4K8EA

Oye1-w116v complexed with the aromatic product of (r)-carvone dismutation
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLVVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 150
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k8eA00
2QCDB 5DBTA 3PF3A 1TO3A 3QSTA 2ZRZA 3UY7A 2VELA 4GUGA 2P1FA 2Y7EA 1JCJA 4MJZA 2A1YA 5U7SA 4LNYA 1YXYA 3E49A 2OCZA 5LNRA 1B3OA 4NX5A 3DFOA 2OMAA 3MYOA 1PV8A 4AAJA 5HINA 4QNEA 3N2MA 1XKYA 3W84A 3LRLA 4WQ6A 1WA3A 1Z42A 4PEKA 3NG3A 5LHFA 1L6YA 3G1FA 3BK0A 4ORMA 4XTIA 5LNSA 1MZHA 4CNOA 3H54A 5C55A 1TPH1 4C1LA 1XBVA 5EL1A 1X1OA 4IX0A 1H1YA 2ABBA 3HG4A 3T44A 3QW4B 1LOLA 4BF9A 3PG8A 2V5BA 1S5TA 5D2VA 3O1NA 1YPIA 1N55A 3G3MA 3I7SA 3GB6A 3TIMA 4AWUA 3A24A 4MIMA 3LHTA 5EBUA 1SFJA 1I2QA 4DQWA 3BGJA 4CNNA 1KBJA 3VKJA 4N9EA 4POCA 2VEKA 3OA3A 4MFEA 3VI2A 4Q33A 3ELFA 1YDOA 1JCNA 4OWGA 2VFGA 1QO2A 4HHPA 4N9DA 3MYPA 3CIXA 2V2HA 3W1QA 4K37A 4PL1A 2DU2A 5FF4A 1LRQA 1W5OA 3UNDA 4XTDA 3G0UA 4P61A 2YGYA 4JTEA 1ME9A 1ME8A 3T40A 1SZGA 1UBSA 1HG3A 3G1XA 3OG3A 2H3DA 2GPTA 1E51A 3BLEA 2R14A 3HG5A 3W7PA 1W5MA 5I3FA 4FHAA 4OV4A 5EKYA 3W2NA 3DKLA 1EIXA 3W7LA 1DJQA 4XZ9A 5K9CA 2NX3A 3QQ0A 2TYSA 1YTKA 2ALDA 3T7VA 3P74A 4O12A 2CW6A 3CTLA 4UTLA 3B05A 3OEXA 5AN7A 3PG9A 3UPBA 4B5NA 3PULA 4JTLA 1G4PA 3T78A 4NXSA 3WJSA 3G8RA 3MW7A 3IIZA 1K3UA 2DP3A 3EX4A 1JUKA 2ATSA 1R2TA 1W3IA 4L4LA 5AC6A 3DBPA 5F2GA 5DY3A 1QPRA 1VHCA 2FB3A 3TK7A 4I7VA 1YXDA 2Y63A 3EKLA 4JYEA 4JY9A 4HN4A 5I3JA 3VE7A 2YXGA 1OX4B 3GIYA 3G22A 3M41A 3GDTA 1NF0A 4LVFA 1XM3A 2QCHA 3SY5A 4A21A 4AWSA 4FXSA 3EXTA 1LBLA 1G4EA 2QCMA 3CQ0A 4Y90A 3V75A 4FIQA 4X22A 2C1HA 1JCXA 1W37A 2QR6A 2GJLA 1Q45A 1WBJA 4NJIA 4MZYA 2Y61A 3TJXA 5LNWA 3W3OA 4CNPA 3A21A 3FJ6A 3KRUA 4ADSA 3KVKA 5G2HA 5BMXA 3I7QA 4WY0F 4K38A 1CX9A 2CZ5A 1K7XA 2E5CA 3NQAA 3QPYA 4LV4A 1TRDA 4JTJA 1RQHA 3S42A 4ZQOA 1IF2A 1W54A 1OX4A 1K8YA 4FXRA 3PWAA 3DI1A 1KTNA 3STGA 2BSLA 2E6AA 1FWWA 5AYXA 3W73A 3C2FA 3M16A 5KZEA 4MUZA 5HR7A 5D2XA 3W88A 3LX9A 4NZJA 4O17A 1WV2A 4N6EA 1R2RA 1ZAJA 2JGQA 3LI1A 4Z08A 4HT3A 4AHPA 2VEPA 2W6RA 3CC1A 5CPNA 2ZZ3A 5D32A 3PY2A 3GAKA 4IMDA 2HMCA 5DCEA 2PCQA 4E2DA 3M5VA 2ZFAA 4AMAA 5U4NA 4WXZA 4R34A 1VCVA 3SIZA 3NQCA 1PS9A 3NPXA 3RK8A 4K6AA 3BW4A 4HIBA 4ML9A 4QAIA 3PAJA 4FNPA 3NO5A 2G96A 4M7SA 1VGAA 3BG5A 1KV8A 1KM4A 2TSYA 4BK9A 4IOTA 2NZLA 2WSQA 1RVGA 1DQWA 1VQTA 4M19A 5HMSA 1FBAA 3ZR4A 2X16A 4O14A 3EWXA 3GXPA 3KXQA 2V82A 3IIOA 1F5ZA 3DFNA 3LTYA 3WJZA 3TFCA 1BWKA 3HMJG 1H1ZA 4DF0A 4AF0B 3FKKA 3INPA 3OVQA 4MJMA 3LCGA 3W7JA 2P0OA 4HPJA 2R8WA 4GJ1A 1GVRA 4O0KA 1WAUA 4A29A 4LW7A 4XBSA 3UZ5A 1MSSA 3W7NA 3ZWSA 5G1YA 1H60A 3PSVA 4WD0A 5AHMA 2OT0A 2WSYA 4MZ8A 4ZMGA 2V30A 3C56A 5A8GA 3MI2A 2NXGA 1RQBA 1QPOA 5FF0A 1OFDA 2FQIA 4X2RA 2BXVA 1H5YA 2P10A 2YFNA 3UWVA 4O4VA 3W7GA 3EXSA 3FS2A 2WNNA 4UMBA 3C4UA 4N6FA 4DF2A 1FWRA 5LZLA 2RH9A 5KITA 1D3GA 1ZHAA 1EUAA 2J9ZA 4FO4A 3Q94A 1M7PA 2CU0A 1K02A 3W85A 1TRIA 3LCXA 5C5YA 3MHFA 3BGGA 3LRMA 3HB9A 4FIRA 1T0OA 1DL3A 1KA9F 2C18A 2YSWA 3PBYA 3E12A 8TIMA 1VYPX 3W86A 1FDJA 4LS2A 5HR6A 4UTIA 1QO5A 1FQ0A 2DZSA 2QCNA 3LCIA 3QW3A 1G7UA 3W72A 2C3ZA 1DKWA 5D03A 4ICNA 2B7OA 3LTSA 2B7PA 1XFBA 2EAWA 3NQDA 1Q6RA 4HNTA 3TU9A 1KTBA 3LCWA 4Z0SA 5DCBA 2CZFA 3ABSA 5DELA 3P8JA 1PHQA 4HNVA 4GBUA 2QAFA 1F6KA 4O52A 1R2SA 1VH7A 4MYXA 1HO1A 3F4NA 5TIMA 1YADA 3QQ1A 3ABOA 4DBEA 1WX0A 3DFQA 2QKFA 2C0AA 1AL8A 4ZVJA 4IJBA 2J9YA 4AB4A 1F7BA 4M6PA 1K03A 1WOBA 5GVJA 1SZNA 2NXHA 1SW0A 4J9JA 1LRTA 2Y7GA 5D09A 4KKXA 3SZ8A 4GUIA 4UR8A 4JTSA 4L4MA 3CU2A 3W6YA 1TPUA 3B0PA 1LROA 3SFKA 3NM1A 1FX6A 1KLYA 1ICPA 1KM0A 3KAOA 1W5NA 4WOZA 4C1KA 1THFD 1XUUA 1QFEA 3HOJA 1TTIA 3THQA 4DELA 1VHNA 1UASA 5AHEA 2DJLA 5CKSA 2FB2A 4XUGA 3I7RA 4O50A 2TMDA 1VC4A 2RKXA 3GZ3A 3KVMA 4NJGA 1KFKA 5K7JA 1JRCA 3GXTA 3QEZA 3L5LA 1TIMA 5CPLA 1MXSA 1PHWA 1FDYA 3W23A 1OFOA 1TTJA 1Z44A 3FJLA 1YLVA 4JIPA 4NJJA 1FWNA 3C2RA 1ZAHA 1ADOA 4K39A 2C19A 4EF9A 4ZQCA 3CEUA 1JULA 1SO6A 3L66A 3RLVA 3BLIA 3C2OA 1OYBA 3R89A 1JVNA 4GXMA 3S5YA 2Q3OA 4KFPA 4LV9A 3NA8A 5H2ZA 4YCPA 4WOQA 1KM1A 4JX6A 2CLEA 5KTLA 3DAQA 2ZRWA 1SUXA 3W87A 2JBMA 4OQVA 1VYRA 4H4IA 4LRSA 2ZZ5A 1TTPA 2QJGA 1EPXA 1AW5A 2CFFA 5HUPA 4LUJA 5FEPA 3DZ1A 5BMWA 3TX9A 5BRBA 1BEUA 2GQAA 4JTGA 2HSAA 3EWUA 3JRKA 3S5ZA 1QNVA 2FPYA 4BI6A 5CSSA 4W9TA 1LLZA 5K9XA 4O54A 3LB0A 4S2CA 3IIXA 3DHFA 3W7CA 2A85A 1ZAIA 1RV8A 4JX4A 3KHJA 3BW3A 4LVBA 2NV1A 1F74A 5DXYA 1G67A 4JEQA 1FCVA 1H62A 1GT8A 3AO0A 3FOKA 3EKZA 1B4EA 3W1TA 4JTHA 1G4TA 3GR7A 2A4AA 3HQ1A 3L2IA 3IRDA 4MLRA 5G2WA 1ONRA 2WOQA 3TQKA 5KZMA 1ALDA 1OF8A 1O5XA 1ME7A 3GNDA 4ONVA 3HBLA 3GVGA 5CSRA 3L0NA 3LXBA 1SW7A 3M5YA 1NF7A 4O8RA 2TPSA 4NNBA 1H51A 1KM5A 4ALDA 4O53A 3EX2A 3IEBA 3IVUA 4MZ1A 4QQ3A 4WX2A 2D73A 4A22A 5D30A 1VCFA 1NAL1 4IMGA 1OG0A 1WDWA 1FCBA 2ZYFA 2RDWA 2A6LA 4JS3A 4M5PA 1YXCA 4TO8A 4LS0A 3QF0A 4RKAA 3PB0A 3YPIA 3W1RA 1XUZA 3FFSA 3NQVA 4FF7A 5J5DA 2OT1A 4E2BA 3UWQA 3UYCA 1OYAA 4O10A 4IMFA 1X1ZA 3K30A 3A5FA 3W1UA 1H7OA 2VXNA 3UY8A 5A5WA 4O28A 3E0IA 3NYZA 1T99A 4S2BA 5KZDA 4PODA 3TMQA 1QR7A 5C2XA 2YYTA 4JIQA 4DO5A 3G1YA 4AXKA 3W1LA 4TX9A 3KVJA 1LP6A 4QM1A 2W0UA 1V7YA 3TSDA 1W3NA 4GWEA 2Z0IA 4MY8A 3NZ1A 4DPPA 2YYUA 3UPWA 1H7WA 2QAPA 1VRDA 2H8ZA 5AC7A 2CLIA 1U83A 3QSRA 2Z6IA 5K9DA 2UV8G 2DZTA 4LC8A 3UWUA 1O95A 3EWBX 1ICQA 3LI0A 3O8AA 2NX1A 1RR2A 3BO9A 1FWTA 3R5EA 2A7RA 2BLEA 1I2PA 3UWWA 1V5XA 4MYAA 3BARA 2BZNA 2Y89A 1WBHA 1KFBA 2ZA1A 1TPC1 1SZEA 2YX0A 2JKAA 1VPXA 4UC5A 2VEMA 3TH6A 2NLIA 4NJKA 3LHVA 1TJPA 4NNAA 1X8FA 3MMTA 4IQLA 3IV3A 1L6WA 3DFTA 3TA6A 4Z1CA 5F4WA 5K4XA 3WJYA 1WQ5A 2XN0A 4FNQA 3W83A 1IXQA 1H7XA 4XBKA 1M5WA 3W2KA 3NGJA 2QDGA 3QH2A 2ZZ4A 3LBCA 5G4EA 3MUXA 1ZY9A 1GPWA 4S1FA 5BNKA 1H7NA 1IGSA 4LS1A 3NM3A 1K8XA 2J6XA 1D3HA 3QRHA 1IXNA 4NT0A 1A5SA 1EP3A 2E6YA 3C61A 2V5LA 4ORIA 2GQ8A 3EWWA 2ZTJA 3B4UA 1N8FA 1GOXA 4MOZA 4NVTA 4Y6GA 3TQVA 5LNVA 1OFPA 4PC8A 1SO5A 3TW6A 2E6FA 3GNNA 5FF7A 3HF3A 1OFQA 3Q2DA 2H90A 2QF7A 3STFA 1J2WA 5HJLA 2WV8A 4K8HA 2NUXA 2V2CA 3BPWA 4FX6M 2EPHA 2CLHA 4Y9AA 1B57A 4FB7A 2VFFA 4UXDA 5G4WA 3L21A 1GEQA 3M47A 4GC4A 4HNNA 4UTMA 3VE9A 3F1QA 3QJAA 1EA0A 3S6DA 2JK2A 3OIXA 4IPJA 3FYPA 5E93A 1GG1A 2VFIA 5DXXA 1W0MA 2GOUA 3SECA 1LBMA 2OX1A 4MLJA 3HG3A 4N9BA 5DY2A 2FPVA 1ZENA 1GTEA 4KWVA 2VKZG 1YDVA 1PVNA 5E0KA 2Z6JA 2HTMA 4FX8A 4BFAA 1OX6A 5CGQA 4JN6A 3P80A 3PM6A 1SFLA 1PIIA 4QJ1A 2JKEA 4UTWC 5D05A 4JTFA 5F4XA 3CEPA 2Y7DA 2PRLA 1ZALA 2YPIA 3CLMA 2YW4A 1Q6QA 2VC6A 4Y8FA 4ZZ9A 3EX1A 3EEGA 1TPDA 1QPNA 3FKRA 1KTCA 2DORA 4P2VA 1RD5A 4YWIA 4H6KA 4RJEA 3CWOX 3LV6A 3STEA 4N2YA 1AMKA 5T26A 3TC6A 5AHNA 5F2IA 1Z41A 3G1SA 3W7RA 3W7EA 5KINA 2CLLA 5TBOA 1A5CA 3LDVA 1WOAA 3C8FA 4O18A 3L67A 3ABQA 4GNJA 1JR1A 1GYLA 3ANYA 5CG7A 3P7YA 3O6YX 5L9FA 4O57A 3RLUA 2C13A 5FEWA 4DEFA 1Q3NA 3KOFA 1JRBA 1O5KA 4UTWA 4CQAA 1NSJA 5D2TA 3W9ZA 4TMBA 2G95A 5EYWA 1LTDA 3NPWA 3KVLA 4OBTA 2GVJA 2B7NA 2H8XA 3JS3A 4UNKA 1P1XA 1JQVA 6ALDA 3LHZA 2O7SA 1T96A 2TRSA 3UXAA 3UWYA 3IGUA 1F2JA 1GG0A 3HGJA 2HS6A 4O1AA 3ATZA 2B7QA 3QPZA 3NVTA 3C2EA 2Y7FA 2EHHA 4O1DA 3H55A 3ABRA 1OABA 5IBXC 2ZA3A 3LXAA 2R91A 1DQXA 3QMSA 4JX5A 3TJLA 3S1WA 3NL6A 4LVGA 4UFHA 3CHVA 2FJKA 3NXFA 3PVFA 4IXXA 1F05A 4K36A 4OE7A 1S5WA 1FCUA 1EWDA 3L68A 1HL2A 2YW3A 4QSHA 1ZFJA 2OJPA 5D33A 4UNLA 1P0KA 1R46A 4GFSA 1PCWA 5F2MA 4BWLC 4K7VA 4MKNA 4R53A 1QMLA 3E02A 1HFBA 1DJNA 1UUMA 3O07A 1AL7A 2GJNA 5F1VA 5IM51 2CLFA 3F4WA 1H7RA 3RU6A 3G8EA 3LCHA 5HULA 1NVMA 3EX6A 3G1HA 5IBXA 1DV7A 3S5OA 3QM3A 3W7IA 4EOUA 4EVZA 3U8GA 1LRNA 3M0ZA 3LHWA 4JTUA 5EY5A 3GK0A 2PRHA 4RXGA 4KFNA 4LTSA 1W31A 4NQ1A 1G6CA 4O19A 3W71A 4UTJA 3MJYA 1J4EA 1TPVA 3GAYA 3LGEA 1LORA 4M7TA 3W70A 3R2GA 2W79A 4PH6A 3ZS4A 4FEZA 3KRSA 1A53A 2E09A 3WK2A 2NX9A 3WK0A 4AVFA 4JYDA 2Y88A 1I2OA 4XQ6A 1UCWA 2PC4A 3G24A 3V1PA 3D0CA 1HUVA 3O63A 5AOUA 1F73A 1TV7A 4MFDA 2LLEA 3TXVA 3HIJA 3ZFHA 1M7OA 3O6DA 3RMJA 4LC6A 3G1DA 1OFBA 2VFEA 4U28A 1GYNA 1WYIA 2A7NA 3MWAA 4WY0B 4JDYA 4Z1BA 2X1RA 1O4UA 2X2GA 4OHQA 2A5HA 4IWWA 2QCGA 3DGRA 1LCOA 4O16A 3LHYA 1MEHA 4RX0A 1N7KA 1KV5A 1VLIA 1BTMA 3W2LA 1P5BA 3WJXA 3S1VA 4ZQRA 1GVSA 1NEYA 5LKYA 4MVAA 3W22A 1X6UA 3PBWA 1SSGA 3LM7A 2WNQA 1T8XA 3EB2A 2X1UA 3MI3A 2E6DA 4PFMA 1DORA 3M44A 2E5DA 1W5QA 1L9WA 3W7OA 4X9SA 4QITA 3LCFA 4IX2A 2WPBA 5D02A 3NQ8A 1W8SA 2YR1A 4LVAA 2JKPA 3FLUA 3W1PA 3DHDA 3PR2A 3NL2A 2QUTA 2VEIA 4O4WA 2A21A 1SW3A 3NPUA 4O11A 4QNWA 2Y6ZA 1C9DA 4WY0A 1ZJIA 3NQFA 2FLIA 3RFAA 3P62A 4UTUA 5G5IA 3UZJA 3W7DA 3U6WA 3S5NA 4HSNA 4FNRA 4Z1AA 4ADTA 1AW1A 1QAPA 3DKJA 4IXHA 4GUFA 5H91A 4ZQMA 1KM2A 2KZHA 3TC7A 3C6CA 3C3NA 5G1TA 4JTIA 3L0KA 4UMCA 1H7PA 5HUOA 1ICSA 2I14A 2ZTKA 3MI6A 1H63A 3MBFA 1LLWA 2VENA 3BV4A 3UD6A 5DN1A 3CT7A 3WK1A 1VYSX 4JICA 3B06A 2AQWA 1SU5A 2GUUA 1R47A 1LM1A 3G1AA 4O0ZA 4YLWA 4UTTC 3L65A 2B4GA 3GYEA 2CLOA 1VLWA 2GVLA 1K7FA 3P5YA 3LERA 1YTDA 4AHOA 1OF6A 4JY8A 3MO7A 3MP4A 3W74A 2E1DA 1GZGA 3M43A 4XWUA 1GVOA 1EP1A 1EUNA 2NV2A 3R13A 3TQ0A 1PL9A 1TB3A 2ZRVA 1WXJA 3NEVA 3TDFA 3A22A 4PA8A 2ISVA 3TROA 2DZWA 5AYYA 1OFEA 7TIMA 2J88A 5AB3A 1GJPA 1VJIA 3LCLA 3SI9A 2WO5A 4NNCA 1X7FA 5CPMA 3TNOA 3P67A 3P8IA 4I7WA 5DCDA 1LDCA 3GDRA 3LOTA 4PTNA 2J24A 4DO4A 3I65A 3LHUA 3TAOA 6TIMA 3DFSA 3S9YA 3EXRA 4UTTA 1FXPA 3IVSA 1F6PA 4JDBA 3R12A 3P82A 1FXQA 4X3ZA 3UXDA 3WFAA 4M6QA 1IIHA 2Q3RA 3W1MA 2RHGA 5CZSA 2Y62A 2WSRA 2VFDA 2BWGA 1Y0EA 3DU0A 4EWND 3NQ2A 5C6MA 3I6RA 2QJHA 1CI1A 3TSBA 4AEOA 4FNTA 4LRTA 1FY6A 5FF3A 3HPZA 3M5ZA 3GKAA 3GDLA 2Z1BA 1L2UA 3GDKA 4RR4A 3UQNA 2YZRA 3LV5A 2AAMA 4UIOA 1YDNA 4Q32A 2H3BA 1K7EA 1TJRA 1U5JA 3M6YA 3F03K 4HPXA 5CPOA 4Z0JA 1KFCA 3E96A 4NX0A 4EIVA 1GVFA 1XBXA 3FA5A 4AHQA 4H3DA 2A2IA 3PUOA 1XBZA 2I9EA 5C54A 1LZOA 1TTQA 5AHIA 1OK4A 3LLFA 3W76A 3LBMA 2V9DA 3NPVA 3NDOA 2QCDA 1QDSA 1SO4A 3STCA 1AW2A 5G2IA 1GQNA 2V0TA 4RZ5A 3PUDA 1EB3A 4LUIA 4NXKA 2YDAA 3P81A 1B9BA 1KFLA 4PCFA 1TQJA 4UMAA 1OJXA 3JR2A 3GX9A 1PCKA 4RK8A 4NU7A 1I2RA 3WK3A 4LOCA 5HQEA 2C15A 3S1XA 3GR8A 4WUIA 2V8ZA 3NR0A 4MY9A 3L9CA 1RPXA 4R33A 3NNTA 3TW7A 5FF2A 3RF9A 4HNUA 2C14A 4UFLA 3P60A 3TAKA 5D2YA 4OV9A 5AHLA 4A2SA 3NL3A 2ZCGA 3N3MA 2CZEA 1SSDA 3DI0A 3O05A 1AK5A 3GKFA 4YCOA 3B04A 1TPWA 1XXXA 1QWGA 4AWTA 4WXYA 2QEZA 1P4CA 3TV8A 4JR5A 2NUWA 4WJEA 4D2JA 5L6UA 3WJWA 4GE8A 2NUYA 3LLDA 3NQ7A 4RZ6A 3W7QA 5D38A 3B03A 3IIPA 2FDSA 1F76A 3AJXA 3GDMA 3RNDA 5FESA 1TSIA 3W2MA 2GVGA 4BI7A 4IMCA 2ZBTA 2VOMA 4TIMA 4GUHA 4EF8A 4HSOA 3TKFA 5CZ0A 2BX7A 3NQGA 3VNDA 2G97A 1GVQA 3KFTA 3G18A 3SW6A 4ADUA 1VR6A 4O1CA 4O13A 3BLFA 3G0SA 4UTKA 2GQ9A 3FYOA 3CB8A 3NL5A 3GLCA 1YYAA 2DZUA 3KX6A 2NXIA 5D2WA 4DO6A 2I1OA 1W1ZA 4DF1A 3EWYA 5LHEA 2EKCA 2QCLA 1ML1A 1KLZA 4YL2A 4GRSA 3L0GA 1LOQA 1I45A 1QOQA 3W07A 1OVDA 3N19B 4WZHA 4CQ9A 3LTPA 3A23A 3OBKA 3P5ZA 3MHGA 4Y96A 1DOSA 4ZL1A 5BW6A 3TE9A 2H6RA 1BKSA 1DHPA 4A3UA 3NQEA 2ISWA 2DJXA 3G3DA 3OHIA 1EP2A 3BG9A 4JGDA 4UFJA 3W2JA 4K7YA 1XBYA 4GUJA 4JD4A 5D04C 3HGSA 3LXCA 3VCRA 4E38A 1EWEA 4FNSA 1VCGA 2IQTA 1Z48A 4UFKA 2FFCA 3S0CA 4YXGA 3M9YA 3QZEA 2ABAA 4N9CA 5J5RA 2ZZ6A 3NQMA 1EX5A 2X30A 3ATYA 1LOSA 1J5TA 3OVRA 2AGKA 1DVJA 1OK6A 1XDMA 4CCDA 1UUOA 1L6SA 5LNUA 2NWRA 2RFGA 2WJZA 2ZQ0A 4QIUA 3IGXA 5I3GA 2CWNA 1R30A 2FIQA 1JJKA 3PBVA 3UWZA 4UFMA 3MBDA 1TYGA 3A9IA 3NZRA 5F1UA 2ZZ1A 1TV8A 4O1BA 1CW2A 3T4CA 3C2VA 4UFIA 3N9RA 2BTMA 2ZRYA 2ZZ2A 3HO8A 3HG2A 3W1XA 2R94A 5LGXA 4JYFA 4FNUA 4R7JA 5EMUA 3SR7A 2XFWA 4RXFA 4DBDA 5HWJA 4IGHA 3TMLA 2A0NA 1AG1O 2NWSA 1OX5A 5AFDA 2XN1A 3QC3A 5DLCA 2G5WA 1SR9A 3DENA 1A5AA 1SQ7A 3B8DA 5EA9A 1NFBA 2QDHA 3LRKA 5MHBA 4CQ8A 3S8HA 4XKYB 4LU0A 4LWWA 5LSMA 2XN2A 4NUWA 2PE4A 2ZZ7A 4N02A 1KM3A 5K4ZA 3G1VA 4LY8A 3TFXA 1TQXA 3QYQA 1B4KA 3FEMA 4JTKA 1FCQA 3FIGA 5F4SA 2CZDA 2PRMA 3CWNA 2ZDRA 1ZCOA 5TQLA 1QCWA 4JTTA 3W7KA 3N34A 3QFEA 1I8JA 2Q8ZA 2YFOA 2B0MA 3A5VA 3O16A 3TSMA 3QMRA 1JCYA 3Q37A 2J9XA 1KW1A 1YPFA 4CCEA 4N4PA 3P61A 5FI8A 3NAVA 2JGYA 3IGSA 2ISSA 3M5XA 4RCXA 1SPQA 3KRZA 1HTIA 4O15A 2YCEA 3BVJA 3BW2A 3M1ZA 4XKYA 2Q8LA 3H53A 5ABTA 3R8RA 3DFPA 5CZJA 1SO3A 3DH7A 2HS8A 4RZ4A 1XDLA 5D37A 5KMYA 2OZ0A 1OFRA 3N14A 1TREA 3PS7A 1MO0A 4I9AA 5I3HA 1OYCA 2X1TA 2FPTA 3NQ6A 1TPEA 2ZRUA 4AF0A 1S3HA 4PL2A 5K2ZA 3HPXA 4IPIA 4DPQA 2QUVA 3M7WA 3W2UA 3HJZA 2QUUA 2ZRXA 3W7HA 1IXPA 3W75A 2QCFA 4IUOA 2QCCA 4LT9A 3PC0A 3I68A 3SSJA 4TU1A 2ZA2A 1JCLA 3T55A 2O7QA 5LGZA 3E9AA 3CIWA 2X1SA 5DBUA 5HWNA 1W56A 2FTPA 3PSWA 4N4QA 1DBTA 1XC4A 2CLMA 2V2DA 3B0UX 4JXCA 4Q4KA 4BWLA 5HNRA 5AYZA 3MP3A 1JCMP 2C16A 2QJIA 3EX3A 3PUEA 1XL9A 1O60A 3OVPA 2C6QA 5BOOA 5AHFA 4YMZA 1KM6A 5E1QA 1UJPA 3VFLA 2EGZA 1IXOA 3Q58A 4TMCA 2EF9A 4G1KA 1VZWA 4A2RA 5FEZA 2Y70A 1A5BA 2QCEA 5F2LA 3QMTA 1MEIA 1GWJA 1RQEA 3SGZA 1TPFA 3HGOA 3O06A 1OHLA 5K3VA 1TPB1 3MP5A 2A7PA 3C52A 2A6NA 4FX7A 1P0NA 1XCFA 1FDZA 2V81A 4OT7A 4QISA 3N9SA 1VS1A 5CZTA 2PURA 4CLMA 5I3KA 3O15A 4E0CA 3CM4A 1C29A 3U2OA 1S5VA 3W1NA 1TMHA 2E5BA 2Y85A 3IIVA 2DZPA 4MPQA 2WNZA 4MY1A 1HO4A 2CLKA 2J27A 5EPDA 3W1AA 1MEWA 4LVDA 3TR2A 4UTHA 3C0JA 1ZNNA 3EWZA 3USBA 3THAA 4BI5A 1K8ZA 5I3IA 1QOPA 3N73A 2WKJA 4NJHA 3B0VC 1C8VA 3PB2A 4UR7A 1G69A 3G0XA 1W5PA 1G4SA 4U4MA 1TV5A 1JUEA 1LBFA 1M6JA 4NZFA 3HPSA 3IVTA 1FWSA 1W3TA 3SGUA 2F7FA 5SWUA 3TUUA 1JQXA 4KFOA 5HWMA 4BR1A 1JUBA 3PBUA 4Z1DA 3TXZA 1KBIA 4TR9A 1Q6LA 4ZQPA 1LYXA 3SJ3A 1UB3A 1KFEA 4KWWA 3P84A 1SZFA 4JNMA 3L5AA 2F84A 1I2NA 1H50A 4UCGA 1O94A 3MHUA 3O6CA 4RV8A 1QPQA 3BG3A 4M6VA 1Q6OA 2WQPA 4CCCA 2Z2UA 2E77A 3TCEA 1PE1A 5KSWA 3DXIA 1GTHA 2RDUA 1KFJA 1D9EA 3HGRA 4I7UA 3W7MA 4K8EA 1TCDA 3S1UA 4ZQNA 2DZVA 4HKPA 2E68A 1RZMA 2RDTA 3NOEA 1YTEA 1I4NA 3ZWTA 3GXNA 5FEXA 1H61A 4OU1A 4RLIA 1A50A 4IMEA 4AH7A 1OFAA 1XI3A 1G7VA 3CPRA 4OGZA 1BWLA 4UUIA 3L5MA 1IIGA 4DXVA 5AC8A 2ATMA 1FUYA 2DZXA 2VFHA 1EEPA 3N2XA
chains in the Genus database with same CATH superfamily
3E0WA 5DBTA 4LSBA 4JTDA 4OFCA 1W9BM 2VELA 1BTCA 1JCJA 1UR2A 5U7SA 2D0FA 2J66A 4PMVA 4DWDA 5LNRA 5BZAA 1D8CA 4DJEA 5KEZA 3IJQA 4AZ6A 3DIPA 4MDOA 2D2OA 4D71A 3LRLA 1IZCA 4NAFB 2V38A 4GX9A 5M1TA 3P3BA 1XKJA 4HN8A 4X9YA 3ARVA 5H8UA 1JPHA 2EG7A 4EPEC 3G1FA 1Q13A 4ORMA 2GLKA 1MZHA 5E6YA 5C55A 3EA3A 5BOEA 1MRAA 2YA0A 4WHBA 1XBVA 2VEGA 4IX0A 4OBSA 2ABBA 4HZ8A 1R3TA 1LOLA 4LYPA 1UWUA 5CBIA 3OLEA 1YPIA 2R1PA 2ZWYA 3TIMA 4MIMA 3LHTA 3WL1A 4X60A 1SFJA 4V33A 3GC4A 5GNYA 4N9EA 4IIHA 3VI2A 2C8NA 1YDOA 1JCNA 4OWGA 3MYPA 4CQCA 4PL1A 1S2WA 3F4DA 1OQFA 3G0UA 3T2OA 1KD0A 1ME8A 1UBSA 1HG3A 3G1XA 1QASA 2R14A 1MXGA 3W7PA 5I3FA 2JEPA 3WEZA 2IPWA 4Q7BA 1PSCA 3WELA 3W2NA 1EL3A 1DJQA 4LCRA 2QIIA 5K9CA 4DLMA 4AZHA 5IDZA 5AZ0A 4ZCWA 4O12A 2CW6A 4UOZA 1BD0A 2CHNA 4NASA 2HVNA 5A2BA 5AN7A 3O7UA 2ZIDA 2Z29A 2WKLA 3UWEA 4PYSA 1QU4A 4NXSA 4ZOAA 3IIZA 1JUKA 2ATSA 1W3IA 5AC6A 3BMVA 3K1DA 3TJ4A 3VE7A 2YXGA 2NQHA 2VURA 3GDTA 3Q65A 4LVFA 3DECA 3WQ4A 2QCHA 4RNIA 1AD1A 1EO5A 4BEQA 3RN6A 2YKKA 3EXTA 1HKIA 1LBLA 1FWHC 4LX4A 4AC1X 1E3ZA 1G4EA 2A3BA 4Y90A 3V75A 1XLFA 1HVXA 3G2GA 2C1GA 2GJLA 1WBJA 4MZYA 1UIOA 5LNWA 3NSXA 2F2HA 5G2HA 4UZSA 4WY0F 3BMWA 1K7XA 2E5CA 3BLLA 3RG6A 1TZZA 4URIA 4GXWA 2GYIA 3AIRA 3N1AA 1IF2A 1BXNA 1KR0A 1W54A 1OX4A 1K8YA 1KRAC 3DI1A 2VZVA 3WYZA 4JIHA 1NU5A 2BSLA 4FLOA 2V68A 1FWWA 3UT0A 3FCPA 4NSBA 1FHLA 4MUZA 5HR7A 1SJAA 4IFOA 1W3JA 3LSCA 3P0XA 4O17A 4PSRA 1R2RA 1ZAJA 3LI1A 4Z08A 3MANA 4IG2A 1V3LA 2ZOXA 1OCNA 3C0LA 2ZZ3A 4GH3A 4INFA 1WCGA 3FVMA 1XP3A 4QBXA 2PCQA 4DWSD 1E5NA 3GXMA 1D7FA 3LU2A 1VCVA 3CL8A 3N2CA 4CD8A 3RK8A 3TP4A 4XIMA 5BOFA 4HIBA 2EPNA 4V28A 1VGAA 2DW7A 1U1UA 4BK9A 3GH7A 1RVGA 1DQWA 1VQTA 3HZ3A 4M19A 4U2ZA 1FOBA 4EPKA 2X16A 5LA1A 1Y7VA 3DFNA 1YKWA 5HJYA 1KXTA 4ACZA 3TFCA 4W8AA 1KCZA 2FH8A 1ZLPA 1BWKA 2DSZA 3HMJG 3R94A 3W4RA 4KW2A 2QUNA 3KTCA 4MJMA 5A2AA 4D8LA 3W7JA 1FWEC 1TE1A 4GJ1A 7ENLA 4XBSA 1MSSA 1X6LA 5DRCA 1H60A 4GNVA 1E6QM 3C56A 3MI2A 3GWQA 3PK7A 4HHLA 3PNZA 1RQBA 3LGDA 4X2RA 3B0XA 4Q8WA 4C6BA 2JF6A 4BQ3A 2VQUA 1WZMA 4R27A 3AFBA 3C4UA 2GDUA 1FWRA 4L61A 5LZLA 1CECA 1V7AA 1D3GA 3D6NA 1HJQA 2NT0A 3L23A 3CUHA 1J01A 2DIEA 1J96A 4J3XA 3R43A 3CUGA 5E70A 3FHQA 3WFLA 4L80A 5I0DA 4DJFA 3TZNA 3U4FA 1KWGA 4KIRA 3QW3A 1AQMA 2OWCA 1Q8JA 3XIMA 2B7OA 3LTSA 2B7PA 2EAWA 1F8MA 1NP2A 3EA2A 1E9IA 1KTBA 3LCWA 4Z0SA 4D8AA 3FEQA 5D8ZA 4DAFA 4DWSC 4HNVA 4GBUA 3WNOA 3CAVA 1F6KA 1E71M 1W3KA 4DWSB 1K6AA 4JTRA 4MYXA 3SQMA 4UBPC 4OIFA 2HDJA 4LUTA 4DBEA 1V51A 1WX0A 2GK1B 3DFQA 2OU4A 2OO0A 1AL8A 1B9ZA 2OQHA 4HCHA 4RW3A 1P1MA 1F7BA 4M6PA 2P8CA 1K03A 1WOBA 2VX5A 3M07A 1XF0A 3ITYA 4IZGA 3VNMA 4DN1A 5CAHA 2IW0A 2NXHA 2W4XA 3BWWA 4ZE4A 2Y7GA 2CBIA 5A2CA 3VOFA 4UR8A 2Q8XA 1VD6A 4JTSA 4L4MA 3UEQA 3OVGA 3UJFA 3W26A 2QDDA 2WKGA 1THFD 3EDDA 2VO5A 1UJQA 4RV3A 3B8VA 2WPGA 1GONA 1XYMA 3AS1A 3NXLA 1UASA 2DJLA 3K2GA 3I7RA 3DG3A 5DF0A 2TMDA 1VC4A 2RKXA 3GZ3A 3KVMA 3QGAC 4S3BA 1RA0A 1KQZA 3GO2A 3PUGA 2WVSA 2WMIB 3FNDA 3GXIA 3F5JA 3FVDA 1FDYA 4HA4A 3AIQA 4HA1A 3FJLA 1YLVA 4NJJA 3WLSA 4QRNA 1W3LA 4K39A 2C19A 4EF9A 1VBJA 2VYOA 3UERA 4KQNA 2PPGA 4J3SA 5LIKX 3IUIA 3BUVA 1JVNA 4GXMA 1EGVA 4GG9A 5BU9A 3ECQA 4R85A 5JBFA 4W8BA 4WOQA 2CLEA 3NCOA 3QR1A 2ZRWA 4ZXOA 3A3WA 2J62A 2G3IA 3PZMA 4D6CA 3N04A 4OQVA 2EO7A 1TTPA 1AW5A 2CFFA 2CEQA 4LUJA 5FEPA 3DZ1A 1J0YA 4H83A 1BEUA 4JTGA 4JFTA 2J8TA 3JRKA 4C6EA 1HXJA 4O54A 5I02A 4AZCA 3LB0A 5CXPA 4QTGA 2VGIA 1VJSA 2WLYA 1JEZA 5H8MA 3AC0A 2EKGA 3DHFA 4MB3A 5CQ1A 3NDYA 1RV8A 4GCAA 3KHJA 3VGFA 1ZB5A 1F74A 5DXYA 2O55A 4L1XA 3FOKA 1KRMA 5C9UA 3HQ1A 2A4AA 3L2IA 4GX8A 3S6TA 3TQKA 2XH2A 1OF8A 5CC3A 3PANA 1JYWA 3GNDA 1CWYA 1OSEA 3QQWA 3L0NA 4M1BA 4XV0A 4F79A 4G6CA 1SW7A 1J0KA 1A4LA 3VC6A 1H51A 1KM5A 5DMLA 5A8PA 3N2BA 2I5QA 4B92A 2CBJA 1XIHA 3IVUA 2WNWA 3ORWA 3TNBA 3R4IA 2D73A 5D30A 1VCFA 1VB9A 7CGTA 1NAL1 2HBXA 1FCBA 2ZYFA 2PF8A 4LS0A 3ID7A 2QV5A 3PB0A 1X7IA 1XUZA 3V5CA 2OT1A 4KMQA 4E2BA 1ZL1A 4NAEA 3UWQA 1OYAA 3OIHA 4M24A 4O10A 3F7JA 2WW5A 3A5FA 2VXNA 2L5HA 3NYZA 1T99A 2INEA 3VIHA 1UR9A 5KZDA 3TMQA 1WZLA 3FDGA 4DO5A 4AXKA 3BANA 1MNSA 4TX9A 2D23A 4YS1A 3BV7A 4QM1A 2FJUB 2W0UA 1JYXA 4AIBA 2Y5SA 1W3NA 4MADA 3WLMA 4NZCA 3NZ1A 1VENA 1E40A 4IPPA 3ARXA 4XSMA 4TX8A 2FZNA 2YBUA 3O8AA 3MDWA 3QY6A 1RR2A 3BO9A 2A7RA 1I2PA 1VBRA 2CKRA 3BARA 1W9PA 2PEVA 2YX0A 2JKAA 3CIVA 3CMFA 3RU8X 4HYVA 3SUTA 2OZTA 4NG3A 4WEVX 4IQLA 3IV3A 1L6WA 2YOCA 4W84A 4EWJA 1E5JA 2VGBA 1DJIA 1XSJA 1W1PA 1IXQA 3W2KA 1E9ZB 1UR1A 3NGJA 2QDGA 1W6TA 4P5UA 4L9XA 5BRQA 3WF0A 3LBCA 2WB5A 3QV8A 1GPWA 5BNKA 3NM3A 1IEQA 1K8XA 3WH6A 1D3HA 3WF2A 1IZKA 4NT0A 4US5D 1A5SA 2E6YA 2JFEX 3C61A 3NFUA 4H9XA 4A3RA 1X8CA 2JE8A 3IJ7A 3B4UA 4R9OA 4XD4A 4PC8A 3NOYA 1SO5A 3VOJA 2E40A 5LIXX 2OG9A 4XO7A 2VC9A 1ECEA 3EDFA 5JUVA 4FX6M 1JNEA 2J7HA 1WUEA 1ONWA 1S2CA 2XFRA 1KFWA 4AVOA 1V6WA 4UXDA 2E25A 1GEQA 1MW0A 3VFCA 3CV6A 4ZO6A 2NSOA 4K8GA 4NZ3A 1BRLB 3BZGA 3VE9A 3W25A 3N17A 2J4GA 3TOYA 2UWFA 3OIXA 4IPJA 2V5DA 1GQLA 2Y8UA 3FJNA 1GG1A 1DPMA 5HMEA 1W0MA 1CBGA 3SECA 1LBMA 3RX4A 4MLJA 4D72A 2VKZG 1YDVA 4XISA 1IV8A 2EG8A 2J7DA 2CBUA 4QJ1A 3VDGA 3FA4A 4UTWC 4JTFA 1A5MC 3WH9A 1TVPA 5TD4A 2PRLA 3JU2A 4BZYA 1FFRA 4GZ7A 3PN8A 3CWHA 4Y8FA 3PPFA 4MNLA 4MWAA 3EEGA 4MAZA 2VCBA 2Z1XA 1TPDA 3PP7A 2DORA 3QZ6A 4R7OA 4YWIA 4H6KA 3STEA 4N2YA 5T26A 2X7WA 5F2IA 1Z41A 1H2JA 3G1SA 3W7EA 1XD1A 4WR3A 5KINA 2QPXA 5A94A 1WOAA 3FA3A 4ATLA 2IKHA 4GNJA 1JR1A 1OT1A 3O6YX 4S3AA 2DT3A 1VAHA 3CUFA 5M3WA 4G9PA 1JFHA 3WNLA 4MNKA 1LQ0A 1CGVA 1LTDA 3KVLA 2GVJA 4DNMA 2DH2A 2IKGA 4NY2A 5C7HA 2XINA 2BHZA 4WK9A 5I06A 4H6QA 3EOLA 1V6YA 3IGUA 1GG0A 3CAQA 2HS6A 3MS8A 2XGBA 4O8AA 2Y7FA 5HNUA 3ABRA 3ZJ7A 1T40A 5CCZA 2X41A 1EQCA 1T7LA 1KGUA 1DWIM 2X1IA 3KS5A 4WLCA 4XD6A 1EC7A 3AYRA 3L68A 1TELA 4JN7A 4QSHA 3CQIA 1ITQA 4NI3A 1NQ6A 3NVDA 1XLCA 3J7HA 4I5RA 3WQGA 3KL5A 5D33A 4WKAA 1PCWA 5F2MA 5MKGB 3ARTA 2O56A 3SAZA 4MKNA 3TLLA 3E02A 1HFBA 1XS2A 3HPFA 4CGTA 1G5AA 3O07A 1AL7A 5F1VA 3KRBA 4GIYA 3G8EA 2PI6A 3UNTA 3DERA 3ARRA 3S5OA 4M8UA 1E56A 2ZVRA 1C9WA 3GK0A 4RXGA 4MAVA 4UZUA 4QCEA 3W71A 5CC6A 4UTJA 2F61A 3LGEA 2AOSA 3ZIZA 4JQ4A 4EKJA 3UP8A 2D2JA 4X2PA 1RUSA 5HATA 3VD4A 3KRSA 1A53A 4K68A 3SADA 2E09A 4QDPA 1UWSA 4JYDA 1I2OA 4F2UA 1UCWA 2PC4A 1CLVA 2OQYA 3O63A 4MFDA 3TXVA 3BE7A 1LWIA 3O6DA 2I9UA 2XIIA 4QE1A 1WYIA 3E0FA 4WY0B 2QULA 3SRKA 4Z1BA 4IWWA 2QCGA 2R82A 5FJJA 4IJCA 4RX0A 4XZNX 1KV5A 3LPPA 1W1IE 1ZQ5A 3CMGA 1VLIA 4AWEA 4WCJA 1HN1A 1HT6A 3WJXA 3LNMA 3W0KA 5A6TC 1X6UA 1H09A 1T8XA 3N6HA 1PX3A 4PFMA 1KC7A 3LCFA 1F61A 3NQ8A 2YR1A 4LVAA 2JKPA 3ZT6A 3WIJA 5XIMA 5DMMA 2C1IA 3ANVA 3PR2A 3NL2A 2QUTA 5EGRA 4O4WA 3K46A 2WVVA 1C9DA 3BLPX 3RFAA 1YRRA 3V36A 3UZJA 3W7DA 5CAKA 5A6BD 4R7WA 3E2QA 1NWTA 3DKJA 1BSIA 2CETA 2KZHA 3TC7A 3MV01 2MANA 3LPFA 3IJ9A 1PZ0A 1UD6A 1H63A 2VX6A 4JICA 2F6UA 2GUUA 1UD4A 1EDGA 4AZ7A 1UPMB 3L65A 1D8WA 1X38A 4LFYA 1K7FA 4G7EA 4AHOA 2X2YA 1R3WA 2E1DA 1GZGA 1UOZA 1O66A 1EP1A 1EUNA 3OU8A 4IQEA 1XPYA 1WXJA 3TDFA 4PA8A 2VCCA 4QEEA 3ICJA 5AYYA 4EPBC 2PDLA 3KP0A 5AB3A 1GJPA 4Z2HA 4HCDA 4NNCA 5JIWA 1US2A 4J4KA 3TNOA 1XW8A 4GCXA 3WMSA 5DCDA 4L6HA 2TAAA 1OGGA 4DO4A 3I65A 3LHUA 3REQA 3DFSA 3U7VA 4E6MA 5D9OA 3SBFA 3R12A 3WUEA 4JQ1A 3WBYA 2DVUA 2CERA 3GNXA 2BWGA 4R9XA 1Y0EA 5E0CA 3WQVA 3NQ2A 5C6MA 2QJHA 3TSBA 4AEOA 2VEFA 5CH9A 2INFA 4FNTA 3WDJA 1FY6A 2XG9A 3NURA 3M5ZA 2Z1BA 1L2UA 3KWSA 2YZRA 3AYVA 3LV5A 4ZOBA 1QHPA 5T91A 4UIOA 3M6YA 1K7EA 4HPXA 5CPOA 4NX0A 1GQJA 4H3DA 4C6CA 2A2IA 1S1RA 2I9EA 1TTQA 5AHIA 2IPJA 4HNOA 1HP5A 4MB4A 4IHCA 3T42A 1F3TA 3W76A 1DJZA 1DJXA 5HPCA 5G2IA 1GQNA 1EB3A 3P14A 1K4HA 3P81A 3N15A 3SN1A 4R88A 1KFLA 4PGLA 3EGJA 6CGTA 1PCKA 2YL8A 4RK8A 4XAYA 1I2RA 4H41A 3UF9A 2JEQA 3S1XA 4HU0A 3GR8A 2C71A 2PD5A 2V8ZA 4NAFA 5FF2A 4D6FA 2ZXDA 2FYMA 3QKEA 3GKFA 5DQPA 4YCOA 3AI0A 4TV6A 3NO3A 4AWTA 4D1JA 2QEZA 1P4CA 1E72M 3TV8A 4Q8OA 1G0CA 4E8CA 3N13A 1NM9A 4CCZA 3SCOA 4TVCA 1MQQA 3WJWA 4B2DD 1ZCCA 1CDGA 3WD1A 3AXHA 1XSKA 3APTA 3M0IA 1XLEA 2ZBTA 3KOYA 4EF8A 2G4FA 4HSOA 5CZ0A 3NQGA 2ZVIA 3KFTA 4F2BA 4ADUA 1VR6A 4O1CA 5TF0A 1GQKA 1UWAA 3WH7A 4G2DA 2BFGA 3U2CA 2HVMA 3AICA 3MC5A 2WVTA 3Q67A 3M46A 2EJ1A 3PTMA 3KX6A 2NXIA 5D2WA 3UVIA 1X97A 3LS9A 1W1ZA 2EPKX 4XAZA 1KLZA 3F2CA 3OZYA 1QOQA 3IUDA 1OVDA 4NL1A 4WZHA 4QJ3B 3QGVA 3LTPA 5F7UA 3SQSA 3A23A 3AAMA 2X7VA 1E6NA 2MUCA 1QUMA 2PBGA 2ONEA 1W9XA 3NQEA 1EJRC 1WKEA 2DJXA 5C8BB 4JGDA 1P7TA 3W2JA 4HOWA 4JD4A 3LXCA 4LBRA 1EWEA 1Q2RA 1GOKA 4W4QA 3K8MA 4UFKA 4DJDD 3M9YA 4JOMA 4L6OA 4J27A 2ABAA 2YCIX 3UG5A 3ITGA 4A05A 1MWOA 1XYAA 1W1A1 2X30A 1EF3A 1I1XA 3LN3A 4CCDA 1UUOA 1L6SA 4GMEA 3SEPA 3IGXA 1MI3A 2CWNA 4UFMA 4PMYA 3NZRA 1NWSA 1P0DA 4O1BA 3WNMA 1XIMA 4UFIA 3UZYA 2BTMA 4TTGA 4WDWA 2E67A 3GTHA 4E5TA 3MV11 3IARA 4JFSA 5EMUA 3BAWA 3QLDA 1DE6A 4DYEA 3B4YA 4IGHA 4J3VA 2BV9A 1AG1O 5E5CA 1LF1A 1Z8AA 4AYSA 5AFDA 2XN1A 3FAWA 3VDCA 5DLCA 3AXIA 1H41A 2PTXA 5EA9A 4Y8EA 4G1NA 3FHAA 4LU0A 3WUGA 4NUWA 4LALA 2BODX 4DUXA 1F3EA 2WJEA 1HGWA 4LY8A 3UW6A 1CGUA 1EYWA 1WE5A 2ZC8A 3Q4DA 5TQLA 1JZ7A 4RZBA 4JTTA 4AU0A 3W7KA 3MUIA 1S2TA 4O0QA 2YFOA 3IS4A 4HTYA 5JMUA 2J9XA 4PCNA 3C0QA 1CIUA 5FI8A 3GHRA 3N2OA 3G6LA 6XIAA 3IGSA 2ISSA 4RCXA 3TN3A 3BVJA 1NTHA 4DJDC 3H53A 4JEJA 2NQLA 3N14A 1TREA 2X0SA 3T8LA 4WF7A 4AZ5A 1OYCA 2X1TA 2ZRUA 5I77A 4PL2A 2ZX8A 3HPXA 1XH1A 2XGIA 1F07A 1J2BA 3W7HA 3KLKA 3WLHA 1IXPA 4C1NB 1B30A 4IUOA 2VRQA 4LT9A 3UGRA 1E4MM 4AMCA 2BDQA 3KLLA 4C90A 4XAGA 2ZA2A 2OO6A 4S3GA 4Y2WA 1OZMA 2O7QA 2E7FA 1UMLA 3CIWA 1PZ2A 1AD4A 1DBTA 4LCSA 3KL0A 1XC4A 3GE7A 3B0UX 4JXCA 4QDWA 3ARUA 2X42A 4JFVA 2C16A 2QJIA 1ZRQA 1BVNP 1EOMA 2ISFA 3W00A 4M80A 5AHFA 4YMZA 5AVHA 1UJPA 2NVDA 1UKSA 2CLPA 3WNKA 3K4AA 3QMTA 2FFIA 1I60A 1RQEA 5T9CE 1JYNA 1TPFA 2D24A 1XLJA 3AHXA 4P8VA 3TONA 5H6HA 4PUNA 4IP5A 4C6PA 2XIMA 1FDZA 2V81A 4AVNA 1VS1A 3II1A 2XVKA 5A6MA 4CLMA 1TA3B 3HV9A 2PDBA 4E0CA 7XIMA 2GK1A 2Y85A 3IIVA 1B54A 2DZPA 1BQCA 3I3DA 3KM8A 2XU2A 1UD8A 3IJDA 3PWIA 3W1AA 4LCQA 4HK7A 4N42A 5CGTA 1B0IA 1ZNNA 3GSMA 3O9NA 1E55A 1EJVC 4M56A 4BI5A 1BVWA 3N73A 3B0VC 4N7QA 3PB2A 4KETA 1K4GA 3WLJA 3G0XA 2J79A 1EF2A 2QNEA 2ZX5A 3IVTA 3GVVA 4NF7A 1Y65A 1DXEA 3GG0A 1JFXA 4BR1A 2XJ7A 4PB3A 4TR9A 1Q6LA 2OXNA 3AIBA 4NI8A 1NDVA 2WMIA 2QV4A 1CEOA 4UCGA 1O94A 3MHUA 4LAMA 3SY8A 1QPQA 4F9DA 1Q6OA 5A95A 5A6AA 1KXVA 1JD7A 5IFTA 2AAAA 1V0NA 2Z2UA 3NZQA 2VNCA 4AIEA 1UOKA 3KBJA 4K8EA 2DZVA 2E68A 1GW9A 2RDTA 5E9XA 4LXFA 3ZWTA 5FEXA 5I00A 3UR2A 4RLIA 1A50A 1I0BA 1D7KA 1EC9A 4UUIA 2POTA 1IIGA 1UZ4A 4K1GA 4ZR8A 1TJ2A 3W27A 4KBXA 2QCDB 5GNZA 1DIDA 2WMHA 4Q8PA 3QSTA 1DIOA 3WENA 3IACA 4GUGA 3D47A 2Y7EA 1Q6EA 4LEQA 2A1YA 4LNYA 3BXWA 1VFHA 1AJ0A 2QMJA 1V6XA 1B3OA 3NO1A 2OMAA 3UBPC 4CD5A 4AAJA 5HINA 4IICA 3N2MA 3M6DA 1XKYA 3WQCA 2A3CA 1ZU8A 3GYCA 3NG3A 1HKMA 5LHFA 1SFSA 1L6YA 4GK8A 1VBHA 1AUSL 4NRSA 1WKFA 3RHGA 1J10A 4XTIA 4CNOA 3BAIA 3ZYZA 4ES4A 3FGCB 2CITA 4GISA 2ZUUA 3VC5A 1H1YA 3HG4A 4BQ5A 1JL8A 3GY1A 2V5BA 1W3HA 1S5TA 5D2VA 1TV2A 3G3MA 4HBKA 2IPFA 3A24A 2TODA 3BMXA 3MUZ1 4M0XA 3V0TA 4WSJA 1LG1A 4DYKA 3BGJA 1X1NA 4CNNA 4NP7A 2PDMA 1KBJA 7ODCA 2YDQA 5CBJA 2WC7A 1QO2A 4HHPA 1TVNA 3CIXA 1XD0A 2V2HA 1GJUA 3W1QA 2DU2A 5FF4A 1W5OA 1OY0A 1US0A 3APYA 4W8LA 2I16A 2GGEA 4LUSB 4JTEA 1ME9A 2VX4A 1SZGA 4HMCA 3OG3A 1E51A 3BLEA 1W5MA 3CHCA 1QNRA 1EIXA 3DKLA 3W7LA 2W61A 1GKRA 3N18A 4XZ9A 4UQ9A 1ZZMA 2ALDA 2WMJA 1E6ZA 3T7VA 3P74A 3CTLA 4UTLA 3B05A 4LAZA 3CBWA 3PG9A 3TYUA 1PO9A 4ZENA 4QEHA 3R1ZA 1M53A 1MW2A 4B5NA 1G4PA 1RJQA 1YDYA 3M0JA 3MW7A 5FOOA 3EX4A 1PZ1A 1R2TA 1QXLA 2OR2A 1AH3A 1DIEA 3I10A 1PTAA 3S3GA 3LEPA 3QY8A 1YXDA 3EKLA 5JVLA 4HN4A 1LT8A 1VIWA 3QOKA 1OX4B 4ZB5A 2ZADA 3SY5A 1JZ8A 4AWSA 1EJSC 2FVKA 3STPA 3TYCA 4DJFD 3SCSA 1JCXA 5EMMA 2QR6A 4NJIA 5EFDA 3WQWA 1KWKA 1DJWA 4CD7A 3NZPA 3PFRA 1KB3A 3B8IA 1D3CA 4GYPA 4DY1A 3NQAA 1UD3A 4AW7A 1GKPA 3S42A 2PA6A 1PUDA 2G3NA 4FXRA 3PWAA 3WUBA 4IGMA 1KTNA 5ENLA 3WDQA 3STGA 5HMDA 2E6AA 2VD9A 3N12A 4W86A 3C2FA 1W32A 1C8XA 1ZPTA 2BMBA 5CGMA 1EZWA 4S3DA 3LX9A 4NZJA 4XAFA 3T9PA 4N6EA 2X8RA 2W6RA 3CC1A 1BRLA 1EFZA 3C0SA 4ACZB 3B8TA 3KBVA 4IMDA 5DCEA 3T0CA 2YCJA 1TX0A 1N8WA 2ZFAA 1BYCA 3NSMA 4FP1A 1B2YA 4M82A 5A8NA 4WXZA 1GGOA 3O0FA 3AXKA 3UJEA 1A5NC 1NH6A 1QNPA 4MJ4A 5I09A 3AWNA 3BW4A 4KRZA 1W1B1 2G96A 4NKCA 4F0HA 4GABA 1ITXA 3WF4A 1ISZA 3WN6A 3DESA 2NZLA 5AZ1A 1BSLA 5HMSA 1QI0A 1IZJA 3GVQA 3R58A 3GXPA 3OZMA 4FLSA 3IIOA 2QPUA 4B15A 1ZTVA 3GW3A 1GNXA 3IUHA 4HP5A 4DJFC 4AF0B 3FKKA 3OVQA 3FK4A 3LCGA 3DG7A 9RUBA 3B8WA 4KWSA 1GVRA 4O0KA 3IJIA 1KGXA 1MUMA 3PSVA 4EXQA 2OT0A 3DBNA 2WSYA 1BG9A 4ZMGA 4PMXA 4S3CA 1HZYA 2NXGA 3BDKA 3R10A 1OFDA 4JL1A 4H9YA 4H8VA 4CD6A 3S2NA 4H2HA 5FL1A 1S2VA 2PGRA 1UP0A 2V5CA 1KCKA 3FS2A 4QJ4B 4N6FA 3VIIA 1ZHAA 1TJ0A 2J9ZA 1K02A 1DJYA 2RJHA 5C5YA 3MHFA 2YL5A 1IR2A 3LRMA 3HB9A 4LUTB 3SUSA 1E15A 5BU6A 3E12A 3E0LA 5HR6A 2A3EA 4KCVA 2O4QA 4UTIA 2PDJA 4GY0A 4V15A 3MMDA 1G7UA 3W72A 2C3ZA 4XSLA 1DKWA 4DBUA 3VD3A 1V3MA 5D03A 3WDIA 5A6JA 3LQGA 1SJCA 4W93A 2CZFA 4W5UA 1OCQA 3N6QA 5IFPA 1EJXC 1HO1A 3RLGA 5TIMA 3TYDA 1POKA 4GLEA 9CGTA 3GC2A 1XDJA 2QHAA 2QKFA 2C0AA 4IJBA 4AB4A 2W62A 4GVGA 3RX3A 3T6CA 1JIBA 3DOPA 1V6TA 1SZNA 1YIXA 3RCNA 1SW0A 2ESCA 1QW9A 2E4TA 2QZRA 4IQDA 3SCPA 4OBRA 3M64A 1IEWA 3SZ8A 4GUIA 4HHMA 2NLYA 1F4HA 1PIFA 3CU2A 2D20A 3RM8A 1ICPA 3KAOA 1W5NA 3U57A 4EPDC 4X61A 1QBBA 2IQ0A 1XR2A 1JI2A 2PODA 1R3YA 3U9IA 4H9MA 1TWSA 4GVFA 2FHBA 4LUYA 5AHEA 2FDMA 4XUGA 2WLZA 4O50A 1Q4WA 3GW0A 4M29A 5K7JA 1JRCA 3QEZA 4CN1A 1RLDA 1A0EA 1WDRA 5CPLA 1PHWA 2ON3A 2Q09A 1KCLA 4C6IA 1TTJA 1Z44A 3FSUA 3TTYA 3VPLA 2XVNA 3C2RA 1XQKA 4AZCB 2YLAA 4JL2A 4F0SA 3D5HA 5LYRA 1JULA 1EA9C 1AZ2A 1UP2A 4MB5A 4W7WA 3R89A 3VNIA 1Z32X 2XSAA 1A4MA 3IAPA 5H2ZA 1XRFA 4YCPA 3DAQA 3VNKA 4L4PA 3CHEA 1SUXA 3QKZA 4BS0A 3B9OA 4GIRA 5BMWA 3TX9A 4DO7A 3CH0A 3KTSA 2J8GA 2Z1SA 2PDPA 3RPDA 1U1JA 1EJTC 3N3TA 2FPYA 2VR2A 5K9XA 1BG4A 3MY9A 1K1DA 3BSMA 1J12A 3CUZA 2WANA 3W7CA 4B4HA 1ZAIA 1HKKA 4JX4A 4B5XA 3BW3A 1SFTA 4ZXLA 1ISWA 1G67A 2J78A 4JEQA 1V8EA 1FCVA 3S46A 1H62A 4FR6A 1TFVA 4P8UA 4JTHA 4DI8A 3VOCA 5G2WA 4UTFA 3QR0A 1ALDA 1R86A 1O5XA 4ECLA 3K13A 3HBLA 3GVGA 3LXBA 2GGIA 4O53A 3SQLA 4MZ1A 2BY1A 5HQLA 3R0UA 4A22A 2HISA 4IMGA 1OG0A 1WDWA 2A6LA 4JS3A 1YXCA 3UYIA 3IGHX 2WMGA 2PTWA 3W1RA 1BYAA 2CCRA 5J5DA 4I5XA 4LQ1A 3UYCA 4IMFA 5FJPA 4PTVA 3N9KA 3W1UA 1H7OA 3PHAA 1QI5A 2HE8A 1EKOA 2YYTA 4JIQA 3KVJA 3UXLA 4H9ZA 3ZMRA 3TSDA 1YNPA 4GWEA 1WKYA 3M0KA 3OYZA 1O12A 4PMNA 4HD5A 3LPGA 1MMFA 4MWAD 3GTFA 1ELSA 1H7WA 4ERIA 2GJXB 2QAPA 3LYEA 7REQA 4LAUA 1GEHA 1U83A 3QSRA 2PDFA 1OGSA 3RIKA 2PMQA 1V6UA 2DZTA 4J2PA 1DTUA 3VIPA 3AUJA 1O95A 5CEWA 1BVZA 1ICQA 3LI0A 1UH4A 1XIEA 3R5EA 2WK2A 3WD4A 1MUCA 2P3EA 4D6HA 3UWWA 1V5XA 2IUZA 4F48A 3E0VA 3LENA 1X39A 2VDGA 1HKWA 2Y89A 1KFBA 1XGDA 3PTDA 3SO7A 3WNPA 3TYEA 1TPC1 1SZEA 1REQB 4EK7A 2FZDA 4LF2A 1UP3A 3R7MA 1HJSA 1FWBC 3ZZ1A 1B3ZA 1E1CB 2OZ8A 4IFKB 3TH6A 3ZJKA 4NJKA 4GVIA 1E73M 3VIJA 3VDHA 3WQ5A 2BVDA 3IJLA 3DFTA 1U30A 4A6GA 1CXFA 3JVAA 3NYDA 4HTBA 4FNQA 3W83A 1H7XA 4XBKA 1M5WA 4FALA 3F2BA 1UKQA 3QH2A 3ALGA 3BL3A 3CZGA 2D3LA 1TJ1A 4B9YA 1DWJM 4GC3A 1H7NA 4M1RA 1SMAA 1XX1A 3F2DA 1S2AA 4YIWA 3GXFA 4H7VA 4BJHA 4S38A 2WWDA 2GQ8A 3EWWA 3LUTA 1N8FA 2O9TA 5XIAA 4MOZA 3FX4A 3LSBA 3ZR5A 3TW6A 3GNNA 3PZNA 2XZ7A 1OFQA 2H90A 2DPEA 1JGMA 2ANUA 5IXEA 2WV8A 3RXZA 1HJUA 2V2CA 1J5SA 1J18A 4B5UA 2R1LA 2CLHA 2FGZA 3TTSA 1B57A 4FB7A 3DHUA 1V02E 4B4FA 3DYPA 1PKLA 3L21A 3CL6A 1O68A 4GC4A 3CZEA 4MNJA 4H8NA 4UTMA 1ONEA 4MWAB 3GG1A 4AIOA 1EA0A 3H22A 5E93A 3MUY1 1R85A 2VFIA 4IF2A 5DXXA 2OX1A 4QG8A 3HG3A 1ZENA 3MPGA 1GTEA 4FX8A 5TAOA 2YCLB 3DYMA 1C91A 4JN6A 3P80A 3PM6A 1SFLA 1PIIA 5D05A 1KO0A 1DJGA 3VD9A 4O1EA 2WJDA 1XCWA 2Y7DA 3VKBA 5A6SA 4PUKA 4ZZ9A 4CN6A 2DT0A 2AMGA 1QPNA 3FKRA 2PDQA 4XZMX 1QNOA 4RJEA 3M0YA 1E6RA 3CWOX 3LV6A 1XYFA 3TC6A 1FHUA 3WD2A 4ZO8A 2OOGA 2W66A 3UCCA 3U5UA 2AKMA 3LDVA 3C8FA 1E0XA 3PPCA 3L67A 4E2VA 5CG7A 5L9FA 3B8SA 2QW5A 4ATDA 3MVIA 1VPQA 1NSJA 5D2TA 1B90A 3DEQA 4TMBA 4XG1A 3M7SA 1RHCA 5BWAA 2ZXAA 2ZE0A 3VVGA 3JS3A 4UNKA 1P1XA 4NILA 5I2UA 3I3BA 2YBVA 3CZJA 1X6NA 3AHVA 2J13A 1VFLA 2FTYA 3VMOA 1V93A 4D6JA 3NVTA 3C2EA 2YDSA 1A0CA 1Q2SA 2FGLA 2WCSA 1TWDA 4Q4RA 3QMSA 1DQXA 2OLHA 4Q4SA 3TJLA 1CCWB 3S1WA 1WDSA 2FJKA 3NXFA 4Q8TA 2VGGA 1F05A 4K36A 4IGNA 1S5WA 3B40A 3MWCA 2Z4GA 1CXHA 3U2EA 4PMUA 2IXVA 2XVLA 2J74A 2KX9A 2SFPA 4BQ4A 4YN5A 6XIMA 4Q8QA 4GO9A 3BCFA 1U1HA 2O9PA 4LAOA 2VDHA 3GUWA 3IANA 4UNLA 4YJ5A 2HROA 5FJOA 3WY1A 3ABZA 4TVDA 5AYIA 1QMLA 5HK4A 3CUIA 1E9LA 3PZOA 2V3EA 4KCUA 4RL3A 5IM51 1FA2A 3F4WA 1D2KA 1IR1A 1DP0A 1NVMA 3EX6A 5IBXA 3QR3A 1R9ZA 3U8GA 4JTUA 8RUCA 5BCAA 5EY5A 1LL6A 3VXGA 4LTSA 2POZA 1W31A 4IFRA 3C86A 4XVDA 2HCVA 1J4EA 4MF4A 4M7TA 2VX7A 4JKMA 1Q7QA 1PTGA 3WMLA 2UY2A 4KH2A 4PH6A 5HPOA 2FVLA 4OUIA 3WK2A 2R9RA 4AVFA 1FVPA 1OGBA 1XWYA 2Y88A 4XQ6A 1XFCA 3WH5A 2JALA 4LJ3A 1J6PA 3D0CA 5AOUA 3G77A 2LLEA 4HHHA 1E1FA 1G9HA 3AU2A 3G1DA 3K5XA 2VFEA 3U5YA 4AEEA 1X96A 2WVVB 2Z1WA 2X1RA 4PUUA 2A5HA 3UZZA 4G5DA 2VJXA 1LCOA 4O16A 8XIAA 1F4AA 1MEHA 5D4YA 3FSTA 1BTMA 3W2LA 1P5BA 4ZQRA 1CZ1A 5LKYA 4Y7EA 3W22A 3PBWA 1SSGA 3AYTA 2WNQA 1XICA 5BXTA 3PWGA 3MI3A 4WKHA 1PKNA 2E6DA 2YCKX 1R0MA 3AJ7A 3W7OA 2YXOA 4UQBA 4TXEA 4GVHA 1KBBA 4FLRA 2WPBA 5D02A 1W8SA 3AMCA 5HANA 1XV8A 4MTVA 3H23A 2IPGA 4QNWA 4O11A 3NQFA 5FACA 3H2MA 4UTUA 2HVOA 4G7EB 3U6WA 1EJUC 4MGGA 5ECVA 2GQ3A 4Z1AA 4ADTA 1AW1A 1EIBA 2OB3A 3VZYA 4GUFA 1KM2A 2FHFA 3PJXA 2J47A 4M3PA 5G1TA 4JTIA 4UMCA 2PAJA 1ICSA 2ZTKA 3MI6A 2AL2A 4XZIA 3WQ8A 1TA3A 4C6NA 4PTXA 1XLBA 4AX7A 2FKPA 5HA7A 4Q6JA 4YLWA 4M6UA 4E4FA 2HE5A 3N29A 2B4GA 3REQB 1OB0A 3KBNA 3E6EA 1VLWA 1J8VA 1OC5A 3P5YA 2VR5A 4GI9A 4JY8A 4RE4A 1C3FA 4G56A 3W74A 4ZB0A 3T81A 5FAJA 3O3RA 4UR9A 2NQ9A 2BS9A 2ZRVA 1UR4A 5A1AA 1OFEA 5M5DA 1VJIA 3LCLA 3VYLA 1XISA 1E4NA 2XIQA 5REQA 4QCFA 3P67A 3TTQA 4I7WA 1XLAA 4QG9A 1LDCA 4FZIA 4L5ZA 3GDRA 3LOTA 4PTNA 3H2FA 4I90A 3RRAA 3TAOA 3BCJA 2ASHA 1GVYA 3S9YA 3EXRA 4UTTA 3IVSA 1XPGA 4I8DA 4YPJA 3P82A 4X3ZA 3UXDA 4G7FA 1TG7A 1H3GA 3L4YA 1MUWA 4PRRA 1T5AA 2Y62A 2VTFA 4C7GA 4IM4A 4Y9OA 2VFDA 3BTNA 3DU0A 3KW3A 1GQIA 4DXXA 3ZLGA 3O2LA 2NW0A 3QTPA 3RJXA 4LRTA 5EMJA 4Q7IA 2XPKA 4Q32A 2H3BA 1TJRA 4RDWA 4HU8A 4A8RA 1KFCA 3E96A 4WGHA 1ITCA 1XBXA 1M3UA 4H00A 2PTZA 1VFFA 5C54A 1V3JA 2VZSA 2C0HA 4AX6A 1AVAA 1A80A 2FZBA 2QCDA 5FAGA 1QDSA 2F9RA 1L0PA 2V0TA 5C9ZA 4Q22A 3PUDA 2G3JA 2DDXA 2YDAA 1IT0A 4FR1A 1PDZA 4UMAA 3GX9A 3OGVA 4NU7A 2GUBA 4LOCA 5HQEA 1YNYA 3NR0A 4R33A 3NNTA 3RF9A 8CGTA 4UQCA 1V3HA 4UFLA 3ZSTA 2XH4A 2DY3A 3P60A 5D2YA 5AHLA 3NL3A 2CZEA 3DI0A 3B04A 1F3WA 1QWGA 2BVYA 2Y8VA 2Q71A 3FGCA 4KERA 2NUWA 1JZ2A 4D2JA 4Q6XA 2OLAA 1XQLA 4B16A 3IIPA 3AJXA 1CTNA 2HV5A 2EPLX 5AC5A 1LWJA 4RDZA 1TSIA 4IMCA 3RX2A 2O9OA 4TIMA 3VCCA 1NDYA 1E70M 4JHZA 4J3TA 4ZO9A 3G18A 3WDPP 1Q7MA 1XH2A 4O13A 2ADAA 3BLFA 3IJ8A 3VDAA 4UTKA 1LL7A 2V3FA 4BCEA 3MZ2A 4F4RA 4LUSA 1P7TB 3GLCA 4FPSA 1YYAA 1R8LA 3C2YA 5I24A 4DM1A 1IHIA 4Z1YA 4DO6A 2PWUA 1SGJA 3RO8A 2AKZA 3EWYA 3SCUA 4L7ZA 4KWOA 2EKCA 2QCLA 3OO2A 4MKSA 1ML1A 1E4LA 4LYRA 3L4WA 1LOQA 4MJ2A 1OD0A 3W07A 3WKZA 4CQ9A 4KT2A 4EXBA 1DTNA 4A8IA 1VPYA 3AZSA 1TUFA 3V0SA 2WVUA 1BKSA 1DHPA 5EU9A 2DEPA 2I5GA 4U5KA 3RM9A 4UFJA 3RAOA 2V63A 2Z24A 2CWXA 3VCRA 1VRXA 1DE5A 1POJA 4MUPA 4YXGA 5LA0A 4KEMA 1JXKA 5HQMA 2ZZ6A 4IPLA 1EX5A 4LB4A 2VT0A 3S4TA 4L65A 2AGKA 3VKAA 1LG2A 1XDMA 2RFGA 3E2VA 4EANA 3WUFA 2PWEA 2WJZA 2ZQ0A 4QIUA 1V4YA 4GACA 5I3GA 3RILA 1R30A 2FIQA 4A35A 3PBVA 3VUSA 4YHGA 5F1UA 4QG6A 1CW2A 1LLOA 2YXXA 3T4CA 3E2RA 3L2LA 1F9CA 2E8YA 2BNJA 1W2VA 3ISIX 1HJXA 5LGXA 1F6YA 3CJPA 1U2YA 3SN4A 4R7JA 1GUVA 2OELA 2Y8KA 4MPKA 1XCXA 1B3YA 4AISA 4BKNA 3QC3A 3MSGA 5C7VA 2G5WA 1SR9A 3VIFA 3E5PA 3S2JA 1FHVA 1R3SA 2QDHA 3LRKA 3B9AA 3GDBA 4CQ8A 3G6MA 2PE4A 4Z2JA 4GNKB 3MU7A 4N02A 4PMDA 1NP0A 3G1VA 2D22A 4REQB 1TQXA 1IEIA 3QYQA 4ZA0A 3FIGA 5F4SA 1JPKA 2PRMA 3FDKA 3TN5A 2VCAA 4GGHA 2DQXA 3QFEA 1I8JA 4XVEA 2B0MA 3VA8A 3TSMA 1PX8A 1JCYA 3CO4A 1KW1A 4CCEA 3SDOA 5KETA 3P61A 4HYRA 4AD1A 1JI1A 1RCQA 2JGYA 3KRZA 1P6BA 2YCEA 3BW2A 4XKYA 2X09A 4P8XA 3GH4A 3GH5A 1T8QA 1VIZA 1SO3A 5CZJA 2G8ZA 3TEVA 1RK6A 4RZ4A 4WSKA 2PDYA 3GU9A 4FAMA 3SCNA 5KMYA 1QATA 2OZ0A 2D69A 1MXDA 1I75A 3OZOA 5I3HA 4JAWA 3DDMA 3NQ6A 2PWFA 4AF0A 1S3HA 2QUVA 1MW1A 3M7WA 2R6OA 2QCFA 3GTNA 1S39A 3ITTA 4DIAA 2QCCA 3ZSSA 3N2TA 4PCSA 3I68A 1RY8A 3W53A 3ZVIA 4TU1A 4C5ZA 4YVPA 4D1IA 3D3FA 4DNHA 1Z89A 1VFSA 3FYYA 3AMLA 1M04A 3M4HA 5AYZA 3MP3A 1OINA 3UETA 3WFZA 3XINA 3UCDA 4AZBA 1AJZA 2C6QA 3WQFA 1KM6A 5E1QA 2J8FA 1CYGA 4QE4A 1IXOA 4AZIA 2BXZA 5C70A 1XLHA 1JF6A 4G1KA 3MSDA 4DZIA 3GNOA 3VAVA 4HJWA 2Y70A 1JDCA 3A47A 3QXBA 3SGZA 1RK5A 4Z42C 3NZGA 4Z2KA 3N6JA 1Z7AA 3MP5A 2AMXA 3UFYA 3USZA 2WHKA 3GD6A 3KOZA 3H2AA 4OT7A 1C93A 4GO8A 2PURA 2V5JA 3H24A 1GHSA 1MQRA 5I3KA 1C29A 1UQZA 1CLXA 3A6OA 1OADA 1I1WA 2I17A 3S5SA 4MPQA 4MY1A 1JDDA 1HO4A 2CLKA 5IHSA 1BWVA 1EDTA 4NZ1A 1FKXA 3V0UA 1IE7C 4QFUA 3B0YA 4LVDA 2DZBA 4E3VA 3QLLA 1A47A 3CYVA 3WQOA 1P6WA 1XYLA 4J3ZA 2W3ZA 3CV7A 5CPQA 4PUEA 5JH1A 2WKJA 4NJHA 4PMOA 1C8VA 4ZSTA 4BA0A 3UGVA 2GDQA 1TV5A 1JUEA 1M6JA 3EAUA 3B8UA 2HPIA 1W3TA 3SGUA 5GJPA 1JQXA 1XJBA 4IL0A 1W2PA 3TXZA 1KBIA 2GJPA 4ZQPA 3SJ3A 1TMQA 4TTUA 3P84A 1CENA 3L5AA 2F84A 3VILA 1Q8AA 1GCYA 3AUOA 3O6CA 2DUAA 1V02A 3AHZA 4NZ5A 1KFJA 4AY8A 2INZA 4ZQNA 3VX0A 1ADSA 3SCWA 2NQZA 3NOEA 2RGLA 4B5SA 3TOPA 1H61A 3CHFA 4DBSA 4AH7A 4OGZA 1UQYA 1BWLA 1Q4NX 1RY0A 3B9DA 1E0VA 4B91A 4DZAA 5AC8A 2XUCA 4GYJA 4FMVA 4ZSUA 2VFHA 1HJWA 5JQ9A 3N2XA 4B3ZA 1EJ7L 3T0AA 3LM3A 1MVYA 2OZ3A 2ZRZA 3UY7A 4F0RA 4MJZA 2OFJA 1S5NA 1YXYA 2OCZA 1V6VA 4XO6A 4Z17A 3FV9A 3PZTA 4PE8A 2Z1VA 4QDMA 4NX5A 4AD5A 3DFOA 3MYOA 2IKJA 3LG3A 4WQ6A 1WA3A 2DUZA 4PEKA 1PKMA 2ISDA 2PS2A 1ODZA 4R5EA 3MKVA 5LNSA 1YW1A 3H54A 1TPH1 3NJ3A 2XISA 3V35A 1W1YA 4C1LA 4DYJA 5EL1A 1X1OA 1HL9A 1XG3A 3CQHA 4GBDA 3T44A 4BF9A 4AFYA 3KP1A 2GDVA 3VOIA 3O1NA 2PBOA 3I7SA 3BOFA 3WLQA 4KWUA 1R9YA 5EBUA 1I2QA 4DQWA 3EMZA 3VKJA 4POCA 2VEKA 3OA3A 1RH9A 3N4EA 3ELFA 1V0MA 1FFQA 2F8QA 4PR4A 4N9DA 1QI4A 1HIZA 4HNCA 3EMQA 4JN8A 4K37A 3OJGA 2ZX9A 3UNDA 2E9BA 3VZZA 3TZFA 4XTDA 3LD5A 5CPTA 4P61A 1GVEA 1XLLA 4H1ZA 3CASA 1XYZA 4F3HA 2QJNA 7PTDA 5BXPA 4FK9A 3VNZA 3APGA 1FWIC 3HG5A 1K8CA 4FHAA 5EKYA 1UYQA 5CJNA 2EXOA 2GJXA 2DFAA 3GU1A 3S47A 3VMNA 4XZWA 3QQ0A 2TYSA 4JTCA 1BXCA 3VK5A 5IRPA 5G4HC 2PWGA 7TAAA 1B3XA 3UPBA 4JTLA 3WJSA 4OUEA 3UA3A 1U5VA 2XIOA 4KRUA 2BHUA 1ISVA 3MJMA 4L4LA 5DY3A 3HN3A 3BAXA 2EEXA 1J93A 1REQA 1VHCA 2FB3A 3TK7A 4F66A 5BROA 4I7VA 5I3JA 2GJRA 3FXYA 1BF2A 1E1CA 2ACSA 3GIYA 3G22A 4IFKA 4M51A 1CXIA 2PDKA 4Q8MA 4KCTA 4PFHA 4A21A 4FXSA 1N2VA 4C6LA 1XLKA 4JQ3A 4PBGA 2QCMA 3CQ0A 3WD3A 1PYMA 3KZSA 4ERAA 4US6A 1Q45A 5M2FX 2D0GA 2Y61A 4EAMA 2VVNA 4ADSA 3KVKA 4U31A 5BMXA 4K38A 3OTRA 2CZ5A 3QPYA 1K6WA 4LV4A 1TRDA 4JTJA 2IMRA 4HOXA 2ICSA 5CLTA 3TWAA 2QPSA 3S2MA 4HB7A 1R3VA 1ONXA 1ZSXA 2BASA 2G41A 3ARWA 1EH9A 3GNRA 4ZB2A 1RCXB 4TV5A 5AYXA 4F2TA 3M16A 4PRWA 5D2XA 2ALRA 4ROPA 8A3HA 2BHYA 3H26A 1WV2A 2X0HA 2JGQA 2J6VA 3I4EA 3AHTA 2VEPA 3GBDA 4DBWA 5CPNA 5D32A 2D2HA 2VUYA 3PY2A 3GAKA 2HMCA 4BY3A 4E2DA 3M5VA 4IP7A 2Q6ZA 4AMAA 5U4NA 3UR5A 2VZTA 3BCDA 3NQCA 3SIZA 1PS9A 3ITXA 1I9CB 2W63A 4K6AA 1K9EA 4QAIA 4FNPA 4CEXC 4V1YA 2YCLA 1KV8A 4HVXA 1KM4A 1XRVA 1NFGA 2PGEA 4GKTA 1V77A 4EACA 1TR9A 4IOTA 2WSQA 3ME3A 1TKKA 1PAMA 4E3TA 2WWCA 1A5LC 1WZKA 1FBAA 3AOFA 1UUQA 4O14A 3EWXA 2HNHA 2V82A 2FTWA 4NRRA 2E3ZA 1F5ZA 3KBSA 2XIJA 3SN0A 2DZAA 1OC7A 1H1ZA 4IQJA 1OG6A 3INPA 3AZTA 2P0OA 5FL0A 2J75A 3T07A 5BYWA 2R8WA 4LW7A 3ZWSA 4V1XA 5G1YA 2VM8A 5AHMA 3TVAA 4ZGYA 1JYVA 4MZ8A 4HCLA 5A8GA 1LJYA 3ES7A 4IIEA 1QI3A 3VTRA 1OIFA 2BXVA 1H5YA 2P10A 4B9ZA 2YFNA 3UWVA 3O6AA 1IQ8A 4O4VA 3HQOA 3EXSA 3BLOA 2CXEA 2WNNA 3EPMA 4UMBA 3AALA 2RH9A 5KITA 1EUAA 4FO4A 3Q94A 4AD2A 1M7PA 4GQ0A 4L6DA 2CU0A 5A8OA 3T1GA 4A3QA 4X0VA 1T0OA 1H5VA 1KA9F 2C18A 3PBYA 2QDEA 2CESA 4DUOA 1FRBA 4LS2A 3WQ6A 1A3WA 1QO5A 1ISXA 1FQ0A 3OB8A 4JQ2A 3CK5A 3BQ6A 2I57A 3LCIA 4RE2A 3H8AA 1O5RA 4ICNA 4QE5A 5LIYX 1Q6RA 3RRXA 2RJGA 5DCBA 3ABSA 3P8JA 4XX6A 4LF1A 3PJTA 2QAFA 4JCLA 4O52A 2RAGA 1DWAM 1R2SA 3UJSA 3ANUA 3OOQA 3ZT5A 1YADA 2WSPA 3QQ1A 1ZBVA 3HTWA 1AQHA 2D3NA 3DCPA 4ZVJA 1FWJC 1QNSA 2O4MA 5GVJA 3LQLA 3VIMA 4J9JA 1LRTA 2GGJA 3RPTA 5D09A 4MSSA 2WCGA 1ZBCA 1X98A 1TPUA 5I07A 3SFKA 2VGFA 3NM1A 4NIRA 3BAYA 4WOZA 4C1KA 1QPKA 4WKFA 5EFFA 3VUPA 1QFEA 3HOJA 3S9ZA 1XRTA 1TTIA 3S9IA 4LYQA 3THQA 1IEVA 1VBUA 1VHNA 4JQAA 5CKSA 2FB2A 2Z7GA 1AH4A 2J7FA 1BGGA 1P0BA 2CXGA 3Q45A 3MQTA 3OQ8A 4BF7A 1KFKA 2E0PA 3UXIA 3JZEA 4MWAE 3L5LA 1NWRA 1TIMA 3W29A 4H2CA 3G1RA 1MXSA 1NIUA 4UWMA 1XH0A 4JBRA 4DZHA 1OFOA 2VVSA 1FWNA 3WO8A 3N11A 1ZAHA 3SCTA 1ADOA 3QHOA 3I3EA 1DXFA 4ZQCA 3CEUA 4DI9A 1UC4A 3BLIA 4IISA 3C2OA 1OYBA 2YL6A 2Q3OA 4KFPA 1IEXA 1ITUA 4HMDA 4LV9A 3NA8A 3OLIA 4JX6A 3ENLA 4GI8A 3CV1A 2ZUMA 1JXJA 2GZXA 3CGTA 4H4IA 4LRSA 2ZZ5A 3URQA 1EPXA 5HUPA 1GHRA 5BRBA 2GQAA 2YJQA 5C0QA 3EWUA 3S5ZA 9XIAA 4XD3A 2FHCA 4BI6A 5CSSA 1LLZA 4P7OA 1PJ9A 3WLNA 4S2CA 1R5YA 5AC4A 1XIDA 3IIXA 1YQ2A 3EKGA 3VABA 1EZ2A 2YIHA 1UWQA 3WCZA 1T6MA 3EZ4A 4GD0A 4JPGA 4P7RA 3EKZA 1CGXA 3W1TA 5CZKA 1G4TA 4MLRA 4KF1A 4E8DA 1ONRA 5KZMA 1NJJA 5C9XA 4ONVA 2DGAA 3DX5A 3GVRA 1Y5VA 5ABGA 4S39A 2TPSA 4NNBA 3EX2A 3IEBA 1VEMA 4QQ3A 5E09A 4LEFA 1RJPA 2HRWA 1TR1A 2A79A 4CU8A 1GOQA 4ROQA 2GOKA 3QF0A 2VWSA 4RKAA 7REQB 3A4JA 3VGBA 4XZLX 8XIMA 3YPIA 4W88A 4FF7A 3W37A 1A3XA 1VKFA 3K30A 5HAOA 1B31A 3UY8A 1BGAA 5A5WA 1XIFA 3WLOA 4Q8NA 4PODA 1W8GA 5C2XA 3W1LA 2ZUWA 4UQDA 1VEOA 4WRHA 5FJUA 4LAKA 3L4XA 1K77A 3JZUA 3A9BA 2ZUVA 1OT2A 4MY8A 2QLYA 3EYPA 4DPPA 1Q5MA 2GFTA 2YYUA 3I6TA 5AC7A 5C9RA 2BOFX 2CLIA 5K9DA 2H9AA 2PDIA 4LC8A 4P7LA 3UWUA 4FXJA 5DANA 3WD0A 2QS8A 4HU3A 1P6CA 1FWTA 1Q6GA 4Y9NA 3VOGA 2BLEA 4PRTA 2PFHA 4MYAA 2VRJA 4Q4OA 2BZNA 1WBHA 5FIPA 2ZA1A 3WF1A 3QYSA 4PEEA 1FP8A 3AXXA 5I3DA 1GZJA 1VPXA 3L7RA 4OKDA 4UC5A 3ARSA 3DGBA 4QR6A 2X0YA 3DN5A 2NLIA 1LWHA 3LHVA 1TJPA 4Z1CA 5K4XA 1PWLA 1WQ5A 2WZIA 2XN0A 1TIWA 2QYGA 3SM0A 1LL4A 3BOXA 1FHDA 1YE4A 3ARPA 4WDUA 4ZE5A 2ZZ4A 2EQDA 1ZY9A 2EBNA 5E6ZA 4FSAA 2XFYA 3IJ6A 1IGSA 1BKHA 3BAKA 3P0WA 4P7QA 2WYSA 3WMCA 1RJRA 1ODUA 4Z2IA 3NSNA 1CXKA 3CYJA 2ZTJA 3BJTA 3TQVA 5LNVA 1QT1A 3HF3A 2BY0A 3Q2DA 2VRKA 3OGSA 2ZXBA 1U22A 1XLGA 1O5QA 4W87A 3UJ2A 3BPWA 2BB0A 3CXOA 4PMZA 1M41A 4KCWA 2FZ9A 2VFFA 3TQPA 1VBGA 2PU0A 5M03A 3M47A 3DHPA 3LY0A 3W6LA 5CLWA 3RYSA 3UU0A 1B3VA 2JK2A 3PFMA 4S3JA 4CD4A 5A6KA 4DXKA 1Q65A 5DY2A 2FPVA 3MUCA 2DUXA 1XIGA 1PVNA 4C6KA 2HTMA 4YYFA 1O1HA 3QOMA 1BFNA 4H19A 1TWIA 2WHLA 2JKEA 4QXIA 1R6WA 5F4XA 3CEPA 3R8GA 2OVLA 3SCRA 4L4OA 1ZALA 5A3HA 2ZWZA 3AIEA 3CLMA 2YW4A 1AQ0A 1Q6QA 3EWDA 2NVAA 3ALFA 1VF8A 3CZ8A 1G1YA 4IH3A 4RDVA 1KTCA 1ZJHA 4P2VA 3UG3A 4ASTA