4K8EA

Oye1-w116v complexed with the aromatic product of (r)-carvone dismutation
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLVVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 150
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k8eA00
4MYXA 4B5NA 3C2FA 2OCZA 3O63A 1EA0A 3MI3A 4LVDA 2YFNA 1PHWA 5DCEA 4O4WA 5HUPA 2WQPA 3T40A 3KXQA 1E51A 4UTWA 1PL9A 3F03K 3T78A 1VR6A 1TIMA 3RNDA 3CC1A 3CWNA 3IEBA 1SZNA 4U28A 2DZSA 4UTKA 3KX6A 4WX2A 3SI9A 1W5QA 1YXCA 1ME8A 2V0TA 1FWWA 3WK2A 1PE1A 4UC5A 4WZHA 4WJEA 2Z6JA 4WOQA 4ALDA 3UQNA 1H1ZA 5DXYA 2Y7DA 1BTMA 3KRSA 1CI1A 3B05A 3ELFA 2I1OA 3HB9A 1QOPA 2TMDA 2I14A 2X30A 3W7QA 2VXNA 1SW0A 1B3OA 3MI6A 2EKCA 5CKSA 4XTIA 2A7PA 2DU2A 4JYEA 3UY8A 4IWWA 3N14A 1GJPA 1FDZA 1FX6A 3PB0A 4GNJA 1A50A 2BLEA 2YYUA 3GLCA 2X1RA 3H53A 1TTQA 1JCMP 5BOOA 1TYGA 1VCVA 2NLIA 2YDAA 3TR2A 5CZSA 2TYSA 2WOQA 3QEZA 5I3FA 5HJLA 4O18A 5CPMA 5AHLA 1AW5A 3FKRA 4FXSA 4UMCA 3PG8A 4LNYA 1U5JA 5D2TA 2H6RA 3M47A 4E2BA 1B57A 4HNVA 3BGJA 2A4AA 4K8EA 2ATMA 4IX2A 1WOBA 5EPDA 2VC6A 1LYXA 3DBPA 3RU6A 4MY8A 1DJQA 1M6JA 1YADA 2GQAA 4PL2A 4K38A 3R89A 4JYFA 5KMYA 1M5WA 4BWLA 4FNTA 4TX9A 3SIZA 4JTHA 2ZRUA 1NF7A 1QPOA 2BWGA 4I7VA 4MFDA 1XBVA 4UIOA 3PSVA 3QMTA 2JKPA 1K02A 2Y7EA 3IIZA 3TCEA 3R5EA 1YTEA 3EXRA 1MO0A 3DI1A 2O7SA 4UTJA 2QCCA 2ZQ0A 2B7OA 4LY8A 4A22A 3EWZA 4QSHA 3PY2A 5CGQA 1LRNA 1KM5A 3Q94A 1M7PA 1F76A 2J9XA 4PC8A 3E02A 1DOSA 1QWGA 1TSIA 5KZMA 3USBA 4RK8A 2PCQA 4W9TA 3DI0A 2NXGA 2V82A 1OF8A 3E9AA 3MW7A 4K7YA 1ME9A 1VZWA 3GXTA 1G6CA 1NEYA 2V5LA 1RQEA 2EAWA 3S0CA 1JUBA 3FFSA 2WNQA 1F5ZA 2V9DA 1GQNA 4JDBA 5CSRA 2ZTJA 3NZRA 1LBLA 4TU1A 4O50A 2R14A 1A5CA 4AF0A 5BNKA 4LVAA 3E49A 2YXGA 1KM0A 3L5MA 1HL2A 2QCHA 4K6AA 3LGEA 2X1UA 4MLRA 4NU7A 1XFBA 5D05A 4LRSA 3EEGA 1XUUA 3A5FA 1IXPA 3O06A 3ABOA 1KV8A 1QPNA 5K9XA 2XN2A 2DP3A 3S8HA 3S5NA 3MMTA 1G7UA 1EP2A 2ZA3A 4NJGA 5AHEA 4Z1DA 3LOTA 3W7DA 2G97A 4Y6GA 2VOMA 1TJPA 3LV6A 3HBLA 3O6YX 2H3BA 5G4WA 3NPWA 3SGUA 1VHNA 2QF7A 1SQ7A 2YFOA 3HG3A 3W1UA 1AL7A 4ZQRA 2Y85A 4HHPA 5FF4A 3NQEA 5AOUA 4ADTA 1DL3A 5T26A 4EVZA 2C6QA 4NQ1A 4DF1A 4GBUA 5D03A 3O16A 3RLUA 1P4CA 4TIMA 5EKYA 3G1VA 4IUOA 4JTEA 4AHOA 3NG3A 4N2YA 3MO7A 3W70A 3DFQA 5MHBA 4UFKA 3H55A 4ZQPA 5K9DA 2FJKA 3OIXA 3JR2A 1X8FA 3IRDA 4XKYA 3LBMA 3LCHA 3TMQA 1K7FA 1OFPA 5C6MA 3TDFA 5F2IA 3HQ1A 3M16A 2GPTA 2E5DA 3G8RA 2QCMA 2VEIA 4UNLA 3QMSA 1JRCA 3FJLA 1J5TA 1QOQA 4UTMA 4FX8A 1X6UA 4X3ZA 4ZQCA 5KZDA 3G0SA 3NQ2A 4O17A 4ZQMA 2YPIA 3G3MA 2WNZA 5C5YA 1KV5A 4IMFA 3NQVA 5DY2A 4AWSA 5D30A 2YR1A 4JXCA 5F1VA 5D38A 4O52A 4LC6A 4QAIA 2ISWA 2Q8LA 3W87A 4CQAA 1B9BA 1RQBA 2CLMA 1PCWA 2Q3OA 3QMRA 5GVJA 2YYTA 3GZ3A 1UASA 1K8XA 2NUWA 1F7BA 3W71A 1OX4B 1O5KA 4Z08A 1WA3A 4AHQA 1UUMA 4ADSA 5K3VA 1FQ0A 3DHDA 4N9CA 1HFBA 2C1HA 4R34A 3N73A 1X7FA 4OBTA 3PBYA 3IVSA 3M5XA 1A5BA 1PS9A 4DF0A 1KM1A 3PM6A 1NVMA 1YDVA 3W2LA 3LRLA 8TIMA 2ISVA 5I3HA 1W3IA 4BF9A 4DBEA 1YTKA 2J27A 3H54A 3P60A 2ZZ3A 3IVUA 3HG2A 4RV8A 3FLUA 3CPRA 4QNEA 3TW6A 3P84A 3GXNA 4O13A 1B4EA 2X2GA 3HIJA 4O19A 2FLIA 1W37A 4ORMA 3W1PA 4JY9A 1SW3A 3P82A 5CSSA 1FWRA 3CHVA 4FNPA 2QJIA 1OABA 6ALDA 1OHLA 1K8ZA 4UFHA 4EF9A 1SSGA 4HSOA 1EIXA 3MYOA 1TPC1 2E6YA 1F6KA 3IV3A 3ANYA 3DKLA 5J5RA 1SU5A 3QW3A 1EB3A 3LV5A 4NXSA 4YCOA 4NNCA 1DQXA 4BFAA 4N4QA 5LKYA 1RZMA 4CCDA 1OFRA 3MP3A 1GVRA 5G5IA 1ZNNA 3A5VA 3NQDA 1ICSA 5SWUA 3ZR4A 2E5BA 2QJHA 4HNUA 5FEWA 1IIGA 3EXTA 1K7XA 1Q3NA 1PVNA 3U2OA 3TAOA 1RPXA 4LRTA 3IGXA 3TQ0A 2FPVA 2VFGA 4O8RA 1JVNA 4O28A 4WQ6A 4M6VA 3QZEA 3LERA 1G7VA 3TXVA 2ZA1A 1YDOA 3GR7A 4NT0A 3GXPA 2BTMA 2ZZ7A 4ZVJA 4ZZ9A 1N7KA 5U4NA 5D04C 4AEOA 1VCGA 2HS8A 2JBMA 1Q45A 3NL6A 3TC6A 4KFNA 3W73A 2JKAA 4EF8A 4NNAA 2CW6A 5FF2A 4A29A 4LVFA 5G1YA 1FDYA 3NL5A 1GOXA 1H5YA 3RFAA 4NX5A 1TJRA 1KTBA 1H7WA 2NXHA 3DFTA 3NQGA 3NQMA 3PC0A 4WY0A 3QW4B 3TXZA 1OX5A 5LNUA 1HG3A 2E5CA 4O16A 3LCLA 3A9IA 1KM3A 2PURA 1YTDA 3NA8A 3PUEA 2QKFA 3C0JA 3L68A 3W2KA 3ATYA 2BSLA 2Q3RA 3G1YA 1JCLA 2NXIA 2VENA 1VYSX 1VYRA 4A2SA 3I6RA 3QRHA 2CLIA 1TCDA 1XCFA 1R2SA 4UMBA 3W7OA 1R2TA 1LORA 3UNDA 3DENA 3DHFA 1HUVA 1NAL1 5D2XA 2ZRVA 1VS1A 3EXSA 3LXCA 3S5OA 2CZ5A 3NR0A 2E77A 4P61A 2VKZG 1SZGA 1NF0A 4TR9A 4XBKA 2J24A 4LT9A 1VC4A 3UWVA 1LM1A 1B4KA 1EP1A 1I2QA 3OVPA 4CLMA 3P81A 3M9YA 1I2OA 3GYEA 3E96A 1UBSA 4JR5A 1GEQA 2NV2A 3LLFA 4ICNA 2ZZ2A 4H3DA 4YWIA 1LOSA 2E6DA 4TMCA 3DFNA 1KM4A 5H2ZA 1A53A 3M0ZA 5G2IA 4OU1A 3BV4A 3STEA 2JK2A 3W1AA 3CLMA 2QCFA 1AG1O 1KFKA 4JYDA 3DGRA 1MZHA 1GVSA 5KTLA 3C56A 5DXXA 1UCWA 1Z48A 2FTPA 3NPVA 2P10A 1F05A 1AW2A 1C9DA 1RVGA 3BLFA 2RHGA 4O1DA 2ZRXA 2VFHA 1TREA 2EF9A 1UJPA 1QMLA 1TV7A 1NFBA 5HQEA 2CZDA 2QDHA 5HMSA 5LNVA 4AVFA 1W5PA 3W7NA 4IPIA 4Y9AA 3MWAA 3O6DA 5KINA 1OVDA 4CNNA 5HWMA 1IXQA 4N9BA 1W31A 4RZ4A 3UWYA 1AK5A 4H6KA 4L4MA 1D9EA 1GYNA 2W0UA 3TQVA 2Y6ZA 2QDGA 4FO4A 1YDNA 1IXOA 2YCEA 4O0ZA 1ZAIA 1D3HA 1JCXA 3E0IA 3LTPA 3PB2A 4O1BA 3UD6A 4L4LA 1DJNA 5F1UA 1XBYA 3LTYA 2RDUA 4PTNA 4M6QA 1O5XA 1WX0A 3UXAA 2YGYA 3W1TA 3I7QA 3W2MA 3B06A 3BARA 1F6PA 4OHQA 3W1LA 4N9DA 3MHGA 2VFFA 3LXAA 2FFCA 3THAA 4MIMA 1H63A 3LCIA 4LV4A 1VGAA 1OX6A 3NNTA 3WFAA 3A22A 2QUVA 2GJNA 5DLCA 3W1RA 4OGZA 4ADUA 1OK4A 3CWOX 3NVTA 3NZ1A 2A21A 5ABTA 3L66A 3M41A 3LCWA 4HNTA 3Q2DA 2FB2A 1EPXA 2OMAA 3MP4A 1PV8A 4ZL1A 1ICPA 1T99A 3GKFA 4O54A 2DZPA 1H60A 3BK0A 2DZTA 2J9ZA 1OFEA 4IXHA 3UY7A 3P8IA 4LU0A 3Q37A 1I45A 1G4SA 1GYLA 1I4NA 2Y61A 2QCDB 1OG0A 1H50A 1KLYA 4FB7A 5HUOA 3STCA 4M7SA 3S9YA 3KVMA 1RD5A 4AB4A 3JS3A 2OT0A 1D3GA 2G96A 5F2MA 2P1FA 4MLJA 5K4XA 2EHHA 2JKEA 3I65A 5LNRA 3MUXA 2H8XA 4Y8FA 1Q6RA 3ZWTA 4D2JA 1HTIA 3PAJA 1QR7A 4MOZA 3QSRA 1OFBA 3PBUA 3VFLA 3DFSA 4JTLA 3S1UA 3TSDA 2GQ8A 3NPXA 3VI2A 1N8FA 3EB2A 1SSDA 2EPHA 3ZFHA 4CCEA 3S1XA 4DPPA 4O1CA 2PE4A 3HPZA 2F7FA 4UTTA 2FDSA 2GUUA 3GKAA 1M7OA 3IIVA 3PBWA 1LZOA 4MJZA 5I3KA 3O6CA 1IGSA 4RKAA 5K9CA 3EKZA 4GUGA 2ZBTA 3L0NA 3PUOA 2QCNA 5AYXA 3DU0A 1JCYA 3TSMA 1OK6A 4FF7A 4WD0A 4UTUA 2ZFAA 4UR7A 3W72A 5A8GA 1ADOA 1W8SA 3Q58A 1G67A 2NZLA 4QM1A 3GR8A 1P0NA 1OFOA 3DH7A 4N9EA 3NQ6A 4GUFA 1YPIA 4MZ8A 1YPFA 5CPNA 1QO5A 1EWEA 3F4WA 3N2MA 1YXYA 3TROA 1SR9A 1VRDA 3BVJA 3CEUA 2PRMA 3W85A 3RF9A 3WK1A 1LBMA 3G0UA 4JY8A 4MYAA 1XDLA 1SFLA 3LI1A 1JRBA 3RMJA 1H7NA 4IMDA 3BGGA 4R7JA 3KRUA 1K3UA 4BI6A 2A1YA 3P8JA 1ZAHA 1DBTA 1P5BA 1W56A 4N6FA 4O0KA 3T4CA 2A0NA 5AHMA 2NWRA 4UTLA 1J2WA 3PS7A 4JTJA 5HR6A 1EUNA 5I3GA 2GQ9A 3W84A 3QJAA 3L2IA 4GUJA 4AMAA 5F2GA 1KTCA 5D2WA 4N4PA 4OE7A 1ONRA 1TV8A 2ZZ5A 4FNQA 2LLEA 1R2RA 5BMWA 1Z44A 4RLIA 2ZZ6A 5AHNA 5EMUA 3THQA 4PL1A 3I7RA 1K8YA 3ABRA 1QAPA 3GDKA 4MKNA 3W75A 4NUWA 3RLVA 2CLFA 2O7QA 1GT8A 3A24A 4YCPA 1K7EA 2WSQA 3G1HA 3TJLA 1TO3A 2WV8A 1JCJA 2NX9A 1G4TA 2VFIA 1R30A 3QYQA 2ABAA 4XUGA 1F73A 3IIXA 4ZQOA 4UNKA 3LHZA 3WJWA 4RJEA 1MEWA 4Q33A 5LNWA 4POCA 2W79A 3KFTA 3IGUA 3LLDA 1H7PA 5G2WA 2V81A 3QC3A 3C52A 4OQVA 4K8HA 4A3UA 2ZDRA 1W5NA 2A6NA 3QQ0A 1DKWA 4UFJA 3FKKA 2DJXA 4MY9A 3LHWA 4LV9A 3GDTA 5LZLA 2RDTA 1EEPA 2DZXA 4NNBA 2R94A 1TPH1 2GVJA 4O11A 3HG5A 1WAUA 1Q6LA 3NEVA 1OFAA 5BW6A 1VPXA 5AHFA 3S42A 2QUUA 3B03A 1ZJIA 4WOZA 1WYIA 3OVRA 4GUIA 4Z1BA 1L6SA 4U4MA 1W1ZA 3EKLA 3KHJA 5AFDA 3KAOA 2E09A 3EWYA 3JRKA 3L67A 2PRHA 3CTLA 1OYCA 2NX1A 3W9ZA 2WNNA 1FY6A 2FIQA 1I2NA 3PG9A 3B0PA 3CIWA 4KWWA 2CU0A 2X1SA 5DELA 2P0OA 1GVFA 2DORA 3DXIA 3AO0A 3PBVA 3CM4A 3INPA 2AQWA 1DVJA 5FEXA 4AAJA 3M5YA 3MI2A 1DV7A 2B0MA 4LW7A 3VNDA 2OZ0A 3CU2A 3QM3A 4O53A 4HN4A 4R33A 3OHIA 3PUDA 4DF2A 1MEIA 2WPBA 3FYPA 5IBXA 3IGSA 5HR7A 4ONVA 5LSMA 3T7VA 3MHFA 3NQ8A 4N6EA 3BLEA 5FF7A 4UTWC 2WO5A 3HGSA 3OA3A 4UUIA 4X22A 4Z0SA 3MHUA 3W07A 1LBFA 3T44A 3AJXA 3T55A 1BWLA 3BLIA 1W54A 5F2LA 3HGJA 3W7PA 3UWQA 2V5BA 1F2JA 3FJ6A 4WY0F 2W6RA 3MJYA 1WOAA 3G0XA 1O4UA 3A21A 5FESA 5CZ0A 3NL3A 4IX0A 3EWUA 4OWGA 1PIIA 4XTDA 3EWXA 4LWWA 4ORIA 4AWUA 1ZY9A 3QSTA 3BG5A 1I2RA 5D2VA 2C13A 5CPLA 1QCWA 3W7LA 3D0CA 2G95A 4KFOA 4JEQA 4WUIA 1FDJA 1LDCA 2ZZ4A 4IMEA 3W1MA 1L2UA 2E6AA 3SJ3A 4RR4A 3UZ5A 3KOFA 3KVJA 2YW3A 1TMHA 3GDLA 5G2HA 3EWBX 2ISSA 2QCEA 2OJPA 1GVOA 4YLWA 1G4PA 4MUZA 4UXDA 1KM2A 2TPSA 4BI5A 2BZNA 4K39A 2R8WA 5BRBA 3PF3A 4DO5A 2FPYA 5D33A 3LM7A 5H91A 3G22A 4DPQA 2Q8ZA 3W23A 4JN6A 2C19A 4GRSA 5EY5A 1CX9A 1SPQA 2B7NA 5AC6A 1SZEA 4NJKA 3NPUA 5I3IA 5HULA 3QH2A 4MFEA 3W86A 3TQKA 1C29A 3W3OA 1LOLA 2CLLA 3C6CA 3FA5A 1XDMA 4QJ1A 3U6WA 4DQWA 4QQ3A 5AC7A 2YW4A 2Y89A 4X2RA 3R12A 1H7XA 4LVGA 2C16A 1TPVA 2X1TA 4UFLA 1TPFA 1OJXA 5F4WA 4BWLC 4CQ8A 4PEKA 3L9CA 2QAPA 4AF0B 3W7MA 4UTTC 5FEPA 2YSWA 1KBIA 4K36A 4CNPA 4GWEA 1VQTA 1AW1A 2ATSA 3GAKA 2C18A 2C3ZA 3WJZA 4J9JA 4GC4A 5AYZA 4JIQA 4JICA 1QNVA 3NQFA 4O10A 3W7CA 5F4SA 3C2VA 1H1YA 1OFQA 2C15A 3W7GA 4EOUA 4A2RA 1JR1A 1QO2A 2VEPA 3EX2A 1YLVA 1ZFJA 4RXGA 4IGHA 4HIBA 1KA9F 2AAMA 3DFPA 5FF3A 3M5ZA 5AYYA 1MSSA 3QF0A 3SFKA 1Y0EA 4N02A 2BXVA 5KSWA 3UWZA 4UMAA 4MVAA 1RR2A 3B0VC 2TRSA 3G1FA 3G1DA 3W7KA 3N9RA 2X16A 1ALDA 3NDOA 2QAFA 2HTMA 1H62A 5D37A 3P74A 1JUEA 4LOCA 4IMGA 3STFA 2J88A 4S2BA 3M44A 4RZ6A 4P2VA 3HMJG 3P67A 3OVQA 2EGZA 2A7RA 3PR2A 4S2CA 4RXFA 1LP6A 1BEUA 3GDRA 4JD4A 5G1TA 4DO4A 4XKYB 3BPWA 2PRLA 3ABQA 1TQXA 3WK3A 1FCQA 5EA9A 3BW4A 1TTPA 2NUXA 5HWJA 2Z6IA 3G1XA 3C61A 2NWSA 3TJXA 5D32A 1VLWA 4QISA 4X9SA 4O14A 3C2RA 3EX1A 3BO9A 3F4NA 3LB0A 3TNOA 1P1XA 3GDMA 5TBOA 1A5AA 1WV2A 2A2IA 4NVTA 1R47A 3O05A 4YXGA 4JNMA 1W5OA 4KFPA 3W7EA 1XKYA 4FNUA 4IOTA 3TUUA 1LTDA 3HPSA 1TTJA 4WXZA 2RFGA 3TMLA 3YPIA 4Q32A 3SW6A 4CNOA 1H7RA 4UCGA 3C3NA 2Z0IA 3DZ1A 1RV8A 4XWUA 1FXPA 1GG0A 4UTHA 1LLZA 1XI3A 2E6FA 2ZCGA 2B4GA 3LI0A 2CLHA 1XBZA 4PODA 4GFSA 4S1FA 4UFMA 4NZJA 2V2DA 3M5VA 4O4VA 4GE8A 1VLIA 4MPQA 1F74A 1X1ZA 3G1SA 1FUYA 2VFDA 5HWNA 2DJLA 5AB3A 4LS1A 1DHPA 1SO5A 1SW7A 3LCGA 2A7NA 3RK8A 3QPYA 3WJXA 4LUIA 2QEZA 4ML9A 1H51A 4K7VA 1OX4A 4YL2A 1TQJA 5L9FA 4RZ5A 2Z2UA 4KWVA 3M1ZA 3SY5A 4NJIA 4OT7A 3CQ0A 4MY1A 1XUZA 5I3JA 3E12A 1TPUA 3NAVA 3HPXA 1A5SA 2R91A 3R2GA 4E2DA 2XN1A 3C2OA 2V2HA 2B7QA 5AHIA 1O95A 3LHUA 1RQHA 3N34A 5G4EA 5LGXA 3UPBA 4AXKA 1TPB1 3G1AA 3HGRA 3VE7A 1EWDA 3O07A 4GUHA 1TPDA 2HS6A 5EBUA 3NXFA 3P61A 3DAQA 3KVLA 3TFXA 7TIMA 4QNWA 3UWUA 1WXJA 3I68A 2DZVA 1DQWA 3N2XA 4IXXA 3W7IA 1WDWA 3K30A 4M19A 5KITA 2RKXA 3HF3A 3TKFA 3V1PA 1K03A 4AWTA 1I2PA 1UB3A 1LLWA 3TE9A 2AGKA 1WQ5A 3N3MA 3VKJA 5IBXC 1JUKA 1LCOA 4I7WA 3EWWA 2DZUA 1WBJA 3S5ZA 1TRDA 3CIXA 3FEMA 3ATZA 1QFEA 5AC8A 2Y88A 1H7OA 4JX6A 1S5VA 3SSJA 1O60A 2D73A 4I9AA 3R8RA 3N9SA 1SFJA 3GNDA 5HNRA 3S6DA 4OV4A 1Q6OA 3LXBA 3L5LA 3M43A 1OYAA 3NQAA 4WY0B 4MJMA 5FF0A 2CWNA 2ZRZA 2GVGA 5FEZA 5C54A 1AMKA 3L21A 3PULA 4PFMA 4UFIA 3QPZA 2YZRA 3W2NA 1KFCA 2Y7FA 3N19B 1V5XA 4Z0JA 2FQIA 1FWSA 5A5WA 3ZWSA 3TU9A 3CEPA 3W76A 2H90A 3L0KA 1GWJA 4H4IA 1ZCOA 3GK0A 5K7JA 3W7JA 1ZALA 1EX5A 3PSWA 1GTEA 1W5MA 5E0KA 3S5YA 1XC4A 3HOJA 3W1QA 5DBUA 4JIPA 2OT1A 3G3DA 3W7HA 1KFBA 1SO3A 3GB6A 3OEXA 2VELA 2ZRWA 2A5HA 4JTGA 4XZ9A 3STGA 4XQ6A 2YX0A 4I7UA 3F1QA 3NM1A 4KKXA 2KZHA 4PH6A 3S1VA 3TC7A 1L9WA 4M6PA 2CLKA 1JQVA 4Q4KA 4IMCA 2WJZA 2A6LA 3NO5A 3NOEA 1AL8A 2NV1A 4DELA 3B0UX 1SUXA 4JS3A 1TRIA 1H61A 5HINA 5U7SA 2RDWA 3GNNA 3W2UA 3KVKA 2J9YA 1KM6A 2A85A 3EX6A 4IPJA 2JGQA 3NL2A 4MZ1A 1GPWA 1UUOA 2QCGA 3EX3A 3W74A 3FYOA 4LUJA 1W3NA 2QR6A 2XFWA 1ME7A 5C55A 2CLEA 4JGDA 1T96A 4C1KA 1N55A 1KFJA 2QUTA 1W0MA 4YMZA 3BG9A 2Y70A 5EL1A 2I9EA 3WJSA 4RX0A 3LX9A 3MP5A 5C2XA 3HG4A 2NX3A 3QFEA 3WK0A 1NSJA 4M7TA 1BKSA 4JX5A 2PC4A 4TO8A 1OFDA 4M5PA 4NXKA 1P0KA 1VJIA 2FB3A 1V7YA 1TV5A 3OG3A 4FHAA 4G1KA 3PVFA 1JQXA 2HMCA 3G24A 3TX9A 5L6UA 1SO4A 5LHFA 2ALDA 3TAKA 5D2YA 1TTIA 4MZYA 2V30A 4Y96A 3W1NA 4GXMA 1U83A 2VEKA 2WSYA 5TIMA 3SZ8A 4BI7A 5LGZA 1S3HA 3BW3A 5LHEA 4FEZA 2Y63A 3W88A 1HO1A 1T8XA 2GJLA 3QQ1A 1OYBA 1S5WA 1O94A 4FX6M 4HNNA 3TH6A 2C14A 4NZFA 2ABBA 4JTUA 2Y7GA 5DY3A 4R53A 1Z42A 1EP3A 4Y90A 4A21A 3B4UA 4GJ1A 2UV8G 1LOQA 4O12A 4HSNA 3PWAA 1S5TA 1L6YA 2OX1A 3R13A 5E93A 5D02A 2WSRA 1EUAA 3VE9A 3TFCA 1JJKA 5AN7A 1JULA 1FXQA 3LRMA 2QJGA 2H3DA 5DCBA 3W1XA 1LRTA 3C2EA 1LROA 3OBKA 3W22A 3SGZA 3L5AA 5F4XA 4JX4A 1FWNA 3UYCA 4PCFA 3M7WA 3BW2A 4E0CA 3LDVA 4FIQA 1WBHA 1ML1A 1J4EA 1VCFA 4O15A 3C4UA 5CG7A 2V8ZA 4LC8A 2B7PA 5EYWA 2V2CA 5DN1A 4CQ9A 3GIYA 2QCLA 1TPEA 1SZFA 1VYPX 3P80A 4DO6A 3B8DA 5DCDA 5K4ZA 1IF2A 3U8GA 2G5WA 5TQLA 5CZTA 1CW2A 1ZENA 1R46A 2GOUA 4UTIA 5J5DA 2QCDA 1MEHA 1VHCA 3I7SA 4Z1AA 2BX7A 5BMXA 1PCKA 1GZGA 2WKJA 4FX7A 3UWWA 1QPRA 4JTSA 3IVTA 5DBTA 1QPQA 4HKPA 3P7YA 4DEFA 1TPWA 3LCXA 4HPJA 4NJHA 4AH7A 4EIVA 4IJBA 3UZJA 3C8FA 4TMBA 2NUYA 4NX0A 1C8VA 1FBAA 1FCVA 4QIUA 1W3TA 2E68A 4LS0A 1XBXA 3W83A 1GVQA 3P5YA 3G18A 4LS2A 3TA6A 1L6WA 4QITA 3TIMA 3W6YA 2Z1BA 2C0AA 3W2JA 3GVGA 3SECA 3IIOA 1KTNA 3V75A 3O8AA 4JTTA 3LRKA 1YXDA 1DORA 3LTSA 5KZEA 5IM51 1I8JA 3O1NA 3NM3A 3CB8A 1IXNA 3LBCA 2DZWA 1G69A 1IIHA 3UPWA 3CT7A 1QDSA 3G8EA 4K37A 1XXXA 1Z41A 5CPOA 3MBFA 4O57A 3HGOA 4AHPA 1FCUA 5E1QA 4IQLA 3UXDA 3MYPA 4ZMGA 1TB3A 3FIGA 4JDYA 5K2ZA 1KFLA 3BG3A 3IIPA 1ZAJA 2XN0A 2ZYFA 4HT3A 3GAYA 3NQ7A 1KW1A 3MBDA 1FWTA 3ZS4A 2GVLA 4UR8A 1YYAA 1JCNA 3HO8A 3TV8A 6TIMA 1VH7A 2E1DA 2JGYA 3ABSA 3LCFA 2Y62A 1KFEA 4BK9A 3DKJA 1LRQA 3HJZA 4FIRA 5CZJA 3TSBA 4LTSA 1FCBA 3O15A 1ZHAA 4JTFA 4OV9A 2ZTKA 1SO6A 2CLOA 2RH9A 1OF6A 3TW7A 4WXYA 3NGJA 5LNSA 1X1OA 4PA8A 5D09A 1KBJA 2CZFA 3DFOA 1Q6QA 1GG1A 1G4EA 1THFD 3FS2A 4O1AA 1MXSA 2F84A 2ZZ1A 4NJJA 4DXVA 3LHVA 2ZRYA 3LHYA 2J6XA 4HPXA 3P62A 3W7RA 4C1LA 2H8ZA 3L65A 4RCXA 2VFEA 3SR7A 2TSYA 4JTKA 2CZEA 2FPTA 4JTIA 4FXRA 3P5ZA 4ZQNA 1XL9A 2ZA2A 3B04A 4EWND 5FI8A 3TK7A 3GX9A 3NYZA 1XM3A 2CFFA 1ICQA 2VEMA 3A23A 3NQCA 3M6YA 4Z1CA 4XBSA 4CCCA 1GTHA 3WJYA 1KLZA 2HSAA 1PHQA 4BR1A 3FOKA 4E38A 1T0OA 4DBDA 3S1WA 4LVBA 3KRZA 3VCRA 4FNSA 3L0GA 3EX4A 2IQTA 1BWKA 4FNRA 3LHTA 1HO4A
chains in the Genus database with same CATH superfamily
4IQEA 3SCRA 3C2FA 1A49A 3WFZA 1XS2A 1OZQA 2YFNA 3SUWA 1FWHC 3T40A 2F2KA 4GVGA 4PFHA 3VIPA 4S3GA 3T78A 1SZNA 3GSMA 4HMNA 1JGMA 1GUVA 4UTKA 4WX2A 4DWSD 2ON3A 5JH2A 1J6PA 1W91A 3HMCA 4WZHA 4ALDA 4W87A 2QVNA 5CXPA 3H6OA 2BY3A 3ELFA 3JVAA 4H9XA 2TMDA 3VC6A 3WQPA 2X30A 5A6SA 1XFCA 1SW0A 3E2VA 3MI6A 1ECQA 2J62A 3GTFA 4JYEA 4IWWA 3N14A 1WZMA 4M24A 3QY6A 2C7FA 4CN1A 1A50A 4PRRA 3MPGA 3GLCA 4C7FA 3VOIA 3KOYA 3PPFA 1Y7VA 1VEPA 3MKVA 3OZOA 4XAYA 1U2YA 4V1YA 2WHMA 1SYTA 1U5JA 2H6RA 4L6OA 3M47A 4YTTA 3UCQA 4HNVA 2OZ8A 1UZ4A 3GIPA 2PWVA 4WSHA 1LYXA 3DBPA 1M6JA 1CNVA 2GQAA 1EJTC 5ECVA 2I17A 3DC8A 3LK6A 3SIZA 1NF7A 1QPOA 2OOGA 4EXAA 4I7VA 3PSVA 3QMTA 5GPRA 2JKPA 1VP5A 3GUGA 3WQOA 2V63A 2Y7EA 1DQUA 1XGZA 5GNZA 1FHDA 4U2YA 1R0MA 1UJQA 3R5EA 2PDNA 1PIFA 3LMZA 3EXRA 3U2EA 1LL7A 1MO0A 2O7SA 1X6NA 2VCCA 4E2OA 3W02A 2ZQ0A 4A22A 3VGHA 4IIFA 5E09A 4ERAA 1J96A 1M7PA 2PP0A 2PEVA 2V3EA 4PC8A 5A6BD 3H8AA 4GNKB 4BA0A 4B9YA 5KZMA 2PCQA 3VNZA 4JNZA 1Q7QA 2V82A 3E9AA 2DUZA 1ME9A 1VZWA 1G6CA 1W8GA 4J3WA 5LIWX 1OIFA 3B97A 3A9BA 2V9DA 5CSRA 4F0SA 1NDVA 3AWOA 1J8VA 3NZRA 1LBLA 3SADA 2YBUA 4AF0A 4JHMA 1IT0A 4US5D 1KM0A 2YL5A 1HL2A 3ABXA 4ZB5A 4P7OA 4NU7A 2FVLA 1MUWA 2OO0A 4DUWA 3ABOA 2AL2B 5K9XA 2DP3A 4LBRA 3H2FA 3S5NA 5AHEA 4NJGA 1EJRC 2TAAA 1EC7A 4LUSA 4DBWA 3HBLA 5C9XA 1A5LC 5CBIA 1CGWA 2BOGX 3SGUA 3VC5A 5I6SA 2E9MA 2QF7A 2QGHA 3HG3A 3I4EA 1WB0A 1CGXA 4GQGA 1PEZA 4ZQRA 2PMQA 4HHPA 3QLDA 4V15A 5AOUA 3ANVA 1DL3A 1XH2A 4EVZA 4DF1A 3W25A 1PZ3A 1VBUA 4K2SA 2H9AB 4TIMA 1PZ2A 2ZUWA 3DX5A 3G1VA 4IUOA 4HYRA 1V93A 4AHOA 3W70A 3EA2A 1QNQA 3ANUA 5K9DA 3AUOA 3MY9A 3RYSA 1LQ0A 4YIWA 4J40A 3CHDA 1F4AA 2O9RA 1AH3A 3BOLA 3CYVA 1OFPA 1M01A 4HA1A 4GIAA 3WF2A 2PTWA 3G8RA 4R27A 2XM2A 3F5JA 2OEJA 4FX8A 1GQIA 3OOQA 5KZDA 4EXBA 3BMWA 3G0SA 3NQ2A 4ZQMA 2YPIA 3G3MA 5AKQA 4GJIA 5DY2A 3MUZ1 4QLLA 2GSEA 3VMNA 4QR6A 5F1VA 1MI3A 4O52A 4S3AA 2ISWA 2Q8LA 3DG6A 2DV0A 2GJXA 2CLMA 4C6JA 3H2NA 2YYTA 3GZ3A 4DAIA 4B15A 2D2JA 4QDMA 1UD6A 1F7BA 5A2BA 4I9JA 3WNLA 1J79A 2ZUUA 2BHZA 5DT7A 3KOXA 1QVBA 3IVSA 3M5XA 4DF0A 4U10A 1OT1A 1X7IA 1KM1A 1NVMA 3MUAA 3A3HA 5CSYA 3RGTA 3LRLA 1W3IA 6TAAA 1LT7A 3H54A 4RV8A 2FMNA 3SUSA 4C6PA 4QNEA 3LYEA 5ABGA 3ZR5A 1PPIA 4ZOBA 4KCVA 3HIJA 1VFLA 4JY9A 3W0KA 3P82A 3S5SA 5CSSA 2EPKX 1K8ZA 1SSGA 4HSOA 3VCCA 3QTGA 1HKIA 1TELA 4GPNA 3WMCA 3E0LA 2GDUA 2QPSA 2QXWA 1TPC1 3QHNA 4BJHA 3ZSSA 4UOZA 3IJLA 2I9UA 4KWUA 3PPHA 1GK8A 3A12A 3V5FA 2D23A 5EU9A 4O0QA 3LV5A 3K5XA 5LKYA 2WANA 1RZMA 1JF5A 1UWIA 4JHZA 3K4AA 4KERA 2WWDA 3ZR4A 2E5BA 2QJHA 4AD5A 1R5YA 3EKGA 1K7XA 1MRQA 3U2OA 4LRTA 3EPOA 3IGXA 2FPVA 2VFGA 1JVNA 4O28A 4XZWA 3QZEA 4OFCA 3LERA 3WEOA 2XIMA 3GR7A 2E7FA 1V3MA 4P8VA 4DAFA 2BTMA 2ZZ7A 1Q13A 4ZZ9A 2Z2BA 5D04C 4AEOA 3NL6A 3TC6A 4EPEC 3FJNA 4W8AA 1XJBA 1ZP3A 2V5DA 6CGTA 5FF2A 5G1YA 3PZTA 3APGA 2FTWA 2P3EA 4TX6A 3MVTA 3PC0A 1XRTA 2Q71A 3CAVA 4XO6A 3TXZA 5LNUA 1HG3A 4IT1A 4NILA 4GI9A 4JN7A 2E0PA 4DYKA 3C0JA 2BSLA 2POTA 2Q3RA 1O66A 2VENA 1VYRA 3N2BA 4A2SA 2CLIA 3WQ4A 3P2VA 1R2TA 4AIBA 1LORA 1AD4A 3UNDA 1HUVA 1NAL1 3EXSA 2ZUNA 3S5OA 2IW0A 4S39A 4DNMA 1IEIA 3EEZA 4IUGA 3IACA 3UWVA 1LM1A 1B4KA 1EP1A 3CXOA 1B3ZA 4CLMA 1ZP4A 3P81A 3M9YA 3E96A 1UBSA 1Q66A 1SM9A 3MCMA 2PD5A 3MS8A 1REQA 4H3DA 3D5HA 4LB3A 1XLBA 4YWIA 1LOSA 4INFA 3DFNA 1KC7A 2HV5A 5H2ZA 1A53A 5G2IA 4M80A 3T42A 2JK2A 1HX0A 1O68A 4Z2GA 4JYDA 1S38A 1A0CA 1WE5A 4DZAA 5KTLA 3NWRA 1Z48A 2FTPA 5EMLA 4JKLA 1C9DA 3BLFA 3WY1A 2RHGA 2AQOA 4EXQA 4PTDA 2J7CA 1Y5XA 4H9UA 1UJPA 3KWSA 1UA7A 4JQ2A 1NFBA 1TWSA 5HQEA 4ZR8A 5CAKA 5HMSA 4HQVA 1OC7A 1W5PA 1I9CB 1QHZA 4IPIA 3OBAA 1QK0A 4CNNA 4L4PA 3T8LA 2HWGA 4RZ4A 1XGDA 1AK5A 2W3ZA 4L4MA 1GYNA 3B8TA 3N2TA 2QDGA 5ABFB 4D1IA 3SSZA 1JCXA 3PB2A 1NOUA 1JPIA 2BVYA 3FGCB 4O1BA 4A05A 4AYSA 5T9BG 3LTYA 1E40A 4H9MA 4UZSA 3BCFA 3W2MA 3B06A 4OHQA 4AFYA 4R5EA 1YE6A 2VFFA 4Y8EA 4MIMA 2WVVB 4JQAA 4WLCA 4ZOEA 1VGAA 1OX6A 2WMJA 4OGZA 4ADUA 2VJXA 5EMMA 3WF3A 3AWNA 1ADDA 2A21A 3RM4A 3CYJA 2Z00A 2FB2A 4GZIA 4TQTA 1E1CB 1EPXA 2OMAA 1PV8A 3C0QA 4ZL1A 2WMKA 1ZBKA 4DXXA 4O54A 4NAEB 1GNXA 4DJFA 1ONWA 1P48A 4IXHA 3P8IA 4WSJA 2CXGA 3SN0A 3RAOA 1UPMB 1KLYA 3STCA 3GHSA 4C7GA 1POKA 3UF9A 1KGUA 2EHHA 3PNUA 4Q8PA 3MUXA 1ONXA 2H8XA 4Y8FA 3ITLA 3PAJA 1QR7A 3QSRA 2OQYA 3PBUA 4JTLA 3S1UA 4OBSA 2GQ8A 2V67A 5CGTA 4DPPA 4W93A 4S23A 3RPMA 2QNEA 3GKAA 1M7OA 4HD5A 2XTKA 3WMLA 1PKYA 1C8YA 2DIEA 3O6CA 3RR4A 3EKZA 3L0NA 5T91A 4AY1A 3WNNA 1JCYA 2PDCA 1FP9A 1E9IA 4WD0A 2OZ3A 3GG1A 4IM4A 4O1FA 4UTUA 3RX3A 1YBQB 1VAHA 4UR7A 4I8YA 5A8GA 1IEWA 2PWFA 3SM0A 1GHSA 1G67A 1KCZA 3GR8A 1P0NA 1OFOA 1AVAA 2I57A 1YPIA 2R1MA 1YNPA 2IMRA 1JZ7A 3N2MA 1D2KA 1WDPA 2WMFA 1VRDA 3CEUA 3REQA 1FWJC 4CU7A 2PRMA 3W85A 5HQMA 4NHVA 4C6FA 1SFLA 3U2CA 1JRBA 3RMJA 3Q4DA 4R7JA 4WDWA 1K3UA 2A1YA 1NWRA 2VTFA 1RP8A 1WCGA 1DBTA 5FJIA 1HJSA 2QF8A 3AS3A 4N6FA 1FFQA 3WUEA 1J5SA 1TVLA 1PSCA 1V4YA 4ZXOA 1EUNA 5I3GA 3KZPA 2GFTA 4GUJA 5HQLA 2F6KA 3AS0A 1ONRA 4W8LA 2HE5A 1QHPA 5CEWA 2WCGA 1TV8A 2QW5A 3QPEA 5C70A 1R2RA 1V0MA 4IG2A 1Z44A 4WDTA 3C0SA 5EMUA 3RRXA 1JAKA 2Z1VA 1UWTA 2R1LA 1E4MM 1XLEA 1GQKA 5DO8A 3ARWA 3TJLA 2WV8A 4BQ3A 2XFRA 4XUGA 3QV7A 3UERA 1MEWA 4B16A 2HK1A 3KFTA 1BVWA 1XYMA 4J2PA 2ZDRA 1W5NA 2A6NA 2Q01A 1DKWA 4B5VA 4MY9A 2WKLA 1DWIM 1X39A 1JI1A 3CZKA 5LZLA 3SY1A 4KEMA 4NNBA 4AW7A 3THDA 3KWXA 3EWCA 1CCWB 4O11A 1Q6LA 1BPLB 2WZEA 2J8TA 1WYIA 4Q7BA 3V36A 4HVXA 3R1ZA 2PLJA 3LGDA 2PRHA 3UT0A 2NX1A 3GO2A 3W9ZA 3IJ8A 3FDGA 4GXWA 6A3HA 4EX4A 4M8UA 5AY7A 4HOWA 1HIZA 5LIUX 4PUUA 2XINA 2VQTA 3VU2A 3AO0A 1B1YA 4ZO8A 2XWEA 2OR2A 1RBAA 5C2GA 1B3WA 1NOFA 3FW6A 3WQ8A 2PF0A 4LYQA 4G1NA 4YYFA 4OBRA 4WEVX 1TA3A 4ONVA 4IFOA 3AS1A 3T7VA 3OYZA 3MHFA 3NQ8A 3BLEA 3EOOA 3OA3A 4UUIA 1QASA 2OYKA 1QPKA 1XH1A 4YVVA 1NM9A 3WBXA 3BLIA 5A6TC 2Z7KA 2P53A 1J0ZA 2V5BA 3FJ6A 2W6RA 3G0XA 4MUPA 3A21A 5CZ0A 1JFHA 4OWGA 1QXLA 4ERGA 2WQDA 4LWWA 4AWUA 1ZY9A 2OQLA 2IKJA 5CPLA 4IIEA 4RNHA 2D22A 3IAPA 1IE7C 2G95A 3RUBL 4YS1A 4C5YA 5M1TA 2ZZ4A 1KQZA 4RR4A 4F2BA 3UZ5A 2XU2A 3EWBX 2ISSA 1EIBA 1Z3NA 4FLRA 1W1PA 2OJPA 4DJFC 4DX3A 3H7VA 3GG0A 3O2LA 3FX4A 4BI5A 2BZNA 3NXLA 2V3DA 1SFTA 3CUXA 3PF3A 1RY0A 5D33A 5H91A 3SY8A 4J5NA 1E0UA 3W23A 2O9OA 3T4WA 3UJFA 3AZTA 2C19A 3ZLGA 4IICA 1GVEA 2O9PA 1Q6CA 2I56A 3FAXA 3I6TA 3KDOA 2HQAA 2POZA 4I6VA 2GGIA 3ENLA 3W86A 1GW1A 5C9WA 5FIPA 1XW8A 5FD0A 5I23A 4QQ3A 2YW4A 4X2RA 3R12A 1OSEA 1UWQA 3GC5A 1XLKA 4BWLC 2QAPA 1UKSA 1XIFA 2BDQA 5FEPA 3ZR6A 3BMXA 4JL1A 4K36A 5JH1A 1VQTA 4RW3A 4NYYA 1XIGA 2HXUA 4ZENA 1Y5VA 2EG6A 1JDFA 1EX1A 3LY0A 1CGTA 1FWBC 3ARTA 2JF6A 1OFQA 5J04A 2C15A 1J12A 3W7GA 4A2RA 4PUMA 1JR1A 2VP8A 1VF8A 1YLVA 1ZFJA 3UZYA 2G3MA 1ZPTA 4LANA 4DJFD 3LD5A 1RK5A 1V3JA 2DUAA 4D6JA 3CQKA 2PU0A 3UR2A 2TRSA 4I9MA 4REQA 3S2MA 4Z2IA 4FOJA 2QAFA 5KETA 1ZJBA 3CQHA 2XH0A 2FHBA 1UMYA 4Y2WA 4V27A 3ITXA 2JE8A 3WENA 4P2VA 3P67A 4S2CA 1LP6A 3GDRA 2OU4A 5GJMA 5A6KA 3CL7A 3BPWA 1TQXA 2VCBA 3WK3A 4DN1A 1F3TA 2WHKA 1HXJA 4MNLA 4WKFA 4HZ8A 4UQAA 4RDVA 4QDPA 1VLWA 2Y1HA 4QISA 4BQ2A 3RITA 2CITA 5BRQA 1SFSA 1R47A 1UD4A 1LWIA 5BU9A 4J3SA 4FNUA 1L8NA 3TUUA 3HPSA 4UQ9A 1Y5WA 1TTJA 4WXZA 1J93A 3IPWA 4HSHA 2QDEA 3AXXA 4Q32A 3SW6A 2HISA 3CL8A 4HN8A 1U33A 2QV4A 1GOOA 4LAMA 1VIWA 1TIWA 3TP4A 1XI3A 2E6FA 2ZCGA 2PC8A 4M6UA 2B4GA 3ES7A 3QKZA 1XBZA 1WDDA 4UFMA 2V2DA 3WF1A 4O4VA 3UJSA 4S3KA 5EBAA 4CD8A 3WBAA 1PWMA 5AB3A 1EO7A 2GDQA 1DHPA 2E4TA 3KCJA 2A7NA 5FJJA 3WJXA 4AD3A 4FR1A 4CQBA 5CC5A 4RZ5A 2Z2UA 3PJTA 4QSFA 5I00A 1V03A 3CQ0A 4MY1A 2XYLA 2XZ9A 2QJNA 2D2OA 3E12A 3POHA 3KUMA 1S1PA 4E2DA 1R87A 5MF5A 4WR3A 1XQLA 1K70A 3E0WA 5G4EA 5LGXA 4AXKA 5XINA 3MUCA 3HGRA 3VE7A 1Q4NX 2GL5A 2CIPA 3N2CA 1TPDA 2HS6A 5EBUA 3VDBA 3DECA 3KVLA 2BVTA 4LF2A 1WP6A 2P88A 2ZE3A 2BNJA 3WLLA 3ZT7A 3N2XA 1E56A 4M19A 2RKXA 2L5HA 1PIGA 1K03A 3SCVA 1UB3A 3HURA 4L1GA 2PWHA 3TE9A 1WQ5A 4MHBA 2DZUA 4IHCA 3QQWA 3S5ZA 2DIJA 3CIXA 3ZM8A 1PKNA 3N9KA 1A3HA 5H8PA 1B3YA 4PEEA 4NIRA 3R10A 1WXYA 1Z69A 2EPOA 1TV4A 3SGGA 3R8RA 3N9SA 4E4UA 5A3HA 3EDDA 3GNDA 5HNRA 3S6DA 1HVQA 1NP2A 1WDRA 1OYAA 1NWTA 2A79A 5FF0A 3ITTA 1XPGA 5A69A 3LNPA 2XDFA 3AS2A 1PKLA 3N19B 4Z0JA 1GQLA 4JL2A 3PZIA 1W9PA 5A5WA 3ZWSA 1MDRA 2DVUA 3W76A 3N17A 2Y8KA 3PNZA 4XD4A 3W7JA 1ZALA 1EX5A 1QW7A 3S5YA 2BBFA 3GY1A 2VNCA 1KFBA 3WNPA 1UP0A 3W28A 4CNSA 1VENA 1UR4A 1K9FA 2ZRWA 2FZ8A 2PGWA 1BD0A 3AYTA 3S1VA 1JI2A 3N15A 4H2HA 1OBAA 7TAAA 1KBKA 2BY2A 1J2BA 4BEUA 4QG6A 4DBUA 3GXDA 1A5MC 2EPMX 1E0XA 3NOEA 3UG3A 4DELA 2D24A 1SUXA 3B0XA 5HINA 5CG0A 1C7TA 4HPHA 5U7SA 2Q09A 2F8QA 3BTNA 7A3HA 3TYUA 1E6RA 2G37A 2A85A 4Q8UA 3NL2A 3W74A 5CC7A 3QC0A 2RAGA 3EYPA 1G94A 3VNYA 2PLCA 3RLGA 1J0HA 5C55A 1T96A 4P8UA 1W32A 1YRRA 4PCNA 1W0MA 4W4QA 2X05A 1P7TA 3DHUA 3MZNA 3VMPA 1J9YA 4XG1A 4KW2A 1E4IA 4MNJA 3B4YA 4DI8A 4L80A 4Z42C 3WK0A 1UH3A 1GCYA 4B4FA 1VJIA 5BCAA 1V7YA 1TV5A 3EZ4A 3TZNA 2WBGA 3OG3A 3A64A 1IR1A 1RUSA 3K8MA 3G24A 5LHFA 3KP0A 5FJUA 3VIFA 1RCOB 3SCWA 4W89A 3E38A 4AZIA 4FLQA 4GI8A 4ICCX 4BI7A 1E15A 1UP2A 1K8CA 4LUTA 3I4KA 2Y63A 1HO1A 1ITUA 3GFZA 1T8XA 4ZXLA 2NW0A 1Q6EA 3K4DA 3DERA 4H8NA 4TXEA 1E6QM 1L6FA 4NZFA 3QV6A 2Y7GA 4U3AA 1XLHA 2E3ZA 2DH3A 3QR3A 1EP3A 3VTRA 4Y90A 4A21A 4P7LA 4Z2LA 2J47A 3ZQ9A 1OZMA 1UZHA 5DMNA 5C2CA 2FTYA 5BYWA 3PZMA 1I1WA 3PWAA 1Q6DA 3R13A 1QUMA 5E93A 3AZRA 1EUAA 5AN7A 4HHMA 1JULA 2QJGA 2XFFA 3B8SA 3WH6A 4N42A 4Q6XA 3C2EA 1HJVA 3OBKA 4JX4A 2GVYA 4MJ4A 4PUWA 2XUCA 1J4EA 2WB5A 2V2CA 1TPEA 3P80A 4DO6A 3QLLA 1CXIA 4FAMA 1UKTA 5K4ZA 4Y9OA 2G5WA 4MB1A 3PZUA 3KBNA 5F7UA 4L56A 1PTDA 4RZBA 4NRRA 2GOUA 4MWAB 4NSBA 5J5DA 2QCDA 4LAKA 3I7SA 5FJPA 1JAEA 2BX7A 4HK6A 1GZGA 4HK5A 3I6EA 8A3HA 1C8QA 4HKPA 2IKGA 4DEFA 3LCXA 4C1NB 1VBJA 1C93A 2DEPA 3P0XA 4GNVA 3NDYA 3C8FA 3UZJA 2C91A 3D46A 3S46A 4L9YA 3ARYA 1FBAA 3RO8A 3RCMA 1R86A 1XIHA 4LS0A 3WLRA 1GVQA 3P5YA 4LS2A 4PRTA 3WQGA 1EJWC 1VRXA 3AROA 3W2JA 3SECA 2GGGA 3T0TA 1KTNA 2QDDA 3O8AA 4JTTA 1YXDA 5FSEC 3STPA 2W5FA 5KZEA 5IM51 4L7ZA 3LBCA 4JBRA 2DZWA 1OCJA 3TZFA 5A2AA 2ZWYA 4R9OA 1J0IA 1EDQA 3DFHA 1A0EA 1XXXA 1JDDA 1UROA 1UWSA 2BG5A 1FCUA 1W3KA 4MWAC 2PP1A 1PX4A 1HKKA 2GVEA 5IOBA 1DIEA 4IQLA 1PDYA 1TB3A 3FIGA 3NO1A 1T6MA 1ZAJA 2PGEA 2XN0A 2ACUA 4G8TA 2YCLB 2CESA 4PGLA 3SUTA 3MBDA 3ZS4A 2GVLA 4UR8A 3WLJA 4D6HA 3ABSA 4CKQA 4JKKA 3AI0A 3KBMA 3TSBA 3TTOA 1V0KA 4WDXA 1EF3A 5ENLA 3H4WA 1V02E 2RH9A 3WCZA 3V16A 1DE5A 2WBKA 3J7HA 4H01A 3NGJA 1UPPA 2YA0A 1Q6QA 4E3TA 1OGSA 4O1AA 1MXSA 2XGBA 2F84A 2ZZ1A 1EQCA 4JEJA 1LT8A 1E6ZA 3LHYA 4C1LA 4B5XA 5I24A 2H8ZA 3L65A 2XSBA 5E5CA 4DB7A 2VFEA 4PSRA 4ZTYA 3SR7A 1TMQA 3VIIA 3SRHA 2PTYA 4FXRA 4AEFA 3DDMA 1F3XA 1XL9A 2FJUB 2XIIA 4HMCA 1XM3A 1BG9A 3KBVA 2YOCA 1ICQA 3M6YA 3M7SA 4Z1CA 3WJYA 4W85A 1UBPC 3FOKA 1XYBA 1JPMA 3S1WA 1YKWA 3WLQA 3L0GA 4BKNA 4IFKA 2IQTA 3UYIA 4MGGA 1GYMA 2ISDA 5I7GA 1QOXA 1EA0A 3OZMA 2ZKMX 1PHWA 5DCEA 1WZAA 1E51A 4B2DA 3F03K 1TIMA 3URAA 3IEBA 2DZSA 2XIBA 3KX6A 1HGYA 4Q7IA 3A47A 3TYZA 3UQNA 1H1ZA 1DWFM 4XAGA 1BTMA 3TYEA 3WUGA 4FZIA 1CI1A 4AC1X 5JVLA 1R3WA 2VGGA 5CGMA 3FAWA 1QOPA 2I14A 1XYLA 5ECUA 3VOFA 5M5DA 3H12A 1SJBA 4QG9A 2VXNA 5EMYA 1XLJA 5CKSA 3VUPA 1EGMA 2DU2A 2INEA 2F9RA 3BZJA 3ZT5A 1XKJA 1XLDA 3C8NA 4H00A 1GJPA 5E70A 1FX6A 1ESWA 7ODCA 4GNJA 5D8WA 4Z17A 2YB4A 3W6MA 2X1RA 1XC6A 3TJ4A 3UR5A 2QV5A 2QGYA 5CZSA 4UQBA 3EBVA 4RNJA 2VR5A 6XIMA 4O18A 5AHLA 5BZAA 4H04A 4UMCA 3SCQA 3UP8A 2QJMA 4E2BA 1B57A 3W81A 3BGJA 2A4AA 3SRKA 3L4UA 1MXDA 1WOBA 5M03A 2EG7A 3RU6A 5MKGA 1DJQA 1YADA 2E67A 5DMLA 3R79A 3R89A 5KMYA 4H7VA 4LAUA 4FNTA 2CLPA 3D6NA 3A4JA 3NOYA 4YVXA 3KHDA 1BF6A 4MFDA 1XBVA 5CPQA 4UIOA 3GHTA 5I03A 5HNNA 1K02A 2FVKA 3IIZA 2DSWA 1CGYA 1BG4A 3ZT6A 1BQCA 3AALA 1FWDC 1H3GA 1UP3A 2FHFA 4QGCA 2QCCA 4LY8A 3B9EA 1J11A 3EWZA 2WCAA 2ACRA 1LRNA 4IISA 2DY3A 1C90A 3Q94A 3VOGA 2ADAA 1DOSA 4A8LA 4TVCA 1CXHA 1TSIA 4CUCA 3USBA 4RK8A 4M3PA 3MUY1 4B3KA 1LUCA 3FA3A 2OSWA 2NXGA 2NSXA 2YDRA 4H6EA 3GXTA 5DANA 1NEYA 3A3WA 1RQEA 2EAWA 4GX8A 3ITOA 3KLLA 4F9DA 1E6PA 5XIAA 2WNQA 1F8IA 4RL3A 2ZX5A 3E2QA 2R14A 1A5CA 2C0HA 4PBEA 2PTDA 1XR2A 3L5MA 3N3TA 3LGEA 3L2MA 5D05A 2CZVA 2V69A 3VIOA 2PI6A 1WUFA 2Y2WA 1IXPA 1QPNA 3L4TA 3E5BA 3CT2A 3EDJA 4GZJA 4ATWA 4Z1DA 1G7UA 1EP2A 4RPQA 3W7DA 1CLVA 2VOMA 1L2QA 1Q7ZA 3B8IA 1IT7A 1V0NA 4Q8NA 1XG4A 5BXPA 4X0NA 2H3BA 1RALA 4B5SA 5REQA 3CAWA 2WAGA 1VHNA 1NFGA 1SQ7A 2YFOA 2HDJA 2OEKA 3OLGA 4EACA 1DJWA 4UQEA 1SJAA 4ADTA 4WF7A 1RBOB 3VUSA 5D03A 3VAVA 1GGOA 3RLUA 1P4CA 4LF1A 4E4PA 1Z6KA 4B92A 1RLCL 1DP0A 3NG3A 3MO7A 3H55A 5D9MA 3WD0A 1X8FA 2ZVRA 1MW2A 3TMQA 2VC7A 1K7FA 4QROA 2VZSA 4CD4A 2GPTA 2WZTA 3QMSA 1Q8JA 4HK7A 1DWJM 2VD9A 1G5AA 3AOFA 2Y4SA 4X3ZA 3MJMA 4O17A 3ARPA 3IS4A 3WLOA 4KEVA 4GC3A 1ECEA 4PBFA 2C8NA 2DVXA 4RUBA 2PBOA 4CQAA 4PMOA 1PCWA 2Q3OA 3QMRA 2EBNA 4HZ7A 3B8WA 4G7EB 1K8XA 2F2HA 1OX4B 1WA3A 2Y8VA 3ZLFA 4AHQA 4LBUA 4N9CA 1HFBA 4R34A 1FHLA 1X7FA 5C9RA 2PS2A 4OBTA 2Z26A 2CNCA 3CUGA 4UQDA 2ODOA 2WSPA 1YDVA 4GQBA 3RJYA 3OGVA 5FA5A 2BGQA 4L9ZA 4OIFA 4JOMA 1XP3A 2ISVA 5I3HA 1YTKA 1F9CA 1RCXB 4MDPA 3L4ZA 2X2GA 2VUYA 1W37A 1SW3A 3AHVA 4KEUA 5EB8A 3WEZA 1OABA 2DSKA 6ALDA 2EG8A 1G01A 4LXFA 1EJ7L 3M0MA 2WM0A 3MYOA 4Q8VA 4Q4PA 1U5VA 3VIGA 3R6IA 1RXOB 4JZ5A 3LA4A 1XYAA 4M56A 3ZVHA 4Z2HA 3VZYA 1I0DA 5FAGA 4K68A 4NNCA 4YCOA 4C6BA 4TTGA 4BCEA 4HNOA 3QY8A 3A5VA 5SWUA 3BJFA 1IIGA 5A94A 2AOSA 3TAOA 5DMMA 3MMUA 1ELSA 3PZNA 1YNQA 1G7VA 3AAMA 1YDOA 3K13A 3GXPA 2RGLA 3UJEA 4ZVJA 1MRAA 3CK5A 2JBMA 4C6DA 4KFNA 1YHTA 3K8LA 3V0SA 4B2DD 2CW6A 4R88A 1FDYA 1H5YA 4NX5A 1M53A 3VNJA 1QI5A 3T6CA 1H7WA 1E6XM 3DFTA 3NQMA 4PMRA 5JMUA 2AKZA 2WMGA 3MC5A 3LCLA 2PURA 1YTDA 3NA8A 2O0TA 5G4HC 3ATYA 1Y65A 3ALFA 4Q8MA 1VYSX 2VRJA 3QRHA 3EMQA 1R3RA 4KF1A 5D2XA 3LXCA 4GQ0A 2E77A 1JG9A 1P43A 1EHNA 1SZGA 1NF0A 4TR9A 4XBKA 4LT9A 1VC4A 4PRWA 1ZL1A 4W7VA 2PP3A 1OADA 1D8CA 1GEQA 3P0WA 1E6NA 2NV2A 3RX2A 3VD4A 2XISA 1W1VA 3ARVA 5ABHA 2ZVIA 2E6DA 1EJXC 2WLYA 3AIVA 4GXPA 4OU1A 3ARUA 3CTTA 3BV4A 3ORWA 2X0HA 1Q4WA 2QCFA 1KFKA 1MZHA 1UCWA 1A5NC 3LSCA 3EA3A 5FL0A 2ZRXA 2VFHA 1TREA 1VEOA 1XIIA 2XSXA 2EF9A 1OT2A 1H41A 4EKJA 2HPIA 3NCOA 5LNVA 3OYXA 2VURA 5JIPA 3P14A 4P7QA 5LA2A 5HWMA 3SN1A 3CJPA 1HKVA 1W31A 3ARQA 1BRLA 4H6KA 2J74A 1D9EA 3TQVA 1IEQA 2Y6ZA 2F61A 3CPUA 1D8WA 4IPLA 1GOKA 3LTPA 4WJXA 3BUVA 1HP4A 3AMLA 5F1UA 1JDCA 2PDQA 4AZGA 3XISA 2RDUA 4PTNA 1XRSA 4M6QA 3UXAA 3CH9A 2RUSA 3ECQA 1GOIA 2YGYA 3I7QA 1BYDA 1F6PA 4CD6A 4XZIA 3OLIA 4N9DA 4M0XA 3LXAA 4YU1A 1WDQA 1S39A 4AY8A 2QUVA 5DLCA 4J3UA 4S3JA 4DM1A 3AHTA 5A6LA 1TX2A 1JNDA 3L66A 3LCWA 1GZJA 1MWOA 1QBAA 3Q2DA 4QE4A 4DJDA 2W4XA 1R7AA 1R6WA 1UR2A 1BQGA 1H60A 3UY7A 1UOKA 3RM8A 3OG2A 4LU0A 3BJTA 1LLOA 1I45A 1I4NA 3QFWA 2Y61A 4M29A 1E5NA 2V6AA 3KVMA 5HMFA 2CKRA 3DG7A 3V18A 2J7EA 5A8PA 4C6OA 4DNHA 1CXFA 1QNSA 2PDUA 1KXTA 1PTGA 3S2CA 2OSXA 3EPNA 4G6CA 4IP7A 2WM1A 4H41A 3VI2A 3CQJA 1QI4A 1SSDA 2EPHA 2BASA 2WHLA 2B31A 3S1XA 4I8DA 2PE4A 2J25A 1BYCA 2UY5A 2GUUA 3NJ3A 4HOXA 2VZVA 4IP4A 3I3DA 1SJDA 4HCHA 4YHEA 4UR9A 1MFVA 3WDQA 5A95A 4H9TA 2HROA 1FKXA 2BGNE 5H6HA 1XIBA 1OB0A 3MDUA 3AYSA 5E0CA 3WDIA 5ABEA 3H7RA 1W8SA 1DJIA 2OODA 3Q58A 5FJRA 4DJEA 3ZO9A 5I3DA 4C6NA 3HV9A 4AD1A 3BVJA 4GKTA 2W67A 3WDRA 3KTXA 1LBMA 4RDZA 1PYMA 4M81A 1CZ1A 4JY8A 3S4TA 1H7NA 1DE6A 4DWSA 4XSMA 3L2LA 3RLHA 3DYPA 5A6JA 4E5TA 1POJA 3EMCA 3GH7A 4A3HA 1W56A 3SURA 2PWUA 4RE4A 5AHMA 1KCLA 4LAZA 1VPYA 2GSJA 4F0MA 4AU0A 5GJNA 1J2WA 4UB9A 4JTJA 5HR6A 1JFXA 5F2GA 3QJAA 3L2IA 4AMAA 3UR7A 4C7DA 4D1JA 5D2WA 1V8EA 3GTIA 3GYCA 4N4PA 4OE7A 1ADSA 3HPFA 4G2DA 4PUEA 5JBDA 3M0KA 4CEUC 4RLIA 2ZZ6A 5AHNA 1BLIA 2XHYA 3CL6A 3THQA 4PL1A 9XIAA 2DSVA 3W75A 4WGHA 3WL1A 2CLFA 2O7QA 1KRCC 2WVUA 3A24A 4YTUA 2BOEX 3NVDA 2WSQA 1TVPA 1TO3A 1JCJA 1SZRA 3A4XA 3IIXA 3DBNA 1CGUA 3WJWA 4Q33A 4PB3A 3CMFA 3O7UA 1H7PA 3GC4A 3WUFA 3V7PA 3K46A 3PPCA 4K8HA 4MMWA 4WDUA 4A3UA 1LL4A 1QHOA 3QQ0A 3CH0A 4UFJA 2DJXA 1R3TA 3GDTA 2RDTA 3T0AA 4ASTA 3WD3A 3QV8A 2J7HA 3WDPP 7ENLA 5BU6A 4GISA 1CIUA 3NEVA 1OFAA 3EWDA 3GR4A 2EKGA 3R7MA 3S42A 3SCUA 1ZJIA 1FWCC 1L0PA 3PAOA 4Z1BA 1L6SA 1GVIA 2VDGA 1J6OA 3EKLA 5AFDA 2PTZA 3KAOA 3O6AA 2E09A 1CDGA 3EWYA 3CTLA 3PTKA 1HKWA 4IMAA 1M1BA 2FIQA 3PG9A 3K8KA 4HPNA 4WGXA 3MKKA 1HNYA 2P0OA 1GVFA 2P3ZA 2DORA 1V6TA 1CPUA 2AQWA 3INPA 3LSBA 3PBMA 4AAJA 1JCTA 4I3GA 4YWSA 1JZ8A 4LW7A 3RIKA 3VNDA 3CU2A 3QM3A 4HN4A 3H4XA 3PUDA 1MEIA 2WPBA 5IBXA 1X1NA 2GWGA 3R25A 4JFSA 1HZYA 5LSMA 4RE0A 5FF7A 4N6EA 4UTWC 3HGSA 4Z0SA 3T44A 1ISXA 2P76A 3BE7A 3T55A 1W54A 3W7PA 3UWQA 1F2JA 4AVOA 3CV1A 5CCZA 4MWAE 1RAKA 3W26A 3NL3A 4IX0A 3WF0A 4U5IA 3GM8A 3G77A 1QNRA 3UJRA 2AKMA 4IPNB 4ORIA 2PPGA 2GGJA 5D2VA 2C13A 4H9ZA 1V7AA 3SCTA 3AQUA 1D7KA 3GW0A 4W86A 7REQB 5RUBA 4JEQA 2VZUA 4ZO6A 1FDJA 1EHAA 1LDCA 4IMEA 1DJGA 4BQ4A 4E2VA 2YW3A 2BHYA 1G4PA 4MUZA 5BXRA 3HQOA 4UXDA 1FOBA 2TPSA 3IK4A 4K39A 1SR0A 2R8WA 5BRBA 2FZBA 3LM7A 3WQVA 1CWYA 3R58A 3SEPA 4DPQA 2Q8ZA 5IHRA 3CAQA 3PFRA 5EY5A 1SPQA 2B7NA 1SZEA 1KRMA 2IXUA 1JD7A 3QH2A 4MFEA 3TQKA 3W3OA 2IKIA 4IGSA 4QJ1A 4F40A 4DQWA 3NSXA 2C16A 2X1TA 4UFLA 1TPFA 1OJXA 3EB4A 3L9CA 3G2GA 4J3VA 4CEXC 1W9DM 3W7MA 3KEHA 4CNPA 1WDSA 6REQB 4GWEA 3SCNA 1AW1A 1M41A 4KGJA 3AXMA 1HN1A 3WJZA 4J9JA 1QNOA 4GVIA 4S3BA 3NQFA 4ZODA 1H1YA 4EOUA 4C6IA 1BF2A 1GOMA 2VEPA 1QO2A 3MANA 1BGGA 3BSHA 1KA9F 2AAMA 1J10A 3DFPA 3LGGA 3ZXWA 3QF0A 4WIWA 3SFKA 1DWAM 1NTHA 1Y0EA 4KCTA 4N02A 2ZUMA 1G1YA 1BFNA 5KSWA 3EDKA 3UWZA 4UMAA 3S2NA 4MVAA 1RR2A 1KD0A 1RJPA 2REQB 3M0VA 3G1FA 3GH4A 1BSLA 3G1DA 3TN4A 1VBHA 1LF1A 4Q4RA 2HVNA 3R43A 3NDOA 4LB4A 3LENA 1YPXA 3PZGA 1H62A 1WKDA 1N8IA 5D37A 4DLMA 3P74A 3PTQA 1JUEA 2JFEX 2J88A 4S2BA 1QU4A 2PZ0A 2X1IA 1U30A 3MQTA 3VDCA 2F6XA 3OVQA 2A7RA 2AL2A 4RXFA 1WKFA 1BEUA 4DO4A 4XKYB 2W91A 3N11A 3IJDA 1PTAA 4CVWA 3M0JA 2PUZA 1EDGA 4ZEPA 3TC3A 1TTPA 1GOQA 2WJDA 2C79A 2YA1A 4GIYA 5H8MA 2C71A 4D9PA 4LEFA 2DT3A 1DJYA 2QLYA 3BO9A 3F4NA 1OWQA 2ANUA 2VWTA 4D8LA 1A5AA 1O7AA 1WV2A 2PTXA 4NVTA 2H9AA 4M1BA 4H6QA 1W5OA 3W7EA 3L4VA 4NAFB 3C2YA 2CETA 4OVXA 4ATDA 2PDFA 5I06A 1I6NA 3UG5A 1H7RA 3F5KA 4UCGA 2ZXAA 3C3NA 2Z0IA 3DZ1A 1RV8A 1FXPA 2WK2A 4LYKA 2PDLA 2J78A 3AC0A 3UCCA 3AHXA 1UC5A 4GFSA 5LIXX 2CBJA 4YHGA 1VLIA 1XYFA 4XIAA 1F4HA 5HWNA 4D6IA 1RK6A 2QEZA 4YL2A 2VDHA 3GNRA 1Q63A 3GNOA 3WMBA 3M1ZA 3N6HA 3B9DA 3RMEA 2QIIA 4JQ3A 4ZGYA 5CLWA 3HPXA 1A5SA 2WHJA 1TVNA 2V2HA 4AZCA 4DI9A 3RCYA 1JDEA 4MTVA 3UPBA 3H24A 1R3SA 2BODX 3BSGA 3NXFA 1AQMA 1BWVA 7TIMA 3UWUA 4LFYA 1WXJA 1ZQ5A 3AZSA 3CAKA 3COTA 4AQLA 4Q4OA 1WDWA 3BAYA 3TKFA 3T1GA 3V1PA 3OBEA 3TWAA 1LLWA 3U3HA 5IBXC 4I7WA 3EWWA 1WBJA 2OLAA 3KBJA 3CUFA 1TRDA 4H8HA 3ATZA 5AC5A 2G3NA 1S5VA 4ZOCA 1PX8A 1DIOA 3OJGA 1MDLA 3SSJA 1O60A 2D73A 1E70M 1XSJA 3AISA 4KBXA 1Q6OA 1V3HA 1T8QA 3LXBA 4WY0B 4X60A 3AUJA 5FEZA 2ISFA 3CZEA 3L21A 3PULA 2OWWA 1QK2A 1KWGA 4S3CA 2BOFX 3W2NA 2Y7FA 4NZ5A 1MNSA 2VGFA 1QATA 1XD0A 2KAUC 3GTXA 1EJSC 4D6FA 4I9TA 4LY4A 3EMZA 3GK0A 3WH7A 2Z1SA 1W5MA 5E0KA 2EQDA 3MVIA 1SO3A 3OEXA 2IPJA 2A5HA 3SJNA 2RDXA 4XZ9A 2G41A 4JQ1A 3NM1A 2KZHA 3FCPA 1C7SA 3ZVIA 2OTDA 2CLKA 1JQVA 1G9HA 4Q4KA 2QPUA 1OY0A 3V0UA 4J3TA 5CSUA 3E0FA 4BF7A 3R8HA 3VDGA 3WIJA 4JTDA 3CS2A 4LX4A 3GNNA 3W2UA 2J9YA 1JNEA 4O1EA 2JGQA 1LWHA 3FYOA 4PCSA 1W3NA 1EXBA 2CHOA 5I79A 3N4AA 4JGDA 3AHYA 3AU2A 1A3XA 4YPJA 3S2LA 1KFJA 3WQ6A 1HW6A 4YMZA 3E74A 2Y70A 2I9EA 3WJSA 4A8IA 2IPFA 3WLTA 3G6LA 2EJAA 1U22A 3M64A 4R7OA 4ROPA 9CGTA 5I78A 4NXKA 1V02A 5XIMA 1BYBA 3QV9A 4AYGA 4JIRA 4PTMA 3DC0A 4G1KA 3PVFA 5HJYA 1Q85A 2HMCA 1FVPA 3WF4A 4ERIA 2ALDA 4KWOA 3A4WA 3TAKA 5D2YA 1UA3A 2HEJA 4Y96A 2ZUVA 1U83A 1EOKA 1FP8A 3E1F1 1DWGM 3SZ8A 2G4JA 3UGVA 1IZKA 1EEXA 4B5UA 1NFPA 1P6WA 1OYBA 4GYFA 4FX6M 1UR1A 1B3VA 4KT2A 5AVNA 2ABBA 2YZ5A 3PJUA 3ZZ1A 1Z42A 3N1AA 3ZLHA 4NL1A 5LXXA 2VD8A 3VVGA 3B4UA 3GFXA 2UV8G 5ABFA 1LOQA 3UFYA 4MPKA 3FGCA 1S5TA 4GY0A 5FACA 1XG3A 3ID7A 2IQ0A 4XIMA 3PTMA 3WEMA 4DXKA 1JZ3A 3TFCA 2ZE0A 3CZGA 1FXQA 3LRMA 2H3DA 3VIJA 2D20A 1EOMA 3NZGA 4QEHA 1CYGA 8XIAA 1RVKA 3W22A 4NRSA 3SIMA 4HU8A 4AZCB 3K1DA 2WVVA 5F4XA 4A3YA 4PUJA 3UYCA 3WBWA 4QS6A 3B3DA 1UH2A 3SQLA 3FHAA 1VCFA 4MB4A 4O15A 1TG7A 1E73M 5CG7A 2V8ZA 2B7PA 4J27A 3GIYA 4LGXA 3PZ9A 4P8WA 5DCDA 4W7WA 1E1CA 2RGMA 4FS9A 3GD6A 3S83A 1IF2A 3ZYZA 4HCDA 2VVSA 3CASA 4NAEA 1ZENA 2CERA 1B3XA 1W1IE 1GOWA 1KXHA 2FVMA 1ZJHA 3U5YA 3RHGA 2BVWA 4FX7A 3UWWA 2DQWA 1QPQA 2W62A 1FH7A 4NI8A 4AH7A 3SCPA 2QVHA 2FDMA 4NX0A 4F0LA 3GW3A 3VD5A 4CQDA 3QHMA 1UG6A 1UQYA 1VB9A 3S2JA 3TA6A 3W6YA 4AG0A 2Z1BA 2HZGA 1RSCA 2RJGA 4HHHA 4PN2A 1DWHM 3OZYA 1LJYA 1EA9C 3LRKA 1DORA 2DUXA 1I8JA 4JN8A 3WBYA 2BV9A 4FSAA 1IXNA 2OEMA 1K6AA 1UD3A 1NQ6A 3G8EA 4MNKA 1Z41A 4DY1A 2HRWA 1YBQA 4Q4MA 3WLNA 1FRBA 2CYGA 1V77A 2HE8A 4JDYA 1J0JA 1KFLA 3BG3A 2D0GA 1WKYA 3OIHA 1H0GA 4IIGA 4URIA 3GAYA 4X2PA 2O56A 3JUGA 1FWTA 4G56A 5BOFA 4PMXA 3TV8A 2E1DA 3LCFA 1FWGC 4BK9A 1LRQA 3V1HA 1UR0A 1UZDA 4FIRA 3AYVA 2ZX6A 4JFUA 1FCBA 4JTFA 5T8GA 1SO6A 4FOUA 1JZ2A 2CLOA 2R24A 1CBGA 5D8ZA 3TW7A 2W27A 4B4HA 4DZHA 3UJ2A 3LZ3A 3BAWA 1KBJA 3RN6A 3T0BA 1GG1A 1G4EA 5PTDA 4NJJA 3O9NA 3CIVA 3LHVA 3W37A 3HU7A 4HPXA 3H2AA 1YMYA 2TSYA 7CGTA 2CZEA 1VJSA 3UZWA 4JIEA 4JTIA 3P5ZA 3ARSA 3GBDA 4M51A 2NVCA 2ZA2A 3QHOA 5FI8A 1M7XA 2CFFA 1EQPA 4LPCA 4W7UA 4A3RA 2VEMA 2Z2AA 3A23A 2J79A 1GORA 4OOZA 3IAQA 2PDYA 4FA3A 1UQZA 3II1A 3HM7A 4E38A 4LVBA 3BZGA 3VABA 1US0A 3PWIA 3LHTA 1HO4A 4MYXA 4B5NA 2OCZA 3O63A 4BS0A 4R7WA 4HU4A 4O4WA 2WQPA 4CCZA 4I6KA 4GGBA 5HAOA 3RNDA 3PTDA 1V0LA 2J7FA 3CWNA 1PXGA 1TV3A 2VHLA 4S3FA 3FK4A 5GNYA 1W5QA 3TVAA 3IUDA 4R3UA 2GYIA 1R7OA 1RPKA 4JFTA 3V35A 1ME8A 3R11A 4ROQA 3IJ6A 3GZAA 5AYBA 1PE1A 3H7UA 3EGJA 8RUCA 1DJHA 1TJ0A 3D3AA 2A3BA 2I1OA 3HB9A 4D6CA 4IIDA 3QTPA 2WJFA 3ES8A 3W7QA 2XZ7A 3E2SA 1B3OA 4JAWA 2NT0A 2EKCA 4Q8QA 2DIKA 2A7PA 2I5IA 4IJCA 3E0VA 3TYDA 4RNFA 1FDZA 3NYDA 2W66A 3PFMA 3PB0A 4JFWA 3BLLA 4HZMA 2YYUA 2QYGA 4Y7EA 3TR2A 4RV3A 5DRCA 2V68A 3QEZA 2OKTA 1TMLA 5HJLA 5CPMA 3FKRA 4ZSUA 3PG8A 3EDFA 4XD6A 3U48A 4Z1YA 3GHUA 3WQDA 3KBWA 4K8EA 2ATMA 4IX2A 4AZBA 3S47A 1QRQA 1ZTVA 4J7RA 2PLKA 3Q67A 4MY8A 4KCUA 2CHNA 1ZLPA 4K1WA 1YNYA 1M5WA 4BWLA 2A3CA 1TZ9A 2PCEA 4TX9A 3TTQA 5HXMA 2ZRUA 1F3EA 2GJPA 2O4QA 2YA2A 3DHPA 1AQ0A 1XD1A 3RM9A 2G3FA 3TCEA 5TAOA 3VOHA 1YTEA 3DI1A 5CPTA 2XM1A 3NSNA 2UWFA 1NDWA 4EPKA 1FFRA 3PY2A 5CGQA 3KE0A 1WO2A 4XZBA 4DIAA 4L6HA 2ZC1A 4BHYA 4W9TA 1OM0A 3DI0A 2PA6A 1OC6A 1OG6A 2QHAA 2VEGA 4XVDA 3JZEA 3S0CA 5IDZA 4W8BA 2ZC8A 4JDBA 1R85A 4TU1A 3JZUA 4O50A 5BXSA 3WX7A 5BNKA 5C7HA 3E49A 2YXGA 3S6TA 1YIXA 4MLRA 1AODA 3N29A 1XFBA 4LRSA 3EEGA 4PMZA 2ASHA 2Y0FA 3AIWA 2XN2A 3LPPA 3USZA 3S8HA 1K4GA 3DEQA 2PZNA 3LOTA 2G97A 3CO4A 4Y6GA 4JIHA 4ES4A 4NI3A 3LV6A 2IS7A 3QGAC 3F5LA 5G4WA 3BV7A 4B3ZA 3RPTA 1HQTA 1AL7A 2Y85A 3LM3A 5FF4A 3NQEA 1TE1A 1MW3A 5T26A 3VKBA 3GDBA 2R1KA 3ISIX 4NQ1A 5GNXA 1NP0A 3O16A 3RJXA 3AIEA 3PZQA 2HPMA 4IQJA 3KZSA 5EKYA 1TUXA 2QT3A 3KP1A 1DJXA 2FJKA 2ZXBA 3UA4A 3IRDA 2OELA 3LBMA 3WQFA 1LQAA 3HQ1A 3M16A 2QCMA 3M46A 2VEIA 1FKWA 3ITYA 3FJLA 1PWLA 1IWBA 2DT0A 1TJ2A 2PDMA 4ZQCA 1O12A 4ICMA 3HFYA 1NU5A 1KV5A 4IMFA 3NQVA 2YB1A 4AWSA 1W3LA 5D30A 4JXCA 3CMJA 5D38A 3GTNA 3RRAA 2J7BA 4QAIA 2WNWA 2A3LA 1XIMA 3U9IA 3WLSA 5GVJA 3VDAA 1UASA 3XINA 2NUWA 4Q3MA 4UQCA 1O5KA 2VCAA 4ECLA 1CXLA 4ADSA 5K3VA 3NZPA 2VI0A 4MB3A 5DT5A 2C1HA 3N73A 1F61A 1EKOA 2ZOXA 3VGDA 1MUCA 1E0WA 1A5BA 1PS9A 3PM6A 3TYCA 1NOWA 4BF9A 4DBEA 2PDXA 3VKKA 3P60A 5CPSA 3IVUA 2UY2A 3T81A 2QPXA 4GVFA 1E5JA 3P84A 1HJXA 3GRIA 1ZU8A 1B4EA 2AGTA 2O9TA 2VYOA 2XFYA 1EYEA 4FNPA 1E3ZA 1W9XA 4UFHA 4EF9A 5E9AA 3TA9A 2YJQA 4ACZB 3IJ9A 1K9EA 2E6YA 1A3WA 2HXTA 3IV3A 3DKLA 1M68A 4AXNA 4MKVA 2PDPA 3CMGA 1DPMA 2WMIB 4TV6A 4PMNA 2XH2A 1NH6A 1OCBA 1DQXA 4BFAA 3T2QA 2PLMA 4LCRA 1XRFA 3MP3A 1A47A 4PMVA 4V33A 3LU2A 1Z32X 3BURA 3NQDA 3VD7A 3FY1A 4HNUA 5FEWA 3VIHA 3EXTA 1K1DA 2GK1B 1PVNA 2F6UA 4AIUA 1RPXA 4O8RA 4WQ6A 1MQRA 3TXVA 4NT0A 3GWQA 1N7KA 3FSUA 4FXJA 1VCGA 2HS8A 1Q45A 4PUDA 3W73A 4GGHA 3HZ3A 2JKAA 2TODA 4LSBA 4EF8A 1JPDX 1GOXA 1YEYA 3RFAA 4QEEA 1KTBA 2Z7GA 2NXHA 3NQGA 2WCSA 4IL2A 3MUIA 1O5QA 3BQ6A 5HMDA 3H22A 2E5CA 4NYUA 3A9IA 1XRVA 3PUEA 2QKFA 4JPGA 3L68A 4QBXA 3MZ2A 1FH8A 2ZX9A 3G1YA 4GJJA 2NXIA 5I0DA 4KRUA 3GS6A 1XCFA 1R2SA 1V51A 4UMBA 2PWDA 4EAMA 2FFIA 2BY0A 3GU9A 1R38A 1VS1A 2CZ5A 2A3EA 2XGIA 4GVHA 2VKZG 2G50A 1Q8AA 1BAGA 3AXKA 2J24A 1I2QA 3TCSA 3OVPA 1BKHA 4JHOA 5LYRA 1EZWA 1I2OA 3KS5A 1VBGA 3UESA 3CUZA 4ICNA 3FV9A 3GVVA 3GTHA 3KOWA 2QIWA 4H9VA 4X0VA 4TMCA 1E0TA 3N25A 1KM4A 3M0ZA 4RPPA 2Y5JA 1XLLA 3W1AA 3CLMA 2ALRA 1AG1O 3BDKA 3SUUA 2ZUTA 3C56A 5DXXA 4IP5A 4V1XA 1P0DA 2P10A 1F05A 1F3WA 4EK7A 4E6MA 1B54A 4A8RA 3VK5A 1NARA 1GONA 2CZDA 1M3UA 1EH9A 4Y9AA 3OGSA 1TWDA 1IXQA 2GUBA 2HCVA 2BS9A 5HMEA 3UWYA 1RY8A 1QI0A 3TN6A 2W0UA 1YDNA 1KBLA 1IXOA 3QXBA 2YCEA 4ZFCA 1D3HA 1UR8A 2WLZA 3E0IA 4L4LA 1VFFA 1O5XA 2BVDA 3ICJA 3O0FA 5IRPA 1QW8A 3NFUA 2VRKA 1MYRA 2UZ9A 1W2VA 3W1LA 2X7WA 3MHGA 4XZMX 1UKQA 4LV4A 4MKSA 3RX4A 3NNTA 1S3TC 2OGYA 3A22A 1UKOA 2GJNA 1U1UA 3W1RA 3GE7A 3N4EA 1OK4A 3NVTA 3NZ1A 3T07A 5ABTA 4HNTA 3UVIA 1FH9A 3VOCA 3VMOA 2YDQA 2WMHA 1C3FA 2WWCA 3WL0A 3XIMA 1ICPA 3GKFA 4FI4A 3VNKA 3BK0A 2DZTA 2J9ZA 2VRQA 3N04A 3Q37A 1FWIC 3BANA 3MWCA 1G4SA 4F66A 5I2UA 1PX3A 5CJ5A 4ZTXA 1OG0A 1RHCA 3WO8A 2X0YA 3TTSA 4K8GA 3S9YA 1RD5A 4AB4A 3JS3A 1ZS2A 2DSUA 3UXLA 1KCXA 1QTWA 4GYPC 2OT0A 1D3GA 1K4HA 3VCNA 2G96A 5F2MA 2JKEA 3LG3A 2DT1A 3I65A 4A8NA 4PB5A 5A1AA 5TF0A 3ZWTA 4D2JA 1H09A 1HTIA 1A5UA 2PU1A 1OFBA 4TVDA 3DFSA 3TSDA 3GFYA 5M2FX 3U7BA 4UNIA 3AXHA 3HN3A 2ZIDA 4YTQA 2A3HA 2SFPA 3O0KA 4UTTA 2YL6A 4ZO9A 3GNXA 3D47A 2VOTA 2J75A 4MWAA 4MJZA 5I3KA 4RKAA 5K9CA 5AYIA 4GUGA 1E55A 3NTYA 2QCNA 4IZGA 3DU0A 1EF2A 1XISA 2FGZA 5HPOA 1OK6A 4XX6A 4C1NA 3H2MA 1E43A 1CEOA 3WH9A 4KETA 3CZ8A 3MT1A 4XD3A 5JXQA 1ZBCA 1OGBA 4JTCA 2D2HA 3T9PA 2NZLA 1IZJA 4E8CA 5CPNA 4ZB2A 4H9YA 1EWEA 3F4WA 4DLFA 1YXYA 3TROA 1SR9A 3MSDA 5FJOA 3RF9A 2INFA 3WK1A 3VFCA 4H8VA 5BRPA 1XDLA 4IMDA 4F0HA 4BY3A 1T7LA 1V79A 1HP5A 1ZAHA 5HDRA 4IPPA 4QS5A 4XISA 3NEHA 2VO5A 4O0KA 5B7YA 1ZCCA 1BSIA 1F6YA 3ERPA 1ONEA 4UTLA 3PS7A 5A6MA 3W84A 1TZ7A 4IGNA 2VX7A 1KTCA 2YCLA 4MM1A 3U5UA 4FNQA 4MB5A 3TN5A 1DXFA 1AH0A 1BXNA 2OLSA 1DIDA 1S5MA 4IH3A 5A8NA 5BMWA 3TTYA 3URBA 3F7JA 2Y24A 1Z7AA 2D1ZA 3GDKA 4WCJA 1NWSA 5DX7A 1S46A 4NUWA 3NQBA 4KRTA 1KFWA 1GT8A 2VGIA 1V3LA 4BZYA 3QYQA 3HV8A 2ABAA 1F73A 4DBSA 4ZQOA 3EDEA 4UNKA 4A35A 5LNWA 3AXIA 3M0HA 1R9ZA 2W79A 4G5DA 4YTRA 3LLDA 4D8ZA 4E3VA 3DGBA 3QC3A 4OQVA 2R1PA 4NF7A 3F2DA 2VX6A 3OQEA 3U7VA 1CB2A 3W82A 2XIJA 1ZZMA 4X61A 3FKKA 4C90A 4LV9A 1KQYA 4QJ3B 2DZXA 1S1RA 2R94A 5BXTA 3DCPA 4NP7A 5JIWA 1E6SM 5BW6A 1VPXA 1TV2A 2QUUA 3B03A 1DJZA 1SGJA 3OVRA 3SRDA 4U4MA 1W1ZA 3TTEA 4PB4A 1X97A 3EPMA 3N13A 2WW5A 3LQGA 3LUTA 1FY6A 3WUBA 1HGWA 3B0PA 1MMFA 1J01A 2E8YA 1KXQA 2FKPA 2INZA 5DELA 4GY7A 1DV7A