4K8EA

Oye1-w116v complexed with the aromatic product of (r)-carvone dismutation
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLVVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 150
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k8eA00
1ADOA 1QPOA 3QF0A 1WDWA 3CC1A 3L0NA 1GTEA 4DQWA 1P1XA 5AHLA 2J24A 1X7FA 2QJGA 1L6WA 3NQCA 5DLCA 5CSRA 1ME9A 3WJSA 1OHLA 4MZ8A 5MHBA 3FYPA 3W7RA 4XUGA 3A21A 1K8XA 4ADUA 1K03A 4AHQA 2H6RA 1IGSA 3L68A 3KXQA 1DORA 1OFAA 3PB0A 1TREA 1OK4A 2G95A 4JIPA 4CLMA 4XBKA 1YPFA 4C1LA 4YCOA 1UB3A 4ZMGA 4EIVA 1WV2A 5D2WA 4O1CA 5FI8A 4ICNA 4O17A 3UWUA 1UJPA 3UXAA 5CSSA 3CTLA 3MBDA 3UWYA 2H8XA 4FHAA 1P0NA 2J9ZA 3Q2DA 1LZOA 1OJXA 1I2RA 5IM51 2PURA 4FIRA 3STEA 3G1AA 3R8RA 3LGEA 2YR1A 3W84A 3KX6A 1MZHA 3IGUA 2XN0A 3DHDA 3W88A 2FB3A 1FCUA 3LXBA 3QRHA 3LRLA 3C52A 1CX9A 5H91A 3THQA 4WOZA 1CW2A 4O50A 5A8GA 5HR7A 1VRDA 4YLWA 1QPQA 1ZALA 5D2XA 4MYXA 3F03K 3B06A 3MP3A 5AFDA 2QR6A 4O1AA 2Z6JA 4N4QA 1TQXA 3HGSA 3MWAA 4IGHA 3GKAA 1W5QA 3G1FA 3PC0A 5KSWA 5EYWA 1XFBA 2CLEA 1S5TA 2VFFA 3QJAA 2TMDA 3O63A 3B04A 3O6YX 3ZR4A 1TSIA 3LCHA 3EWXA 3M41A 2FPVA 2QCGA 5CKSA 1FBAA 1M6JA 1SZNA 1EA0A 4PTNA 1GVQA 1VJIA 2QF7A 5F2GA 2Y7FA 1GTHA 1O4UA 1TTQA 5AHNA 2IQTA 1PIIA 3DXIA 2DZSA 3NM3A 3TSMA 1A5AA 4NJJA 5D2VA 3UYCA 3GX9A 3NQMA 1RZMA 4A21A 1DQXA 1O5XA 1SO5A 3GLCA 2DZTA 1ME7A 1J5TA 3EWYA 1Z41A 4LNYA 4QNEA 5BMXA 3QM3A 1K8YA 4S2CA 3TQ0A 1SW0A 4O13A 4UMCA 2ZRVA 4N9BA 3HG2A 3TJXA 4NZJA 2I9EA 3C2FA 3MI6A 4O12A 3TW7A 1VCFA 2HS8A 4RV8A 3W07A 2A0NA 4HSNA 3NL2A 1WOBA 4JYFA 4LWWA 3WK1A 2W79A 3STCA 4O0ZA 3UWVA 1I2PA 3CM4A 4WD0A 4WX2A 4GBUA 3A5VA 3L21A 1H60A 5HMSA 5J5DA 3W1MA 1W3TA 4QIUA 2BXVA 2NXIA 2ZQ0A 1LP6A 4JTUA 2ZYFA 2RHGA 3M43A 1MSSA 4N02A 1QOPA 3E12A 5AHEA 4GFSA 3NPWA 4MY1A 1MXSA 1T96A 4K36A 3DI0A 3W7OA 3QMSA 3R2GA 1A5CA 3M5VA 3MJYA 3CQ0A 3DKLA 2A4AA 3STGA 4JTGA 1VH7A 4GNJA 1W3IA 5D02A 3OEXA 4WZHA 5CZ0A 3NO5A 4ML9A 1G6CA 4DO4A 1PHWA 3S0CA 3W7HA 4GUHA 4UTKA 3W7KA 1QPRA 1FUYA 3R89A 4R33A 1W8SA 1I4NA 5CG7A 4ZQOA 1YADA 1SW7A 1KFEA 3FJLA 4A3UA 3UWQA 5HR6A 3TXZA 3OA3A 2W6RA 4WXZA 5EKYA 4Z0SA 2VKZG 4E2BA 1VYRA 5F2MA 2VENA 2P10A 2NUYA 4LV4A 2CLHA 3IVSA 1IIHA 3TSDA 1EP1A 3TNOA 2ZRYA 4UCGA 3IEBA 1YYAA 4BWLC 1IXOA 2FJKA 4ADTA 5DCEA 5D09A 4O0KA 4N6FA 2Y7DA 1SQ7A 4MOZA 2EKCA 3KRSA 2ZRWA 4MZYA 3UPBA 3LERA 2BLEA 4K8HA 4M5PA 5F2IA 3NR0A 4XZ9A 1THFD 2Y6ZA 3BLEA 3HQ1A 5D33A 3L5AA 4WXYA 4JX6A 1EUAA 3W2JA 2WNZA 5EPDA 1OF6A 3C6CA 3LCIA 3LCLA 5AHIA 1YPIA 2GVGA 5TBOA 3W75A 2EAWA 1R46A 4ZQMA 4GUGA 3NZRA 1KTBA 1U5JA 3YPIA 1MO0A 3Q94A 2E6FA 4LRTA 5D2YA 4FIQA 4W9TA 1I2OA 3R12A 4XWUA 1OFEA 2DP3A 1HL2A 3F4WA 3P61A 1JCMP 1I45A 1Q3NA 3NG3A 1JUKA 3PB2A 4WJEA 4N9CA 3MHUA 1H1YA 4GRSA 2FFCA 3IVTA 4UTTA 4MY8A 2VFHA 5AHMA 3EB2A 3FYOA 4ZZ9A 3T55A 3PBWA 4ONVA 1ML1A 5KZEA 4OBTA 1W5NA 3UWWA 2XN1A 4PC8A 1LRTA 3L65A 3HPZA 3KRUA 1RV8A 1NVMA 1GYLA 3LCXA 4O4VA 1OFBA 3G1YA 5E1QA 2WKJA 3TC6A 5K4ZA 1L6YA 3NQDA 3GK0A 2V0TA 4O14A 1GEQA 4PCFA 2FLIA 2CW6A 3P84A 3LCFA 2YDAA 2DZUA 3W7NA 2NV2A 3H55A 3GKFA 3P5ZA 2VFDA 4IMCA 2E6YA 4UTWC 3EWUA 4AF0B 1HO4A 2Y62A 5FF3A 3T7VA 5ABTA 4FX6M 4O54A 1C9DA 3EWZA 4NX5A 2ATSA 3P8IA 3M47A 3DFQA 3JR2A 3MHGA 3RU6A 5DCDA 4FX7A 4IMEA 3UNDA 3ZWSA 3EWBX 1WYIA 4G1KA 3DKJA 3HO8A 1EWEA 2B4GA 4CCDA 3G1DA 1F7BA 2OCZA 5LNRA 2UV8G 3W7EA 1TMHA 3IIXA 3Q37A 2OZ0A 4QSHA 2QKFA 4NXSA 2JBMA 5DBTA 4JTSA 4RK8A 3M1ZA 4X3ZA 5LNWA 1YXDA 4NZFA 3MYPA 4NNCA 4JXCA 3KHJA 4HNVA 2NLIA 4JICA 4MLJA 3SECA 3M6YA 4O15A 1O60A 5L6UA 1TQJA 3W1TA 1SZFA 1KV5A 2OT1A 5T26A 1H51A 3PG9A 3W1AA 2WSYA 3UPWA 1OFPA 1PVNA 3P7YA 1VYPX 3QW4B 1VC4A 5D38A 3LXAA 3F1QA 2B7QA 1ZAJA 4HN4A 3KAOA 2JK2A 1T99A 2TYSA 4IWWA 2FPTA 4RXGA 2CZFA 3FOKA 1PCKA 3DFPA 3HF3A 4MYAA 3HGRA 3G3MA 1P4CA 4NJGA 3QFEA 2A1YA 3LTYA 1KA9F 1KTNA 4NX0A 4MZ1A 1H50A 3GVGA 4B5NA 4NVTA 1FDZA 1FXQA 3DI1A 1FY6A 1JRCA 2EF9A 4S2BA 4FNUA 3SI9A 3TIMA 2YW3A 3VNDA 4TMBA 1AL7A 1XBXA 2JGQA 5A5WA 2O7QA 3HB9A 3W22A 1TV8A 5CPNA 2B7OA 4XQ6A 5FF2A 4L4MA 1FWSA 4WUIA 3FA5A 3NYZA 1SSDA 3C3NA 2QAPA 4CQAA 1QOQA 3RLVA 3G1HA 4YMZA 2GQ9A 2CLFA 3OVRA 1B4KA 2C6QA 1GT8A 4DEFA 3STFA 4KFPA 3B8DA 4TR9A 5F1UA 1TTJA 3W2LA 2A7NA 5KTLA 2VFIA 4DELA 3A5FA 4LV9A 2BSLA 5D03A 1JQXA 4TO8A 5KINA 5AOUA 1DQWA 2CLLA 3W9ZA 3ABQA 3NQGA 3L9CA 3FLUA 2CZ5A 4ALDA 1OFDA 1XL9A 4WY0F 1Y0EA 3KVKA 4Y9AA 2E5DA 5EY5A 1JVNA 2YCEA 4PL2A 2XN2A 1HO1A 4PEKA 3M9YA 3PVFA 4FB7A 2H3DA 5G2IA 5FF0A 1DL3A 1KM5A 1L9WA 3QW3A 1TRIA 2C14A 1W31A 3A22A 3TQKA 1R30A 1B57A 1EPXA 4GWEA 3ZS4A 3TAOA 2RFGA 4S1FA 3ATYA 2R94A 1JCJA 3E9AA 2ISSA 4M7SA 1SPQA 1V5XA 5HWNA 1AG1O 4M6QA 1QR7A 3W2NA 5DY2A 1VHNA 3KRZA 5LNVA 1M7PA 4PFMA 2DZXA 2ZBTA 5I3GA 2VELA 4RZ5A 4MJMA 4LVGA 5LHFA 3HG3A 1WBHA 3B4UA 2DORA 3C2OA 2A2IA 3QSRA 1NAL1 2G97A 2CLIA 2E5BA 5LKYA 4ADSA 4K7VA 4JTKA 1G7VA 4TU1A 2OMAA 4N9EA 2A21A 1SUXA 1LRNA 2FDSA 1H7OA 3PWAA 3C4UA 1KFKA 1GOXA 1WXJA 3NM1A 4IMGA 5GVJA 8TIMA 4XTIA 3BG3A 1FQ0A 1KFBA 2OJPA 3W2UA 1UBSA 2HS6A 1XDMA 3OIXA 3UD6A 1KM4A 1Q45A 2Z1BA 2X1RA 2V5LA 3D0CA 2YSWA 3TK7A 1A53A 2C0AA 5DXXA 1TB3A 1GZGA 3HPSA 2DJLA 2A7RA 5DN1A 1LLZA 3CB8A 1R2RA 3I7QA 3IIVA 1YDVA 1LRQA 1ZY9A 2PRLA 4KKXA 5KZDA 1ALDA 3RLUA 3QYQA 1MEIA 3NXFA 4ORMA 1R2SA 3GNNA 3DHFA 4MY9A 4BI6A 2J88A 1LTDA 4DF2A 5FEWA 3QH2A 3TX9A 1SO3A 4RCXA 5D2TA 1N8FA 3UY8A 4EF9A 1LDCA 1DBTA 4UFHA 1TPEA 1L6SA 4UTMA 3KVLA 1OX4B 3UXDA 1TJPA 1AMKA 3T44A 5FESA 3F4NA 1RVGA 3DAQA 4QJ1A 4XTDA 1RQHA 1G69A 4UTJA 4XKYB 5EL1A 1X8FA 4O1BA 5EBUA 1XXXA 4HT3A 3T4CA 1QO5A 5AC7A 4Z1AA 1LORA 4GJ1A 2ZZ3A 2Y63A 5L9FA 2CWNA 3BW2A 1B4EA 4Z08A 3LCGA 5AHFA 3GZ3A 3S9YA 4U4MA 3WJWA 1LCOA 2RH9A 3PM6A 1PV8A 1SZGA 5U4NA 1FWRA 1G4PA 3OBKA 5E93A 3W70A 4CNPA 2B0MA 1FX6A 2ALDA 3RNDA 4OV9A 5I3FA 2ZZ4A 3G3DA 1G7UA 4AF0A 4Q33A 4JTJA 5I3HA 3SFKA 1H7RA 4UFJA 1VPXA 4ZVJA 4UTUA 1UUMA 1JCNA 3LXCA 2C16A 2J9XA 5D05A 5FF4A 2Z6IA 1DV7A 4UUIA 3HBLA 4H6KA 3W87A 1ONRA 2EGZA 4O16A 3VCRA 1V7YA 3DBPA 2EPHA 1XC4A 2ISWA 5DY3A 3GDRA 1GVFA 5BW6A 4UIOA 3L0GA 4FNSA 3W1QA 3N9RA 2C18A 4CNNA 3MO7A 3OVPA 4MFDA 5G1TA 1TV7A 3CEPA 1F6PA 4GUFA 4GUJA 5D04C 1TRDA 4PH6A 4DBEA 2E5CA 3JS3A 3GR8A 2QCNA 2PRMA 3E96A 4O52A 3SZ8A 2ZA1A 2YW4A 3QSTA 3CHVA 3GXTA 2GJNA 2CFFA 1JRBA 4QM1A 3EXTA 2H3BA 1SO6A 3NL6A 3IV3A 2JKAA 2CLMA 3DFOA 2A7PA 1PS9A 4BI5A 1F76A 4N4PA 1EX5A 4D2JA 1K3UA 1PHQA 4JTEA 3OVQA 4LUIA 1KFJA 4EVZA 3SR7A 4MPQA 5HWJA 5LSMA 3QQ1A 4JGDA 3CEUA 1I2NA 5G5IA 2A6NA 4L4LA 1JUEA 1JCXA 4I7WA 3CWOX 3BARA 4OU1A 1ZENA 4HIBA 3MP4A 4MIMA 3PUDA 3W7JA 1P5BA 2QDHA 2VXNA 3S5ZA 4HSOA 4P61A 4AWSA 3E02A 1TPC1 4RXFA 1OYCA 2E6DA 1NF7A 1OX5A 1FCVA 1H7XA 4UC5A 2X1UA 4OGZA 2DZWA 2FQIA 4YL2A 3NGJA 1T8XA 4GXMA 3HG4A 1DVJA 2C19A 1OVDA 4QQ3A 2ZZ2A 3FIGA 4M6VA 3VE7A 5C5YA 2VFEA 4R53A 2Y7GA 3KVMA 2QUUA 3S1UA 1SR9A 1LOQA 2NXGA 1WA3A 3NQ8A 4LRSA 2A5HA 3ZFHA 3LOTA 1IXPA 3UY7A 4O19A 1L2UA 4ZQPA 2NWSA 1KV8A 1LROA 4NU7A 4XBSA 4R7JA 1GWJA 3R5EA 1BEUA 6TIMA 1S3HA 1ZNNA 2KZHA 4MKNA 3PSVA 3IIZA 4LVBA 2FPYA 5CZJA 5G2HA 2ZTJA 3LV5A 3QC3A 4UTHA 3L5MA 3PSWA 4UFKA 5G4EA 1G4EA 1ME8A 1BKSA 2YX0A 4FXSA 3ELFA 3MBFA 3HOJA 1Z48A 1P0KA 3NQ7A 1I8JA 3ABRA 3AO0A 1EUNA 3EXSA 3L5LA 1G4TA 3LHVA 3P62A 3PUEA 1W3NA 3A24A 2NUXA 2TPSA 4Q4KA 2V82A 4AH7A 4O57A 5BMWA 3VI2A 1XKYA 5BRBA 4RX0A 3MP5A 5FEPA 5C2XA 3W6YA 3L67A 3GYEA 1D9EA 3HMJG 4TX9A 2QJIA 1A5BA 4I7UA 4HHPA 1AW1A 1ICSA 1TIMA 3B03A 1VLIA 3PG8A 3O15A 1KM3A 1Q6OA 1VCVA 1EEPA 1W0MA 2X1TA 4FXRA 4PODA 3W2MA 1OX6A 4UNKA 2Y85A 4Z1DA 5CGQA 1Q6QA 3W85A 3NQAA 3VFLA 5C55A 4MUZA 4N6EA 2Y88A 4JN6A 3G0XA 5DELA 5C54A 1OF8A 2GQAA 1HFBA 1UCWA 1K7EA 1GVRA 4LS0A 3LM7A 3LBCA 3SGUA 5HWMA 5TQLA 1W37A 1JULA 3LHZA 1EB3A 3WK0A 1R47A 1OFQA 1JQVA 3S42A 1LBMA 1W5PA 4IQLA 3M0ZA 7TIMA 1TPWA 1TPB1 4JDYA 4A2SA 1H63A 1DJQA 3GDMA 2DJXA 4JR5A 1VCGA 2CU0A 2I1OA 1ZJIA 3P81A 3TA6A 2QCEA 3W72A 5IBXC 4AVFA 1VGAA 4LU0A 5HULA 1CI1A 4TMCA 4ZQNA 3I7SA 4UTIA 1S5VA 3TDFA 1YXCA 4FNQA 3B0VC 3BLIA 4X9SA 3RF9A 2P1FA 3MYOA 3O16A 5F4WA 1OFOA 3SGZA 3W1XA 3GAKA 2GPTA 4K39A 4JYEA 2X2GA 3S6DA 4UMBA 4NNBA 3HG5A 1OYBA 5K9XA 4PA8A 5G4WA 2QCMA 4Y96A 1TPUA 3K30A 3A23A 3INPA 4OHQA 5AYXA 3NQVA 5KITA 1OX4A 3WJXA 2RDUA 4CQ9A 4BWLA 3NEVA 2NWRA 2E6AA 1AW2A 2WPBA 5K9DA 3B0PA 5D37A 5K4XA 2Q3RA 4XKYA 3LB0A 3LV6A 2Z2UA 1EP2A 2ZFAA 3G18A 4U28A 1GVSA 2VOMA 3N2XA 3GB6A 2DZPA 5FEZA 2YPIA 3DENA 3BGGA 4FEZA 5HNRA 2FB2A 1H7NA 1IXNA 1GPWA 3DU0A 4I7VA 3N34A 1X1ZA 4KWVA 4IX2A 2G96A 2PE4A 3CLMA 5K9CA 3WFAA 3AJXA 1H61A 2QCFA 1FDYA 3EKLA 5G1YA 2Y7EA 2HTMA 3TMQA 3W83A 1WBJA 4FNPA 1SW3A 5CPLA 2B7PA 3TROA 1B3OA 3N9SA 3TW6A 2HMCA 2NX9A 3PS7A 2Q3OA 2JKEA 3U6WA 4BFAA 4ZL1A 3W1RA 5F4SA 1HG3A 1Z44A 5BNKA 3GDTA 1S5WA 1SO4A 4EF8A 3DGRA 3NOEA 1RR2A 2XFWA 2ZZ1A 2AQWA 2QJHA 1F2JA 2WNNA 1PL9A 4E0CA 3M5XA 4AWTA 1DOSA 4CQ8A 3W74A 3FEMA 3W7CA 2YYTA 3I65A 1VHCA 2TSYA 3IVUA 3P60A 1GYNA 1K7XA 3DFNA 3NZ1A 3W7MA 1TTIA 4HKPA 2QCHA 1YDOA 3UZ5A 1H7WA 1ZAHA 4LUJA 3TSBA 4UTWA 4WOQA 4ORIA 3WK3A 3G0SA 3OHIA 3GDKA 3ZWTA 2X30A 3DFSA 3IIPA 1JR1A 4E38A 4UMAA 1QPNA 3TKFA 2ZRUA 3SY5A 5KMYA 2CZEA 4FX8A 2O7SA 3TMLA 3U2OA 1YLVA 3GAYA 5CPMA 3W1NA 3W2KA 2GVJA 5TIMA 4QNWA 3H53A 1KM6A 2NZLA 4UTLA 3LHYA 4AMAA 1N7KA 3LLFA 1LYXA 1XDLA 4Z1BA 3DZ1A 3S5NA 4YCPA 3C61A 1TPVA 3C2EA 4UFMA 3EKZA 1NEYA 3SJ3A 4AXKA 3ANYA 5E0KA 5I3IA 2ZA3A 1F73A 4K38A 3FS2A 4MJZA 2H90A 3O06A 4P2VA 3TV8A 1GJPA 5IBXA 2VEPA 3LHUA 3N3MA 2YZRA 3FKRA 2D73A 4K7YA 1I2QA 3EX4A 1TV5A 4NJIA 4DPPA 4JS3A 4M7TA 5DBUA 1O94A 1F74A 4H3DA 3M16A 3CIXA 4DO6A 3W7QA 3H54A 5CZTA 3NQFA 3A9IA 2E77A 3TR2A 3NNTA 4DXVA 4O1DA 3LI0A 3KVJA 3QPZA 3QPYA 2WQPA 1QFEA 4QITA 3PULA 4KFOA 4RZ4A 2FTPA 3QEZA 3CU2A 4IOTA 1TPDA 1QMLA 3GXPA 1C29A 3MUXA 4OV4A 3LI1A 2DU2A 3PY2A 1RPXA 1ZHAA 1TTPA 2YYUA 2E1DA 1F05A 4IMFA 1A50A 3Q58A 1KM1A 1F6KA 4K6AA 4HNUA 2E09A 1U83A 4HNTA 4O4WA 2TRSA 3W7GA 4K8EA 2C3ZA 1EP3A 3USBA 1BTMA 4JYDA 2ZDRA 3V1PA 2WSQA 3T78A 5AN7A 3HJZA 5J5RA 3P74A 6ALDA 4CCCA 1RD5A 3GR7A 4LY8A 3PF3A 1Z42A 3W7IA 1HUVA 1XI3A 1KLZA 2ZZ6A 1FWWA 4HPJA 3LX9A 1M7OA 1F5ZA 3MHFA 3C56A 2V2HA 3PR2A 2RDWA 1RQEA 5AYZA 3G24A 1UASA 4OWGA 2QCCA 3G1SA 1XM3A 1LBLA 4OT7A 2NX1A 1E51A 2C13A 3LBMA 3P67A 2QDGA 4CCEA 2ZTKA 1PCWA 4MLRA 4RJEA 1IF2A 5FF7A 4UTTC 2EHHA 1XBZA 3TUUA 3M44A 3DFTA 5AC8A 4MVAA 4NUWA 2ISVA 4O11A 1W5MA 3TFXA 3EX1A 3EWWA 3S1XA 3MMTA 3TJLA 1GQNA 3W1PA 3S8HA 1DKWA 3CT7A 4RKAA 4QAIA 3KFTA 1FCBA 1XUUA 3P80A 3C0JA 4JEQA 4AEOA 4UFIA 4JX4A 3PAJA 4JNMA 2R14A 2WO5A 3TU9A 5I3JA 3BPWA 2R8WA 3TFCA 4UFLA 2A85A 3P82A 1OK6A 1LM1A 2X1SA 4JY9A 1NFBA 4AAJA 2WJZA 4IX0A 1QDSA 3EX6A 1KFLA 2NXHA 3FKKA 5F4XA 3GDLA 1H7PA 1KBIA 1QCWA 1W1ZA 1EWDA 5LNUA 2V9DA 2VEMA 3O07A 1BWLA 1OFRA 3LRMA 2F84A 2QCDB 4WY0B 3CWNA 2PC4A 2BZNA 3SW6A 2ZZ5A 3BK0A 3QQ0A 4QISA 4JIQA 4IUOA 4WQ6A 2QAFA 3ATZA 2P0OA 3NL5A 3MW7A 1JJKA 1YTEA 4LT9A 5LHEA 1LLWA 3SSJA 1SSGA 4LW7A 2LLEA 2VC6A 4DF0A 5HJLA 2BX7A 3RMJA 1ZCOA 5H2ZA 4AWUA 2OX1A 5LGZA 4AB4A 2DZVA 3W1LA 4X2RA 5HQEA 2ZRXA 2VEKA 3FFSA 4Y8FA 3BGJA 3W71A 3S1VA 4RZ6A 4EOUA 1QNVA 4BI7A 5U7SA 2GJLA 1BWKA 4H4IA 3W3OA 1WOAA 2CLKA 3R13A 2B7NA 2Q8LA 1MEHA 2HSAA 4N2YA 3LCWA 2X16A 1Q6LA 3MI2A 5DXYA 2WOQA 5K2ZA 3NQEA 4Y6GA 2Q8ZA 3E49A 5EA9A 4LVFA 4BF9A 4BR1A 2PCQA 4EWND 1WAUA 1JCLA 1K7FA 1M5WA 3IIOA 4Y90A 4LC6A 4AHOA 2RDTA 4A29A 5DCBA 2Z0IA 3BG9A 4ZQRA 3W73A 1C8VA 2J9YA 1FDJA 2AGKA 1N55A 3N19B 4KWWA 2ZA2A 3NL3A 1FWTA 1AW5A 1NSJA 2YXGA 3C2RA 3EEGA 1K8ZA 2ZRZA 3EXRA 1X1OA 3LRKA 3SIZA 1KFCA 1AL8A 2WV8A 1G4SA 1R2TA 4JDBA 2YFNA 3M7WA 4LVAA 4KFNA 1X6UA 1H62A 1J2WA 3W1UA 4NXKA 3MI3A 1TJRA 3QMTA 4LC8A 5FEXA 4NT0A 5LZLA 3TAKA 4M19A 1GG0A 4JY8A 4O18A 3L2IA 1ICQA 1SZEA 3U8GA 4FNTA 3BO9A 3BW3A 3B05A 2PRHA 3GXNA 2ZZ7A 3T40A 3LHWA 2Y61A 4GC4A 3VKJA 4RR4A 1ZAIA 5CPOA 3I6RA 3NDOA 3PBVA 3TCEA 1KLYA 3PUOA 3GNDA 3O1NA 1OYAA 1AK5A 4RLIA 2CZDA 1OG0A 3IGXA 4CNOA 1H5YA 3G8EA 3P5YA 3BLFA 3G1VA 3NPUA 5CZSA 4X22A 2GOUA 1O5KA 2E68A 1WQ5A 2OT0A 1J4EA 2YGYA 3S5OA 4YWIA 4Z1CA 2V2CA 4NQ1A 4M6PA 4UXDA 5SWUA 1GG1A 1TPH1 1W54A 5HUOA 1TCDA 4IXXA 3EX3A 2NX3A 1JCYA 3DH7A 3CIWA 2NV1A 3M5YA 4Q32A 3L66A 3C8FA 2BWGA 4UNLA 1FCQA 2QCLA 1K02A 5K7JA 4JTFA 3W7PA 2R91A 2JKPA 3NA8A 3W86A 5KZMA 3G0UA 2V30A 2WSRA 4JTTA 2FIQA 3S5YA 3FJ6A 3LLDA 1GVOA 3HIJA 3ABSA 2Y89A 4HPXA 5AB3A 4MFEA 3L0KA 1SFLA 2ZCGA 1KM0A 4IJBA 3KOFA 3O8AA 1LOSA 4JTHA 1DJNA 3I7RA 1A5SA 1UUOA 3M5ZA 3B0UX 2V8ZA 3N2MA 3NQ2A 4IPJA 4TIMA 4JD4A 3BVJA 5D30A 3HGOA 4O53A 2Y70A 2GQ8A 4C1KA 1NF0A 1KTCA 2A6LA 5AYYA 1KBJA 3G22A 3NAVA 4DO5A 4NJKA 4IMDA 3GIYA 4GE8A 4BK9A 1PE1A 3CPRA 4YXGA 2J27A 4NJHA 3HGJA 4K37A 1DHPA 2ABAA 3WJYA 1HTIA 3NPVA 4LS2A 3QZEA 3C2VA 3UQNA 3PBYA 5LNSA 5LGXA 1D3GA 1LOLA 3LTSA 3LDVA 2YFOA 4LOCA 2VEIA 3LTPA 4R34A 1FXPA 2F7FA 3LHTA 1D3HA 3QMRA 3OG3A 1W5OA 2J6XA 1YTKA 5HUPA 5D32A 1ZFJA 4UR7A 4DBDA 1YXYA 1VLWA 1KW1A 4LS1A 5EMUA 4OE7A 1G67A 2V81A 3WK2A 2W0UA 4IXHA 1EIXA 2ABBA 4FF7A 2G5WA 3O6CA 3RK8A 3THAA 1VQTA 4IPIA 2QEZA 1YTDA 3RFAA 3BW4A 1JUBA 1IXQA 3IGSA 3NQ6A 4AHPA 1SFJA 1KM2A 1XBYA 1W56A 4JTIA 4JX5A 1XCFA 1QO2A 3I68A 4FO4A 1VYSX 4HNNA 1WX0A 4LVDA 4J9JA 3P8JA 3W7LA 1XUZA 1LBFA 5I3KA 3TXVA 3UWZA 1MEWA 3O6DA 4N9DA 4POCA 3NPXA 4PL1A 3S1WA 2WNQA 3W7DA 3TE9A 1FWNA 3BG5A 2QUVA 3JRKA 3TQVA 4UR8A 1VR6A 3N14A 2BTMA 1TO3A 3N73A 5HINA 1XBVA 3O05A 1ICPA 4ZQCA 4A22A 1H1ZA 1T0OA 3VE9A 1TPFA 3IRDA 1O95A 5G2WA 5C6MA 2C15A 1QWGA 5AC6A 4NNAA 4E2DA 4LTSA 2V2DA 3TC7A 4A2RA 4JTLA 4O10A 4DPQA 2CLOA 3V75A 1OABA 1IIGA 2H8ZA 1RQBA 4WY0A 2QCDA 2RKXA 3TH6A 1VS1A 1B9BA 5BOOA 4Z0JA 5F1VA 5K3VA 4OQVA 2GUUA 2VFGA 2C1HA 2ATMA 3G1XA 3BV4A 2NUWA 2I14A 4O28A 2QUTA 2GVLA 3UZJA 1SU5A 4FNRA 3ABOA 3HPXA 2V5BA 3WJZA 2AAMA 3E0IA 4DF1A 1QAPA 1VZWA 3PBUA 3NVTA 2JGYA 1TYGA 3W76A 3G8RA 1YDNA 4I9AA 5F2LA 4O8RA 3W23A 1Q6RA 3EX2A 4GUIA
chains in the Genus database with same CATH superfamily
3QF0A 4DIAA 4WSJA 2OR2A 1GTEA 3EB4A 3SCOA 2Q09A 2I16A 1CGUA 1L6WA 4IHCA 4HVXA 5CSRA 1ME9A 3WL0A 2PDFA 1NOFA 4MZ8A 4S3GA 1DWAM 5MHBA 3FYPA 4F40A 4XUGA 3PJWA 1CGVA 4ADUA 4Q8TA 4AD4A 4PR4A 3KXQA 1DORA 5AC4A 3KP0A 4GH1A 1TREA 2UY4A 1OK4A 1D7FA 2HZGA 1EJVC 4RW5A 1WV2A 4O1CA 5HMFA 1XLAA 4F79A 1UJPA 1M01A 3UWYA 2H8XA 5HA7A 1KKOA 4A6GA 1UWIA 2YOCA 1QT1A 4H8VA 3VGDA 4Q6JA 4B15A 1XH2A 1ZB5A 3LGEA 2YR1A 4L6HA 4HQVA 3IGUA 3W88A 2FB3A 3N2CA 3QRHA 3THQA 3GY1A 3O6AA 5A8GA 1G01A 3W26A 3TOYA 1GVIA 5AFDA 5I03A 2YKKA 4LFYA 1RBAA 1QI3A 1BYDA 1GOQA 2EG6A 4L7ZA 2FTYA 3G1FA 4KIEA 4OOUA 3UF9A 4C6KA 4PEEA 4GYFA 2TMDA 1O12A 3B04A 3O6YX 3ZR4A 1KNWA 1F8IA 1JDAA 4L6DA 4PMRA 2D3NA 3LCHA 3M41A 1CT5A 2FPVA 2OPJA 2QCGA 1BGGA 3GVVA 1EA0A 1UP2A 4Z2KA 3VKBA 3WENA 5IHRA 1YNPA 3AXIA 4QLLA 1N8WA 5AHNA 3EDKA 3N17A 4LAKA 1ESWA 1UKSA 2IQTA 3DXIA 2DZSA 1A5AA 4NJJA 5D2VA 3UYCA 4AZGA 1ZU8A 4QXIA 3D46A 3RR1A 1FWEC 1SO5A 1ME7A 3KZSA 3W81A 1J5TA 3EWYA 1Z41A 3CUFA 4LNYA 1LL6A 1K8YA 4S2CA 3TQ0A 4JKKA 1SW0A 4UMCA 4JQ1A 3FSTA 1XQLA 2I9EA 2PGWA 2V67A 3TW7A 1P0DA 3W07A 3UR8A 4HSNA 3W02A 5TD4A 3BLLA 4O0ZA 3DERA 3UWVA 4W7WA 1I2PA 3CM4A 4GBUA 2TAAA 1VB9A 2BXVA 2D2GA 1LP6A 5JBEA 3F2BA 4N02A 2F2HA 5IFPA 1BYBA 1HJVA 1Z69A 3NPWA 1MXSA 4CD4A 3QMSA 5AYIA 3SIMA 1QI4A 1ELSA 4GNJA 4C6QA 4WZHA 1VFHA 2XIIA 2FKPA 4DO4A 1PHWA 4C6FA 1W8SA 4YTUA 3RRAA 1E3ZA 1SW7A 3NZPA 3FJLA 5C9RA 3I6EA 3K2GA 5BCAA 5HR6A 3S2MA 3SUUA 4CKQA 5EKYA 2EEXA 1VYRA 5F2MA 5LIUX 3N2BA 2VQUA 2CLHA 4DZAA 1IIHA 4UCGA 1AVAA 3FDKA 4BWLC 1A5UA 1AFSA 4V1YA 4JHOA 1NP2A 2UY2A 2Z4GA 4MNLA 1Q6FA 4B5XA 4O0KA 1OIFA 3PZTA 4CN1A 1SQ7A 4MKVA 3KRSA 3LERA 1GVEA 4M5PA 1UJQA 4BS0A 3WNOA 1EUAA 3W2JA 2WNZA 3KBSA 6ENLA 3CBWA 3W75A 2EAWA 3T81A 3NZRA 1MO0A 1CWYA 2ALRA 1EJUC 1DIKA 2DSUA 4NZ3A 2XU2A 1O66A 5DEZA 1C8YA 2QJMA 1KRBC 1JCMP 1I45A 1EJ7L 1XYZA 1B3ZA 3ZSTA 4B16A 4N9CA 1H1YA 3MC5A 4W85A 2WHKA 4MY8A 4Z2GA 1XPYA 3PBWA 3ZXWA 3VK5A 4ONVA 3V5FA 4JFWA 4JZ5A 4OBTA 4G2DA 2BP1A 4LCSA 2OO0A 2XN1A 3K4AA 3LA4A 1VBRA 3HPZA 4JBRA 2DIEA 1OFBA 3G1YA 5E1QA 5K4ZA 3N25A 6REQB 4H83A 1I60A 1W32A 4PSPA 3CQIA 2PDXA 3B9OA 2DZUA 4NL1A 3W7NA 3L4VA 3P5ZA 1FTXA 2E6YA 4UTWC 1JL8A 1HO4A 4BY3A 1WDSA 1XLLA 4FX6M 1H1NA 3EWZA 1X8CA 2PBOA 3DFQA 3JR2A 2F38A 3BURA 4GINA 1R38A 4IMEA 4JQAA 3B9NA 2I5QA 2OCZA 2ZE3A 2XIJA 1P43A 2E3ZA 3I3BA 2ZADA 3WNNA 5DMYA 3WH6A 4JTSA 3R10A 5AVHA 1T5AA 4G9PA 3MYPA 4DX3A 1Q6EA 4QSFA 5A95A 4QGCA 2W66A 4UWMA 3UNTA 4JICA 4O15A 5I2UA 5L6UA 4BF7A 2IKHA 1KV5A 2ZX7A 3KOYA 3VOHA 1QW7A 5FJJA 2J47A 4MWAA 4C6LA 1PVNA 1C9WA 5D38A 2B7QA 3KAOA 3NZQA 1IWBA 2JK2A 5HMDA 4F9DA 2NT0A 3Q65A 2FGLA 4GO9A 7REQA 3GTNA 4NJGA 4JFTA 3LTYA 1KA9F 2BOEX 3DGBA 1JZ2A 3CV7A 1DYSA 3KE0A 4AY8A 3AUOA 1FDZA 3B9AA 2PWDA 4FXFA 1AL7A 2XH7A 3S5SA 4UQBA 4O0QA 3ZLHA 3I4EA 4HU3A 1UR1A 4LYQA 5FSEC 2VR4A 1YIXA 1JAKA 2JEPA 3ABXA 3MANA 2XWDA 4L4MA 1US0A 3NYZA 9RUBA 2VCCA 3RJXA 1U1HA 5A6BA 1BYCA 1UZDA 6XIMA 1YNQA 4JN8A 3STFA 2Y0FA 3B8DA 4DN1A 2GL5A 4TR9A 3W2LA 5HAOA 2A7NA 2OLAA 2QDEA 4AIOA 3Q67A 3WEZA 1MQRA 1KGWA 1HJXA 1RJPA 3WNMA 2P88A 5AOUA 3ABQA 4ZB0A 2UWFA 1QJWA 1W3JA 2AOSA 4W8LA 2KAUC 1RA5A 5A6BD 4WY0F 2WBGA 5EY5A 4PL2A 2XN2A 4PEKA 4HU8A 3KOZA 4FB7A 1JNEA 2PGRA 5CG0A 4XAZA 3C3UA 3QTGA 3QW3A 2JIWA 1E6NA 4PMJA 3A22A 3TQKA 1R30A 1B57A 2DUXA 2W62A 2YL6A 3AS2A 3VKKA 3TYBA 1H4PA 3W01A 3GBEA 1LUCA 4M7SA 4XVEA 1SPQA 3LPFA 7TAAA 1KB3A 4GI9A 1VFSA 3GTFA 4C90A 2YXOA 4PFMA 2DZXA 2ZBTA 3VABA 1R5YA 4CVWA 5LHFA 3HG3A 4WKFA 3QSRA 3O9NA 2OB3A 5I00A 3OOQA 4IMAA 1S2AA 5LKYA 4JTKA 1MNSA 5IXEA 1G7VA 1XLHA 2OMAA 2A21A 2XDFA 1LRNA 2G3FA 1F3TA 3NM1A 4D71A 4AZ7A 1LJYA 1WKEA 2W63A 4L4OA 4ZO9A 4GVIA 1KFBA 4LY4A 2OJPA 1UBSA 2HS6A 4L56A 3CQHA 2YSWA 1KCXA 3SRFA 1GZGA 1S39A 2DJLA 3EGJA 1UIPA 5DN1A 2EQDA 3W25A 2XVKA 4DLFA 1UR9A 4ZR8A 3I7QA 1GONA 1LRQA 1ZY9A 5KZDA 4B4FA 4D72A 1R9ZA 1V6VA 1XIBA 3CH9A 4C6PA 4PB3A 1R2SA 2J88A 3N29A 5FEWA 1SO3A 5D2TA 4DWDA 3UY8A 1PKMA 1LDCA 5LA2A 4UFHA 1KRAC 3ARQA 3UA3A 4UTMA 3DC0A 1DTUA 3UXDA 1TJPA 2DH3A 4FLSA 3NSMA 3DAQA 1Q8AA 1E9LA 5DMLA 1TCMA 1M03A 2QUMA 3CZKA 5EL1A 4I90A 3GC2A 1GCYA 4W86A 4S3JA 3T4CA 1QO5A 4B9YA 3BMWA 3UZXA 1W9BM 2CWNA 3BW2A 3RLHA 3TEVA 4Z08A 4I9TA 5CXPA 4CQBA 1LCOA 3UEQA 2RH9A 4LYRA 3UZZA 5U4NA 3W70A 3N4EA 5FL1A 2FHCA 3HFYA 3RNDA 4OV9A 3RO8A 4EP8C 2ZZ4A 3AIEA 1F9CA 4AF0A 3MVIA 1H7RA 2Z29A 1HNYA 1IGWA 5GPRA 1UWTA 1JCNA 3JUGA 3LXCA 4AYGA 4OECA 1W91A 2C16A 5D05A 3CAWA 1DV7A 4CD6A 3AIVA 2EGZA 4MTVA 1V7YA 2VGFA 2WLZA 3VINA 3VIIA 1B3XA 1OSEA 1XP3A 4HHHA 5REQB 3OVPA 4GUFA 3T2QA 1TRDA 1TKKA 4PH6A 3ARXA 4GX8A 1KWKA 3JS3A 3SGGA 2OX4A 1OG6A 1UQYA 1AJ0A 3W4RA 3TYDA 4J40A 2R1LA 4YTTA 2CYGA 3NL6A 3VM7A 3SCPA 2E0PA 2CLMA 1U5VA 5BYWA 2DQWA 4PB5A 4D2JA 5ABFB 2VCBA 2GGHA 5HWJA 3TNBA 4LF1A 1NJJA 3CEUA 1FWCC 4L4LA 3ZLGA 4I7WA 3CWOX 4HIBA 1DXIA 2H9AB 1I1XA 2VXNA 2UBPC 1JD9A 1X96A 1YBQB 4Q4RA 1HKKA 1TPC1 3MZ2A 1OX5A 4TXEA 2X1UA 4OGZA 1FA2A 1FP8A 4HCLA 2D2OA 4YL2A 2PWUA 2C19A 3GH5A 4D9PA 2EJAA 4QQ3A 4GNKB 3VE7A 3LN3A 2VFEA 1VFLA 1KGUA 4R53A 1SGJA 4HA3A 2X05A 4DBUA 1L2QA 2DSVA 3GNXA 2J7BA 1UWUA 1LROA 4XO7A 4R7JA 4PMOA 4MGGA 6TIMA 4D8AA 1S3HA 4PBFA 1ADDA 2FPYA 4UTHA 3L5MA 3PSWA 5G4EA 3FW6A 4LJ3A 4FXSA 3ELFA 4IIBA 4L1WA 1P0KA 3WLJA 3GIQA 1EUNA 1KCZA 4AZIA 1VJSA 3STPA 1J12A 4G7EB 2TPSA 4AH7A 3I10A 4RX0A 1BF2A 3TLLA 3E2RA 2D24A 2HV5A 4CU7A 1AW1A 4C6CA 1TIMA 4UQ9A 3UJEA 3O15A 1KM3A 4FXRA 4PODA 1EEPA 1W0MA 2X1TA 3WQ4A 2BS9A 1PSCA 3CK5A 4PMQA 3PZIA 4UNKA 3WF0A 2Y85A 5C55A 4X2PA 4IJCA 3CZ8A 5DT5A 2PP0A 1QUMA 3WDQA 3VTRA 2YBTA 2EPNA 5DELA 2GQAA 4AZCB 4DI8A 1X7IA 4FR1A 4LS0A 1J6PA 1XYLA 1BXBA 1HL8A 3LM7A 3SGUA 4HMNA 2CEQA 3H2OA 1GHRA 1EA9C 1DJXA 4EE9A 3AYSA 2JE8A 4JIRA 3S42A 3Q45A 1S2VA 3WH9A 4CNUA 2F9RA 4IQLA 1TPB1 2GUBA 1DWIM 1H63A 4J7RA 3GDMA 4BQ5A 1W9DM 3P81A 3VPLA 1HIZA 5IBXC 4LU0A 5HULA 1E9ZB 4GXWA 4QQUA 1EGMA 2A3CA 2HVNA 3ZJKA 3TDFA 1XW8A 4EXBA 3B0VC 4IFKA 4X9SA 3RF9A 2P1FA 3MYOA 1QBAA 5F4WA 3WH7A 2PCEA 1OFOA 1RA0A 1US2A 4UQCA 4HMCA 4K39A 3SQSA 1U2YA 2VVNA 4JYEA 2X2GA 3WQFA 4NNBA 3HG5A 5HQLA 5K9XA 4PA8A 3BC9A 3TTQA 2BASA 3OZYA 4OHQA 2ZVIA 3OHMB 3NQVA 2RUSA 5KITA 1OX4A 1UUQA 1E70M 3GDBA 1VFUA 2E6AA 2QUNA 5K9DA 1V3HA 5K4XA 1YX1A 4JIHA 4XKYA 4UZSA 1VIZA 2GZXA 1GOOA 2Y2WA 2Z2UA 3E5PA 1EP2A 1C8QA 3OBEA 5I3DA 3KBWA 2YPIA 3ZSSA 2CKSA 3MV01 1EZWA 3G1RA 1IXNA 1VFMA 2P3ZA 2XTKA 3NXLA 1S2CA 4DRSA 2J79A 3MCOA 3ZR6A 2DUZA 2G96A 5K9CA 5JVLA 3BUVA 2E28A 3VOGA 3VU2A 1B90A 4Q4SA 5G1YA 2HTMA 3U7BA 2G3IA 1WBJA 2WQDA 1W3KA 1F8MA 2VNCA 4F0SA 1PUDA 4Q8QA 2VC7A 2JKEA 4BFAA 4X60A 2R6OA 5I0DA 1EC9A 4GZ7A 4U3AA 1A5MC 2INFA 2R24A 2PDQA 1F2JA 3A3WA 2WNNA 5DX7A 3CQKA 1DPMA 3OLGA 1DOSA 3WQPA 2HXTA 4CQ8A 4MMWA 2DVUA 4BZYA 4IH3A 4WF7A 1GYNA 3W7MA 1TTIA 4HKPA 4J1OA 4LF2A 3CT2A 4DBSA 2P50A 1JYWA 3QY6A 2ESCA 1E0VA 2QJJA 3WK3A 4JKMA 1M04A 3OHIA 3VNIA 4ZSUA 2O0TA 3TKFA 2ZRUA 3D5HA 3LSBA 3WFZA 2CZEA 4FX8A 3URAA 4Q3MA 4YN5A 2O7SA 5M03A 1GKRA 3GAYA 3GFZA 5CPMA 3W1NA 3HV9A 4PTXA 3TWBA 2PDHA 3H53A 1L8NA 1KM6A 2NZLA 4GIYA 4LAMA 3F2CA 1G1YA 1XDLA 4YCPA 4EPKA 3EKZA 4K1GA 5E0KA 1UKTA 3FS2A 4OUEA 1HKIA 3UG4A 4P2VA 2WYSA 3FKRA 3VUPA 1I2QA 3EX4A 4MADA 3BCDA 2OWWA 4DPPA 4PRWA 5DBUA 3RRXA 3GNRA 1PXGA 4JOMA 2CZVA 1EJRC 2E77A 1ZZMA 2ICSA 1CENA 2Z00A 1EHNA 2J13A 3VKDA 4Q8PA 4JL1A 3GXDA 2PWEA 3THDA 1YHTA 3RPTA 2WSPA 3TYAA 4JTQA 1QFEA 3PANA 2PDPA 3BLDA 4D6JA 2FTPA 3B0YA 4P8VA 3QEZA 3CU2A 4H7CA 3C8NA 1QMLA 3GXPA 1KD0A 2OU4A 3EMCA 3R8GA 4OV4A 4PN2A 2HE8A 4PMYA 3DHUA 1RPXA 5TAOA 1EBGA 2XVLA 3IPWA 1XYMA 5T9BG 4K6AA 2E09A 1ZRQA 4BEUA 3CZJA 4IJRA 2HK1A 4K8EA 3W7GA 4IPNB 2C3ZA 2VHLA 1EP3A 1OC7A 4IP5A 4FALA 2DVTA 3V1PA 2WSQA 1SR0A 1CLKA 5XIAA 4CCCA 2AMGA 4PUEA 1J6OA 2VGBA 1Z42A 1HUVA 1FH7A 3QBUA 4W7UA 3FK4A 3LX9A 3K8MA 1ZSXA 3HQNA 5GJNA 3ARTA 3C56A 3TTSA 2V2HA 3GO2A 1SFSA 5CSYA 6REQA 3R0KA 1LBLA 2NX1A 3T1GA 1E51A 1W1B1 3P67A 1DWGM 2ZTKA 1K4HA 5T91A 3RITA 1KXTA 4ZOBA 4S23A 2WM0A 2FFIA 1QATA 4AC1X 4EKJA 1J0HA 3W1PA 3S8HA 2FHBA 1X1NA 3H12A 1Z32X 3H6OA 5A6SA 3CT7A 1XUUA 1MDRA 1Z6KA 4JX4A 3HMCA 4JNMA 2J62A 2R14A 1UOKA 2VO5A 1UA3A 3TFCA 3P82A 2PDYA 2OXNA 3VGEA 4XX6A 3NEHA 1NFBA 2WJEA 1KFLA 1TFVA 3WYZA 2P5NA 2V5KA 1ENUA 3WUEA 4A4AA 3FKKA 5A8QA 3GDLA 1KBIA 1QCWA 1GZ1A 5LNUA 3LRMA 2XSBA 3SW6A 2BZNA 3ITVA 2PAJA 3VIMA 5DANA 2ZZ5A 3BK0A 4QRNA 3QQ0A 3W27A 1MWOA 2BODX 2P0OA 4IF2A 1JJKA 4HMDA 3V5OA 4LT9A 4M1RA 1SSGA 2LLEA 4AD5A 1PAMA 1ZCOA 5LIXX 4HZ8A 4JTCA 3FFSA 3CL6A 3ISIX 1MMFA 4Q4MA 4XZMX 4H7VA 1OGGA 4BI7A 5U7SA 4H4IA 1BWKA 4TX6A 2WWCA 3GG1A 3AS1A 3WQGA 4WDWA 1EYEA 3K46A 3KTSA 3WQ8A 2HSAA 1XRFA 4ROPA 4NAFB 3BL3A 1LF1A 4G7FA 3MI2A 3PZGA 5JIPA 3ONBA 2C0HA 1RHCA 4L9ZA 3F5LA 4W4QA 4IUGA 1FWDC 4BF9A 4BR1A 1FFRA 3SB0A 1YE4A 3H2AA 2WZTA 4LC6A 1W17A 3BLOA 3RAOA 3W6LA 1ISXA 2Z0IA 3BG9A 2J7FA 3WNKA 3NFUA 3W73A 2J9YA 1FH8A 2AGKA 3N19B 1K8ZA 3MSYA 3QYSA 4BEQA 4YU1A 4TV5A 3ZVIA 2WV8A 1G4SA 3MMUA 1XKJA 1H0GA 5JU6A 4JDBA 2YFNA 4DAIA 4LVAA 3AXXA 4KFNA 3GYCA 1H62A 1J2WA 3W1UA 1VD6A 4ENLA 5HJYA 4Z2JA 1QI2A 1OCQA 4Z42C 4O18A 3U8GA 4FNTA 1JZ7A 3BO9A 4P8WA 1DIOA 4KMQA 4XZHA 3B05A 3GXNA 1UH3A 4TQTA 4R27A 2Y61A 4GC4A 5LA0A 4F3HA 1E72M 2UY3A 3AIUA 4CQCA 5BWFA 3RX2A 1EF2A 2NQJA 3W82A 3TCEA 1W9VA 3EB3A 3O1NA 4HZMA 1AK5A 1XCWA 3VA8A 3M07A 1H5YA 3NQBA 4H00A 3BLFA 3G1VA 2GOUA 2E68A 5HNNA 3ZLFA 2YGYA 2YDQA 2J7CA 3SCWA 4NQ1A 4U3CA 1WZKA 4M6PA 1PYFA 5G1MA 4UXDA 5SWUA 3U4FA 2BVYA 2FGZA 1W54A 5EGRA 4HP5A 3T6CA 1JCYA 1TZZA 1MUCA 3CIWA 4J28A 4I6VA 5CGTA 3QV8A 2QCLA 1WKDA 2NVCA 2QVNA 5CAKA 4JTFA 1FVPA 2R91A 3BTNA 3WMBA 3L2LA 1B2YA 2E4TA 4JTTA 3RCYA 4N7QA 1GOWA 1LT8A 3KS6A 1JI1A 4MFEA 2G3NA 3L0KA 4IJBA 2R9RA 1LOSA 4JTHA 1EQPA 1PDYA 4AY7A 3M5ZA 3B0UX 4J3XA 2V8ZA 1WKYA 4L80A 3N2MA 3WLHA 4JD4A 2GVYA 5CAHA 5D30A 4PTMA 2O4MA 3HGOA 3M0LA 2Y70A 3WLMA 1Z9AA 1NF0A 3W53A 2A6LA 5A8PA 1HW6A 1XSJA 3IARA 5AYYA 2XIQA 4NJKA 4RW3A 4HYRA 5M2FX 4BK9A 3LPGA 1ZGDA 1Z89A 1EDGA 2C8NA 1JF6A 4PE8A 1OT2A 1VBHA 1Q6CA 3QZEA 5LNSA 4XV0A 1LOLA 3LDVA 1HL9A 2YFOA 2VEIA 3LTPA 4F0KA 5AY7A 3UPMA 2G37A 1T7LA 2ZXBA 1XFCA 2EPKX 1V3KA 4E8CA 4XZIA 1Q5MA 3NJ3A 3WK2A 4IXHA 2ABBA 2G5WA 2W61A 1UC5A 2DSKA 1YTDA 3RFAA 3BW4A 5C70A 3IGSA 2VZOA 1QASA 5C9XA 1PKYA 3U5YA 3ITCA 1XCFA 2YL8A 3WLNA 3CO4A 4A35A 3ZR5A 4ZXLA 4HNNA 1Q2SA 4OVXA 1R3QA 1XUZA 2DW7A 3O6DA 3R0UA 3VFCA 3S4TA 4UR8A 5HANA 3II1A 2Y24A 5HINA 1XBVA 1ICPA 3VE9A 3F4DA 3RG6A 1O95A 5C6MA 3H2EA 3V0SA 4RE0A 2DGAA 1HGYA 4DPQA 4CD7A 3DYMA 3AICA 2HRWA 2ADAA 3COTA 1IIGA 3UETA 3IJ8A 4P5UA 2WMJA 2IXVA 4WY0A 2QCDA 2RKXA 3H4WA 1PKNA 4FOKA 1S1RA 3VKCA 5K3VA 1J0IA 2VFGA 1QHOA 3UZJA 3GHTA 7CGTA 3LYEA 1SU5A 4LPCA 2AAMA 3RR4A 4KPLA 3OLDA 1VZWA 1TYGA 3W76A 4K68A 3BZJA 5F2LA 1IEXA 1P6CA 1Q6QA 1WNOA 4GUIA 4A8RA 3H2MA 1QPOA 3HA1A 3T4WA 4NZ4A 3CC1A 3A9BA 4DQWA 1P1XA 5AHLA 1ADSA 4GXPA 3PNUA 2CESA 3R0DA 2YDRA 3WO8A 3WMCA 5CC7A 2NVAA 1OHLA 1QNPA 1POKA 1HVQA 3A21A 3NWRA 3S6TA 4H9TA 1K03A 2H6RA 1IGSA 3QZ6A 4DWSA 2E67A 4GOAA 6TAAA 2UZ9A 4XBKA 1YPFA 4H6RA 1A3HA 4DJDA 4YCOA 1UB3A 3GD6A 2DV0A 3UU0A 2WZHA 4ICNA 3EWDA 4O17A 1XLEA 3UXAA 1KR0A 3CTLA 3AS3A 3NYDA 2J9ZA 4C7GA 8XIMA 2VDGA 1OJXA 3GTHA 3VZYA 2CBVA 4FIRA 3G1AA 2Z7GA 3QZAA 3R8RA 4HD5A 2XN0A 4YIWA 4G7EA 3LXBA 1TZ7A 5HR7A 2P3EA 4GI6A 4JNYA 1XGEA 3AMLA 4YLWA 5FD0A 4DJDD 4DO7A 1WPCA 4MYXA 5JH2A 3GU2A 3POHA 1SJCA 2QR6A 1BRLA 3QOKA 5HNTA 2Z6JA 1T8QA 3WDIA 3HZ3A 1EXPA 3MWAA 4EPEC 3GKAA 4ACYA 3QFWA 4JIEA 1XFBA 3QJAA 5DT7A 3RO6A 3PTMA 4MNJA 5GJMA 3DOPA 1E43A 2WK2A 1LQAA 1ZBKA 3EWXA 4IGMA 2OOGA 5E0FA 5CKSA 3MSDA 1JGIA 3VIFA 4C6EA 4H2HA 1W1A1 1NOWA 3KCJA 1IEVA 1ISYA 3VIGA 1FHDA 2Y7FA 4KIRA 3DEQA 4ZOCA 4XAPA 1MFVA 3SCQA 3NSXA 3GX9A 1P6BA 4A21A 1DQXA 3CZEA 2BY0A 2Q71A 4XZNX 2FZ8A 5BMXA 4HBKA 4N9BA 3HG2A 3TJXA 5AZ0A 3R79A 1M53A 3MI6A 4GIAA 1VCFA 2A0NA 1YKWA 3NSNA 2YCJA 4JYFA 2ZIDA 4LWWA 5AC5A 1L6GA 2QF8A 3STCA 4ACZB 3WY1A 4WD0A 3A5VA 1EJXC 1Q63A 5HOSA 4GMEA 3MJMA 5HMSA 3W1MA 2CBUA 1W3TA 4GVHA 1P7TA 3OPSA 2ZQ0A 1UR4A 4JTUA 4PYSA 3M43A 1MSSA 3ARWA 1U5HA 5AHEA 1WB0A 3WBWA 3QLDA 2C79A 3M5VA 5JUVA 1DEDA 3MJYA 3TOPA 1K9DA 3R4IA 1IT7A 4JTGA 1JPMA 3EPOA 1W3IA 1O6IA 4J2PA 1UWRA 4A8NA 5CZ0A 2AQVA 1IQ8A 4NKCA 5A6LA 3W7HA 4GUHA 3W29A 4MWAC 1FUYA 3R89A 1BF6A 1I4NA 4ZQOA 1KFEA 3GE7A 3CJPA 2X09A 2VJXA 3LY0A 5AYBA 3IAPA 1JIBA 1W1IE 3TXZA 2W6RA 4EWJA 3TN4A 1J79A 2HEJA 5D9OA 2AQOA 1TWDA 1HF6A 1SJBA 4Q8OA 4C5ZA 3IVSA 2BVDA 1EP1A 3TNOA 2ZRYA 2Z27A 2ZX5A 2ZUTA 1O1HA 3ZJ8A 2FTWA 5D09A 2Y4SA 2GK1A 2ONEA 2Y7DA 4DNHA 4MOZA 4B5VA 1GKQA 3QR3A 3ZIZA 2BLEA 1GQIA 2Z2AA 4LUYA 1W9PA 4XZ9A 1THFD 3HQ1A 5D33A 4QG9A 1U1UA 1XR2A 1DE6A 3LCIA 3LNPA 1YPIA 2GVGA 1XLIA 5TBOA 4HK6A 1KTBA 2P8BA 3S2LA 2E6FA 4LRTA 4FIQA 3WLIA 1W8GA 4XWUA 3ZJ7A 1OFEA 2WHLA 1F3WA 2DP3A 1PBGA 3F4WA 5BXTA 1PPIA 3F4VA 2GDVA 4WJEA 4AEFA 1UWAA 3QHMA 4FF5A 3W38A 1IEIA 2FFCA 1E1FA 3IVTA 4UTTA 4BJHA 1V3IA 3FYOA 2FZMA 1XLKA 3BCJA 3T55A 3I3EA 3WELA 3HURA 4PGLA 2ZX8A 3H8AA 2PDLA 4MM1A 1LRTA 1XICA 3SY1A 2ZVRA 1GYLA 4O4VA 2PTZA 3AMKA 1E73M 1L6YA 5BOFA 1S2UA 1OIMA 1GEQA 4WHBA 2CW6A 2V3EA 3VGFA 3H55A 1NM9A 2IPWA 2YA2A 2VFDA 1GQKA 2GGJA 3EWUA 5FF3A 3T7VA 2D69A 5ABTA 1FOBA 1EDTA 3D6NA 2FZDA 3VILA 3P8IA 1GZJA 3M47A 4S3AA 4MB4A 4URIA 2GWGA 4NAEA 4M82A 3RU6A 5DCDA 4IL2A 3ZWSA 4HA1A 3IJQA 4G1KA 3DYPA 3DKJA 3HO8A 3ZQ9A 3SRKA 2HXUA 2B4GA 4Q7BA 1F7BA 4LUSB 3LBOA 4HJFA 4HCDA 4DJEC 4WDUA 3F7JA 1JD7A 3MCMA 1YW1A 3IJLA 4DB7A 2REQB 3L4TA 3Q37A 5E6ZA 2WJFA 2IKIA 2JBMA 2PDMA 5DBTA 4RK8A 3M1ZA 1I0DA 2FMNA 4X3ZA 4NNCA 1M65A 3VIPA 2WC7A 3QHNA 4MLJA 1F61A 3M6YA 1R3VA 1TQJA 3LGDA 4PUJA 4FR6A 1MW0A 5T26A 4GPNA 3W1AA 1FWGC 2VZUA 3R11A 3UPWA 4FLRA 2HWGA 3P7YA 4S39A 3QW4B 2OO6A 4YVXA 3WCZA 2B81A 3PZQA 1ZAJA 3QR1A 4HN4A 1XYCA 1T99A 2TYSA 3GFYA 5IDZA 3HF3A 4MYAA 3URBA 4EACA 2Y8KA 1VEPA 2BXYA 2VZSA 3T07A 1TX0A 3P93A 3GVGA 4Q8VA 3OGRA 1JI2A 1JNDA 1JRCA 3GH7A 4FNUA 3SI9A 2YW3A 3VNDA 4HPGA 2VTFA 1NARA 2I9UA 2WVUA 2JGQA 3CUJA 4JCMA 1XLJA 4A3QA 1WUFA 2V69A 5F7UA 1HJWA 1RK6A 2F2KA 2B7OA 3M7SA 5FF2A 4ILSA 1XIDA 4ZO8A 1N82A 3C3NA 2OWXA 3RLVA 4WDXA 3H7UA 1B4KA 5HK4A 4DZIA 4LSBA 4KFPA 2GOKA 2VX5A 2CETA 2WMIB 1TTJA 3T0CA 2VCAA 1V03A 1VFFA 2VFIA 3KZPA 3I4KA 4XBJA 5D03A 1K6WA 4M0XA 2CLLA 2IUZA 3S9IA 3W9ZA 2V68A 3ZYZA 3NQGA 3L9CA 3FLUA 4MJ4A 4ALDA 1W6TA 1OFDA 2PODA 1XL9A 5DO8A 4LCRA 4WLCA 2PP3A 2Z2BA 4YJ5A 1Y0EA 3KVKA 3V18A 5FJIA 1JVNA 2YCEA 3M9YA 2OTDA 3PVFA 3ID7A 3SQLA 1HX0A 4RE2A 3VC6A 4GCXA 3CMGA 1KM5A 3VIHA 1NH6A 2C14A 1EPXA 4GWEA 3T0TA 3ZS4A 1MZRA 4UR9A 4RNJA 2R94A 1FRBA 1V5XA 5HWNA 1RXOB 4FI4A 1AG1O 4M6QA 1QR7A 3W2NA 1VHNA 1EJSC 1M7PA 2PLCA 3AHYA 5I3GA 4YTSA 1A5KC 1JDCA 2VELA 3IK2A 3K4WA 4V28A 1WBHA 4GIRA 3B4UA 4BHYA 2DORA 3C2OA 1ZP3A 4M1BA 1XISA 4RL3A 2CLIA 4ADSA 3NDYA 4NAFA 4N9EA 4OOZA 1SUXA 2ACQA 4IMGA 4GACA 1ONEA 4XTIA 2CBIA 2HCVA 3ZM8A 3W2UA 3OIXA 3FA3A 3GUWA 2Z1BA 2X1RA 1XGDA 1FWAC 5DXXA 5JBDA 4Y9OA 1TB3A 5LIWX 2QGHA 1HVXA 3WQDA 4GQRA 3B9DA 2DPEA 4WEVX 2A7RA 3TN3A 3ARVA 2AL2A 4NIRA 1S38A 2WZMA 1LLZA 4XD5A 1LG1A 4LAOA 2PS2A 3MSGA 3CUHA 1JPHA 2BV9A 3IIVA 1A47A 2PRLA 4KKXA 4IT1A 5I02A 4QR6A 2YLAA 1K9TA 3VOJA 4WGXA 1ZPTA 4BI6A 4MY9A 5C9UA 4DF2A 4KEZA 4C5YA 1AH3A 1PZ0A 3TX9A 3MO4A 4EF9A 1H41A 1ODUA 1L6SA 5JH1A 3KVLA 1CB7B 3BANA 1WXYA 2I56A 4NRRA 4UTJA 5E6YA 5EBUA 1XXXA 4EAYA 1S46A 2E8ZA 1ZLPA 1W9UA 2XFYA 4HT3A 4PBGA 3E74A 3GHRA 1QXLA 3AZTA 3B40A 5JBFA 3BAWA 4E8GA 5I24A 2Y63A 1E1CB 1B4EA 2BFGA 2R1KA 3S9YA 4U4MA 3BLKA 3WJWA 4B5UA 1PV8A 3SN0A 1FWRA 4N42A 3RXZA 5I3FA 2NSXA 1IZJA 1U30A 3SFKA 4LALA 1VPXA 4ZVJA 1MQQA 1UHVA 2J9XA 3TCSA 3GXIA 3W87A 2ISWA 3ITTA 5BW6A 1GVFA 4UIOA 5A1AA 4FNSA 3CV1A 5FCZA 1Q6DA 3ZVHB 2V5DA 3MO7A 1MQPA 2EPOA 4KGJA 1TV7A 3CEPA 1P0EA 4GUJA 3LZ5A 3EDEA 3ITXA 4DBEA 3DYOA 3B8WA 2ZXQA 3GR8A 2QCNA 3CL8A 2PRMA 3E96A 3SZ8A 1BG4A 3QSTA 5CCZA 3RMEA 3GBDA 2CFFA 1JRBA 3EXTA 1CYGA 4Z17A 2QV5A 1W1VA 3KLLA 2JKAA 1AODA 2A7PA 1PS9A 1CDGA 4K1WA 1TX2A 3MDWA 1EX5A 4J4KA 5J04A 4IQDA 4IIGA 1RD6A 4LUIA 1TVPA 1E40A 1KO0A 4EVZA 1EC8A 3N15A 1I2NA 5G5IA 1ONWA 2A6NA 1JUEA 3KEHA 2C1IA 4MIMA 3W7JA 2QDHA 4NI8A 3H22A 4AWSA 4CQDA 3E02A 3IUDA 1AQMA 1OYCA 4XVDA 2E6DA 1NF7A 3ECQA 3CNYA 4RE4A 2ZUWA 1DVJA 2YBVA 4J27A 2RJHA 2ZZ2A 3FGCA 3FIGA 3WQEA 5C5YA 1JG9A 3KVMA 4CNTA 1OEPA 3S1UA 2FZNA 3WBAA 4UBPC 4ML4A 3ZFHA 3UY7A 1UW9A 3TN5A 2PLJA 2WHJA 4ZQPA 2E40A 1MRQA 1V3MA 1GW1A 4XBSA 3R5EA 1BEUA 2PB1A 3WH5A 3OGVA 1GORA 4LVBA 4GD0A 5CZJA 5I07A 2WVVB 5I78A 5G2HA 2ZTJA 3LV5A 9CGTA 1G4EA 1W2PA 4ZE5A 1ME8A 1BKSA 4L61A 1EDQA 4LXFA 1KWGA 3NQ7A 4FK9A 1I8JA 3AO0A 4OBRA 1CLVA 1G4TA 2V63A 3KL3A 3LHVA 4W5UA 3PUEA 1W3NA 4CNSA 3A24A 2NUXA 2V82A 4O57A 5BMWA 3BICA 5AZ1A 1XKYA 4Q4QA 5IDIA 3TA9A 1MW3A 3W6YA 1XH0A 1ISVA 4MG4A 3GYEA 1D9EA 3DIPA 4TX9A 4HHPA 1ICSA 3T08A 3AHXA 3VDHA 1VLIA 3KL5A 1Q6OA 1VCVA 2QNEA 4H01A 2OQYA 4G8TA 4Z1DA 5CGQA 1JYXA 4GHRA 2Y88A 3N13A 4P7NA 1XQKA 2BG5A 1HFBA 3WF1A 3RU8X 1A0CA 3SCTA 1UCWA 3RM8A 3QTPA 4AIBA 1OWQA 1GVRA 2J74A 3LK6A 5HWMA 3MQTA 2D22A 5TQLA 1XV8A 2FH6A 3WK0A 1R47A 1JQVA 2ISFA 1B3WA 2Y1HA 3E0LA 2YB4A 1W5PA 1I0BA 3REQA 3OLEA 7TIMA 3QV9A 1VAHA 1YRRA 1I9CB 3VD7A 3WL1A 4PRTA 2WLYA 4YHGA 5B7ZA 3W72A 1E6SM 9XIMA 1VGAA 1CI1A 1BFNA 1YQ2A 3FN9A 4TMCA 4MPKA 4XAYA 3I7SA 3LMZA 1LG2A 1QI5A 1KR1A 3GVWA 3QGVA 4GG9A 4V33A 3GHUA 2CHOA 3SGZA 2HISA 3VXGA 1E4MM 3S6DA 3KBNA 4UMBA 3W24A 1OYBA 5G4WA 2NW0A 3K30A 3A23A 3INPA 2CIPA 1BHGA 3T42A 3WJXA 4JPGA 1MW1A 3MKVA 4XD3A 4BWLA 1LQ2A 2NWRA 1FP9A 1AW2A 4A8LA 3T05A 4JHMA 1NIUA 4H9YA 2Q3RA 4GY1A 3PWIA 3QN3A 3M0JA 2QW5A 3FSUA 1CGXA 3KOWA 2J66A 5DQPA 2VOMA 3HN3A 2PU1A 3VGBA 2DZPA 5FEZA 3BGGA 4FEZA 2OKTA 2FB2A 1DJIA 4PULA 1UR3M 4I7VA 2OLHA 4LBRA 4IX2A 3CLMA 3WBEA 1RK5A 3AWOA 3B8TA 4KS0A 1H61A 3FDGA 3V0TA 1BSIA 1FDYA 3EKLA 4J3ZA 2HE5A 3AIQA 3TMQA 2JEQA 3IJ7A 3W83A 5CPLA 5BXRA 6PTDA 1TV4A 2POZA 1B3OA 2WKGA 3P14A 2Q3OA 3UJRA 3U6WA 4QJ5B 4ZL1A 2PC8A 1Z44A 4TVUA 5ECUA 4GGHA 1SO4A 1X6NA 5A6AA 1BKHA 1Q7ZA 5EMKA 2Z7KA 5LXXA 1PL9A 1AZ2A 3M5XA 4AWTA 2W92A 4DXXA 3W74A 4CEXC 4PSRA 3W7CA 2HJPA 3AWNA 1TWWA 1VHCA 2HVMA 3P60A 4F66A 3DFNA 5A2CA 1ZAHA 3B4YA 1NY1A 4QDWA 4KCVA 4BQ3A 3V0UA 4EAMA 4UTWA 2X42A 2XHYA 3EAUA 1QTWA 2X30A 1R9YA 4QAWA 1KKRA 4E38A 4UMAA 1QPNA 8CGTA 3SY5A 1MI3A 4GO8A 1XSKA 2CC0A 3PZ9A 2R1MA 4DM1A 2VOTA 3VDCA 3TMLA 3U2OA 2GVJA 1K9FA 1TA3A 4AEEA 2VZTA 4UTLA 4H9MA 1J18A 4QG6A 4PUKA 3AXMA 2VEGA 1QPKA 3E2VA 1N7KA 3NO3A 4Z1BA 3HQPA 1BD0A 3GC5A 2EXOA 2Y5SA 3CUGA 3LMYA 2GQ3A 4LYPA 1F73A 1NDYA 2H90A 4E2VA 2D73A 3QKEA 4K7YA 4LBSA 4QCFA 1TV5A 3OVGA 3R8HA 1N8IA 5BU9A 4M7TA 3ZT6A 4RDVA 3LU2A 3M16A 3H54A 1JFHA 3NQFA 3BE7A 3UG8A 4MNKA 3NNTA 4DXVA 3BQ6A 1WCGA 2HBVA 1A5NC 2J8TA 1FHVA 2P8CA 3VX1A 4D6HA 1FFQA 3KBVA 1TPDA 5H8PA 1EO7A 3VOFA 3MMWA 1ITXA 5C7HA 3LM3A 2YYUA 1F05A 4UQDA 4IPLA 1B5TA 1U83A 4HNTA 2XSAA 4O4WA 2TRSA 3PHAA 4FP1A 1TJ1A 5G4HC 7PTDA 2GSJA 2XINA 3HTWA 1U1JA 2WNWA 2OZ3A 1IE7C 4XUYA 3ARUA 3GR7A 4HYWA 2V3FA 1G5AA 1KLZA 3VAVA 4ASTA 3NURA 1C8XA 1SVDA 4RNHA 1GVYA 3G24A 3G1SA 1P6WA 1XM3A 3P3BA 3V35A 2AKZA 4RPPA 4MLRA 1IF2A 1HKMA 2EHHA 3HPAA 3TUUA 2PUZA 2ISVA 3TFXA 3S1XA 3EWWA 2WAGA 3H4GA 3TJLA 2WM1A 3TC3A 4C1NB 2QYGA 4QAIA 3WSUA 1DTNA 4S3DA 3WLRA 1TR9A 1JZ6A 3BPWA 2R8WA 1B3VA 4AD0A 3AC0A 3APTA 2ZE0A 3CUIA 1W3HA 3UBPC 4AAJA 1CGYA 2WJZA 4B5TA 2NXHA 3GNOA 5F4XA 5CLWA 1ECEA 4XAGA 1E6XM 4PTWA 5D8WA 4JAWA 1A5OC 4QLJA 3FJNA 3O07A 2GYIA 1BWLA 2F84A 2GUYA 3CWNA 5E0CA 3OG2A 1GW9A 4GZEA 1VPQA 1QK0A 3VD9A 3TWAA 1QBBA 3NTYA 3MW7A 1Y5XA 1YTEA 4WKAA 1KGXA 1EPVA 1LLWA 3TZNA 4KRTA 4LW7A 4F2TA 2G8ZA 1REQB 3W1LA 5HQEA 3QC0A 4Y8FA 3BGJA 5FAGA 3S1VA 2GJLA 4CU8A 2J7EA 4O1FA 1WOAA 3R13A 3DUGA 7ODCA 2V6AA 4GX9A 1O5QA 3BAXA 3W6MA 1HP5A 2XISA 4O8AA 3ZO9A 4R7OA 2GJXA 3E49A 5EA9A 1EXBA 4HA0A 4ICCX 4C6NA 4PCNA 1V0MA 1UYQA 1WAUA 1MFUA 2WC4A 2ZUMA 1K7FA 3IIOA 1QNSA 3ME3A 4H8NA 9XIAA 4AHOA 2RDTA 2VDHA 2B31A 5DCBA 4US5A 3FAXA 2WVTA 4KWWA 2ZA2A 4D1JA 1FWTA 2D2JA 3FNDA 3C2RA 1HJSA 1UWQA 1X1OA 3LRKA 3AMCA 1KFCA 1S3TC 2E7FA 3KOXA 3POCA 4JKLA 4INFA 3IRSA 2V5JA 1X6UA 1Y5VA 4D6CA 2VWTA 4C6MA 5FEXA 4US5D 5LZLA 4M19A 1GG0A 3KL0A 1XYAA 1OC6A 1SZEA 5DMMA 4GNVA 2XSXA 4X63A 3UFYA 1BPLB 5A6KA 4RR4A 1ZAIA 4NZ1A 5CPOA 4LANA 2MANA 5CH9A 3I6RA 3IUIA 5DRIA 1S2WA 1J5SA 1LWIA 2PMQA 3U5UA 4RLIA 2CZDA 1OG0A 3IGXA 1NP0A 3P5YA 5FOOA 4X22A 4AZ5A 1O5KA 3XINA 4YWIA 2V2CA 5FJRA 1TPH1 3TP4A 4IXXA 3EX3A 2NX3A 2YCLA 4OJYA 3DH7A 1LWJA 3M5YA 3U3HA 1VF8A 3L66A 3G77A 3WG6A 2F6KA 1NFPA 2JKPA 4NZCA 4ATDA 4Y8EA 2AMXA 3S5YA 1GVOA 3PZUA 2Y89A 1FWIC 1R85A 4F4RA 3RLGA 3WLPA 4B3ZA 1IWAA 1Q85A 1SFLA 4Q8WA 3GUGA 1PO9A 4IIHA 3I7RA 4LH8A 1A5SA 1GGOA 5ABGA 2YA0A 3QY8A 3UA4A 4TIMA 4DWSC 4Z2IA 4R9OA 3SCUA 1KTCA 1W2VA 4XO6A 1J2BA 1NDWA 1B0IA 3NAVA 4DO5A 4IMDA 5HATA 3GIYA 2VR5A 2VI0A 4E4PA 1IEWA 3WJYA 3SO7A 4PMVA 3BMVA 3UWEA 3FAWA 4HZ6A 3PBYA 1GQLA 1H5VA 1H49A 1XYBA 3LTSA 2GJPA 4F9JA 4LOCA 4R34A 2X7VA 2F7FA 2D0GA 1D3HA 1TUFA 1H3GA 3DECA 1W5OA 2J6XA 4QEEA 1YTKA 1S1PA 4I5XA 5HUPA 1UKOA 1E1CA 4UR7A 3BAYA 3N2OA 1KW1A 3TTYA 1DXFA 2V81A 1EIXA 3O6CA 3THAA 1RLCL 3DBNA 1IT0A 1JUBA 3CXOA 4E4UA 4LAUA 1WO2A 1QO2A 1JPDX 1R7AA 1LBFA 3UWZA 3UVAA 1IR1A 1MEWA 4N9DA 2BVWA 4Q4PA 3S1WA 5MF5A 2OSXA 4C6BA 1QHZA 3TQVA 2RAGA 4AY1A 2VEFA 4C60A 5CC6A 1TO3A 3O05A 4ZQCA 1R9XA 1UZ4A 1TPFA 5G2WA 2ON3A 4A8IA 3UT0A 1TE6A 2I5GA 2V2DA 4W84A 3VDBA 3TC7A 1TWZA 4GBDA 3V75A 1H2JA 1PTDA 3IGHX 1SM9A 3TH6A 1VS1A 2YJQA 4I9MA 3PPFA 2GUUA 1YNYA 2C1HA 3O7UA 3CMFA 4CCZA 4M80A 1PKLA 2A79A 3QVQA 2XIOA 1CCWB 4W5ZA 5GNYA 3ABOA 4GYPC 2V5BA 2GSHA 3WJZA 1WZLA 4S3EA 3MUAA 4H9XA 2JGYA 1E0TA 3G8RA 1YDNA 4I9AA 3W23A 2YL5A 5HBFA 3H2FA 1WDWA 3L0NA 4ZB2A 1L0PA 4AD1A 2VUNA 1X7FA 4GCAA 5CJNA 4ATWA 2PZ0A 3GM8A 4ZO7A 2YA1A 3NQCA 5DLCA 1XINA 3SN4A 4GVFA 4HPHA 3TR9A 4AISA 4RZBA 3W7RA 2QPXA 2IKJA 1K8XA 3A4AA 4AHQA 3PB0A 2G95A 4JIPA 4CLMA 2P53A 4C1LA 3TJIA 1UC4A 1Q4NX 4ZMGA 4X0NA 4V15A 3OZPA 2YZ5A 4U5IA 1DXEA 5D2WA 5FI8A 1MUMA 4PZVA 2Q6ZA 1QNOA 4IM4A 1TWSA 3AYRA 1P0NA 4M56A 5JMUA 3DG3A 2HBXA 1LZOA 2DFAA 2VMFA 5I7GA 5IM51 3B97A 3I3DA 4MWAB 2OYMA 1BTCA 3DHDA 3TLQA 3LRLA 5H91A 1CX9A 3SUVA 1ZS2A 1CW2A 4O50A 3L4UA 1K9EA 2BOFX 2CERA 2QLYA 4JQ2A 5D2XA 3WFLA 3C86A 1TWIA 3IJ6A 4O1AA 1TQXA 4JNZA 4DM2A 7REQB 3MWCA 4DUWA 1DP0A 1CLXA 3WQOA 4IGHA 3GXFA 3CZLA 3PC0A 3E2QA 2NV9A 5KSWA 5EYWA 1FHUA 2Z1XA 3K8KA 3WH8A 1TSIA 2BXZA 3PTDA 3SURA 2WVSA 1OCBA 1FBAA 4M8UA 1SZNA 4JL2A 4PTNA 3ARPA 3VC5A 1VJIA 2QF7A 2WANA 5F2GA 3CTTA 3B8UA 3K13A 1GTHA 1O4UA 1TTQA 2QT3A 4AUBA 3TSMA 2X41A 1LL4A 3GLCA 4W8BA 2DZTA 4GZJA 4PMXA 1XRTA 1QVBA 4QNEA 3QM3A 1XLGA 1CXHA 1HN1A 3C2FA 4O12A 4WIWA 4H6QA 3QV7A 3TVAA 3NL2A 3MUIA 2OEMA 4DZ5A 5CBBA 5FJPA 3PK7A 1MXGA 4NYYA 4K2SA 1EEXA 3BDKA 4WX2A 2XM1A 3L21A 1EQCA 4QIUA 2OQHA 4WSHA 4P8UA 2NXIA 2RHGA 5BXPA 2WXDM 1QOPA 1HZYA 4GFSA 2DT3A 1A0EA 4EXQA 1T96A 3DI0A 4WSKA 3W7OA 3R2GA 4IIEA 3SUTA 1A5CA 1LUCB 2OYLA 1XX1A 1C93A 1QU4A 3STGA 3HPFA 1VH7A 3BCFA 3PBMA 1B30A 5D02A 3ARZA 4MDPA 3NO5A 3BH4A 1G6CA 3UZWA 2ZICA 1Q7MA 1E0WA 4UTKA 4IG2A 4R33A 2F6UA 4QEHA 4GQ0A 1ZQ5A 3VCNA 3HM7A 4ICMA 4AVOA 5CG7A 1YADA 4GI8A 1YEYA 1F07A 3QGKC 3OA3A 4WXZA 4Z0SA 2VKZG 4E2BA 3CUZA 2VQTA 2ASHA 2NUYA 1Q8JA 3EPNA 2DT0A 2ZWYA 4JIIX 4Q22A 4LV4A 3WD0A 4XB3A 1R8LA 4GQGA 3ORWA 1LLOA 1DHKA 5DCEA 4PCTA 3AS0A 4KWOA 2C91A 3VZXA 3A4JA 3AUJA 1SJAA 4MZYA 4D6FA 1PTAA 1C7TA 4K8HA 3VNZA 3NR0A 1UBPC 1KBKA 4GH3A 4JX6A 3FV9A 3ZMRA 3P0WA 4ZBCA 5EPDA 1OF6A 3UGVA 5AHIA 1W1TA 3LPOA 3OW1A 4WR3A 2YXXA 1GK8A 4LGXA 3YPIA 2ZWZA 1VPYA 4CGTA 4DY1A 4W9TA 1I2OA 2GGEA 4DZHA 3U2EA 3IK4A 1Z3NA 2WSKA 3P61A 3L23A 3NG3A 1I1WA 1JUKA 1AJ2A 1PIFA 3SDOA 3PB2A 3MHUA 3N12A 5AHMA 3CUXA 3EB2A 1ML1A 3A64A 5E09A 3UWWA 4RNFA 4W87A 3L65A 4XKMA 1NVMA 1BVZA 3EZ4A 1FH9A 3UCQA 3VD4A 1V77A 2Z24A 2AKMA 1XS2A 5MKGA 3E2SA 3NQDA 3GK0A 1CB2A 4H19A 4O14A 4PCFA 4OTKA 5PTDA 4C6JA 3P84A 4J35A 2YDAA 1H0IA 4IGNA 2Q02A 3IUHA 5A8OA 1V3JA 3H4XA 4AF0B 5T9CE 4F8XA 4NX5A 2ATSA 2X8RA 2CKRA 3VD3A 3MHGA 3U7VA 1CXLA 4FX7A 1E9IA 3EA2A 1GOKA 1J10A 2ZX9A 2EPLX 2FZ9A 3EWBX 1WYIA 3GTXA 3DDMA 2OELA 1EWEA 3G1DA 2POTA 3KLKA 2PSNA 3GZAA 4LAZA 3SCNA 2UV8G 1TMHA 3IIXA 4ATLA 1NOUA 2OZ0A 4QSHA 1I6NA 4NXSA 2IPJA 3VMPA 4U5KA 3C0SA 4PFHA 2BGNE 3WQ6A 4JTAA 1XPGA 5LNWA 1CECA 1YXDA 4NZFA 4U2YA 3OYZA 4IQEA 3KHJA 5BZAA 3SCRA 2NQ9A 1I75A 2OEKA 1E6PA 3GW0A 3W1TA 1SZFA 1EBHA 4XZWA 4DI9A 3UJSA 2QGYA 3S3GA 4PTDA 1OFPA 1VIWA 4K3ZA 5D9NA 4F2BA 1VYPX 1VC4A 1EO5A 3LNMA 2PGFA 3LXAA 1U33A 4IWWA 2FPTA 1CNVA 2CZFA 4AQLA 1XLDA 3AISA 2INZA 3QXBA 4PUDA 3HGRA 3G3MA 1P4CA 3QFEA 1R3TA 1VFTA 4KEUA 1S2TA 3BOFA 4TTGA 4MZ1A 1YDYA 1H50A 1UD4A 3WUFA 4B5NA 4NVTA 1G9HA 3DI1A 1FY6A 4S2BA 3TIMA 2IPFA 2NQZA 4E8DA 4TMBA 3JVAA 1UROA 1P1MA 1AQ0A 1B1YA 3FA4A 3W22A 1TV8A 4V1XA 4YHEA 5CPNA 1UPPA 4XQ6A 4CN6A 4MF4A 1FWSA 1PJ9A 4WUIA 4CN4A 4F48A 2E1WA 3SN1A 1SSDA 3LPPA 3PBGA 3THCA 2BGSA 3U57A 2GQ9A 1W1PA 5I6SA 2JF6A 2C6QA 1J0YA 4HMEA 4DEFA 3AAMA 1A80A 3NDZA 1WXZA 5FJTA 4ZFMA 3IJDA 1V51A 5M17A 4TTUA 3V36A 1PYMA 4N0RA 2G50A 2BSLA 5EMJA 4TO8A 5CC5A 5JIWA 2CZ5A 1RY8A 1XIEA 2E5DA 3F5JA 4M3PA 5LIYX 1HO1A 1RP8A 3O2LA 1FWBC 1DL3A 5CEWA 1V4YA 1L9WA 1DWFM 5M3WA 2OOFA 3H24A 2JF7A 1W31A 5H6HA 3KBMA 2D0HA 3TAOA 2RFGA 1OBAA 4W8AA 1JCJA 2PWFA 1AQHA 2ISSA 4M24A 2J8GA 3AHTA 1RJQA 1E56A 1IZKA 3OQEA 3H21A 2IPGA 4MJMA 1WDRA 4FZIA 2A2IA 3VDGA 2G97A 4LYKA 2E5BA 3WQCA 4K7VA 4ZGYA 5FSDC 1UPMB 4TU1A 2XVPA 4B5WA 3PWAA 1XSIA 1GOXA 1WXJA 4D6GA 5GVJA 1AH0A 3BG3A 4ZCWA 2QHAA 1V0NA 2V5CA 1XDMA 5TNVA 1Q45A 1E6RA 3UD6A 2VGGA 3VZZA 2V5LA 3D0CA 2Z1SA 3TK7A 1BYAA 3AQUA 3HPSA 5DFAA 2WMKA 5I23A 1UR0A 2VX7A 1AMYA 3QPEA 3EA3A 4M29A 1R2RA 2GGGA 4IFKB 1YDVA 5EMLA 5CJMA 4FS9A 1Q13A 1ALDA 4GI4A 1JAEA 3ZOAA 4DJFC 3GHSA 4ORMA 3BXWA 1UKPA 3GNNA 1W9XA 3QH2A 3M46A 4IZGA 2BVTA 1DBTA 3G6LA 1OX4B 4IICA 3WEMA 1AMKA 5I79A 1QNQA 5LIKX 4HSHA 1NWSA 1RQHA 1G69A 4XKYB 4O1BA 1M68A 3PZOA 5AC7A 3SUWA 1XLFA 4QFUA 4GJ1A 5L9FA 4BA0A 1HGWA 1G94A 3ITYA 5AHFA 3GZ3A 2EKGA 4UZUA 3VIJA 3SRDA 1SZGA 1XDJA 3OU8A 5BRQA 1G4PA 2TODA 4ZXOA 4CNPA 2B0MA 4G56A 1FX6A 1BXNA 2F8QA 2A3LA 3PTQA 1XIJA 1TE1A 1E6QM 3G3DA 1G7UA 5I3HA 1FWFC 4UTUA 1UUMA 3BSHA 1UP0A 2Z6IA 4UUIA 4UOQA 3VCRA 2X40A 1UD6A 2EPHA 1XC4A 2VUYA 1E55A 5DY3A 3GDRA 3L0GA 3MUY1 4B92A 4CNNA 4JFVA 2J75A 4MFDA 5G1TA 4OUIA 4Y9PA 5D04C 5KZ6A 3SQMA 3RUBL 3PFMA 2XH0A 1V8EA 3GSMA 2BMBA 4O52A 4JFSA 3G6MA 2OSWA 4E3VA 1OGSA 2YW4A 3CHVA 3GXTA 2GJNA 1JZ8A 4QJ3B 4QM1A 4MSSA 1QW8A 3WX7A 4HYVA 2XGIA 2H3BA 3N04A 4B5SA 3AIWA 7A3HA 1P0BA 2VRQA 1F76A 4N4PA 3M0XA 1V6XA 1K3UA 1EIBA 3OVQA 1KFJA 3W00A 7XIMA 3SR7A 3QQ1A 1XIMA 3BARA 3FHAA 4OU1A 1ZENA 3QV6A 5FA5A 3IANA 2XFFA 1P5BA 1CXFA 3KWSA 4ZOAA 3O0FA 4NF7A 5CPQA 3QGAC 4GJJA 3ARRA 4ZOEA 1HQTA 1FCVA 4AFYA 4RV3A 1UWSA 2DZWA 1GOIA 4GC3A 3KBJA 3NGJA 1T8XA 1OVDA 4US6A 1TVLA 1OZMA 1WE5A 2QDDA 1SR9A 4Z2HA 2ZKMX 3NQ8A 4LRSA 1IXPA 3CL7A 4GK8A 1YMYA 3M0HA 4O19A