4R0IA 2A4OA 1DS2E 2XTTB 2GTBA 1AB9C 1P11E 2HPPH 1YC0A 4UFGH 3GY8A 1KSNA 2PGQB 1EOLA 3VB7A 2W3KA 3KNXA 2PLXA 2ZGJA 3HGNA 2SGPE 3U28C 2J9NA 3K65B 1RJXB 5EJLA 1O3OA 3GY6A 3URCA 1MD8A 4XSKU 3ZYEA 1MZAA 3RXVA 1OP0A 4ZAEA 1JBUH 3P8FA 2GDEH 3M7UA 1NO9H 3MNCA 1GJ4H 1EOJA 2K8IA 3RXMA 1JWTA 3KF2A 1W14U 1M9UA 1JIRA 2JJ1D 1UK3A 3NCLA 3GCHB 2FPZA 3OX7U 1MCTA 2PKAA 3DFJA 1TRMA 1BTXA 1AKSB 3TITA 1ZZZA 1MH0A 2LELA 2M5TA 4AGKA 3BSQA 3E6PH 4CHAC 1ORFA 3F0PA 4I86A 2F9VA 4HGCA 1GI7B 2WPIS 1DITH 4MNVA 2PUQH 4FUBA 5ETXA 1YPJH 2FS8A 3LDXH 4U2WA 1QBOA 4TY6A 2Z3CA 3E91A 2H2ZA 3BTGE 1SGEE 2JH5D 3GICB 5F03A 3SNCA 3RXRA 1PJPA 3A87A 3I78A 4ASUD 1P3CA 1SB1H 3QN7A 1MQ6A 5ESTE 1RGQA 3SNDA 3AAUA 1FY8E 1N6YA 2AS9A 2J92A 2XCNA 5C94A 5L2YH 1HXEH 4TWYA 2ZEBA 5K0HA 3SU0A 1NBME 1GGDC 3F3BA 1C5YB 3FFGA 5F6MA 1ZJKA 1XUFA 1YLDA 3N7DA 1LQEA 1LVOA 1AO5A 1OYTH 1G36A 1LHDH 4O3TA 1J14A 3RXTA 3PMBB 3BTQE 1THRH 3QZQA 3RUOA 4NWKA 3LOXA 1Z8RA 4K1TA 1GI1A 3QGJA 2BD2A 2F43B 3FZZA 3I77A 1DXWA 3Q3YA 4CHAB 4K69A 1O3NA 3JZ1B 4FUIA 1FZZA 2Z9LA 1YBWA 4FOUC 1HCGA 1O3BA 1YM0A 4UE7H 2JETC 1TWXB 1WCZA 1C5MD 4JK5A 3RXAA 1FJSA 5K7RA 1C1RA 4BOHA 1ZTLA 4RI0A 1O3AA 3C27B 2FYRA 3MH6A 3GYMA 1E79D 3A7VA 2VH6A 5GCHF 4BAKB 1EX3A 4JCNA 2BLWA 5EW2H 4AORA 1OHHD 4MVNA 3MNBA 1O33A 1O3FA 4F49A 3D62A 1P09A 1TLDA 3M3SA 2A2QH 2LNCA 2VGCC 4Q7XA 1GCTB 1QL9A 2RG3A 1DXPA 1BRAA 1K1MA 4MPUA 4OS4A 1H1BA 4E06H 3NZIA 1O3GA 1A0HB 1B0FA 3KQEA 4DT7B 1Y3XA 1MBQA 2GCTB 3E8LA 4MLFB 1SQTA 2ZTXA 1K21H 4UDWH 3KCGH 2VIVA 2V35A 3VGCC 4I8KA 1TRYA 4NIWA 2P3TB 1S85A 3TJVA 1SBWA 4I8JA 1QRWA 2A7CA 2AGIX 4IC5A 1GHVH 1TX7A 1XMNB 3HATH 1K1LA 4GCHG 4YTAA 2Z94A 3TU7H 4FVDA 1WUNH 4XBCA 1LQDB 1A3BH 2BDGA 3QTVH 5DP5A 1O3CA 1OP2A 3S9AA 3GS9A 4SGBE 4A92A 4OS6A 4R8TB 1SGYE 3RMMH 4ABHA 2F3CE 2JETB 2VIDA 1BBRK 1OS8A 1BTWA 1ZSJA 3KL6A 1YPHE 1NRSH 2C8YB 1A5GH 2NU1E 2FLRH 2CJIA 2VB0A 2HOBA 1O2IA 3ZZBA 3VB3A 1IHTH 3E0PB 5FPTA 1O2LA 1QCPA 2WINI 1RFNA 1ANBA 1TBQH 4BXWA 1T8LA 5C3NA 3GDUA 2R9PA 3OY5U 1UTMA 1UVPA 3BG8A 2P59A 1CHGA 1PFXC 4LZ1H 5A0BA 1WAYB 1A2CH 4M9FA 3RXHA 1FONA 3A8CA 4ISIH 1KXFA 1KLTA 3HPTB 3PMJA 3VGCB 2A0QB 4AC9A 3S0NA 3ENSB 1ANCA 5JYIA 3H7OA 2JJ2D 3F9GA 1O5GH 3UIRA 2H9EH 1IQIA 2C90B 1SGRE 2BY6X 1SC8U 2AGEX 3E16B 1F92A 3QGNB 4UONA 2GMTC 3PLKA 5GJ4B 1J17T 1NM6A 2WYJA 5EPNA 5DP8A 2GCHG 1Z1IA 4AFQA 1C2MA 2O9QA 3SU5A 2A5IA 1ACBE 3MTYA 1J8AA 2CF8H 1O2JA 1BTHH 2Q6FA 2UWLA 2B7DH 1O2UA 1O3MA 1IQKA 3LGYA 1EPTB 3A8BA 2KM0A 2BDYA 1UVSH 4NGAH 1GJ5H 3R0FA 4F48B 2W3IA 4A1VA 3OSYA 1O2MA 2XC4A 2R2WU 2FOHA 1GG6C 1GVZA 4ASHA 2CMYA 1J16A 4FU9A 1O3PB 3F1SB 3DCLA 4DJZB 5DP9A 3P95A 2ZU2A 4P02A 1W12U 1P2OA 2VWMA 1QB6A 4OS1A 5JBTA 1KTTB 1JRSA 1OP8A 1SMFE 2F9OA 3F2GA 3A82A 4ACAA 3RC5A 3ZVAA 3SBKA 1GJDB 3F6UH 4KTSA 1K9OE 4B2BA 2FESH 3HKIB 3U8RH 5AVDA 2ZGCA 3S7KB 2C3SA 2BDAA 2AEIH 1UTOA 1K1NA 4RT0A 3BEIB 1CT0E 1DWCH 1MMJN 2LP6A 1FPCH 3F9HA 3I29A 4WH6A 5JB8S 3UUZA 1QNJA 2SGAA 3MWIU 4AB8A 2Y7ZA 5JPMH 2ZFSA 1O36A 3MH4A 1BB0B 3A80A 2ZDVH 1YCPM 2AMDA 1YCPH 5GWZA 2KFWA 2H9TH 2JIZD 8GCHF 4U32A 5DP6A 3UPEA 1GHBG 1AFQB 1NT1A 2A32A 2SGFE 2CHAC 3VB4A 1PPCE 4X2YA 4YT6H 1GMCF 2UWPA 1A5HA 2G4TA 1DSTA 4DURA 1AE8H 4X6NA 4X8TH 2HGTH 4INLA 1WXRA 3GDVA 1PYTC 1IOEA 2ZGBH 6GCHF 4ABIA 1AGJA 2EI6A 1SGFA 4Y76A 4JK6A 1GG6B 4DCDA 1AHTH 1Z6EA 5FBIA 4B6EA 3EDXB 4YOJA 2BDBA 3PTBA 4I7YH 1KY9A 1DANH 2RA0A 2PP6A 1GBKA 2IPQX 3PM3A 4TSFD 4TPIZ 2V0BA 1KDQA 1K2I1 1WTHD 3LIWA 1GBDA 1C1PA 1G2MA 4ABFA 1DLEA 1ELBA 1RRKA 1GI4A 4U30A 4BTTB 3M7TA 1G9IE 4BTIB 3H5CB 1UHBA 4NSVA 1W11U 1NN6A 5LPEA 1BMMH 4LOYH 2ZZUH 7KMEH 5FPSA 4P00A 4ZMAH 3SUDA 4AGJA 1RTKA 3ATWA 3KGPA 2F9NA 2ZCHP 3U1JB 1TNLA 1Z8GA 4ISOA 3CENA 1MBMA 1X7AC 2JH0D 1B5GH 3P92A 2PHBA 3RXBA 4AFZA 4A6LA 2A4RA 1MU6B 1Y3WA 4TPYA 1FLEE 2V3HH 3KEEA 1ZMNA 1QR3E 1MTWA 2OUAA 4XBDA 4ZROA 3ELAH 4I8LA 1O3HA 1O3EA 1XVOA 1S0QA 2RA3A 3SNEA 1AZ8A 1F5LA 1E37B 1O2HA 3BV9B 2ZP0H 1F5KU 4NIVA 4O97A 4K3JA 2B8OH 1C5VA 3UTUH 5A0CA 2GD4B 2PWXA 4YT7H 3QDZB 2JH6D 3SI4H 3ZZ8A 4NSYA 1T4VH 1T8NA 3RMOH 5JBAS 1SFIA 2TGDA 2OTVA 2OC0A 1NY22 1UTKA 4ZXYH 3HK3B 2QXJA 2ZDLA 4TYDA 1SLWB 1C1QA 3ZIAD 1S6FA 2TPIZ 3E3TA 4B71A 2SNVA 3RXSA 3V3MA 1C9PA 1LPGB 1MTNB 4JZFH 1WDIA 1MTSA 2WV9A 1QA0A 3ZVBA 2WPKS 3SORA 5A8YA 1C5LH 3P6ZB 1EP6A 4NZLA 5HM2A 2XYAA 2OK5A 4AFSA 2BD4A 2ODQA 3UREA 2SGDE 3MO6A 3V0XA 4K1EA 2ZFRH 4CH2B 4YLQH 1C1VH 4I32A 3WY8A 2Y5HA 1Y3YA 4WY3A 4Y0YE 1CBWC 2ZGXH 3DUXH 3MU5A 4MNYA 1UTNA 4VGCC 4FUHA 2FOMB 1DT2A 2I6QA 2FXRA 3SO3A 1GWAA 2KX4A 1BBRH 1SSXA 3SNBA 2QA9E 4WMFA 2ANKH 1EZQA 1G3DA 1ESTA 4JZDH 1UK2A 5T3HA 1QJ1B 1GHYH 4WWYA 3LONA 2ZFFH 4WJG2 3GCOA 3NRLA 1C9TA 3F2FA 3LT3A 3GY2A 1BHXF 1UTPA 2QF0A 2WZQA 2GT8A 1ELTA 2A5KA 1C5TA 1C1UH 4Y7AA 5EQQA 5EXLA 4A1TA 2W26A 4E7NA 2QXGA 1NC6A 5LPRA 1BDAA 4GSOA 1MU8B 3DFLA 3T28A 1LDTT 4NA9H 3M5OA 1ETSH 7GCHG 2AHME 1PPGE 2XRCA 4YOIA 2THFB 1ZGVA 1HYLA 5EJ1A 3PTNA 4K1SA 4NA7A 3PLPA 5DK1A 3P8GA 1INCA 4NG9H 4JMYA 2QF4A 1CGJE 4CREA 3TNSA 3QWCH 1IQMA 1G32B 2XWBI 2OQ5A 2K1QA 2LPRA 5E0JA 5LPFA 4Y10E 4FUDA 3E90B 3Q3XA 2B0FA 3NUMA 1CBWB 2XC0A 5C67A 4VGCB 2WUCA 3KYFA 1QBNA 4CRAA 1FI8A 3BTDE 1GDNA 5HXFA 1SQRA 2GZ7A 4FETA 5F8ZA 1WOFA 2IPHA 4FUCA 3SV9A 1DX5M 1NU9A 5C17A 1YYY1 1ELCA 1D6WA 3A81A 2Y6TA 2ZPQA 3PMAB 3QTOH 1V2RT 1Y3VA 1CHOG 1H8DH 1S84A 1RD3B 3UFAA 3BTFE 1EAUA 2IJOB 4ABEA 1DOJA 3OYPA 2QCYA 4AZ2B 3VG8A 3CS0A 1UTJA 1FV9A 3RU4T 4O03A 2ZFQH 1PQAA 1EB2A 2L74A 4BAOB 2P8OC 1N8OC 2BMGB 1S0RA 1TQ0B 1UTQA 3LH1A 3E0NB 4XOJA 3DT0H 3GCTG 1FXYA 5HYOA 4MTBA 5EGMA 2KCAA 1O5CB 2BB4A 1S82A 1GI6A 5CE1A 1BTUA 3A7XA 1O2PA 2BLOA 1QGFA 5DPAA 1QB9A 3RU4E 4Q7ZA 4PROA 4IW4E 1OWHA 1P01A 3RMLH 1GHAF 2FLBH 2F9PA 1ZPBA 4RN6A 1ANDA 3SU3A 2V3OH 1PPFE 2OINA 1K1JA 2O8UA 1RTFB 3BEUA 2ZDMA 3STIA 1E0FD 1WV7H 1CT4E 4NIXA 4ISHH 3CS7A 3ZV8A 1ZPZA 1TNKA 2BD9A 1O5DH 2BVXH 2AIPA 1YCPK 3RXGA 3RXIA 1FN8A 3TK6A 5C2ZA 2BY5X 1VGCB 4X8VH 1JIMA 1HAXB 5JB9S 4FU8A 1SL3A 3ATMA 4A7IB 2G51A 1ELDE 2OC8A 5C5OA 1V2MT 1P02A 1SGCA 3NXPA 8LPRA 1GL0E 1CT2E 4Y6DA 1IQFA 3SU1A 3QZRA 1S5SA 1BMLA 1C5NH 1O0DH 3M5NA 1O5BB 1GPZA 2ZPSA 3H7TA 2P8OB 1N8OB 1TGSZ 2V3MA 1H9IE 5FAHA 2ZDKA 1V2VT 2FI4E 1GMDF 5CHBA 1C5QA 3STJA 1TMBH 4TWWA 1GCTC 3E1XB 3T2NA 3T62A 2PTCE 3DD2H 1ZSLA 2TGTA 3PV5A 2ULLA 4KKDA 1HAHH 1AMHA 1E1QD 2BM2A 5C0TA 1AQ7A 2GCTC 1LKBA 1HIAA 4CRCA 1AIXH 4NZQA 2CGAA 3MOCA 1T31A 3SI3H 2G4UA 4FUEA 2P93A 4WH8A 1DFPA 2DUCA 1LTOA 5GXPA 2G55A 2ZHEH 1BOQA 3SQHE 4ABBA 1PQ7A 2Y81A 1FUJA 1CA8B 3BTTE 5SGAE 2BOHB 3UWJH 1J9CH 1A7SA 1FQ3A 3MMGA 2NU2E 3ZZCA 5TCAA 2ODYB 1EPTA 2NU0E 4KTCA 3S69A 3M36A 1HDTH 4D7FA 2ZC9H 1LHEH 3FOAA 4B2AA 4INKA 2ZGHA 3SZEA 1FDPA 5E8EH 4H42U 4H6SB 5EG4A 2G81E 2BD5A 1UO6A 1BT7A 1KTSB 1HAVB 5KEDA 1KXDA 1FNIA 1AZZA 3G01A 4TT3D 2Q6GA 1V2NT 1BMAA 4IMZA 5FCRA 1E35B 1GMHF 2WHXA 3U8TH 2CXVA 1KYNA 3AW0A 1GI2A 2FZZA 2AIQA 2C8XB 3ZVDA 2OD3B 1A61H 2GT7A 2XNIA 2Y7XA 3ZZ7A 1HRTH 2HVXA 2GV7A 2UUKB 1W10U 2YMSB 2TGPZ 3LJOA 2O8WA 4JZEH 1C2JA 3BTKE 5J4SA 3PYHA 2XBWA 3UR9A 1TABE 3OFND 4J1YA 1SGQE 3TJUA 4GUXA 1EQ9A 1FIWA 1QZ8A 3LC5A 2Z3DA 1OWJA 3Q3KA 1P3EA 1DUEA 2K0QA 3RC4A 4HG6A 1TIOA 4AYVB 3O8DA 4MG3A 2ZPRA 3BF6H 1VCQA 1AWHB 5A8XA 2G8TA 2ZWLH 5JDUB 3QUMP 1OWDA 1GI3A 2WSSD 2L6OA 1EPTC 1HAIH 2V7QD 4GLYA 3SQEE 4CR5A 2BD3A 1OWEA 4Y7BA 3BTME 1GL1A 2FMJA 1TQ7B 5F53A 1MKWK 4I8HA 4KP0A 1V2WT 4DVAU 1L1NA 1S6HA 3MH5A 1YLCA 1LHGH 1BQYA 1TYNA 4ZH8A 1RXPA 3HK6B 2Z3EA 1FY4A 1IHSH 3UAIC 2J95A 1GBCA 5EJZA 3LPRA 2PSXA 1YPLH 1WTGH 1IQHA 2Y82A 1A0JA 1ZMJA 4Y79A 2BVSH 1HIAB 1MCVA 1C4Y2 2AYWA 1QQ4A 2W6ID 3SUEA 2WPHS 2NU3E 1C5RA 1G2LA 1CO7E 2SGQE 3RXLA 1HUTH 1SGPE 2QF3A 5C1UA 1AE5A 2IOTA 1WSSH 5GCHG 2C8ZB 4ZCNA 1AFQC 1EP5A 1YPMH 4RKJB 2Q1JA 1MABB 2FX6A 3LC3A 2KR7A 3SV7A 1FN6A 2Z9JA 4B73A 3SV2H 1P2IA 1KIGH 1TNGA 2OXSA 1K1OA 2QN5T 4FU7A 1MD7A 4UFDH 2EI8A 4B76A 1L4ZA 3AVZA 2Z9GA 5EIYA 3O8RA 2ZG0H 2XWAA 1Q2WA 1YPEH 4WMDA 5AFYH 3QLPH 5ESBA 1TPAE 3T5FH 7LPRA 1V2JT 2AMPA 2BX4A 2ZNKH 3ODDA 4OM9A 1EAXA 1GI9B 5GPIB 1T32A 1TNHA 1TGNA 2BY8X 1ZOMA 1TBRH 1NFXA 3M5MA 1C2GA 3GCNA 9LPRA 3TH2H 2RDEA 1Z1JA 1C5XB 1Z8IB 1FY5A 2QE7D 1EZUC 1IQLA 3KQ5A 5JBCS 1ELAA 1AVGH 1P2QA 3CP7A 1C1MA 3GYLB 3HKJB 2ZQ1A 4WVPE 1PYTD 1ZGIA 4GHTA 1QRZA 2WV4A 3VXEH 5E0GA 1TGCA 1IAUA 2BDCA 3EGKH 1C5ZB 4MNWA 4U01A 1HV7A 2KCYA 2STAE 5DP3A 3ZZDA 5EU8A 3PWCA 3O8CA 6ESTA 1MAXA 2QXHA 4Q4LA 2BOKA 3LGIA 2ZTZA 3SUGA 3VB6A 5F8TA 2VWOA 2EA3A 3N99A 1ZTKA 3OAAD 5AFZH 2OC7A 1UVUH 2PTNA 1T8OA 1P57B 1H9LB 3RMNH 3SV6A 5FL7D 1ELFA 5A0AE 2Q6DA 5C1XA 3L33A 1BTPA 4KGAA 2OCVB 2VIQA 4IGDA 3U9AH 1GDQA 3MNXA 1O3LA 2CV3A 2F9UA 3M7QA 2FIRH 4J2YB 4B6FA 5AF9H 1OWIA 1QA7A 3KQCA 1LCYA 1PQ8A 2A2XH 1TAWA 3TJNA 1MTNC 4X1RU 1ETRH 2KCPA 1QL7A 1O3DA 5KECA 3RU4D 4B74A 2W7UA 4X1NU 3EQ0H 5LGOA 2JKHA 4KELA 2OC1A 2FOBA 3BTEE 1GJCB 4ZHMU 1ELGA 2XXLA 5HIZA 1GBJA 3T29A 1BRUP 4XE4A 3RXEA 3WWFA 1QFKH 4DGJA 3EYDA 3L3TA 1CGHA 1OX1A 1QJ7B 1ZJDA 1G30B 2XBYA 4NCYA 2ZFPH 2QV1A 2HRVA 1BJVA 3TH4H 1HNEE 3VPKA 1C2LA 3EA8A 4F4OC 5HKKD 3JZ2B 4CH8B 4OGYA 1UJ1A 2Z7FE 1OKXA 1ESBA 1XM1A 3A88A 4X6PA 3FZDA 3GY4A 3FKSD
chains in the Genus database with same CATH topology
3A7WA 3T26A 1VITF 1CGIE 3KN2A 1CVWH 1GBTA 2GZ8A 2KAIA 4OS7A 2EEKA 2G52A 4D8NA 2XBVA 2ZKSA 5A09A 1P2JA 2BXUH 4MQAA 1EAWA 1PPZA 4AX9H 4Z6AH 2YNAA 1S6LA 3BTHE 3M5LA 4OS5A 1GBLA 4MPXA 4E05H 5EW1H 4K2YA 3FANA 2TIOA 3UB0A 1SHHB 4DIIH 1C1OA 1HBTH 1DY9A 1OPHB 1O2VA 1VCPA 2F91A 4Z0KA 8GCHG 2VIOA 1NRRH 2FOCA 5DP4A 2FM2A 3RLWH 3RLYH 2IJD1 4IN2A 1O38A 2J34A 3RXQA 1GMCG 1KLIH 1H8HD 3R3GB 4UFFH 5EQRA 1C5SA 3RP2A 3GY7A 1V3XA 6GCHG 3FP8E 3UR6A 8ESTE 3Q76A 3TGKE 1XUIA 1AFEH 4CRBA 4O9VA 1OWKA 3SGAE 3WWBA 1ZMLA 1AUTC 1C2DA 3SUFA 2FOAA 3UQOA 2FTLE 3GISB 4X1PU 2UUJB 1MKWH 1O5AB 2F9BH 1HAOH 1Q3XA 1SOZA 2J94A 3RXDA 3OTPA 4QT8C 2EI7A 1MUEB 3U69H 1O2RA 3MYWA 1FY3A 1EXFA 2TGAA 3IG6B 1QURH 3RM2H 2R3YA 1VCWA 1GHZA 2BD8A 2P3FH 1TOCB 2FI3E 2NU4E 1XUGA 3ZYDA 1GJBB 3A8DA 2HNTC 2XOKD 2Z9IA 2PSYA 1UTLM 5L6NH 2VWLA 2F4LA 1O2YA 1NRPH 1L1JA 4AG1A 4UEHH 2QF5A 1YGCH 1P03A 1T8MA 2PW8H 3HGPA 3QK1A 3TJOA 5DGJA 1HJAC 4D9QA 2FTMA 3BEFB 3SN8A 5E2OA 3VEQB 3P70B 1D3TB 2AGGX 1C5UA 3TNTA 2J5UA 2D26C 3GDSA 2CN0H 1E1RD 3TPIZ 1ZR0A 2G5NA 3LGWA 1SFQB 2ZA5A 3ZV9A 1D3DB 1LO6A 5E0HA 1O2GH 3BTWE 2H5DA 2H1UA 1O39A 1YKTA 2BTCE 3UWIA 4D76A 2R2MB 4ISNA 1NFUA 3ATLA 3GOVB 1SOTA 1D3PB 1QB1A 1NFYA 1EJMA 1SLUB 5IK2D 3S7HB 2CK3D 1HPGA 1GI8B 1HXFH 4RKOB 1A4WH 1WQSA 1MKXH 4CRFA 1V2UT 3RXPA 1GBAA 1NFWA 3IWMA 4Y11E 3SW2B 1A0LA 5FHTA 1TNIA 5AHGH 1FAXA 1S83A 2FODA 1NZQH 1H8ED 1VGCC 2FOEA 1HAVA 1BTYA 1V2LT 1AVWA 6CHAB 1FX0B 2JDID 1BZXE 1V2KT 2KAIB 4ISLA 1BMFD 1CU1A 1NRQH 4MPVA 4DIHH 2EC9H 3SJ8A 6LPRA 2P16A 5C1YA 1Z71A 2RDLA 1WQVH 2R0KA 2ZCKP 3RM0H 1TPSA 1MAYA 1GVLA 1HJAB 1Z6JH 4LK4A 5L2ZH 4CRDA 3K6YA 1NS3A 2H6MA 3SJKA 1T4UH 2I6SA 1PPHE 2R0LA 4Z1MD 3OU0A 1H8IH 1GCDA 1FPHH 4MDSA 1THPB 4FUFA 4JZIA 2STBE 1XUHA 1CE5A 3FO8D 2OBOA 1COWD 1F2SE 4B1TA 3RXFA 1BRBE 1BCUH 1ABJH 2FOGA 2BHGA 2XCFA 1PPEE 1DUAA 1O2XA 2SGEE 1V2ST 4TY7A 4ZKNU 5C20A 2ZIQH 2VNTA 1G3CA 1Y5AT 5C5NA 2J4IA 2XBXA 5DP7A 5E2PA 3SU4A 5DN6D 3LU9B 1GVKB 1YPKH 1N6XA 3C1KA 1Y3UA 2WV5A 1C2IA 4DY7B 1L0ZA 1TNJA 3RXJA 1ANEA 3PWBA 1EZXC 5JBBS 5BPEA 1BMNH 3H09A 2A7HA 2GDDA 2GVFA 3B23B 1S81A 1C2HA 3GY3A 3UQVA 3T25A 1NPMA 3UNRA 1BJUA 1C5WB 1XVMA 4HTCH 1W0KD 1TGBA 2Z9KA 4B2CA 2UUYA 1BUIA 1Z8JB 2Y5GA 4YZUA 1W0JD 1DM4B 1XKBC 2C8WB 4WF8A 3V13A 4YXWD 1DLKB 1V2PT 1AI8H 1SPJA 1LHFH 3EE0B 2FI5E 4GCHF 1QY6A 2YMSD 1XUJA 1HAZB 3Q77A 3EA9A 1K28D 5CDFE 2ZHDA 2XW9A 1W3CA 1GJAB 2DE9A 2M2AA 4BNRA 5T6DA 1LMWB 4F55A 3MU1A 1CA0C 1GJ7B 2BLVA 4JYVH 3T27A 3F2HA 2ZU4A 4GAWA 1VJAU 3URDA 1AB9B 4FUJA 4ZKRU 2GGVB 3MU8A 2P94A 3ZZ9A 2YMSC 1P2KA 4DG4A 1XKAC 2ZU3A 3UNSA 2GP9B 4CBOA 4H6TA 3M3VA 2Y5FA 3KHVA 2O8MA 1C5PA 5IYTA 5TCCA 1TONA 1NROH 2AH4X 2ANMH 2BVRH 2FEQH 1MTUA 4JYUH 1HLTH 1UK4A 1P04A 2AFQB 1LPKB 4WXVA 4A1XA 1V2TT 5ABWA 1CSOE 2FOFA 1B0EA 1DSUA 7ESTE 2HNTE 1W7GH 4ZUHA 2HLCA 5EQSA 5DO4H 2GZ9A 3W1EA 3SZNA 1GBBA 1THSH 1V2QT 3LGTA 1D3QB 3MU0A 4DT4A 3OEED 4X2WA 3TH3H 2ZQ2A 1D4PB 4Y71A 1ZRBA 3ZZ5A 1N1LA 4ESTE 1O30A 2A1DB 2BQ7B 1AD8H 3SGQE 1O35A 5G4BA 1IQNA 2FS9A 2GCHF 4CR9A 1HJ9A 8KME2 1DPOA 1BIOA 1GHAG 1TA6A 1Q31A 4ABAA 1F0SA 1EATA 2GV6A 1D6RA 4MNXA 3MO9A 2TBSA 1CA0B 4WXIA 1Y8TA 2BZAA 2QAAA 1HB0B 2ALPA 3B9FH 1C2KA 2BLQA 2UWOA 2ANWA 2ODPA 1OYQA 1V6DA 1T7CA 2O8TA 2ZO3H 1DVAH 4YOGA 1NESE 5GIBA 3TLOA 1L2EA 5FX5A 3N7OA 3F0OA 1GGDB 3ATKA 2YOLA 1XUKA 1LPZB 3PO1C 4O3UA 2D1JA 1L4DA 2VVVA 2VINA 2ALVA 2ZDNA 1NU7B 1QTFA 3SYJA 1Y5UT 3SV8A 1PQ5A 3PRBA 3NK8A 2P95A 4NIYA 3PV4A 5CHAC 4FVBA 1TBZH 2A5AA 3TGIE 2O8LA 2PV9B 4HZHA 1P9SA 2YNBA 2GX4A 5L30H 2AMQA 2G5VA 3ZVFA 2BD7A 1DICA 1W2KH 1TMTH 1GMDG 2WYGA 5EODA 1WYKA 5T1VA 1O5FH 5B6OA 1G3BA 3L6PA 1LVYA 1YPGH 3DHKH 3RC6A 1UCYK 5HGGA 1O2ZA 2PKAB 3S9BA 2ZI2H 4Q7YA 4GHQA 4INHA 4IMQA 3LJJA 1C1SA 1O34A 1O2NA 5TJXA 5C0UA 1C2FA 2ZF0H 1GHBF 3TK5A 3ATIA 1BRCE 3U1IB 3SU2A 3MFJA 1OXGA 4ABJA 1A3EH 4I31A 2WPLS 3MO3A 5A2MH 1Y5BT 1ESAA 3MU4A 1P12E 3SJOA 2VGCB 4GPGA 1TX8A 1QIXB 1A46H 1UCYE 4X8SH 1YF4A 2VH0A 3A89A 3ODFA 1C1NA 3PO1B 5DG6A 1BBRE 3DA9B 4BAQB 4YESB 2ASUB 1Y59T 3W95A 3DSOA 5HMAA 4AG2A 2D2DA 3RDZA 1MQ5A 4BXSA 1A1RA 5EOKA 3O8BA 1VJ9U 1HGTH 4Y8XA 5CHAB 4AN7A 3PMHB 4BANB 4B75A 1SGNE 3NWUA 2FO9A 3UNQA 1U6QA 4K5ZA 3S9CA 2BY9X 2NWNA 2VVCA 4OGXA 4THNH 1C4U2 4ZXXH 1EASA 1SG8B 1GMHG 1HAYB 1O3KA 3F9EA 2WPMS 4A5TS 4K8YA 2BYAX 4Y0ZE 1F5RA 3BG4C 3M37A 1GJ6A 3BIUH 4X1QU 1FMGA 1MKXK 1VR1H 1ZHRA 3MH7A 4XD7D 1VITH 3RXUA 1AVXA 3ZZAA 1KXEA 1W0ZU 4NFFA 3A7ZA 1F7ZA 1UMAH 2WUBA 1KLJH 3ESTA 2BY7X 2OBQA 1ETTH 3OEHD 3ZVGA 1O37A 5DJ7A 4MPWA 2W7SA 1MTVA 2VWNA 1SVPA 1SR5C 4E7RG 4AB9A 2WPJS 3F68H 1SKYE 1SGIB 4LZ4B 2XC5A 1P8VC 3D23A 5H4IB 3D49H 4D7GA 3W94A 4OS2A 3EAJA 1E36B 4X1SU 1O2KA 4X6OA 3Q00A 3RXCA 2CF9H 2OQUA 4I8GA 3FVFB 1ZYOA 3UOUA 1NRNH 2ZDAH 3KQDA 5I46H 3SNAA 1DWBH 1MZDA 1D9IA 1LHCH 1EFRD 2ZTYA 3ZZ4A 5FX6A 1ZHPA 2H9HA 4IS5A 5FBEA 1EUFA 3PROA 2GMTB 3FAOA 4ABGA 5T6FA 3OTJE 2XNDD 1EJNA 3SJ9A 1GBHA 4HFPB 4IC6A 4CBNA 1OOKB 3MI4A 4XBBA 1FAKH 4X0WU 2J2UA 5FPYA 2KCOA 2B5TB 2PGBB 1W8BH 1SGDE 3P17H 3BG4B 5B6LA 1QL8A 3BIVH 3V12A 5EXNA 2A45B 2D8WA 2PFEA 2ILNA 4LXBH 3LGUA 2H5CA 4RSPA 1KXBA 3GY5A 2WPDD 1KMHB 1ARCA 1QHRB 5GDSH 2RCEA 4Q2KA 1BITA 1K1IA 1SLXB 1WU1A 2OP9A 5J4QA 2QXIA 3A84A 2FWWA 2W5EA 5EPYA 3LKWA 1JXPA 3BN9A 4Y8ZA 2ANYA 2ZU1A 1RIWC 3ZVCA 1RTLA 1G3EA 2VVUA 5FCKA 2GKVE 2HPQH 1G37A 3VB5A 1LVMA 1LVBA 4D9RA 1TPPA 1E34B 5IDKA 2A31A 1K22H 3AAVA 1QRXA 1EJAA 2QGRA 4DOQA 2HWLB 1AU8A 3SJIA 1GBFA 4SGAE 3WW7A 3K6ZA 1GJ8B 1W0YH 1J15A 3VXFH 1C1TA 1QJ6B 7GCHF 1O3IA 1P2MA 4HI3A 2W6JD 2ZHWH 1O2OA 2FP7B 2OLGA 1TPOA 1W7XH 1DDJA 1XXFA 1P0SH 1GI0A 1H4WA 1CQQA 1KXAA 4H4FA 4DW2U 2Y80A 2DE8A 1KXCA 3NPSA 3PB1E 2BDIA 2BQ6B 2BX3A 3QX5H 4K60A 4YO9A 2QY0B 2CHAB 3A86A 1DWEH 3P8OA 2SNWA 2ZCLP 3EA7A 3PV2A 1UVTH 2VIPA 1GHWH 3A85A 5PTPA 1TMUH 1SQAA 1O31A 3FP7E 4Q63A 1ZHMA 1ZLRA 1TOMH 4YLUA 1ELEE 1L1GA 2FDAA 2G00A 2V6NA 5F8XA 3TGJE 2SFAA 4Y8YA 4ZKOU 1ARBA 1TX6A 4X2VA 3PRDA 1C4V2 1RIWB 2P3UB 1ID5H 3FN8A 1O3JA 3N7EA 2F83A 2R3UA 4ZKSU 4FUGA 4AOQA 4IBLH 3A8AA 1OSSA 5DKMA 1IQJA 1FIZA 2ZFTA 3OE7D 3AASA 1H9HE 1IQEA 1P06A 3LH3A 4X2XA 2QIQA 4KTUA 4X8UH 1P10A 2Z6BD 4Q80A 1CHOF 1V2OT 2VIWA 3K9XB 3MNSA 3MHWU 1NBMD 1A5IA 3D65E 3P8NA 3A83A 4FXGH 4IN1A 4ABDA 3LGVA 3SHCH 2AERH 4NA8A 4AFUA 4NWLA 1SGTA 2HALA 2TRMA 1SQOA 1O2WA 4JYTA 1P9UA 4YM9A 2KZ4A 1TE0A 1DWDH 2ZHFH 2BQWB 1UCYH 5EXMA 1EKBB 4ZHLU 1DY8A 1ZPCA 1P05A 1ABIH 1EB1H 2PKSC 1AN1E 3AK5A 1HFDA 3GCTF 1GBEA 3K2UA 3RXKA 1DE7H 1ZSKA 1GDUA 4UD9H 1HJ8A 4GVUA 2A7JA 1AKSA 2HNTF 1TRNA 3F9FA 1C1WH 3UY9A 2ESTE 6CHAC 2B9LA 2C4FH 3TIUA 2QYIA 1NTPA 3B8JA 3VFEA 2BZ6H 3ITIA 1TFXA 1F0UA 1P2NA 4BAMB 4CRGA 1TGTA 3NKKA 4NFEA 1YP9A 1JMOH 2ZECA 2UUFB 3ZZ6A 5CMXH 2FX4A 4K8BA 5DSFA 3U8OH 3U98H 1HAPH 1O2QA 2PUXB 3M35A 1E38B 2C93B 4WMEA 1SHYA 3AW1A 4BTUB 4X6MA 1F0RA 1JOUB 1KDQB 1TA2A 1Z7KA 3TVJB 3FP6E 1XXDA 1QQUA 2PR3A 1XX9A 4UFEH 2VBCA 4XDEA 5I25A 3ZVEA 1JRTA 2QC2A 2BDHA 1K1PA 5A8ZA 1UHBB 2VJ1A 3KQBA 1LKAA 3V7TA 1W13U 3PLBA 1PPBH 1VITG 3UOPA 1SGFG 1SI5H 1WBGB 5HM9A 1ELVA 1QBVH 1C5OH 1AY6H 2A4GA 3IITA 1IQGA 9ESTA 3KIDU 1B7XB 2BXTH 2FYQA 1AUJA 1F0TA 1O5EH 4M7GA 5LH8A 1GJ9B 3A7YA 5GNDA 2PKSB 4I33A 3SOSA 1GBMA 2HLDD 1UVOA 1AWFH 3SHAH 1SLVB 3TK9A 1GBIA 1TALA 1ZTJA 4AYYB 3M3TA 2VU8E 1O32A 3SU6A 3SGBE 3QO6A 4JZ1A 1BHXB 5T6GA 3GCHC 1FY1A 4BAHB 1VZQH 2J38A 1RS0A 1EAIA 3DSPA 1ZRKA 3RXOA 1BTZA 1O2TA 1EZSC 2IN2A 3ZZ3A 5BRRE 1HAGE 2ZHQH 5FXLA 1GHXH 4ZHAA 3A7TA 3OY6U 1BA8B 4XFQA 3M61U 2A4QA 1YPHC 1GI5A 1C2EA 1O2SA 1TB6H 2ZU5A 4R0IA 2A4OA 1DS2E 2XTTB 2GTBA 1AB9C 1P11E 2HPPH 1YC0A 4UFGH 3GY8A 1KSNA 2PGQB 1EOLA 3VB7A 2W3KA 3KNXA 2PLXA 2ZGJA 3HGNA 2SGPE 2J9NA 3K65B 1RJXB 1O3OA 3GY6A 3URCA 1MD8A 4XSKU 3ZYEA 1MZAA 3RXVA 1OP0A 4ZAEA 1JBUH 3P8FA 2GDEH 3M7UA 1NO9H 3MNCA 1GJ4H 1EOJA 2K8IA 3RXMA 1JWTA 3KF2A 1W14