4K8LA

Crystal structure of a putative 4-hydroxyproline epimerase/3-hydroxyproline dehydratse from the soil bacterium ochrobacterium anthropi, target efi-506495, disordered loops
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
333
structure length
305
Chain Sequence
SMRSTKVIHIVGCHAEGEVGDVIVGGVAPPPGKTVWEQSRFIASDETLRNFVLNEPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGSNSICVSTVLLDSGIIPMQEPVTRMVLEAPGGLIEVEAECRNGKAERISVRNVPSFADRLNASLEVGTITVDTAYGGDSFVIVDAASIGMELAEIGVKITKAANEQLGFRHPEKDWNHISFCQITEPVTRDGDILTGVNTVAITGTGCSARMAVLHAKGQMKVGERFIGHCRLDKTLELGGKPAISPIISGRAWVTGTSQLMLDPSDPFPSGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 4-hydroxyproline epimerase/3-hydroxyproline dehydratse from the soil bacterium ochrobacterium anthropi, target efi-506495, disordered loops
rcsb
source organism Ochrobactrum anthropi
molecule tags Isomerase
molecule keywords Proline racemase
total genus 78
structure length 305
sequence length 333
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k8lA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4k8lA01
1TM0A 4IK0A 1W62A 1QY9A 4JCIA 4K7GB 4DUNA 1U0KA 2PVZA 4J9WA 5M47A 1S7JA 5H2YA 1U1VA 2H9FA 1BWZA 1XUBA 1YM5A 5IWEA 4IJZA 5H2GA 4K7XA 3EKMA 3EDNA 4K8LA 5HA4A 2PW0A 1U1XA 1SDJA 4Q60A 4J9XA 4Q2HA 2GKEA 4JUUA 4JD7A 1T6KA 1W61A 4JBDA 4LB0A 3EJXA 1GQZA 2GKJA 2Q9HA 1QYAA 2Q9JA 1U1WA 3FVEA 3G7KA 2AZPA 2OTNA 1XUAA
chains in the Genus database with same CATH superfamily
4JCIA 4RPAA 1U1VA 2H9FA 4GL6A 5HA4A 2ZXRA 2GKEA 4JD7A 3PW9A 3EJXA 1QYAA 3FVEA 3G7KA 2AZPA 2OTNA 2YMAA 3ICJA 5H2YA 5IWEA 5H2GA 4K7XA 3WQZA 2QB8A 3EDNA 1U1XA 4Q60A 4Q2HA 1WPMA 4JBDA 4LB0A 4LG3A 1U1WA 2QB7A 2MPBA 1XUAA 1TM0A 4IK0A 1W62A 4K7GB 3DEVA 1I74A 2HAWA 1IR6A 4PY9A 1XUBA 2ZVFA 4LS9A 3PTJA 1K23A 2KPTA 3EKMA 4K8LA 2EB0A 1SDJA 4OA3A 2QB6A 4JUUA 2ZXPA 1T6KA 1W61A 1WPPA 2Q9HA 5ANPA 2LT2A 2ZXOA 3W5WA 2KW7A 3PVHA 4DUNA 1QY9A 2IW4A 1U0KA 2PVZA 4J9WA 5M47A 1S7JA 1BWZA 2ENXA 1YM5A 3G98A 4IJZA 2PW0A 4J9XA 1GQZA 2GKJA 2Q9JA 3IGHX 1K20A
chains in the Genus database with same CATH topology
4JCIA 4RPAA 1U1VA 2H9FA 4GL6A 5HA4A 2ZXRA 2GKEA 4JD7A 3PW9A 3EJXA 1QYAA 3FVEA 3G7KA 2AZPA 2OTNA 2YMAA 3ICJA 5H2YA 5IWEA 5H2GA 4K7XA 3WQZA 2QB8A 3EDNA 1U1XA 4Q60A 4Q2HA 1WPMA 4JBDA 4LB0A 4LG3A 1U1WA 2QB7A 2MPBA 1XUAA 1TM0A 4IK0A 1W62A 4K7GB 3DEVA 1I74A 2HAWA 1IR6A 4PY9A 1XUBA 2ZVFA 4LS9A 3PTJA 1K23A 2KPTA 3EKMA 4K8LA 2EB0A 1SDJA 4OA3A 2QB6A 4JUUA 2ZXPA 1T6KA 1W61A 1WPPA 2Q9HA 5ANPA 2LT2A 2ZXOA 3W5WA 2KW7A 3PVHA 4DUNA 1QY9A 2IW4A 1U0KA 2PVZA 4J9WA 5M47A 1S7JA 1BWZA 2ENXA 1YM5A 3G98A 4IJZA 2PW0A 4J9XA 1GQZA 2GKJA 2Q9JA 3IGHX 1K20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TM0 A;  4IK0 A;  1W62 A;  1QY9 A;  4JCI A;  4K7G B;  4DUN A;  1U0K A;  2PVZ A;  4J9W A;  5M47 A;  1S7J A;  5H2Y A;  1U1V A;  2H9F A;  1BWZ A;  1XUB A;  1YM5 A;  5IWE A;  4IJZ A;  5H2G A;  4K7X A;  3EKM A;  3EDN A;  4K8L A;  5HA4 A;  2PW0 A;  1U1X A;  1SDJ A;  4Q60 A;  4J9X A;  4Q2H A;  2GKE A;  4JUU A;  4JD7 A;  1T6K A;  1W61 A;  4JBD A;  4LB0 A;  3EJX A;  1GQZ A;  2GKJ A;  2Q9H A;  1QYA A;  2Q9J A;  1U1W A;  3FVE A;  3G7K A;  2AZP A;  2OTN A;  1XUA A; 
#chains in the Genus database with same CATH topology
 4JCI A;  4RPA A;  1U1V A;  2H9F A;  4GL6 A;  5HA4 A;  2ZXR A;  2GKE A;  4JD7 A;  3PW9 A;  3EJX A;  1QYA A;  3FVE A;  3G7K A;  2AZP A;  2OTN A;  2YMA A;  3ICJ A;  5H2Y A;  5IWE A;  5H2G A;  4K7X A;  3WQZ A;  2QB8 A;  3EDN A;  1U1X A;  4Q60 A;  4Q2H A;  1WPM A;  4JBD A;  4LB0 A;  4LG3 A;  1U1W A;  2QB7 A;  2MPB A;  1XUA A;  1TM0 A;  4IK0 A;  1W62 A;  4K7G B;  3DEV A;  1I74 A;  2HAW A;  1IR6 A;  4PY9 A;  1XUB A;  2ZVF A;  4LS9 A;  3PTJ A;  1K23 A;  2KPT A;  3EKM A;  4K8L A;  2EB0 A;  1SDJ A;  4OA3 A;  2QB6 A;  4JUU A;  2ZXP A;  1T6K A;  1W61 A;  1WPP A;  2Q9H A;  5ANP A;  2LT2 A;  2ZXO A;  3W5W A;  2KW7 A;  3PVH A;  4DUN A;  1QY9 A;  2IW4 A;  1U0K A;  2PVZ A;  4J9W A;  5M47 A;  1S7J A;  1BWZ A;  2ENX A;  1YM5 A;  3G98 A;  4IJZ A;  2PW0 A;  4J9X A;  1GQZ A;  2GKJ A;  2Q9J A;  3IGH X;  1K20 A; 
#chains in the Genus database with same CATH homology
 4JCI A;  4RPA A;  1U1V A;  2H9F A;  4GL6 A;  5HA4 A;  2ZXR A;  2GKE A;  4JD7 A;  3PW9 A;  3EJX A;  1QYA A;  3FVE A;  3G7K A;  2AZP A;  2OTN A;  2YMA A;  3ICJ A;  5H2Y A;  5IWE A;  5H2G A;  4K7X A;  3WQZ A;  2QB8 A;  3EDN A;  1U1X A;  4Q60 A;  4Q2H A;  1WPM A;  4JBD A;  4LB0 A;  4LG3 A;  1U1W A;  2QB7 A;  2MPB A;  1XUA A;  1TM0 A;  4IK0 A;  1W62 A;  4K7G B;  3DEV A;  1I74 A;  2HAW A;  1IR6 A;  4PY9 A;  1XUB A;  2ZVF A;  4LS9 A;  3PTJ A;  1K23 A;  2KPT A;  3EKM A;  4K8L A;  2EB0 A;  1SDJ A;  4OA3 A;  2QB6 A;  4JUU A;  2ZXP A;  1T6K A;  1W61 A;  1WPP A;  2Q9H A;  5ANP A;  2LT2 A;  2ZXO A;  3W5W A;  2KW7 A;  3PVH A;  4DUN A;  1QY9 A;  2IW4 A;  1U0K A;  2PVZ A;  4J9W A;  5M47 A;  1S7J A;  1BWZ A;  2ENX A;  1YM5 A;  3G98 A;  4IJZ A;  2PW0 A;  4J9X A;  1GQZ A;  2GKJ A;  2Q9J A;  3IGH X;  1K20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...