4K8LA

Crystal structure of a putative 4-hydroxyproline epimerase/3-hydroxyproline dehydratse from the soil bacterium ochrobacterium anthropi, target efi-506495, disordered loops
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
333
structure length
305
Chain Sequence
SMRSTKVIHIVGCHAEGEVGDVIVGGVAPPPGKTVWEQSRFIASDETLRNFVLNEPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGSNSICVSTVLLDSGIIPMQEPVTRMVLEAPGGLIEVEAECRNGKAERISVRNVPSFADRLNASLEVGTITVDTAYGGDSFVIVDAASIGMELAEIGVKITKAANEQLGFRHPEKDWNHISFCQITEPVTRDGDILTGVNTVAITGTGCSARMAVLHAKGQMKVGERFIGHCRLDKTLELGGKPAISPIISGRAWVTGTSQLMLDPSDPFPSGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 4-hydroxyproline epimerase/3-hydroxyproline dehydratse from the soil bacterium ochrobacterium anthropi, target efi-506495, disordered loops
rcsb
source organism Ochrobactrum anthropi
molecule tags Isomerase
molecule keywords Proline racemase
total genus 78
structure length 305
sequence length 333
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k8lA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k8lA01
4JCIA 4LB0A 3FVEA 3EJXA 4J9XA 4JUUA 1GQZA 1U1WA 4K8LA 1W61A 2OTNA 4JBDA 1W62A 4IJZA 4K7GB 4Q60A 4IK0A 2GKJA 1XUAA 4J9WA 1QY9A 5IWEA 4Q2HA 1U1VA 2AZPA 2GKEA 5M47A 4K7XA 1XUBA 1SDJA 2Q9JA 1S7JA 1BWZA 5HA4A 2PVZA 5H2GA 1TM0A 1QYAA 1YM5A 1T6KA 4DUNA 1U1XA 3EDNA 2Q9HA 4JD7A 2PW0A 3G7KA 5H2YA 2H9FA 1U0KA 3EKMA
chains in the Genus database with same CATH superfamily
4JCIA 2LT2A 5ANPA 2QB6A 1W61A 4IK0A 1IR6A 1BWZA 1WPMA 4JD7A 4RPAA 1U0KA 3EKMA 2ZVFA 3EJXA 4J9XA 2ENXA 2ZXOA 4K8LA 1W62A 4IJZA 1XUAA 2MPBA 4J9WA 3WQZA 2GKEA 2ZXRA 1XUBA 1TM0A 2Q9HA 3PW9A 2H9FA 2HAWA 4LB0A 3FVEA 3W5WA 1WPPA 1U1WA 2EB0A 4JBDA 4LS9A 3PTJA 2YMAA 2ZXPA 4K7GB 4Q60A 2GKJA 3IGHX 5IWEA 4K7XA 2Q9JA 5HA4A 2PVZA 1QYAA 1YM5A 1T6KA 3ICJA 4DUNA 1U1XA 2KPTA 4LG3A 2PW0A 3G7KA 1I74A 4JUUA 1GQZA 1K20A 3PVHA 1K23A 2OTNA 2QB7A 2KW7A 2IW4A 4PY9A 1QY9A 4Q2HA 1U1VA 2AZPA 5M47A 3DEVA 2QB8A 1SDJA 1S7JA 4OA3A 5H2GA 3G98A 3EDNA 5H2YA 4GL6A
chains in the Genus database with same CATH topology
4JCIA 2LT2A 5ANPA 2QB6A 1W61A 4IK0A 1IR6A 1BWZA 1WPMA 4JD7A 4RPAA 1U0KA 3EKMA 2ZVFA 3EJXA 4J9XA 2ENXA 2ZXOA 4K8LA 1W62A 4IJZA 1XUAA 2MPBA 4J9WA 3WQZA 2GKEA 2ZXRA 1XUBA 1TM0A 2Q9HA 3PW9A 2H9FA 2HAWA 4LB0A 3FVEA 3W5WA 1WPPA 1U1WA 2EB0A 4JBDA 4LS9A 3PTJA 2YMAA 2ZXPA 4K7GB 4Q60A 2GKJA 3IGHX 5IWEA 4K7XA 2Q9JA 5HA4A 2PVZA 1QYAA 1YM5A 1T6KA 3ICJA 4DUNA 1U1XA 2KPTA 4LG3A 2PW0A 3G7KA 1I74A 4JUUA 1GQZA 1K20A 3PVHA 1K23A 2OTNA 2QB7A 2KW7A 2IW4A 4PY9A 1QY9A 4Q2HA 1U1VA 2AZPA 5M47A 3DEVA 2QB8A 1SDJA 1S7JA 4OA3A 5H2GA 3G98A 3EDNA 5H2YA 4GL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCI A;  4LB0 A;  3FVE A;  3EJX A;  4J9X A;  4JUU A;  1GQZ A;  1U1W A;  4K8L A;  1W61 A;  2OTN A;  4JBD A;  1W62 A;  4IJZ A;  4K7G B;  4Q60 A;  4IK0 A;  2GKJ A;  1XUA A;  4J9W A;  1QY9 A;  5IWE A;  4Q2H A;  1U1V A;  2AZP A;  2GKE A;  5M47 A;  4K7X A;  1XUB A;  1SDJ A;  2Q9J A;  1S7J A;  1BWZ A;  5HA4 A;  2PVZ A;  5H2G A;  1TM0 A;  1QYA A;  1YM5 A;  1T6K A;  4DUN A;  1U1X A;  3EDN A;  2Q9H A;  4JD7 A;  2PW0 A;  3G7K A;  5H2Y A;  2H9F A;  1U0K A;  3EKM A; 
#chains in the Genus database with same CATH topology
 4JCI A;  2LT2 A;  5ANP A;  2QB6 A;  1W61 A;  4IK0 A;  1IR6 A;  1BWZ A;  1WPM A;  4JD7 A;  4RPA A;  1U0K A;  3EKM A;  2ZVF A;  3EJX A;  4J9X A;  2ENX A;  2ZXO A;  4K8L A;  1W62 A;  4IJZ A;  1XUA A;  2MPB A;  4J9W A;  3WQZ A;  2GKE A;  2ZXR A;  1XUB A;  1TM0 A;  2Q9H A;  3PW9 A;  2H9F A;  2HAW A;  4LB0 A;  3FVE A;  3W5W A;  1WPP A;  1U1W A;  2EB0 A;  4JBD A;  4LS9 A;  3PTJ A;  2YMA A;  2ZXP A;  4K7G B;  4Q60 A;  2GKJ A;  3IGH X;  5IWE A;  4K7X A;  2Q9J A;  5HA4 A;  2PVZ A;  1QYA A;  1YM5 A;  1T6K A;  3ICJ A;  4DUN A;  1U1X A;  2KPT A;  4LG3 A;  2PW0 A;  3G7K A;  1I74 A;  4JUU A;  1GQZ A;  1K20 A;  3PVH A;  1K23 A;  2OTN A;  2QB7 A;  2KW7 A;  2IW4 A;  4PY9 A;  1QY9 A;  4Q2H A;  1U1V A;  2AZP A;  5M47 A;  3DEV A;  2QB8 A;  1SDJ A;  1S7J A;  4OA3 A;  5H2G A;  3G98 A;  3EDN A;  5H2Y A;  4GL6 A; 
#chains in the Genus database with same CATH homology
 4JCI A;  2LT2 A;  5ANP A;  2QB6 A;  1W61 A;  4IK0 A;  1IR6 A;  1BWZ A;  1WPM A;  4JD7 A;  4RPA A;  1U0K A;  3EKM A;  2ZVF A;  3EJX A;  4J9X A;  2ENX A;  2ZXO A;  4K8L A;  1W62 A;  4IJZ A;  1XUA A;  2MPB A;  4J9W A;  3WQZ A;  2GKE A;  2ZXR A;  1XUB A;  1TM0 A;  2Q9H A;  3PW9 A;  2H9F A;  2HAW A;  4LB0 A;  3FVE A;  3W5W A;  1WPP A;  1U1W A;  2EB0 A;  4JBD A;  4LS9 A;  3PTJ A;  2YMA A;  2ZXP A;  4K7G B;  4Q60 A;  2GKJ A;  3IGH X;  5IWE A;  4K7X A;  2Q9J A;  5HA4 A;  2PVZ A;  1QYA A;  1YM5 A;  1T6K A;  3ICJ A;  4DUN A;  1U1X A;  2KPT A;  4LG3 A;  2PW0 A;  3G7K A;  1I74 A;  4JUU A;  1GQZ A;  1K20 A;  3PVH A;  1K23 A;  2OTN A;  2QB7 A;  2KW7 A;  2IW4 A;  4PY9 A;  1QY9 A;  4Q2H A;  1U1V A;  2AZP A;  5M47 A;  3DEV A;  2QB8 A;  1SDJ A;  1S7J A;  4OA3 A;  5H2G A;  3G98 A;  3EDN A;  5H2Y A;  4GL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...