4K91A

Crystal structure of penicillin-binding protein 5 (pbp5) from pseudomonas aeruginosa in apo state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
342
structure length
342
Chain Sequence
b'ESMVPAPPQLAAKSYVLMDGESGQVLVENNGDQRLPPASLTKLMTAYIATKEIEAGRIGENDLVTVSEHAWRTGGSRMFIKVGSQVSVSDLLHGIIIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLPNPDHYSSARDMAVLARAIIYGEPSHYAIYAQKEFLWNNIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCLVASAVRDGQRMIAVVFGTNSEQARAAETQKLLTYGFRFFESRNFYKKGTELTKGLVWKGSEHEVKAGLAEDLTMTLPRGQMQKLQASMVLEPQLMAPIQQGQVIGKVEVKLDDKVIRSADLVALNAVEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ala-D-ala-carboxypeptidase
molecule tags Hydrolase
source organism Pseudomonas aeruginosa ucbpp-pa14
publication title Structural analysis of the role of Pseudomonas aeruginosa penicillin-binding protein 5 in beta-lactam resistance.
pubmed doi rcsb
total genus 101
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase
A PF07943 PBP5_C Penicillin-binding protein 5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.410.10 Mainly Beta Sandwich Peptidoglycan synthesis regulatory factor (PBP3), Domain 2 D-Ala-D-Ala carboxypeptidase, C-terminal domain 4k91A02
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4k91A01
3UDIA 3HUOA 5GLCA 3CZDA 2WGIA 4KQQA 1SHVA 1YMSA 4MBFA 1QMEA 5DTKA 2B5RA 1HZOA 4X56A 1HD8A 5FAPA 2J8YA 1W5DA 4KQRA 1YLPA 3V39A 2QMIA 3A3EA 3GSGA 3GR2A 1M40A 4MEZA 2ZQCA 4P0MA 1J9MA 1PYYA 2HP5A 4LV1A 2VGKA 4N1XA 4ZBEA 1QMFA 4WMCA 4X53A 1GHPA 1PWGA 3PBOA 4R0QA 4LENA 1IYQA 5HAPA 4M3KA 3CG5A 3G31A 4IVKA 3BFEA 1K38A 3BLSA 3O86A 4JF5A 2Y2GA 2XGNA 4KENB 4OVDA 3UY6A 3ITBA 1ZC2A 4OQ0A 4LV0A 2WKIA 5EVIB 1ESUA 3HL9A 3WS2A 5FATA 4MLLA 4NETA 3MXSA 3FV7A 4OPYA 1WYBA 5A92A 1OMEA 1SKFA 3BLMA 3FKVA 5EECA 3EQVA 1RCJA 5FDHA 3ZG8B 2A49A 3SH9A 2HDRA 2ZQ9A 5EVLA 3A3DA 1SCWA 3P09A 3BECA 3WS1A 3HUNA 5GL9A 2ZQDA 3BRMA 3RXWA 4OPQA 4C3QA 4E3NA 5M1AA 1E4DA 5FSRA 5GHYA 3HLCA 3JYIA 5J8XA 4RX3A 3D4FA 4OOLA 4IBRA 3MKEA 1RGYA 4QJGA 2ZD8A 1NY0A 4EBNA 1K6SA 3ZGAB 3HBRA 3E2KA 1IYOA 4ZJ3A 3VFFA 3Q81A 1KDWA 2PU4A 2V1ZA 1PWDA 3TSGA 2V2FF 5DF9A 3MZFA 3C5AA 3G2ZA 2QZ6A 3WS5A 3UDXA 3Q07A 1LI9A 1FCOA 2ZM2A 4S2KA 5CRFA 3HUMA 5AQ7A 5EVIC 4E3JA 1HTZA 4S2NA 1M6KA 2PU2A 1FQGA 1IYPA 2IWBA 3SS3A 1EI5A 4RVAA 3HLFA 1MXOA 3MZEA 2I72A 4OOMA 5CXWA 3S22A 2IWCA 2EX6A 3UE0A 5FAOA 5JYPA 5CGWA 1XP4A 3LO7A 3C4OA 3OPRA 5EE8A 5KSHA 1Q2PA 2H0TA 2Z2LB 3HVFA 3IXBA 3PBRA 4JXWA 4BLMA 1TDLA 1I5QA 2HDSA 1Q2QA 3UPOA 5GHXA 1IEMA 1YMXA 5M18A 3HLGA 2EX2A 1ONGA 5U47A 1DJBA 5DTTA 3AGFA 1E25A 1HVBA 2H5SA 3N7WA 3O87A 1MWRA 4BL2A 2H0YA 3OCLA 2R9WA 3ZCZA 4EBPA 4OP5A 1LL9A 2P9VB 1K25A 1W79A 4C75A 1EWZA 2HP6A 3IHAA 1MKIA 3FZCA 4GDNA 3UE3A 2Y2LA 1O7EA 1FR6A 4MNRA 2XK1A 3W4OA 4R23A 1MPLA 3SOIA 4JF6A 3UPNA 4Z9QA 4BQMA 3MFDA 3ZNTA 3N8RA 1GHIA 1NYMA 4JXVA 2Y2OA 3G4PA 3VSLA 2XEPA 3WWXA 3HLWA 1Y54A 1VQQA 3ISGA 3NC8A 4K0XA 4XUZA 1K56A 4OQIA 1KGEA 4WEJA 1K56D 1ES2A 4HBUA 1EROA 2Y2KA 5HAIA 1BLSA 3Q1FA 4KZ3A 4E3LA 3G2YA 2X02A 5GLBA 5M19A 5EOOA 4GOGA 1G68A 5F1GA 5FQIA 4KZBA 1MBLA 5DTSA 4KQOA 3OZHA 4WZ4A 3ITAA 4L0LA 5FA7A 5FQJA 1AXBA 1K55A 3V50A 3VP3A 5FQ9A 3LCEA 3ZNYA 5GHZA 3Q7VA 2Y2PA 1FOFA 2HPBA 4XUXA 3W8KA 5BOHA 4EV4A 4X6TA 1ERMA 4OKPA 5EVIA 3GV9A 4ZTKA 2Z2MB 3BFFA 2WUQA 2Y91A 2ZQAA 1KGFA 3FWLA 3V5MA 4B4XA 1KE0A 1CI8A 1LL5A 5EUAA 3IHBA 2DRWA 2Q9NA 1LI0A 4P6BA 3DW0A 1RP5A 3HLBA 3SS5A 5A90A 3DWZA 3ZG7B 4B88A 1ZKJA 4X69A 5KSCA 1BUEA 2ZJ9A 4FSFA 4OP8A 3IWOA 5FAQA 3AGDA 2E8IA 1YQSA 5AQ9A 4A5RA 4BD0A 3MXRA 4JBFA 4JF4A 3E2LA 3M2KA 4DE0A 3UDFA 5HX9A 5E2GA 2JBFA 3V3RA 3QNCA 3PBNA 2XF3A 4JPMA 2UWXA 2ZC4B 5HL1A 5CGXA 2Y2QA 1YT4A 1BSGA 5I94A 3RXXA 1H8YA 2WZZA 2VGJA 3FKWA 1XXMA 2ZM8A 3VMAA 4PM9A 1L0DA 4E3OA 3MZDA 3IT9A 2JCHA 1WE4A 4DXCA 5L2FA 4LV2A 1K57C 1JWZA 2ZQ8A 4WMCD 1KE4A 3S4XA 5F1FA 2ZC3B 1CEFA 4N9KA 1L0GA 4GD6A 3ZG0A 5E2EA 4OLGA 1JTGA 1ES5A 1MWUA 1K4EA 2ZC5B 5AQBA 5DVAA 5GLAA 3N8LA 2WYXA 3ZFZA 1XGIA 1E3UD 2XD1A 4KG5A 4DKIA 1XX2A 5CTMA 1ESIA 1YLJA 3IWIA 4QU3A 1XKZA 5E2HA 1CEGA 1ERQA 2WAEA 4FH4A 5FQKA 1PW8A 3CMZA 4CJNA 1KE3A 2EXAA 4WM9A 3VP4A 3Q7ZA 1GA0A 1L0FA 1PW1A 5HFOA 4MBHA 3PBTA 4HESA 2P74A 3M2JA 5EPHA 3SS4A 2EX8A 2RCXA 4OQHA 3UO9A 3BFGA 3EQUA 3QHYA 3NI9A 4GN2A 4UA9A 4JXSA 5FI7A 4BENA 4EUZA 2XFTA 3FYZA 1L0EA 1K55C 5CGSA 3OPPA 1YLTA 3N4IA 3LEZA 1TVFA 4E3KA 4E6XA 1W8YA 3OPLA 5CECA 1O07A 1ZG6A 1BZAA 3IXDA 4KZ4A 3N8SA 1KDSA 4JKTA 3VSKA 2J9PA 4DDYA 2H10A 3PAEA 3G35A 4KZ7A 3V3SA 4Y0TA 2ZMAA 4R4SA 2BLSA 1TEMA 3O3VA 1YLWA 2XFSA 3M6HA 3N6IA 3GTCA 4Y0OA 4PMAA 3Q82A 2ZC6B 2ZM0A 3IF6C 2ZQ7A 2WKEA 3IF5A 4NK3A 4R3BA 4U0XA 4BL3A 5FASA 1FCNA 2HDUA 2BG1A 2HDQA 2Y2HA 3QNBA 4IEDA 1NJ4A 3IH8A 3Q7VB 1DJAA 4O7DA 3WS0A 3ZVWA 4HEFA 1FSYA 1MY8A 4K0WA 4S2MA 3AGEA 4X55A 4DE1A 3NCKA 1H5XA 4BD1A 2Y2MA 3MKFA 3OCNA 1ALQA 1PI4A 1XPBA 3HLEA 5CERA 2EFUA 1KGGA 4N1HA 4XXRA 1LHYA 3DTMA 3HREA 5TFQA 1NXYA 4RX2A 4RA7A 3G34A 3LY3A 1K57A 5F82A 1NZUA 2OLUA 3WRZA 4YFMA 1FSWA 3G32A 4N92A 1NRFA 4F94A 1ZG4A 2GDNA 2X71A 1IKIA 3VOZA 4KZ5A 2WGWA 1NZOA 2Y59A 4GB7A 1JTDA 1BLCA 1XGJA 4RYEA 3B3XA 5DF8A 4GNUA 2DNSA 3A3JA 3NBLA 4UA6A 2C5WB 2V20A 3SH8A 1U60A 1CK3A 4EBLA 4WZ5C 1JWPA 1FR1A 1PZPA 4ZAMA 2OV5A 1W7FA 1BTLA 5FQMA 3VOYA 1W8QA 3CJMA 3VP0A 3UNWA 4R1GA 3A3FA 4GZBA 2J9OA 2P9VA 3OC2A 5DF7A 4E3MA 4OPZA 1ONHA 5HW3A 1K6RA 3GRJA 4UAAA 4UA7A 1MWSA 2HP9A 4Y7PA 1N9BA 4PM8A 2X01A 1SDNA 2WADA 1YM1A 4P87A 4FH2A 4H8RA 4EQIA 1WYCA 3G30A 1E3UA 1DY6A 1K4FA 4R3JA 5FI2A 2OLVA 4S2OA 1KVLA 3GMWA 5CHUA 4KZAA 3RJUA 2JE5A 4JLFA 4C6YA 3C7UA 1K54C 4LV3A 2EX9A 3BFCA 3NDEA 5A91A 4ZDXA 2XD5A 4QD4A 4WYYA 5FI6A 1S0WA 2Y2IA 5HAQA 1DJCA 4PPRA 4K91A 3PTEA 3IH9A 3BM6A 1H8ZA 2JC7A 4HBTA 4OONA 4FD8A 2FFYA 1MWTA 3IXHA 5CEBA 3NY4A 4B4ZA 1IELA 5GLDA 2A3UA 4S2PA 3S1YA 1BULA 1JVJA 1N4OA 2Q9MA 2WK0A 2ZLYA 1PI5A 4JXGA 2FFFB 4WBGA 1G6AA 3PBQA 4R4RA 2EFXA 1IKGA 4PM5A 1S6RA 1KVMA 1BLHA 2DCFA 3IWQA 4GDBA 5IHVA 5A93A 2Y2JA 4DDSA 4OOYA 2PBYA 2XQZA 2WGVA 3IXGA 4GKUA 4OLDA 5JYOA 1ES4A 3IF6A 5CTNA 3W4QA 4KZ8A 4BJPA 4FCFA 1JWVA 2RL3A 2C6WB 3GVBA 1GCEA 4PM6A 5EVID 1C3BA 3BFDA 4N9LA 5TGFA 4WELA 5FQQA 2Y55A 4S2LA 4QHCA 2XH9A 5TR7A 5HARA 3MBZA 4DXBA 3LY4A 2Y4AA 4KZ9A 4P85A 4QB8A 1YLYA 3UN7A 2WZXA 5CHJA 2J7VA 2OSUA 3GQZA 3IQAA 4U0TA 4E3IA 2WKHA 1GHMA 1YLZA 2WAFA 4QY5A 3NIAA 3TG9A 5E43A 4GD8A 4KZ6A 3W4PA 2IWDA 2CC1A 3UE1A 4LCMA 5EOEA 3O88A 2Y2NA 4DRTA 4S2IA 3ZG9B 1TDGA 5CEDA 3C4PA 3DWKA 4OQGA 4KG6A 2EXBA 3SH7A 4OPRA 1PWCA 4OH0A 2XLNA 3HLDA 4PM7A 2G2UA 3A3IA 3VP1A 1BT5A 1I2SA 1XA1A 1RGZA 1K54A 3PAGA 5G18A 3TOIA 5KZHA 3UPPA 3ZG5A 4MBKA 3ZVTA 4U3TA 4QY6A 3VP2A 5KMWA 4S2NC 4UHUA 3I7JA 1NYYA 4D2OA 1LLBA 3IF6B 4YINA 3M6BA 4ZJ2A 4ID4A 4DF6A 4WZ5A 5CHMA 4X68A 1FCMA 2ZC7A 1I2WA 1PZOA 1L2SA 4KG2A 1SDEA 4WEKA 1VM1A 5AQAA 3VFHA 4DE3A 4EWFA 5E2FA 2XDMA 1PIOA 2R9XA 1CI9A 2WGWB 3WS4A 4IBXA 1GA9A 5D3OA 5F83A 1ES3A 4DE2A 1BLPA 4ZJ1A 3P98A 3ZHHA 2G2WA 4Y0UA 2QPNA 2XR0A 3C7VA 1IYSA 3ZDJA 1XA7A 3PBSA 4CPKA 3WRTA 1Z6FA 4S2JA 4LCLA 3BYDA 4Q8IA 3OPHA 4IVIA 3NDGA 3BEBA 4E6WA
chains in the Genus database with same CATH superfamily
5GLCA 4KQQA 1SHVA 5HL6A 5FAPA 2J8YA 2OWHA 4MEZA 2ZQCA 2HP5A 4NXEA 4WMCA 2D02A 4M3KA 3CG5A 4IVKA 1S67L 2XGNA 4OVDA 3HL9A 5K5BA 3MXSA 4R38A 2NUTC 4WLAA 1SKFA 3DBAA 3F1PB 2A49A 1LT0A 5EFWA 3O5YA 3BECA 5GL9A 2ZQDA 4FUWA 3RXWA 4C3QA 4NXFA 4E3NA 1E4DA 3HLCA 5J8XA 4OOLA 4IBRA 1RGYA 4CLCE 4QJGA 4HJ4A 4EEPA 3ZGAB 1IYOA 2V1ZA 2V2FF 3MZFA 3KX0X 2QZ6A 5TJJA 4ARZA 1T1AA 1HTZA 4RVAA 2I72A 3LIDA 5CXWA 2IWCA 2VGLM 1EW0A 2XROA 3OPRA 3CWFA 5GHXA 1IEMA 1YMXA 3HLGA 1N9LA 2JKTM 1YSPA 1TS7A 1MWRA 3OCLA 3QP1A 5AJGA 4EBPA 4OP5A 5L10A 2HP6A 4K08A 3IX3A 1O7EA 2XK1A 4R23A 2ZOIA 3C8CA 3UMEA 5IT5A 1GHIA 3E0YA 3VSLA 1T1BA 2XEPA 4F3LA 3HLWA 1Y54A 1VQQA 4XUZA 3JVVA 3CUEC 1DP9A 5TBMB 4HIAA 1ES2A 3Q1FA 4KZ3A 3R4KA 3DAVA 5GLBA 1TF1A 4KZBA 2ZMVA 4MCWA 1D1JA 1XJ3A 4WZ4A 4L0LA 1N9OA 2O9AA 3EEHA 1UGUA 2Y2PA 2FZ0A 3EOIA 2VLGA 1ERMA 3BFFA 2Y91A 4UQIS 3FWLA 1KE0A 3IHBA 1LI0A 3FC7A 5A90A 4Y13A 3MQOA 3C38A 1BUEA 4OP8A 2BASA 2E8IA 1YQSA 3MXRA 4JF4A 3B33A 2JBFA 2MJ6A 2XF3A 3MJQA 5IS1A 5CGXA 2WZZA 1T19A 3MZDA 3IT9A 5L2FA 1K57C 1JWZA 4WMCD 1D7EA 4EUVA 5TBMA 3SZTA 3F1NB 3QP6A 3EGXC 1K4EA 5AQBA 5DKKA 1XGIA 2XD1A 4KG5A 3KSFA 1XX2A 2O9CA 1XKZA 5F69A 3Q7ZA 1GA0A 3EQUA 3QHYA 3NI9A 4P6ZM 1SKOB 4JXSA 4EUZA 2XFTA 3RTYA 1K55C 3JVUA 1YLTA 1TVFA 4Q0JA 4DN0A 4GJ4A 1ZG6A 1BZAA 3P01A 2WKRA 3MMHA 4KZ7A 1TEMA 3CAXA 1YLWA 3O3VA 2L0WA 4I5SA 4Y0OA 2ZM0A 3IF6C 4U0XA 5FASA 1S4RA 2HDUA 2Z6DA 2Y2HA 1NJ4A 2GNXA 4K0WA 1IOUA 5G4YA 2Y2MA 3MKFA 3GDIA 3U2AA 2BTFP 5TFQA 1PNEA 1NXYA 1OTBA 4JGPA 3WRZA 1VETA 4BBVA 1XJ2A 2KLIA 1OTDA 3E4PA 3HCYA 2JHEA 1N9NA 4R6LA 3VOLA 3PYPA 1BLCA 2JKRM 2V1AA 4RYEA 2J3TD 5HSQA 5L8MA 4Y17A 2V20A 3SH8A 2W1TB 4ESPA 1PZPA 1W7FA 5FQMA 3CJMA 3VP0A 3A3FA 4GZBA 2QJ7A 2P9VA 3OC2A 5HW3A 3EEAA 2P7JA 1K6RA 4Y7PA 3GECA 3FPWA 1T18A 1E3UA 1DY6A 4S2OA 1KVLA 4C6YA 2JE5A 4JLFA 1K54C 4LV3A 2K31A 3H7WB 2XD5A 3E4OA 2Y2IA 1P0ZA 4YOFA 2XRNA 2QHKA 3BQ8A 3CITA 1H8ZA 2JC7A 4OONA 4FD8A 5CEBA 4MN7A 3D3OA 5GLDA 2A3UA 1N4OA 2WK0A 2ZLYA 2A24B 1S66L 2EFXA 1IKGA 3IWQA 5A93A 2PBYA 2WGVA 4AFIA 4GKUA 3NHQA 4BJPA 5DKLA 4FCFA 4GS9B 2Y55A 4S2LA 2XH9A 1XJ6A 5TR7A 2VKSA 3LY4A 1FIKA 4HJ3A 4QB8A 3T4JA 2O9BA 4U0TA 2OSUA 4E3IA 2WKHA 1YLZA 4QY5A 4GD8A 5EOEA 2QWSA 4EETB 1TDGA 3MR0A 5CEDA 3C4PA 3IX4A 3DWKA 4KG6A 3SH7A 1PWCA 1STZA 4OH0A 1BT5A 3PAGA 3TOIA 5KZHA 3ZVTA 2EA9A 4U3TA 3VP2A 5KMWA 4S2NC 5KIZA 4D2OA 1NYYA 1LLBA 1FILA 4ZJ2A 4DF6A 2XA7M 5CHMA 2ZC7A 1PZOA 2B18A 1UWPX 4DE3A 4EWFA 5E2FA 3EWKA 2XDMA 4BBTA 1PIOA 2WGWB 1IFQA 5F83A 4LFUA 1BLPA 4ZJ1A 2XR0A 1P97A 3ZDJA 3PBSA 1Z6FA 1H3QA 4Q8IA 4IVIA 3BEBA 3HUOA 3CZDA 2WGIA 3T4LA 1QMEA 4G3KA 1HD8A 1W5DA 3V39A 1ACFA 2QMIA 4H6JB 3A3EA 1M40A 1CF0A 4KQDA 5HWTA 4P0MA 2JKFA 4LV1A 2PRFA 4N1XA 1QMFA 3LGOA 3G31A 3BLSA 1ZC2A 4OQ0A 2QJ5A 2WKIA 4LV0A 5EVIB 1ESUA 4UQIM 5FATA 3A0VA 3KSIA 5A92A 1OMEA 3G6OA 5EECA 3DTEA 3LFVA 3LIAA 4OPQA 4L9EA 5M1AA 5GHYA 3IBRA 3D4FA 2ZL1B 3MKEA 4DMZA 2ZD8A 2PYRA 3E2KA 2PU4A 1PWDA 1VEUB 5DF9A 2OOLA 3E98A 3CLOA 3WS5A 1FCOA 4S2KA 3T1XA 3B42A 1IYPA 1TD5A 2ZL1A 5L07A 1EI5A 3MZEA 4OOMA 3UE0A 1OTAA 3LO7A 3C4OA 2H0TA 3IXBA 3PBRA 2HDSA 1Q2QA 1Y28A 5M18A 3LUQA 5G4ZA 2EX2A 5U47A 1DJBA 2I9VA 4FTXA 1HVBA 2H5SA 3N7WA 4BL2A 1P9WA 4DJ2A 1LL9A 1K25A 4C75A 3IHAA 1WA9A 1MPLA 3SOIA 4JF6A 3MFDA 3ZNTA 3N8RA 1JNUA 2Y2OA 3ISGA 1T1CA 1ZHHB 4Q0IA 1K56A 1KGEA 1K56D 4PAUA 1BLSA 4E3LA 3DTIA 5EOOA 3UB6A 4HJ6A 2OWJA 5FQ9A 2PT7A 5HD5A 3LR0A 4OKPA 5EVIA 2B95A 4ZTKA 2EWVA 2ZQAA 2DRWA 2Q9NA 1RP5A 3H9WA 5HPIA 4B88A 5F6AA 1ZKJA 2EWWA 5KSCA 3TJZC 5FAQA 4MDZA 3AGDA 4A5RA 3OLOA 4JBFA 4DE0A 5C5KA 2UWXA 2YKHA 1YT4A 1BSGA 1KOUA 5FEFA 3T4OA 4E3OA 2VV8A 2WKQA 3F1OB 3MXQA 4LV2A 2XSSA 1KE4A 4GD6A 2W3GA 4GHIB 1MWUA 4F3LB 5GLAA 2ZOHA 4HH3A 1BYWA 3IWIA 2WAEA 3CMZA 3LICA 3VP4A 3QP8A 3SS4A 3UO9A 4GN2A 4UA9A 3W2ZA 2HJ9C 4BENA 2Q0OA 3A0SA 1L0EA 5CGSA 4FOFA 2Y8HA 4E3KA 3OPLA 5HWVA 2JKTI 1O07A 3IXDA 3S7NA 2PHYA 3PAEA 3G35A 4WN5A 3V3SA 4R4SA 2W1RA 3N6IA 3M6HA 3Q82A 2IA2A 1MC0A 2WKEA 4R3BA 4BL3A 4IJGA 2BG1A 4X1MA 4Y15A 3QNBA 4IEDA 1DJAA 4S2MA 2CMNA 3NCKA 5CERA 1ALQA 3HLEA 2EFUA 3HJIA 4N1HA 3DTMA 1SKOA 4UEYA 4RA7A 1K57A 4BMWA 2OLUA 3G32A 5HD3A 5AVFA 4E04A 4HY8A 3LYXA 1S1ZA 1XGJA 5DF8A 3NBLA 3MS6A 4KUKA 1CK3A 4WZ5C 1YAXA 4HNBA 1S4SA 1JWPA 2OV5A 4Y5FA 3H7WA 1W8QA 2HJEA 1GSVA 3UNWA 4R1GA 4CLCD 2J9OA 2HP9A 4PM8A 1SDNA 3T50A 1YM1A 4FH2A 5J7EA 5HDCA 2VZWA 5J4EA 1K4FA 4R3JA 4HOIA 4LLOB 2EX9A 2HZ5A 3NDEA 5FI6A 1S0WA 5LBRA 4PPRA 3IH9A 3BM6A 3K3CA 3IXHA 4B4ZA 4S2PA 1BULA 2Q9MA 1PI5A 4JXGA 3K3DA 1ZTUA 4GS9A 4WBGA 4R4RA 2M7UA 2VX8A 4PM5A 4GDBA 4DDSA 4OOYA 3H82B 5JYOA 5CTNA 3W4QA 2K7SA 4KZ8A 4ETZA 2C6WB 4PM6A 2PR5A 4O01A 3BFDA 5TGFA 3BY8A 4QHCA 3V67A 5HZHA 5HDSA 2Y4AA 1V9ZA 2VGLS 4GHIA 2YKFA 5FL3A 5CHJA 2J7VA 3GQZA 4PKYA 1GHMA 5FEGA 5E43A 4KZ6A 3W4PA 2IWDA 1G6OA 4LCMA 1XFQA 4S2IA 3ZG9B 4ETXA 2HF6A 2VK3A 4OPRA 3VP1A 3A3IA 1I2SA 1RGZA 3ZG5A 1W63M 3I7JA 3IF6B 3L9KA 1OPXA 1X0OA 4WEKA 3VFHA 1VM1A 5AVEA 1CI9A 1D06A 1ES3A 4GLQA 4IHQA 4Y0UA 3NULA 4NG2A 3WRTA 2DMWA 4HQAA 4Y2FA 5L09A 1YMSA 4MBFA 5DTKA 4EU0A 2FH5A 3GSGA 2UV0E 1F2KA 4X25A 3L7HA 1J9MA 1PYYA 2WKPA 4ZBEA 4X53A 1GHPA 1PWGA 3PBOA 5F68A 1IYQA 1TS6A 3BFEA 1K38A 4JF5A 2Y2GA 4KENB 3UY6A 3ITBA 3WS2A 1DP8A 4NETA 5I5LA 1TS8A 3T4KA 4ME4A 1WYBA 2INWA 3FKVA 2H28A 1RCJA 5FDHA 3ZG8B 3SH9A 2HDRA 3ZYTA 5EVLA 3A3DA 1SCWA 3P09A 3WS1A 3BRMA 4LRXC 3FPVA 4RX3A 2GJ3A 1XFNA 1K6SA 4ZJ3A 3VFFA 3Q81A 1KDWA 2PBDP 3PHYA 2PDRA 3C5AA 3UDXA 3Q07A 1LI9A 2ZM2A 4WL9A 5CRFA 3HUMA 5AQ7A 5EVIC 4S2NA 2PU2A 1FQGA 3SS3A 3BY9A 5CGWA 1OJ5A 5KSHA 1Q2PA 1I5QA 3UMDA 1F5MA 1ONGA 3AGFA 1E25A 3ICYA 2H0YA 2R9WA 1LSWA 2P9VB 1AWIA 2PR6A 4G3WA 3H82A 1MKIA 3FZCA 3UE3A 2Y2LA 4MNRA 5HPFA 1J3WA 2L1MA 3BW6A 2V9AA 2HGVA 4Z9QA 3UPNA 3PR6A 3G4PA 2L4RA 3NC8A 4OQIA 1EROA 2Y2KA 5HAIA 4LGWA 1VETB 5M19A 4I3JA 2W3DA 5F1GA 5FQIA 1MBLA 4LPZA 5DTSA 3OZHA 4MN5A 1K0KA 5FQJA 3ZNYA 4B9OA 2KX6A 2J80A 4XUXA 4X6TA 2Z2MB 2WUQA 3V5MA 5EUAA 2XA7S 2GX5A 3DW0A 3HLBA 3LR5A 3E4QA 3ZG7B 4X69A 2QKPA 3CUEA 1W63Q 3NOPC 2W3HA 4FSFA 3FG8A 1PFLA 2PD7A 3T4SA 4H6JA 1YPRA 3V3RA 3QNCA 3IX8A 3PBNA 4JPMA 5HWWA 2ZC4B 5HL1A 4YNRA 3LI8A 3K2NA 3A0RA 1XXMA 2ZM8A 4PM9A 2JCHA 3MQ0A 4DXCA 2VV7A 3R7WA 4BWIA 1CEFA 5E2EA 1JTGA 2W1TA 1ES5A 2A24A 2ZC5B 4ZRRA 5DVAA 3N8LA 2WYXA 3MSHA 4NXBA 3LR4A 5CTMA 1ESIA 1YLJA 4QU3A 3WS4A 4FH4A 2M1CA 5FQKA 1H0MA 3D72A 1KE3A 1PW1A 5HFOA 3PBTA 3PXPA 2D01A 2P74A 4HESA 5EPHA 2EX8A 2RCXA 4OQHA 5FI7A 3FYZA 3OPPA 2PAVP 5CECA 2V8CA 1LSXA 1KDSA 1F9IA 3VSKA 3VE3A 4Y0TA 3S7PA 2ZMAA 2BLSA 4EXOA 3GTCA 5DFXA 1Z09A 2ZQ7A 4NK3A 1MKMA 4ARZB 2HDQA 3IH8A 4NKPA 1FSYA 1MY8A 4IUKA 4X55A 4DE1A 1H5XA 1XPBA 2VV6A 1KGGA 1LHYA 3NOTC 3R7WB 4RX2A 1OJGA 3G34A 1NZUA 4MN6A 1FSWA 4N92A 1NRFA 1ZG4A 2GDNA 2X71A 5DJUA 4R70A 1IKIA 2K2NA 2VA0A 2Y59A 4GB7A 1JTDA 3IS2A 5DFYA 3B3XA 3VE4A 1P9RA 3F1PA 4D60A 4UA6A 1YSQA 2C5WB 3CHWP 1OTEA 3DTKA 3NOUC 2R78A 3SW1A 2ZMFA 1FR1A 1G5UA 3TE8A 1VB6A 3VOYA 1ONHA 4UAAA 3IBJA 1N9BA 5HDDA 2X01A 4HI4A 1ODVA 2WADA 4H8RA 5MC7A 4EQIA 4JGOA 1NLZA 4II7A 3C7UA 3KYEA 2W27A 3BFCA 4BBUA 2JN7A 4QD4A 1DJCA 4JGQA 5EM1A 4K91A 3QP2A 3UB5P 3LI9A 2QYBA 1IELA 1JVJA 2LB5A 3T1QB 1V9YA 3PBQA 1KVMA 2DCFA 5IHVA 2ACGA 3IXGA 4CQHA 4IUHA 2W3EA 1NWZA 3CI6A 5EV0A 3GVBA 3S7QA 1F98A 4HH2A 1C3BA 4N9LA 4WELA 5FQQA 1Y4OA 4I3AA 5HARA 3MBZA 4GCZA 3F1NA 3VV4A 2WAFA 3TG9A 2CC1A 3UE1A 2Y2NA 3MF0A 4DRTA 2V8FA 1HLUP 2AVXA 4OQGA 1XA1A 3KSHA 3UPPA 4MBKA 3RH8B 4YINA 4ID4A 4I39A 1FCMA 2E8JA 1L2SA 3C2WA 5AQAA 3UB7A 3UB8A 1GA9A 2V0UA 1LL8A 3ZHHA 2QPNA 3C7VA 1IYSA 4PKYG 4CPKA 2O0YA 4S2JA 4LCLA 3BYDA 4OLGA 3NDGA 3UDIA 1S1YA 1HZOA 2B5RA 4X56A 4EEUA 4KQRA 1YLPA 3GR2A 3BJNA 2Z6CA 3EGDC 4YWZA 2NUPC 4P6ZS 2VGKA 2P04A 4R0QA 4MMNA 4LENA 5HAPA 3O86A 2P08A 4MLLA 4QWOA 3BWLA 3LR3A 3FV7A 3B47A 4NEED 4OPYA 1MZUA 3NECA 4DJ3A 3BLMA 3EQVA 3ULFA 2ZQ9A 4L9GA 4NXGA 3HUNA 5FSRA 4R3AA 2PYPA 3JYIA 3C30A 1A0KA 1NLYA 4HHDA 1NY0A 3HJKA 4EBNA 3HBRA 3KYZA 4HP9A 3TSGA 3G2ZA 4JGRA 2B02A 1OT6A 4E3JA 4I3IA 1M6KA 2IWBA 3S7OA 4GW9A 3HLFA 1MXOA 4O8GA 3S22A 2EX6A 4X1LA 3QP5A 5FAOA 5JYPA 1XP4A 5EE8A 2Z2LB 3HVFA 4JXWA 5IU1A 4BLMA 1TDLA 3KYQA 3UPOA 1CJFA 5DTTA 4Q0HA 4I38A 4O0PA 3ZCZA 2A2LA 4LRZE 1W79A 1EWZA 4M4XA 3W4OA 4GDNA 2V1BA 1FR6A 2OAP1 3TW8A 4BQMA 1NYMA 4JXVA 5DJTA 3WWXA 1VHMA 4K0XA 4WEJA 4HBUA 1NRJA 3G2YA 2X02A 4GOGA 4WUJA 1G68A 3KSGA 4KQOA 3ITAA 5FA7A 1AXBA 1K55A 3V50A 3VP3A 3LCEA 5GHZA 3Q7VA 1LSVA 3KO6A 1FOFA 2HPBA 3W8KA 5BOHA 4EV4A 4CLCB 3GV9A 1KGFA 4B4XA 1CI8A 1LL5A 2HV1A 2JKGA 2V0WA 4G3VA 4P6BA 1SZVA 2GZAA 3SS5A 3TRCA 3DWZA 2ZJ9A 4CLCA 3IWOA 5AQ9A 4BD0A 3E2LA 3M2KA 3UDFA 5HX9A 5E2GA 1GSXA 2Y2QA 5I94A 3RXXA 1H8YA 2VGJA 3FKWA 2KDKA 3VMAA 1L0DA 3UE6A 5FDSA 1WE4A 2ZQ8A 4XT2B 3S4XA 3UB9A 5F1FA 2ZC3B 4N9KA 1L0GA 3ZG0A 1DP6A 1UWNX 3ZFZA 2VJWA 1E3UD 4DKIA 3IS2B 1YKDA 1CQAA 4EW7A 2W0NA 5E2HA 1CEGA 1ERQA 1PW8A 2OAQ1 4CJNA 2EXAA 4WM9A 1L0FA 4MBHA 3M2JA 3BFGA 4B93A 3T4QA 5J3WA 3N4IA 3LEZA 4E6XA 1W8YA 4KZ4A 3MFXA 1XJ4A 3N8SA 4JKTA 2J9PA 4DDYA 1GSWA 2H10A 2XFSA 4PMAA 2ZC6B 1OT9A 3IF5A 1FCNA 3CPTA 2LB9A 3RFBA 3P7NA 1H8MA 3Q7VB 4O7DA 3WS0A 4Z1WA 3ZVWA 4HEFA 3MQQA 3AGEA 1L3LA 4KUOA 4BD1A 3OCNA 1PI4A 4XXRA 3HREA 4QPRA 3BQAA 3LY3A 5F82A 4YFMA 4PHTA 4F94A 5A8BA 3VOZA 4KZ5A 2WGWA 1NZOA 5EM0A 4GNUA 2DNSA 3QP4A 3A3JA 2KOIA 1OTIA 2G7UA 3CPTB 1U60A 4Y3IA 4CLCC 4EBLA 3JPUA 5F5YA 4ZAMA 3T4TA 1BTLA 4XT2A 4E3MA 5DF7A 4OPZA 3GRJA 4UA7A 1MWSA 2J3TC 3LIFA 3T1SA 4P87A 1WYCA 3G30A 3T1RA 5FI2A 2OLVA 3GMWA 1DRMA 5CHUA 1TS0A 4KZAA 3RJUA 5A91A 4ZDXA 3LIEA 4HP4A 4WYYA 3U4LP 5HAQA 3ZQ5A 3PTEA 4HBTA 2FFYA 1MWTA 3NY4A 3S1YA 2O99A 2VEAA 1G28A 2JKRI 2FFFB 4EERA 1G6AA 1S6RA 1BLHA 2Y2JA 2XQZA 4OLDA 1ES4A 3IF6A 4L9FA 4WF0A 1JWVA 2RL3A 3LEQA 1GCEA 3OOVA 5EVID 3OBFA 4EQ1A 4DXBA 4P85A 4KZ9A 2W3FA 1YLYA 3UN7A 2WZXA 3IQAA 1PRQA 3NIAA 2PD8A 3D9YA 4RQ9A 3O88A 2ZBBA 2J3WA 1VEUA 2EXBA 4LRYC 5EVEA 2XLNA 3HLDA 4PM7A 2G2UA 3NJAA 1K54A 5G18A 3T12B 4QY6A 5CX7A 4UHUA 3M6BA 4WZ5A 4X68A 1I2WA 2Y79A 4KG2A 1SDEA 4EESA 2R9XA 2M7VA 4IBXA 5D3OA 4DE2A 3P98A 2G2WA 3LIBA 1XA7A 3F1OA 3OPHA 3O87A 4E6WA
chains in the Genus database with same CATH topology
3UDIA 3HUOA 5GLCA 3CZDA 2WGIA 4KQQA 1SHVA 1YMSA 4MBFA 1QMEA 5DTKA 2B5RA 1HZOA 4X56A 1HD8A 5FAPA 2J8YA 1W5DA 4KQRA 1YLPA 3V39A 2QMIA 3A3EA 3GSGA 3GR2A 1M40A 4MEZA 2ZQCA 4P0MA 1J9MA 1PYYA 2HP5A 4LV1A 2VGKA 4N1XA 4ZBEA 1QMFA 4WMCA 4X53A 1GHPA 1PWGA 3PBOA 4R0QA 4LENA 1IYQA 5HAPA 4M3KA 3CG5A 3G31A 4IVKA 3BFEA 1K38A 3BLSA 3O86A 4JF5A 2Y2GA 2XGNA 4KENB 4OVDA 3UY6A 3ITBA 1ZC2A 4OQ0A 4LV0A 2WKIA 5EVIB 1ESUA 3HL9A 3WS2A 5FATA 4MLLA 4NETA 3MXSA 3FV7A 4OPYA 1WYBA 5A92A 1OMEA 1SKFA 3BLMA 3FKVA 5EECA 3EQVA 1RCJA 5FDHA 3ZG8B 2A49A 3SH9A 2HDRA 2ZQ9A 5EVLA 3A3DA 1SCWA 3P09A 3BECA 3WS1A 3HUNA 5GL9A 2ZQDA 3BRMA 3RXWA 4OPQA 4C3QA 4E3NA 5M1AA 1E4DA 5FSRA 5GHYA 3HLCA 3JYIA 5J8XA 4RX3A 3D4FA 4OOLA 4IBRA 3MKEA 1RGYA 4QJGA 2ZD8A 1NY0A 4EBNA 1K6SA 3ZGAB 3HBRA 3E2KA 1IYOA 4ZJ3A 3VFFA 3Q81A 1KDWA 2PU4A 2V1ZA 1PWDA 3TSGA 2V2FF 5DF9A 3MZFA 3C5AA 3G2ZA 2QZ6A 3WS5A 3UDXA 3Q07A 1LI9A 1FCOA 2ZM2A 4S2KA 5CRFA 3HUMA 5AQ7A 5EVIC 4E3JA 1HTZA 4S2NA 1M6KA 2PU2A 1FQGA 1IYPA 2IWBA 3SS3A 1EI5A 4RVAA 3HLFA 1MXOA 3MZEA 2I72A 4OOMA 5CXWA 3S22A 2IWCA 2EX6A 3UE0A 5FAOA 5JYPA 5CGWA 1XP4A 3LO7A 3C4OA 3OPRA 5EE8A 5KSHA 1Q2PA 2H0TA 2Z2LB 3HVFA 3IXBA 3PBRA 4JXWA 4BLMA 1TDLA 1I5QA 2HDSA 1Q2QA 3UPOA 5GHXA 1IEMA 1YMXA 5M18A 3HLGA 2EX2A 1ONGA 5U47A 1DJBA 5DTTA 3AGFA 1E25A 1HVBA 2H5SA 3N7WA 3O87A 1MWRA 4BL2A 2H0YA 3OCLA 2R9WA 3ZCZA 4EBPA 4OP5A 1LL9A 2P9VB 1K25A 1W79A 4C75A 1EWZA 2HP6A 3IHAA 1MKIA 3FZCA 4GDNA 3UE3A 2Y2LA 1O7EA 1FR6A 4MNRA 2XK1A 3W4OA 4R23A 1MPLA 3SOIA 4JF6A 3UPNA 4Z9QA 4BQMA 3MFDA 3ZNTA 3N8RA 1GHIA 1NYMA 4JXVA 2Y2OA 3G4PA 3VSLA 2XEPA 3WWXA 3HLWA 1Y54A 1VQQA 3ISGA 3NC8A 4K0XA 4XUZA 1K56A 4OQIA 1KGEA 4WEJA 1K56D 1ES2A 4HBUA 1EROA 2Y2KA 5HAIA 1BLSA 3Q1FA 4KZ3A 4E3LA 3G2YA 2X02A 5GLBA 5M19A 5EOOA 4GOGA 1G68A 5F1GA 5FQIA 4KZBA 1MBLA 5DTSA 4KQOA 3OZHA 4WZ4A 3ITAA 4L0LA 5FA7A 5FQJA 1AXBA 1K55A 3V50A 3VP3A 5FQ9A 3LCEA 3ZNYA 5GHZA 3Q7VA 2Y2PA 1FOFA 2HPBA 4XUXA 3W8KA 5BOHA 4EV4A 4X6TA 1ERMA 4OKPA 5EVIA 3GV9A 4ZTKA 2Z2MB 3BFFA 2WUQA 2Y91A 2ZQAA 1KGFA 3FWLA 3V5MA 4B4XA 1KE0A 1CI8A 1LL5A 5EUAA 3IHBA 2DRWA 2Q9NA 1LI0A 4P6BA 3DW0A 1RP5A 3HLBA 3SS5A 5A90A 3DWZA 3ZG7B 4B88A 1ZKJA 4X69A 5KSCA 1BUEA 2ZJ9A 4FSFA 4OP8A 3IWOA 5FAQA 3AGDA 2E8IA 1YQSA 5AQ9A 4A5RA 4BD0A 3MXRA 4JBFA 4JF4A 3E2LA 3M2KA 4DE0A 3UDFA 5HX9A 5E2GA 2JBFA 3V3RA 3QNCA 3PBNA 2XF3A 4JPMA 2UWXA 2ZC4B 5HL1A 5CGXA 2Y2QA 1YT4A 1BSGA 5I94A 3RXXA 1H8YA 2WZZA 2VGJA 3FKWA 1XXMA 2ZM8A 3VMAA 4PM9A 1L0DA 4E3OA 3MZDA 3IT9A 2JCHA 1WE4A 4DXCA 5L2FA 4LV2A 1K57C 1JWZA 2ZQ8A 4WMCD 1KE4A 3S4XA 5F1FA 2ZC3B 1CEFA 4N9KA 1L0GA 4GD6A 3ZG0A 5E2EA 4OLGA 1JTGA 1ES5A 1MWUA 1K4EA 2ZC5B 5AQBA 5DVAA 5GLAA 3N8LA 2WYXA 3ZFZA 1XGIA 1E3UD 2XD1A 4KG5A 4DKIA 1XX2A 5CTMA 1ESIA 1YLJA 3IWIA 4QU3A 1XKZA 5E2HA 1CEGA 1ERQA 2WAEA 4FH4A 5FQKA 1PW8A 3CMZA 4CJNA 1KE3A 2EXAA 4WM9A 3VP4A 3Q7ZA 1GA0A 1L0FA 1PW1A 5HFOA 4MBHA 3PBTA 4HESA 2P74A 3M2JA 5EPHA 3SS4A 2EX8A 2RCXA 4OQHA 3UO9A 3BFGA 3EQUA 3QHYA 3NI9A 4GN2A 4UA9A 4JXSA 5FI7A 4BENA 4EUZA 2XFTA 3FYZA 1L0EA 1K55C 5CGSA 3OPPA 1YLTA 3N4IA 3LEZA 1TVFA 4E3KA 4E6XA 1W8YA 3OPLA 5CECA 1O07A 1ZG6A 1BZAA 3IXDA 4KZ4A 3N8SA 1KDSA 4JKTA 3VSKA 2J9PA 4DDYA 2H10A 3PAEA 3G35A 4KZ7A 3V3SA 4Y0TA 2ZMAA 4R4SA 2BLSA 1TEMA 3O3VA 1YLWA 2XFSA 3M6HA 3N6IA 3GTCA 4Y0OA 4PMAA 3Q82A 2ZC6B 2ZM0A 3IF6C 2ZQ7A 2WKEA 3IF5A 4NK3A 4R3BA 4U0XA 4BL3A 5FASA 1FCNA 2HDUA 2BG1A 2HDQA 2Y2HA 3QNBA 4IEDA 1NJ4A 3IH8A 3Q7VB 1DJAA 4O7DA 3WS0A 3ZVWA 4HEFA 1FSYA 1MY8A 4K0WA 4S2MA 3AGEA 4X55A 4DE1A 3NCKA 1H5XA 4BD1A 2Y2MA 3MKFA 3OCNA 1ALQA 1PI4A 1XPBA 3HLEA 5CERA 2EFUA 1KGGA 4N1HA 4XXRA 1LHYA 3DTMA 3HREA 5TFQA 1NXYA 4RX2A 4RA7A 3G34A 3LY3A 1K57A 5F82A 1NZUA 2OLUA 3WRZA 4YFMA 1FSWA 3G32A 4N92A 1NRFA 4F94A 1ZG4A 2GDNA 2X71A 1IKIA 3VOZA 4KZ5A 2WGWA 1NZOA 2Y59A 4GB7A 1JTDA 1BLCA 1XGJA 4RYEA 3B3XA 5DF8A 4GNUA 2DNSA 3A3JA 3NBLA 4UA6A 2C5WB 2V20A 3SH8A 1U60A 1CK3A 4EBLA 4WZ5C 1JWPA 1FR1A 1PZPA 4ZAMA 2OV5A 1W7FA 1BTLA 5FQMA 3VOYA 1W8QA 3CJMA 3VP0A 3UNWA 4R1GA 3A3FA 4GZBA 2J9OA 2P9VA 3OC2A 5DF7A 4E3MA 4OPZA 1ONHA 5HW3A 1K6RA 3GRJA 4UAAA 4UA7A 1MWSA 2HP9A 4Y7PA 1N9BA 4PM8A 2X01A 1SDNA 2WADA 1YM1A 4P87A 4FH2A 4H8RA 4EQIA 1WYCA 3G30A 1E3UA 1DY6A 1K4FA 4R3JA 5FI2A 2OLVA 4S2OA 1KVLA 3GMWA 5CHUA 4KZAA 3RJUA 2JE5A 4JLFA 4C6YA 3C7UA 1K54C 4LV3A 2EX9A 3BFCA 3NDEA 5A91A 4ZDXA 2XD5A 4QD4A 4WYYA 5FI6A 1S0WA 2Y2IA 5HAQA 1DJCA 4PPRA 4K91A 3PTEA 3IH9A 3BM6A 1H8ZA 2JC7A 4HBTA 4OONA 4FD8A 2FFYA 1MWTA 3IXHA 5CEBA 3NY4A 4B4ZA 1IELA 5GLDA 2A3UA 4S2PA 3S1YA 1BULA 1JVJA 1N4OA 2Q9MA 2WK0A 2ZLYA 1PI5A 4JXGA 2FFFB 4WBGA 1G6AA 3PBQA 4R4RA 2EFXA 1IKGA 4PM5A 1S6RA 1KVMA 1BLHA 2DCFA 3IWQA 4GDBA 5IHVA 5A93A 2Y2JA 4DDSA 4OOYA 2PBYA 2XQZA 2WGVA 3IXGA 4GKUA 4OLDA 5JYOA 1ES4A 3IF6A 5CTNA 3W4QA 4KZ8A 4BJPA 4FCFA 1JWVA 2RL3A 2C6WB 3GVBA 1GCEA 4PM6A 5EVID 1C3BA 3BFDA 4N9LA 5TGFA 4WELA 5FQQA 2Y55A 4S2LA 4QHCA 2XH9A 5TR7A 5HARA 3MBZA 4DXBA 3LY4A 2Y4AA 4KZ9A 4P85A 4QB8A 1YLYA 3UN7A 2WZXA 5CHJA 2J7VA 2OSUA 3GQZA 3IQAA 4U0TA 4E3IA 2WKHA 1GHMA 1YLZA 2WAFA 4QY5A 3NIAA 3TG9A 5E43A 4GD8A 4KZ6A 3W4PA 2IWDA 2CC1A 3UE1A 4LCMA 5EOEA 3O88A 2Y2NA 4DRTA 4S2IA 3ZG9B 1TDGA 5CEDA 3C4PA 3DWKA 4OQGA 4KG6A 2EXBA 3SH7A 4OPRA 1PWCA 4OH0A 2XLNA 3HLDA 4PM7A 2G2UA 3A3IA 3VP1A 1BT5A 1I2SA 1XA1A 1RGZA 1K54A 3PAGA 5G18A 3TOIA 5KZHA 3UPPA 3ZG5A 4MBKA 3ZVTA 4U3TA 4QY6A 3VP2A 5KMWA 4S2NC 4UHUA 3I7JA 1NYYA 4D2OA 1LLBA 3IF6B 4YINA 3M6BA 4ZJ2A 4ID4A 4DF6A 4WZ5A 5CHMA 4X68A 1FCMA 2ZC7A 1I2WA 1PZOA 1L2SA 4KG2A 1SDEA 4WEKA 1VM1A 5AQAA 3VFHA 4DE3A 4EWFA 5E2FA 2XDMA 1PIOA 2R9XA 1CI9A 2WGWB 3WS4A 4IBXA 1GA9A 5D3OA 5F83A 1ES3A 4DE2A 1BLPA 4ZJ1A 3P98A 3ZHHA 2G2WA 4Y0UA 2QPNA 2XR0A 3C7VA 1IYSA 3ZDJA 1XA7A 3PBSA 4CPKA 3WRTA 1Z6FA 4S2JA 4LCLA 3BYDA 4Q8IA 3OPHA 4IVIA 3NDGA 3BEBA 4E6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDI A;  3HUO A;  5GLC A;  3CZD A;  2WGI A;  4KQQ A;  1SHV A;  1YMS A;  4MBF A;  1QME A;  5DTK A;  2B5R A;  1HZO A;  4X56 A;  1HD8 A;  5FAP A;  2J8Y A;  1W5D A;  4KQR A;  1YLP A;  3V39 A;  2QMI A;  3A3E A;  3GSG A;  3GR2 A;  1M40 A;  4MEZ A;  2ZQC A;  4P0M A;  1J9M A;  1PYY A;  2HP5 A;  4LV1 A;  2VGK A;  4N1X A;  4ZBE A;  1QMF A;  4WMC A;  4X53 A;  1GHP A;  1PWG A;  3PBO A;  4R0Q A;  4LEN A;  1IYQ A;  5HAP A;  4M3K A;  3CG5 A;  3G31 A;  4IVK A;  3BFE A;  1K38 A;  3BLS A;  3O86 A;  4JF5 A;  2Y2G A;  2XGN A;  4KEN B;  4OVD A;  3UY6 A;  3ITB A;  1ZC2 A;  4OQ0 A;  4LV0 A;  2WKI A;  5EVI B;  1ESU A;  3HL9 A;  3WS2 A;  5FAT A;  4MLL A;  4NET A;  3MXS A;  3FV7 A;  4OPY A;  1WYB A;  5A92 A;  1OME A;  1SKF A;  3BLM A;  3FKV A;  5EEC A;  3EQV A;  1RCJ A;  5FDH A;  3ZG8 B;  2A49 A;  3SH9 A;  2HDR A;  2ZQ9 A;  5EVL A;  3A3D A;  1SCW A;  3P09 A;  3BEC A;  3WS1 A;  3HUN A;  5GL9 A;  2ZQD A;  3BRM A;  3RXW A;  4OPQ A;  4C3Q A;  4E3N A;  5M1A A;  1E4D A;  5FSR A;  5GHY A;  3HLC A;  3JYI A;  5J8X A;  4RX3 A;  3D4F A;  4OOL A;  4IBR A;  3MKE A;  1RGY A;  4QJG A;  2ZD8 A;  1NY0 A;  4EBN A;  1K6S A;  3ZGA B;  3HBR A;  3E2K A;  1IYO A;  4ZJ3 A;  3VFF A;  3Q81 A;  1KDW A;  2PU4 A;  2V1Z A;  1PWD A;  3TSG A;  2V2F F;  5DF9 A;  3MZF A;  3C5A A;  3G2Z A;  2QZ6 A;  3WS5 A;  3UDX A;  3Q07 A;  1LI9 A;  1FCO A;  2ZM2 A;  4S2K A;  5CRF A;  3HUM A;  5AQ7 A;  5EVI C;  4E3J A;  1HTZ A;  4S2N A;  1M6K A;  2PU2 A;  1FQG A;  1IYP A;  2IWB A;  3SS3 A;  1EI5 A;  4RVA A;  3HLF A;  1MXO A;  3MZE A;  2I72 A;  4OOM A;  5CXW A;  3S22 A;  2IWC A;  2EX6 A;  3UE0 A;  5FAO A;  5JYP A;  5CGW A;  1XP4 A;  3LO7 A;  3C4O A;  3OPR A;  5EE8 A;  5KSH A;  1Q2P A;  2H0T A;  2Z2L B;  3HVF A;  3IXB A;  3PBR A;  4JXW A;  4BLM A;  1TDL A;  1I5Q A;  2HDS A;  1Q2Q A;  3UPO A;  5GHX A;  1IEM A;  1YMX A;  5M18 A;  3HLG A;  2EX2 A;  1ONG A;  5U47 A;  1DJB A;  5DTT A;  3AGF A;  1E25 A;  1HVB A;  2H5S A;  3N7W A;  3O87 A;  1MWR A;  4BL2 A;  2H0Y A;  3OCL A;  2R9W A;  3ZCZ A;  4EBP A;  4OP5 A;  1LL9 A;  2P9V B;  1K25 A;  1W79 A;  4C75 A;  1EWZ A;  2HP6 A;  3IHA A;  1MKI A;  3FZC A;  4GDN A;  3UE3 A;  2Y2L A;  1O7E A;  1FR6 A;  4MNR A;  2XK1 A;  3W4O A;  4R23 A;  1MPL A;  3SOI A;  4JF6 A;  3UPN A;  4Z9Q A;  4BQM A;  3MFD A;  3ZNT A;  3N8R A;  1GHI A;  1NYM A;  4JXV A;  2Y2O A;  3G4P A;  3VSL A;  2XEP A;  3WWX A;  3HLW A;  1Y54 A;  1VQQ A;  3ISG A;  3NC8 A;  4K0X A;  4XUZ A;  1K56 A;  4OQI A;  1KGE A;  4WEJ A;  1K56 D;  1ES2 A;  4HBU A;  1ERO A;  2Y2K A;  5HAI A;  1BLS A;  3Q1F A;  4KZ3 A;  4E3L A;  3G2Y A;  2X02 A;  5GLB A;  5M19 A;  5EOO A;  4GOG A;  1G68 A;  5F1G A;  5FQI A;  4KZB A;  1MBL A;  5DTS A;  4KQO A;  3OZH A;  4WZ4 A;  3ITA A;  4L0L A;  5FA7 A;  5FQJ A;  1AXB A;  1K55 A;  3V50 A;  3VP3 A;  5FQ9 A;  3LCE A;  3ZNY A;  5GHZ A;  3Q7V A;  2Y2P A;  1FOF A;  2HPB A;  4XUX A;  3W8K A;  5BOH A;  4EV4 A;  4X6T A;  1ERM A;  4OKP A;  5EVI A;  3GV9 A;  4ZTK A;  2Z2M B;  3BFF A;  2WUQ A;  2Y91 A;  2ZQA A;  1KGF A;  3FWL A;  3V5M A;  4B4X A;  1KE0 A;  1CI8 A;  1LL5 A;  5EUA A;  3IHB A;  2DRW A;  2Q9N A;  1LI0 A;  4P6B A;  3DW0 A;  1RP5 A;  3HLB A;  3SS5 A;  5A90 A;  3DWZ A;  3ZG7 B;  4B88 A;  1ZKJ A;  4X69 A;  5KSC A;  1BUE A;  2ZJ9 A;  4FSF A;  4OP8 A;  3IWO A;  5FAQ A;  3AGD A;  2E8I A;  1YQS A;  5AQ9 A;  4A5R A;  4BD0 A;  3MXR A;  4JBF A;  4JF4 A;  3E2L A;  3M2K A;  4DE0 A;  3UDF A;  5HX9 A;  5E2G A;  2JBF A;  3V3R A;  3QNC A;  3PBN A;  2XF3 A;  4JPM A;  2UWX A;  2ZC4 B;  5HL1 A;  5CGX A;  2Y2Q A;  1YT4 A;  1BSG A;  5I94 A;  3RXX A;  1H8Y A;  2WZZ A;  2VGJ A;  3FKW A;  1XXM A;  2ZM8 A;  3VMA A;  4PM9 A;  1L0D A;  4E3O A;  3MZD A;  3IT9 A;  2JCH A;  1WE4 A;  4DXC A;  5L2F A;  4LV2 A;  1K57 C;  1JWZ A;  2ZQ8 A;  4WMC D;  1KE4 A;  3S4X A;  5F1F A;  2ZC3 B;  1CEF A;  4N9K A;  1L0G A;  4GD6 A;  3ZG0 A;  5E2E A;  4OLG A;  1JTG A;  1ES5 A;  1MWU A;  1K4E A;  2ZC5 B;  5AQB A;  5DVA A;  5GLA A;  3N8L A;  2WYX A;  3ZFZ A;  1XGI A;  1E3U D;  2XD1 A;  4KG5 A;  4DKI A;  1XX2 A;  5CTM A;  1ESI A;  1YLJ A;  3IWI A;  4QU3 A;  1XKZ A;  5E2H A;  1CEG A;  1ERQ A;  2WAE A;  4FH4 A;  5FQK A;  1PW8 A;  3CMZ A;  4CJN A;  1KE3 A;  2EXA A;  4WM9 A;  3VP4 A;  3Q7Z A;  1GA0 A;  1L0F A;  1PW1 A;  5HFO A;  4MBH A;  3PBT A;  4HES A;  2P74 A;  3M2J A;  5EPH A;  3SS4 A;  2EX8 A;  2RCX A;  4OQH A;  3UO9 A;  3BFG A;  3EQU A;  3QHY A;  3NI9 A;  4GN2 A;  4UA9 A;  4JXS A;  5FI7 A;  4BEN A;  4EUZ A;  2XFT A;  3FYZ A;  1L0E A;  1K55 C;  5CGS A;  3OPP A;  1YLT A;  3N4I A;  3LEZ A;  1TVF A;  4E3K A;  4E6X A;  1W8Y A;  3OPL A;  5CEC A;  1O07 A;  1ZG6 A;  1BZA A;  3IXD A;  4KZ4 A;  3N8S A;  1KDS A;  4JKT A;  3VSK A;  2J9P A;  4DDY A;  2H10 A;  3PAE A;  3G35 A;  4KZ7 A;  3V3S A;  4Y0T A;  2ZMA A;  4R4S A;  2BLS A;  1TEM A;  3O3V A;  1YLW A;  2XFS A;  3M6H A;  3N6I A;  3GTC A;  4Y0O A;  4PMA A;  3Q82 A;  2ZC6 B;  2ZM0 A;  3IF6 C;  2ZQ7 A;  2WKE A;  3IF5 A;  4NK3 A;  4R3B A;  4U0X A;  4BL3 A;  5FAS A;  1FCN A;  2HDU A;  2BG1 A;  2HDQ A;  2Y2H A;  3QNB A;  4IED A;  1NJ4 A;  3IH8 A;  3Q7V B;  1DJA A;  4O7D A;  3WS0 A;  3ZVW A;  4HEF A;  1FSY A;  1MY8 A;  4K0W A;  4S2M A;  3AGE A;  4X55 A;  4DE1 A;  3NCK A;  1H5X A;  4BD1 A;  2Y2M A;  3MKF A;  3OCN A;  1ALQ A;  1PI4 A;  1XPB A;  3HLE A;  5CER A;  2EFU A;  1KGG A;  4N1H A;  4XXR A;  1LHY A;  3DTM A;  3HRE A;  5TFQ A;  1NXY A;  4RX2 A;  4RA7 A;  3G34 A;  3LY3 A;  1K57 A;  5F82 A;  1NZU A;  2OLU A;  3WRZ A;  4YFM A;  1FSW A;  3G32 A;  4N92 A;  1NRF A;  4F94 A;  1ZG4 A;  2GDN A;  2X71 A;  1IKI A;  3VOZ A;  4KZ5 A;  2WGW A;  1NZO A;  2Y59 A;  4GB7 A;  1JTD A;  1BLC A;  1XGJ A;  4RYE A;  3B3X A;  5DF8 A;  4GNU A;  2DNS A;  3A3J A;  3NBL A;  4UA6 A;  2C5W B;  2V20 A;  3SH8 A;  1U60 A;  1CK3 A;  4EBL A;  4WZ5 C;  1JWP A;  1FR1 A;  1PZP A;  4ZAM A;  2OV5 A;  1W7F A;  1BTL A;  5FQM A;  3VOY A;  1W8Q A;  3CJM A;  3VP0 A;  3UNW A;  4R1G A;  3A3F A;  4GZB A;  2J9O A;  2P9V A;  3OC2 A;  5DF7 A;  4E3M A;  4OPZ A;  1ONH A;  5HW3 A;  1K6R A;  3GRJ A;  4UAA A;  4UA7 A;  1MWS A;  2HP9 A;  4Y7P A;  1N9B A;  4PM8 A;  2X01 A;  1SDN A;  2WAD A;  1YM1 A;  4P87 A;  4FH2 A;  4H8R A;  4EQI A;  1WYC A;  3G30 A;  1E3U A;  1DY6 A;  1K4F A;  4R3J A;  5FI2 A;  2OLV A;  4S2O A;  1KVL A;  3GMW A;  5CHU A;  4KZA A;  3RJU A;  2JE5 A;  4JLF A;  4C6Y A;  3C7U A;  1K54 C;  4LV3 A;  2EX9 A;  3BFC A;  3NDE A;  5A91 A;  4ZDX A;  2XD5 A;  4QD4 A;  4WYY A;  5FI6 A;  1S0W A;  2Y2I A;  5HAQ A;  1DJC A;  4PPR A;  4K91 A;  3PTE A;  3IH9 A;  3BM6 A;  1H8Z A;  2JC7 A;  4HBT A;  4OON A;  4FD8 A;  2FFY A;  1MWT A;  3IXH A;  5CEB A;  3NY4 A;  4B4Z A;  1IEL A;  5GLD A;  2A3U A;  4S2P A;  3S1Y A;  1BUL A;  1JVJ A;  1N4O A;  2Q9M A;  2WK0 A;  2ZLY A;  1PI5 A;  4JXG A;  2FFF B;  4WBG A;  1G6A A;  3PBQ A;  4R4R A;  2EFX A;  1IKG A;  4PM5 A;  1S6R A;  1KVM A;  1BLH A;  2DCF A;  3IWQ A;  4GDB A;  5IHV A;  5A93 A;  2Y2J A;  4DDS A;  4OOY A;  2PBY A;  2XQZ A;  2WGV A;  3IXG A;  4GKU A;  4OLD A;  5JYO A;  1ES4 A;  3IF6 A;  5CTN A;  3W4Q A;  4KZ8 A;  4BJP A;  4FCF A;  1JWV A;  2RL3 A;  2C6W B;  3GVB A;  1GCE A;  4PM6 A;  5EVI D;  1C3B A;  3BFD A;  4N9L A;  5TGF A;  4WEL A;  5FQQ A;  2Y55 A;  4S2L A;  4QHC A;  2XH9 A;  5TR7 A;  5HAR A;  3MBZ A;  4DXB A;  3LY4 A;  2Y4A A;  4KZ9 A;  4P85 A;  4QB8 A;  1YLY A;  3UN7 A;  2WZX A;  5CHJ A;  2J7V A;  2OSU A;  3GQZ A;  3IQA A;  4U0T A;  4E3I A;  2WKH A;  1GHM A;  1YLZ A;  2WAF A;  4QY5 A;  3NIA A;  3TG9 A;  5E43 A;  4GD8 A;  4KZ6 A;  3W4P A;  2IWD A;  2CC1 A;  3UE1 A;  4LCM A;  5EOE A;  3O88 A;  2Y2N A;  4DRT A;  4S2I A;  3ZG9 B;  1TDG A;  5CED A;  3C4P A;  3DWK A;  4OQG A;  4KG6 A;  2EXB A;  3SH7 A;  4OPR A;  1PWC A;  4OH0 A;  2XLN A;  3HLD A;  4PM7 A;  2G2U A;  3A3I A;  3VP1 A;  1BT5 A;  1I2S A;  1XA1 A;  1RGZ A;  1K54 A;  3PAG A;  5G18 A;  3TOI A;  5KZH A;  3UPP A;  3ZG5 A;  4MBK A;  3ZVT A;  4U3T A;  4QY6 A;  3VP2 A;  5KMW A;  4S2N C;  4UHU A;  3I7J A;  1NYY A;  4D2O A;  1LLB A;  3IF6 B;  4YIN A;  3M6B A;  4ZJ2 A;  4ID4 A;  4DF6 A;  4WZ5 A;  5CHM A;  4X68 A;  1FCM A;  2ZC7 A;  1I2W A;  1PZO A;  1L2S A;  4KG2 A;  1SDE A;  4WEK A;  1VM1 A;  5AQA A;  3VFH A;  4DE3 A;  4EWF A;  5E2F A;  2XDM A;  1PIO A;  2R9X A;  1CI9 A;  2WGW B;  3WS4 A;  4IBX A;  1GA9 A;  5D3O A;  5F83 A;  1ES3 A;  4DE2 A;  1BLP A;  4ZJ1 A;  3P98 A;  3ZHH A;  2G2W A;  4Y0U A;  2QPN A;  2XR0 A;  3C7V A;  1IYS A;  3ZDJ A;  1XA7 A;  3PBS A;  4CPK A;  3WRT A;  1Z6F A;  4S2J A;  4LCL A;  3BYD A;  4Q8I A;  3OPH A;  4IVI A;  3NDG A;  3BEB A;  4E6W A; 
#chains in the Genus database with same CATH topology
 5GLC A;  4KQQ A;  1SHV A;  5HL6 A;  5FAP A;  2J8Y A;  2OWH A;  4MEZ A;  2ZQC A;  2HP5 A;  4NXE A;  4WMC A;  2D02 A;  4M3K A;  3CG5 A;  4IVK A;  1S67 L;  2XGN A;  4OVD A;  3HL9 A;  5K5B A;  3MXS A;  4R38 A;  2NUT C;  4WLA A;  1SKF A;  3DBA A;  3F1P B;  2A49 A;  1LT0 A;  5EFW A;  3O5Y A;  3BEC A;  5GL9 A;  2ZQD A;  4FUW A;  3RXW A;  4C3Q A;  4NXF A;  4E3N A;  1E4D A;  3HLC A;  5J8X A;  4OOL A;  4IBR A;  1RGY A;  4CLC E;  4QJG A;  4HJ4 A;  4EEP A;  3ZGA B;  1IYO A;  2V1Z A;  2V2F F;  3MZF A;  3KX0 X;  2QZ6 A;  5TJJ A;  4ARZ A;  1T1A A;  1HTZ A;  4RVA A;  2I72 A;  3LID A;  5CXW A;  2IWC A;  2VGL M;  1EW0 A;  2XRO A;  3OPR A;  3CWF A;  5GHX A;  1IEM A;  1YMX A;  3HLG A;  1N9L A;  2JKT M;  1YSP A;  1TS7 A;  1MWR A;  3OCL A;  3QP1 A;  5AJG A;  4EBP A;  4OP5 A;  5L10 A;  2HP6 A;  4K08 A;  3IX3 A;  1O7E A;  2XK1 A;  4R23 A;  2ZOI A;  3C8C A;  3UME A;  5IT5 A;  1GHI A;  3E0Y A;  3VSL A;  1T1B A;  2XEP A;  4F3L A;  3HLW A;  1Y54 A;  1VQQ A;  4XUZ A;  3JVV A;  3CUE C;  1DP9 A;  5TBM B;  4HIA A;  1ES2 A;  3Q1F A;  4KZ3 A;  3R4K A;  3DAV A;  5GLB A;  1TF1 A;  4KZB A;  2ZMV A;  4MCW A;  1D1J A;  1XJ3 A;  4WZ4 A;  4L0L A;  1N9O A;  2O9A A;  3EEH A;  1UGU A;  2Y2P A;  2FZ0 A;  3EOI A;  2VLG A;  1ERM A;  3BFF A;  2Y91 A;  4UQI S;  3FWL A;  1KE0 A;  3IHB A;  1LI0 A;  3FC7 A;  5A90 A;  4Y13 A;  3MQO A;  3C38 A;  1BUE A;  4OP8 A;  2BAS A;  2E8I A;  1YQS A;  3MXR A;  4JF4 A;  3B33 A;  2JBF A;  2MJ6 A;  2XF3 A;  3MJQ A;  5IS1 A;  5CGX A;  2WZZ A;  1T19 A;  3MZD A;  3IT9 A;  5L2F A;  1K57 C;  1JWZ A;  4WMC D;  1D7E A;  4EUV A;  5TBM A;  3SZT A;  3F1N B;  3QP6 A;  3EGX C;  1K4E A;  5AQB A;  5DKK A;  1XGI A;  2XD1 A;  4KG5 A;  3KSF A;  1XX2 A;  2O9C A;  1XKZ A;  5F69 A;  3Q7Z A;  1GA0 A;  3EQU A;  3QHY A;  3NI9 A;  4P6Z M;  1SKO B;  4JXS A;  4EUZ A;  2XFT A;  3RTY A;  1K55 C;  3JVU A;  1YLT A;  1TVF A;  4Q0J A;  4DN0 A;  4GJ4 A;  1ZG6 A;  1BZA A;  3P01 A;  2WKR A;  3MMH A;  4KZ7 A;  1TEM A;  3CAX A;  1YLW A;  3O3V A;  2L0W A;  4I5S A;  4Y0O A;  2ZM0 A;  3IF6 C;  4U0X A;  5FAS A;  1S4R A;  2HDU A;  2Z6D A;  2Y2H A;  1NJ4 A;  2GNX A;  4K0W A;  1IOU A;  5G4Y A;  2Y2M A;  3MKF A;  3GDI A;  3U2A A;  2BTF P;  5TFQ A;  1PNE A;  1NXY A;  1OTB A;  4JGP A;  3WRZ A;  1VET A;  4BBV A;  1XJ2 A;  2KLI A;  1OTD A;  3E4P A;  3HCY A;  2JHE A;  1N9N A;  4R6L A;  3VOL A;  3PYP A;  1BLC A;  2JKR M;  2V1A A;  4RYE A;  2J3T D;  5HSQ A;  5L8M A;  4Y17 A;  2V20 A;  3SH8 A;  2W1T B;  4ESP A;  1PZP A;  1W7F A;  5FQM A;  3CJM A;  3VP0 A;  3A3F A;  4GZB A;  2QJ7 A;  2P9V A;  3OC2 A;  5HW3 A;  3EEA A;  2P7J A;  1K6R A;  4Y7P A;  3GEC A;  3FPW A;  1T18 A;  1E3U A;  1DY6 A;  4S2O A;  1KVL A;  4C6Y A;  2JE5 A;  4JLF A;  1K54 C;  4LV3 A;  2K31 A;  3H7W B;  2XD5 A;  3E4O A;  2Y2I A;  1P0Z A;  4YOF A;  2XRN A;  2QHK A;  3BQ8 A;  3CIT A;  1H8Z A;  2JC7 A;  4OON A;  4FD8 A;  5CEB A;  4MN7 A;  3D3O A;  5GLD A;  2A3U A;  1N4O A;  2WK0 A;  2ZLY A;  2A24 B;  1S66 L;  2EFX A;  1IKG A;  3IWQ A;  5A93 A;  2PBY A;  2WGV A;  4AFI A;  4GKU A;  3NHQ A;  4BJP A;  5DKL A;  4FCF A;  4GS9 B;  2Y55 A;  4S2L A;  2XH9 A;  1XJ6 A;  5TR7 A;  2VKS A;  3LY4 A;  1FIK A;  4HJ3 A;  4QB8 A;  3T4J A;  2O9B A;  4U0T A;  2OSU A;  4E3I A;  2WKH A;  1YLZ A;  4QY5 A;  4GD8 A;  5EOE A;  2QWS A;  4EET B;  1TDG A;  3MR0 A;  5CED A;  3C4P A;  3IX4 A;  3DWK A;  4KG6 A;  3SH7 A;  1PWC A;  1STZ A;  4OH0 A;  1BT5 A;  3PAG A;  3TOI A;  5KZH A;  3ZVT A;  2EA9 A;  4U3T A;  3VP2 A;  5KMW A;  4S2N C;  5KIZ A;  4D2O A;  1NYY A;  1LLB A;  1FIL A;  4ZJ2 A;  4DF6 A;  2XA7 M;  5CHM A;  2ZC7 A;  1PZO A;  2B18 A;  1UWP X;  4DE3 A;  4EWF A;  5E2F A;  3EWK A;  2XDM A;  4BBT A;  1PIO A;  2WGW B;  1IFQ A;  5F83 A;  4LFU A;  1BLP A;  4ZJ1 A;  2XR0 A;  1P97 A;  3ZDJ A;  3PBS A;  1Z6F A;  1H3Q A;  4Q8I A;  4IVI A;  3BEB A;  3HUO A;  3CZD A;  2WGI A;  3T4L A;  1QME A;  4G3K A;  1HD8 A;  1W5D A;  3V39 A;  1ACF A;  2QMI A;  4H6J B;  3A3E A;  1M40 A;  1CF0 A;  4KQD A;  5HWT A;  4P0M A;  2JKF A;  4LV1 A;  2PRF A;  4N1X A;  1QMF A;  3LGO A;  3G31 A;  3BLS A;  1ZC2 A;  4OQ0 A;  2QJ5 A;  2WKI A;  4LV0 A;  5EVI B;  1ESU A;  4UQI M;  5FAT A;  3A0V A;  3KSI A;  5A92 A;  1OME A;  3G6O A;  5EEC A;  3DTE A;  3LFV A;  3LIA A;  4OPQ A;  4L9E A;  5M1A A;  5GHY A;  3IBR A;  3D4F A;  2ZL1 B;  3MKE A;  4DMZ A;  2ZD8 A;  2PYR A;  3E2K A;  2PU4 A;  1PWD A;  1VEU B;  5DF9 A;  2OOL A;  3E98 A;  3CLO A;  3WS5 A;  1FCO A;  4S2K A;  3T1X A;  3B42 A;  1IYP A;  1TD5 A;  2ZL1 A;  5L07 A;  1EI5 A;  3MZE A;  4OOM A;  3UE0 A;  1OTA A;  3LO7 A;  3C4O A;  2H0T A;  3IXB A;  3PBR A;  2HDS A;  1Q2Q A;  1Y28 A;  5M18 A;  3LUQ A;  5G4Z A;  2EX2 A;  5U47 A;  1DJB A;  2I9V A;  4FTX A;  1HVB A;  2H5S A;  3N7W A;  4BL2 A;  1P9W A;  4DJ2 A;  1LL9 A;  1K25 A;  4C75 A;  3IHA A;  1WA9 A;  1MPL A;  3SOI A;  4JF6 A;  3MFD A;  3ZNT A;  3N8R A;  1JNU A;  2Y2O A;  3ISG A;  1T1C A;  1ZHH B;  4Q0I A;  1K56 A;  1KGE A;  1K56 D;  4PAU A;  1BLS A;  4E3L A;  3DTI A;  5EOO A;  3UB6 A;  4HJ6 A;  2OWJ A;  5FQ9 A;  2PT7 A;  5HD5 A;  3LR0 A;  4OKP A;  5EVI A;  2B95 A;  4ZTK A;  2EWV A;  2ZQA A;  2DRW A;  2Q9N A;  1RP5 A;  3H9W A;  5HPI A;  4B88 A;  5F6A A;  1ZKJ A;  2EWW A;  5KSC A;  3TJZ C;  5FAQ A;  4MDZ A;  3AGD A;  4A5R A;  3OLO A;  4JBF A;  4DE0 A;  5C5K A;  2UWX A;  2YKH A;  1YT4 A;  1BSG A;  1KOU A;  5FEF A;  3T4O A;  4E3O A;  2VV8 A;  2WKQ A;  3F1O B;  3MXQ A;  4LV2 A;  2XSS A;  1KE4 A;  4GD6 A;  2W3G A;  4GHI B;  1MWU A;  4F3L B;  5GLA A;  2ZOH A;  4HH3 A;  1BYW A;  3IWI A;  2WAE A;  3CMZ A;  3LIC A;  3VP4 A;  3QP8 A;  3SS4 A;  3UO9 A;  4GN2 A;  4UA9 A;  3W2Z A;  2HJ9 C;  4BEN A;  2Q0O A;  3A0S A;  1L0E A;  5CGS A;  4FOF A;  2Y8H A;  4E3K A;  3OPL A;  5HWV A;  2JKT I;  1O07 A;  3IXD A;  3S7N A;  2PHY A;  3PAE A;  3G35 A;  4WN5 A;  3V3S A;  4R4S A;  2W1R A;  3N6I A;  3M6H A;  3Q82 A;  2IA2 A;  1MC0 A;  2WKE A;  4R3B A;  4BL3 A;  4IJG A;  2BG1 A;  4X1M A;  4Y15 A;  3QNB A;  4IED A;  1DJA A;  4S2M A;  2CMN A;  3NCK A;  5CER A;  1ALQ A;  3HLE A;  2EFU A;  3HJI A;  4N1H A;  3DTM A;  1SKO A;  4UEY A;  4RA7 A;  1K57 A;  4BMW A;  2OLU A;  3G32 A;  5HD3 A;  5AVF A;  4E04 A;  4HY8 A;  3LYX A;  1S1Z A;  1XGJ A;  5DF8 A;  3NBL A;  3MS6 A;  4KUK A;  1CK3 A;  4WZ5 C;  1YAX A;  4HNB A;  1S4S A;  1JWP A;  2OV5 A;  4Y5F A;  3H7W A;  1W8Q A;  2HJE A;  1GSV A;  3UNW A;  4R1G A;  4CLC D;  2J9O A;  2HP9 A;  4PM8 A;  1SDN A;  3T50 A;  1YM1 A;  4FH2 A;  5J7E A;  5HDC A;  2VZW A;  5J4E A;  1K4F A;  4R3J A;  4HOI A;  4LLO B;  2EX9 A;  2HZ5 A;  3NDE A;  5FI6 A;  1S0W A;  5LBR A;  4PPR A;  3IH9 A;  3BM6 A;  3K3C A;  3IXH A;  4B4Z A;  4S2P A;  1BUL A;  2Q9M A;  1PI5 A;  4JXG A;  3K3D A;  1ZTU A;  4GS9 A;  4WBG A;  4R4R A;  2M7U A;  2VX8 A;  4PM5 A;  4GDB A;  4DDS A;  4OOY A;  3H82 B;  5JYO A;  5CTN A;  3W4Q A;  2K7S A;  4KZ8 A;  4ETZ A;  2C6W B;  4PM6 A;  2PR5 A;  4O01 A;  3BFD A;  5TGF A;  3BY8 A;  4QHC A;  3V67 A;  5HZH A;  5HDS A;  2Y4A A;  1V9Z A;  2VGL S;  4GHI A;  2YKF A;  5FL3 A;  5CHJ A;  2J7V A;  3GQZ A;  4PKY A;  1GHM A;  5FEG A;  5E43 A;  4KZ6 A;  3W4P A;  2IWD A;  1G6O A;  4LCM A;  1XFQ A;  4S2I A;  3ZG9 B;  4ETX A;  2HF6 A;  2VK3 A;  4OPR A;  3VP1 A;  3A3I A;  1I2S A;  1RGZ A;  3ZG5 A;  1W63 M;  3I7J A;  3IF6 B;  3L9K A;  1OPX A;  1X0O A;  4WEK A;  3VFH A;  1VM1 A;  5AVE A;  1CI9 A;  1D06 A;  1ES3 A;  4GLQ A;  4IHQ A;  4Y0U A;  3NUL A;  4NG2 A;  3WRT A;  2DMW A;  4HQA A;  4Y2F A;  5L09 A;  1YMS A;  4MBF A;  5DTK A;  4EU0 A;  2FH5 A;  3GSG A;  2UV0 E;  1F2K A;  4X25 A;  3L7H A;  1J9M A;  1PYY A;  2WKP A;  4ZBE A;  4X53 A;  1GHP A;  1PWG A;  3PBO A;  5F68 A;  1IYQ A;  1TS6 A;  3BFE A;  1K38 A;  4JF5 A;  2Y2G A;  4KEN B;  3UY6 A;  3ITB A;  3WS2 A;  1DP8 A;  4NET A;  5I5L A;  1TS8 A;  3T4K A;  4ME4 A;  1WYB A;  2INW A;  3FKV A;  2H28 A;  1RCJ A;  5FDH A;  3ZG8 B;  3SH9 A;  2HDR A;  3ZYT A;  5EVL A;  3A3D A;  1SCW A;  3P09 A;  3WS1 A;  3BRM A;  4LRX C;  3FPV A;  4RX3 A;  2GJ3 A;  1XFN A;  1K6S A;  4ZJ3 A;  3VFF A;  3Q81 A;  1KDW A;  2PBD P;  3PHY A;  2PDR A;  3C5A A;  3UDX A;  3Q07 A;  1LI9 A;  2ZM2 A;  4WL9 A;  5CRF A;  3HUM A;  5AQ7 A;  5EVI C;  4S2N A;  2PU2 A;  1FQG A;  3SS3 A;  3BY9 A;  5CGW A;  1OJ5 A;  5KSH A;  1Q2P A;  1I5Q A;  3UMD A;  1F5M A;  1ONG A;  3AGF A;  1E25 A;  3ICY A;  2H0Y A;  2R9W A;  1LSW A;  2P9V B;  1AWI A;  2PR6 A;  4G3W A;  3H82 A;  1MKI A;  3FZC A;  3UE3 A;  2Y2L A;  4MNR A;  5HPF A;  1J3W A;  2L1M A;  3BW6 A;  2V9A A;  2HGV A;  4Z9Q A;  3UPN A;  3PR6 A;  3G4P A;  2L4R A;  3NC8 A;  4OQI A;  1ERO A;  2Y2K A;  5HAI A;  4LGW A;  1VET B;  5M19 A;  4I3J A;  2W3D A;  5F1G A;  5FQI A;  1MBL A;  4LPZ A;  5DTS A;  3OZH A;  4MN5 A;  1K0K A;  5FQJ A;  3ZNY A;  4B9O A;  2KX6 A;  2J80 A;  4XUX A;  4X6T A;  2Z2M B;  2WUQ A;  3V5M A;  5EUA A;  2XA7 S;  2GX5 A;  3DW0 A;  3HLB A;  3LR5 A;  3E4Q A;  3ZG7 B;  4X69 A;  2QKP A;  3CUE A;  1W63 Q;  3NOP C;  2W3H A;  4FSF A;  3FG8 A;  1PFL A;  2PD7 A;  3T4S A;  4H6J A;  1YPR A;  3V3R A;  3QNC A;  3IX8 A;  3PBN A;  4JPM A;  5HWW A;  2ZC4 B;  5HL1 A;  4YNR A;  3LI8 A;  3K2N A;  3A0R A;  1XXM A;  2ZM8 A;  4PM9 A;  2JCH A;  3MQ0 A;  4DXC A;  2VV7 A;  3R7W A;  4BWI A;  1CEF A;  5E2E A;  1JTG A;  2W1T A;  1ES5 A;  2A24 A;  2ZC5 B;  4ZRR A;  5DVA A;  3N8L A;  2WYX A;  3MSH A;  4NXB A;  3LR4 A;  5CTM A;  1ESI A;  1YLJ A;  4QU3 A;  3WS4 A;  4FH4 A;  2M1C A;  5FQK A;  1H0M A;  3D72 A;  1KE3 A;  1PW1 A;  5HFO A;  3PBT A;  3PXP A;  2D01 A;  2P74 A;  4HES A;  5EPH A;  2EX8 A;  2RCX A;  4OQH A;  5FI7 A;  3FYZ A;  3OPP A;  2PAV P;  5CEC A;  2V8C A;  1LSX A;  1KDS A;  1F9I A;  3VSK A;  3VE3 A;  4Y0T A;  3S7P A;  2ZMA A;  2BLS A;  4EXO A;  3GTC A;  5DFX A;  1Z09 A;  2ZQ7 A;  4NK3 A;  1MKM A;  4ARZ B;  2HDQ A;  3IH8 A;  4NKP A;  1FSY A;  1MY8 A;  4IUK A;  4X55 A;  4DE1 A;  1H5X A;  1XPB A;  2VV6 A;  1KGG A;  1LHY A;  3NOT C;  3R7W B;  4RX2 A;  1OJG A;  3G34 A;  1NZU A;  4MN6 A;  1FSW A;  4N92 A;  1NRF A;  1ZG4 A;  2GDN A;  2X71 A;  5DJU A;  4R70 A;  1IKI A;  2K2N A;  2VA0 A;  2Y59 A;  4GB7 A;  1JTD A;  3IS2 A;  5DFY A;  3B3X A;  3VE4 A;  1P9R A;  3F1P A;  4D60 A;  4UA6 A;  1YSQ A;  2C5W B;  3CHW P;  1OTE A;  3DTK A;  3NOU C;  2R78 A;  3SW1 A;  2ZMF A;  1FR1 A;  1G5U A;  3TE8 A;  1VB6 A;  3VOY A;  1ONH A;  4UAA A;  3IBJ A;  1N9B A;  5HDD A;  2X01 A;  4HI4 A;  1ODV A;  2WAD A;  4H8R A;  5MC7 A;  4EQI A;  4JGO A;  1NLZ A;  4II7 A;  3C7U A;  3KYE A;  2W27 A;  3BFC A;  4BBU A;  2JN7 A;  4QD4 A;  1DJC A;  4JGQ A;  5EM1 A;  4K91 A;  3QP2 A;  3UB5 P;  3LI9 A;  2QYB A;  1IEL A;  1JVJ A;  2LB5 A;  3T1Q B;  1V9Y A;  3PBQ A;  1KVM A;  2DCF A;  5IHV A;  2ACG A;  3IXG A;  4CQH A;  4IUH A;  2W3E A;  1NWZ A;  3CI6 A;  5EV0 A;  3GVB A;  3S7Q A;  1F98 A;  4HH2 A;  1C3B A;  4N9L A;  4WEL A;  5FQQ A;  1Y4O A;  4I3A A;  5HAR A;  3MBZ A;  4GCZ A;  3F1N A;  3VV4 A;  2WAF A;  3TG9 A;  2CC1 A;  3UE1 A;  2Y2N A;  3MF0 A;  4DRT A;  2V8F A;  1HLU P;  2AVX A;  4OQG A;  1XA1 A;  3KSH A;  3UPP A;  4MBK A;  3RH8 B;  4YIN A;  4ID4 A;  4I39 A;  1FCM A;  2E8J A;  1L2S A;  3C2W A;  5AQA A;  3UB7 A;  3UB8 A;  1GA9 A;  2V0U A;  1LL8 A;  3ZHH A;  2QPN A;  3C7V A;  1IYS A;  4PKY G;  4CPK A;  2O0Y A;  4S2J A;  4LCL A;  3BYD A;  4OLG A;  3NDG A;  3UDI A;  1S1Y A;  1HZO A;  2B5R A;  4X56 A;  4EEU A;  4KQR A;  1YLP A;  3GR2 A;  3BJN A;  2Z6C A;  3EGD C;  4YWZ A;  2NUP C;  4P6Z S;  2VGK A;  2P04 A;  4R0Q A;  4MMN A;  4LEN A;  5HAP A;  3O86 A;  2P08 A;  4MLL A;  4QWO A;  3BWL A;  3LR3 A;  3FV7 A;  3B47 A;  4NEE D;  4OPY A;  1MZU A;  3NEC A;  4DJ3 A;  3BLM A;  3EQV A;  3ULF A;  2ZQ9 A;  4L9G A;  4NXG A;  3HUN A;  5FSR A;  4R3A A;  2PYP A;  3JYI A;  3C30 A;  1A0K A;  1NLY A;  4HHD A;  1NY0 A;  3HJK A;  4EBN A;  3HBR A;  3KYZ A;  4HP9 A;  3TSG A;  3G2Z A;  4JGR A;  2B02 A;  1OT6 A;  4E3J A;  4I3I A;  1M6K A;  2IWB A;  3S7O A;  4GW9 A;  3HLF A;  1MXO A;  4O8G A;  3S22 A;  2EX6 A;  4X1L A;  3QP5 A;  5FAO A;  5JYP A;  1XP4 A;  5EE8 A;  2Z2L B;  3HVF A;  4JXW A;  5IU1 A;  4BLM A;  1TDL A;  3KYQ A;  3UPO A;  1CJF A;  5DTT A;  4Q0H A;  4I38 A;  4O0P A;  3ZCZ A;  2A2L A;  4LRZ E;  1W79 A;  1EWZ A;  4M4X A;  3W4O A;  4GDN A;  2V1B A;  1FR6 A;  2OAP 1;  3TW8 A;  4BQM A;  1NYM A;  4JXV A;  5DJT A;  3WWX A;  1VHM A;  4K0X A;  4WEJ A;  4HBU A;  1NRJ A;  3G2Y A;  2X02 A;  4GOG A;  4WUJ A;  1G68 A;  3KSG A;  4KQO A;  3ITA A;  5FA7 A;  1AXB A;  1K55 A;  3V50 A;  3VP3 A;  3LCE A;  5GHZ A;  3Q7V A;  1LSV A;  3KO6 A;  1FOF A;  2HPB A;  3W8K A;  5BOH A;  4EV4 A;  4CLC B;  3GV9 A;  1KGF A;  4B4X A;  1CI8 A;  1LL5 A;  2HV1 A;  2JKG A;  2V0W A;  4G3V A;  4P6B A;  1SZV A;  2GZA A;  3SS5 A;  3TRC A;  3DWZ A;  2ZJ9 A;  4CLC A;  3IWO A;  5AQ9 A;  4BD0 A;  3E2L A;  3M2K A;  3UDF A;  5HX9 A;  5E2G A;  1GSX A;  2Y2Q A;  5I94 A;  3RXX A;  1H8Y A;  2VGJ A;  3FKW A;  2KDK A;  3VMA A;  1L0D A;  3UE6 A;  5FDS A;  1WE4 A;  2ZQ8 A;  4XT2 B;  3S4X A;  3UB9 A;  5F1F A;  2ZC3 B;  4N9K A;  1L0G A;  3ZG0 A;  1DP6 A;  1UWN X;  3ZFZ A;  2VJW A;  1E3U D;  4DKI A;  3IS2 B;  1YKD A;  1CQA A;  4EW7 A;  2W0N A;  5E2H A;  1CEG A;  1ERQ A;  1PW8 A;  2OAQ 1;  4CJN A;  2EXA A;  4WM9 A;  1L0F A;  4MBH A;  3M2J A;  3BFG A;  4B93 A;  3T4Q A;  5J3W A;  3N4I A;  3LEZ A;  4E6X A;  1W8Y A;  4KZ4 A;  3MFX A;  1XJ4 A;  3N8S A;  4JKT A;  2J9P A;  4DDY A;  1GSW A;  2H10 A;  2XFS A;  4PMA A;  2ZC6 B;  1OT9 A;  3IF5 A;  1FCN A;  3CPT A;  2LB9 A;  3RFB A;  3P7N A;  1H8M A;  3Q7V B;  4O7D A;  3WS0 A;  4Z1W A;  3ZVW A;  4HEF A;  3MQQ A;  3AGE A;  1L3L A;  4KUO A;  4BD1 A;  3OCN A;  1PI4 A;  4XXR A;  3HRE A;  4QPR A;  3BQA A;  3LY3 A;  5F82 A;  4YFM A;  4PHT A;  4F94 A;  5A8B A;  3VOZ A;  4KZ5 A;  2WGW A;  1NZO A;  5EM0 A;  4GNU A;  2DNS A;  3QP4 A;  3A3J A;  2KOI A;  1OTI A;  2G7U A;  3CPT B;  1U60 A;  4Y3I A;  4CLC C;  4EBL A;  3JPU A;  5F5Y A;  4ZAM A;  3T4T A;  1BTL A;  4XT2 A;  4E3M A;  5DF7 A;  4OPZ A;  3GRJ A;  4UA7 A;  1MWS A;  2J3T C;  3LIF A;  3T1S A;  4P87 A;  1WYC A;  3G30 A;  3T1R A;  5FI2 A;  2OLV A;  3GMW A;  1DRM A;  5CHU A;  1TS0 A;  4KZA A;  3RJU A;  5A91 A;  4ZDX A;  3LIE A;  4HP4 A;  4WYY A;  3U4L P;  5HAQ A;  3ZQ5 A;  3PTE A;  4HBT A;  2FFY A;  1MWT A;  3NY4 A;  3S1Y A;  2O99 A;  2VEA A;  1G28 A;  2JKR I;  2FFF B;  4EER A;  1G6A A;  1S6R A;  1BLH A;  2Y2J A;  2XQZ A;  4OLD A;  1ES4 A;  3IF6 A;  4L9F A;  4WF0 A;  1JWV A;  2RL3 A;  3LEQ A;  1GCE A;  3OOV A;  5EVI D;  3OBF A;  4EQ1 A;  4DXB A;  4P85 A;  4KZ9 A;  2W3F A;  1YLY A;  3UN7 A;  2WZX A;  3IQA A;  1PRQ A;  3NIA A;  2PD8 A;  3D9Y A;  4RQ9 A;  3O88 A;  2ZBB A;  2J3W A;  1VEU A;  2EXB A;  4LRY C;  5EVE A;  2XLN A;  3HLD A;  4PM7 A;  2G2U A;  3NJA A;  1K54 A;  5G18 A;  3T12 B;  4QY6 A;  5CX7 A;  4UHU A;  3M6B A;  4WZ5 A;  4X68 A;  1I2W A;  2Y79 A;  4KG2 A;  1SDE A;  4EES A;  2R9X A;  2M7V A;  4IBX A;  5D3O A;  4DE2 A;  3P98 A;  2G2W A;  3LIB A;  1XA7 A;  3F1O A;  3OPH A;  3O87 A;  4E6W A; 
#chains in the Genus database with same CATH homology
 3UDI A;  3HUO A;  5GLC A;  3CZD A;  2WGI A;  4KQQ A;  1SHV A;  1YMS A;  4MBF A;  1QME A;  5DTK A;  2B5R A;  1HZO A;  4X56 A;  1HD8 A;  5FAP A;  2J8Y A;  1W5D A;  4KQR A;  1YLP A;  3V39 A;  2QMI A;  3A3E A;  3GSG A;  3GR2 A;  1M40 A;  4MEZ A;  2ZQC A;  4P0M A;  1J9M A;  1PYY A;  2HP5 A;  4LV1 A;  2VGK A;  4N1X A;  4ZBE A;  1QMF A;  4WMC A;  4X53 A;  1GHP A;  1PWG A;  3PBO A;  4R0Q A;  4LEN A;  1IYQ A;  5HAP A;  4M3K A;  3CG5 A;  3G31 A;  4IVK A;  3BFE A;  1K38 A;  3BLS A;  3O86 A;  4JF5 A;  2Y2G A;  2XGN A;  4KEN B;  4OVD A;  3UY6 A;  3ITB A;  1ZC2 A;  4OQ0 A;  4LV0 A;  2WKI A;  5EVI B;  1ESU A;  3HL9 A;  3WS2 A;  5FAT A;  4MLL A;  4NET A;  3MXS A;  3FV7 A;  4OPY A;  1WYB A;  5A92 A;  1OME A;  1SKF A;  3BLM A;  3FKV A;  5EEC A;  3EQV A;  1RCJ A;  5FDH A;  3ZG8 B;  2A49 A;  3SH9 A;  2HDR A;  2ZQ9 A;  5EVL A;  3A3D A;  1SCW A;  3P09 A;  3BEC A;  3WS1 A;  3HUN A;  5GL9 A;  2ZQD A;  3BRM A;  3RXW A;  4OPQ A;  4C3Q A;  4E3N A;  5M1A A;  1E4D A;  5FSR A;  5GHY A;  3HLC A;  3JYI A;  5J8X A;  4RX3 A;  3D4F A;  4OOL A;  4IBR A;  3MKE A;  1RGY A;  4QJG A;  2ZD8 A;  1NY0 A;  4EBN A;  1K6S A;  3ZGA B;  3HBR A;  3E2K A;  1IYO A;  4ZJ3 A;  3VFF A;  3Q81 A;  1KDW A;  2PU4 A;  2V1Z A;  1PWD A;  3TSG A;  2V2F F;  5DF9 A;  3MZF A;  3C5A A;  3G2Z A;  2QZ6 A;  3WS5 A;  3UDX A;  3Q07 A;  1LI9 A;  1FCO A;  2ZM2 A;  4S2K A;  5CRF A;  3HUM A;  5AQ7 A;  5EVI C;  4E3J A;  1HTZ A;  4S2N A;  1M6K A;  2PU2 A;  1FQG A;  1IYP A;  2IWB A;  3SS3 A;  1EI5 A;  4RVA A;  3HLF A;  1MXO A;  3MZE A;  2I72 A;  4OOM A;  5CXW A;  3S22 A;  2IWC A;  2EX6 A;  3UE0 A;  5FAO A;  5JYP A;  5CGW A;  1XP4 A;  3LO7 A;  3C4O A;  3OPR A;  5EE8 A;  5KSH A;  1Q2P A;  2H0T A;  2Z2L B;  3HVF A;  3IXB A;  3PBR A;  4JXW A;  4BLM A;  1TDL A;  1I5Q A;  2HDS A;  1Q2Q A;  3UPO A;  5GHX A;  1IEM A;  1YMX A;  5M18 A;  3HLG A;  2EX2 A;  1ONG A;  5U47 A;  1DJB A;  5DTT A;  3AGF A;  1E25 A;  1HVB A;  2H5S A;  3N7W A;  3O87 A;  1MWR A;  4BL2 A;  2H0Y A;  3OCL A;  2R9W A;  3ZCZ A;  4EBP A;  4OP5 A;  1LL9 A;  2P9V B;  1K25 A;  1W79 A;  4C75 A;  1EWZ A;  2HP6 A;  3IHA A;  1MKI A;  3FZC A;  4GDN A;  3UE3 A;  2Y2L A;  1O7E A;  1FR6 A;  4MNR A;  2XK1 A;  3W4O A;  4R23 A;  1MPL A;  3SOI A;  4JF6 A;  3UPN A;  4Z9Q A;  4BQM A;  3MFD A;  3ZNT A;  3N8R A;  1GHI A;  1NYM A;  4JXV A;  2Y2O A;  3G4P A;  3VSL A;  2XEP A;  3WWX A;  3HLW A;  1Y54 A;  1VQQ A;  3ISG A;  3NC8 A;  4K0X A;  4XUZ A;  1K56 A;  4OQI A;  1KGE A;  4WEJ A;  1K56 D;  1ES2 A;  4HBU A;  1ERO A;  2Y2K A;  5HAI A;  1BLS A;  3Q1F A;  4KZ3 A;  4E3L A;  3G2Y A;  2X02 A;  5GLB A;  5M19 A;  5EOO A;  4GOG A;  1G68 A;  5F1G A;  5FQI A;  4KZB A;  1MBL A;  5DTS A;  4KQO A;  3OZH A;  4WZ4 A;  3ITA A;  4L0L A;  5FA7 A;  5FQJ A;  1AXB A;  1K55 A;  3V50 A;  3VP3 A;  5FQ9 A;  3LCE A;  3ZNY A;  5GHZ A;  3Q7V A;  2Y2P A;  1FOF A;  2HPB A;  4XUX A;  3W8K A;  5BOH A;  4EV4 A;  4X6T A;  1ERM A;  4OKP A;  5EVI A;  3GV9 A;  4ZTK A;  2Z2M B;  3BFF A;  2WUQ A;  2Y91 A;  2ZQA A;  1KGF A;  3FWL A;  3V5M A;  4B4X A;  1KE0 A;  1CI8 A;  1LL5 A;  5EUA A;  3IHB A;  2DRW A;  2Q9N A;  1LI0 A;  4P6B A;  3DW0 A;  1RP5 A;  3HLB A;  3SS5 A;  5A90 A;  3DWZ A;  3ZG7 B;  4B88 A;  1ZKJ A;  4X69 A;  5KSC A;  1BUE A;  2ZJ9 A;  4FSF A;  4OP8 A;  3IWO A;  5FAQ A;  3AGD A;  2E8I A;  1YQS A;  5AQ9 A;  4A5R A;  4BD0 A;  3MXR A;  4JBF A;  4JF4 A;  3E2L A;  3M2K A;  4DE0 A;  3UDF A;  5HX9 A;  5E2G A;  2JBF A;  3V3R A;  3QNC A;  3PBN A;  2XF3 A;  4JPM A;  2UWX A;  2ZC4 B;  5HL1 A;  5CGX A;  2Y2Q A;  1YT4 A;  1BSG A;  5I94 A;  3RXX A;  1H8Y A;  2WZZ A;  2VGJ A;  3FKW A;  1XXM A;  2ZM8 A;  3VMA A;  4PM9 A;  1L0D A;  4E3O A;  3MZD A;  3IT9 A;  2JCH A;  1WE4 A;  4DXC A;  5L2F A;  4LV2 A;  1K57 C;  1JWZ A;  2ZQ8 A;  4WMC D;  1KE4 A;  3S4X A;  5F1F A;  2ZC3 B;  1CEF A;  4N9K A;  1L0G A;  4GD6 A;  3ZG0 A;  5E2E A;  4OLG A;  1JTG A;  1ES5 A;  1MWU A;  1K4E A;  2ZC5 B;  5AQB A;  5DVA A;  5GLA A;  3N8L A;  2WYX A;  3ZFZ A;  1XGI A;  1E3U D;  2XD1 A;  4KG5 A;  4DKI A;  1XX2 A;  5CTM A;  1ESI A;  1YLJ A;  3IWI A;  4QU3 A;  1XKZ A;  5E2H A;  1CEG A;  1ERQ A;  2WAE A;  4FH4 A;  5FQK A;  1PW8 A;  3CMZ A;  4CJN A;  1KE3 A;  2EXA A;  4WM9 A;  3VP4 A;  3Q7Z A;  1GA0 A;  1L0F A;  1PW1 A;  5HFO A;  4MBH A;  3PBT A;  4HES A;  2P74 A;  3M2J A;  5EPH A;  3SS4 A;  2EX8 A;  2RCX A;  4OQH A;  3UO9 A;  3BFG A;  3EQU A;  3QHY A;  3NI9 A;  4GN2 A;  4UA9 A;  4JXS A;  5FI7 A;  4BEN A;  4EUZ A;  2XFT A;  3FYZ A;  1L0E A;  1K55 C;  5CGS A;  3OPP A;  1YLT A;  3N4I A;  3LEZ A;  1TVF A;  4E3K A;  4E6X A;  1W8Y A;  3OPL A;  5CEC A;  1O07 A;  1ZG6 A;  1BZA A;  3IXD A;  4KZ4 A;  3N8S A;  1KDS A;  4JKT A;  3VSK A;  2J9P A;  4DDY A;  2H10 A;  3PAE A;  3G35 A;  4KZ7 A;  3V3S A;  4Y0T A;  2ZMA A;  4R4S A;  2BLS A;  1TEM A;  3O3V A;  1YLW A;  2XFS A;  3M6H A;  3N6I A;  3GTC A;  4Y0O A;  4PMA A;  3Q82 A;  2ZC6 B;  2ZM0 A;  3IF6 C;  2ZQ7 A;  2WKE A;  3IF5 A;  4NK3 A;  4R3B A;  4U0X A;  4BL3 A;  5FAS A;  1FCN A;  2HDU A;  2BG1 A;  2HDQ A;  2Y2H A;  3QNB A;  4IED A;  1NJ4 A;  3IH8 A;  3Q7V B;  1DJA A;  4O7D A;  3WS0 A;  3ZVW A;  4HEF A;  1FSY A;  1MY8 A;  4K0W A;  4S2M A;  3AGE A;  4X55 A;  4DE1 A;  3NCK A;  1H5X A;  4BD1 A;  2Y2M A;  3MKF A;  3OCN A;  1ALQ A;  1PI4 A;  1XPB A;  3HLE A;  5CER A;  2EFU A;  1KGG A;  4N1H A;  4XXR A;  1LHY A;  3DTM A;  3HRE A;  5TFQ A;  1NXY A;  4RX2 A;  4RA7 A;  3G34 A;  3LY3 A;  1K57 A;  5F82 A;  1NZU A;  2OLU A;  3WRZ A;  4YFM A;  1FSW A;  3G32 A;  4N92 A;  1NRF A;  4F94 A;  1ZG4 A;  2GDN A;  2X71 A;  1IKI A;  3VOZ A;  4KZ5 A;  2WGW A;  1NZO A;  2Y59 A;  4GB7 A;  1JTD A;  1BLC A;  1XGJ A;  4RYE A;  3B3X A;  5DF8 A;  4GNU A;  2DNS A;  3A3J A;  3NBL A;  4UA6 A;  2C5W B;  2V20 A;  3SH8 A;  1U60 A;  1CK3 A;  4EBL A;  4WZ5 C;  1JWP A;  1FR1 A;  1PZP A;  4ZAM A;  2OV5 A;  1W7F A;  1BTL A;  5FQM A;  3VOY A;  1W8Q A;  3CJM A;  3VP0 A;  3UNW A;  4R1G A;  3A3F A;  4GZB A;  2J9O A;  2P9V A;  3OC2 A;  5DF7 A;  4E3M A;  4OPZ A;  1ONH A;  5HW3 A;  1K6R A;  3GRJ A;  4UAA A;  4UA7 A;  1MWS A;  2HP9 A;  4Y7P A;  1N9B A;  4PM8 A;  2X01 A;  1SDN A;  2WAD A;  1YM1 A;  4P87 A;  4FH2 A;  4H8R A;  4EQI A;  1WYC A;  3G30 A;  1E3U A;  1DY6 A;  1K4F A;  4R3J A;  5FI2 A;  2OLV A;  4S2O A;  1KVL A;  3GMW A;  5CHU A;  4KZA A;  3RJU A;  2JE5 A;  4JLF A;  4C6Y A;  3C7U A;  1K54 C;  4LV3 A;  2EX9 A;  3BFC A;  3NDE A;  5A91 A;  4ZDX A;  2XD5 A;  4QD4 A;  4WYY A;  5FI6 A;  1S0W A;  2Y2I A;  5HAQ A;  1DJC A;  4PPR A;  4K91 A;  3PTE A;  3IH9 A;  3BM6 A;  1H8Z A;  2JC7 A;  4HBT A;  4OON A;  4FD8 A;  2FFY A;  1MWT A;  3IXH A;  5CEB A;  3NY4 A;  4B4Z A;  1IEL A;  5GLD A;  2A3U A;  4S2P A;  3S1Y A;  1BUL A;  1JVJ A;  1N4O A;  2Q9M A;  2WK0 A;  2ZLY A;  1PI5 A;  4JXG A;  2FFF B;  4WBG A;  1G6A A;  3PBQ A;  4R4R A;  2EFX A;  1IKG A;  4PM5 A;  1S6R A;  1KVM A;  1BLH A;  2DCF A;  3IWQ A;  4GDB A;  5IHV A;  5A93 A;  2Y2J A;  4DDS A;  4OOY A;  2PBY A;  2XQZ A;  2WGV A;  3IXG A;  4GKU A;  4OLD A;  5JYO A;  1ES4 A;  3IF6 A;  5CTN A;  3W4Q A;  4KZ8 A;  4BJP A;  4FCF A;  1JWV A;  2RL3 A;  2C6W B;  3GVB A;  1GCE A;  4PM6 A;  5EVI D;  1C3B A;  3BFD A;  4N9L A;  5TGF A;  4WEL A;  5FQQ A;  2Y55 A;  4S2L A;  4QHC A;  2XH9 A;  5TR7 A;  5HAR A;  3MBZ A;  4DXB A;  3LY4 A;  2Y4A A;  4KZ9 A;  4P85 A;  4QB8 A;  1YLY A;  3UN7 A;  2WZX A;  5CHJ A;  2J7V A;  2OSU A;  3GQZ A;  3IQA A;  4U0T A;  4E3I A;  2WKH A;  1GHM A;  1YLZ A;  2WAF A;  4QY5 A;  3NIA A;  3TG9 A;  5E43 A;  4GD8 A;  4KZ6 A;  3W4P A;  2IWD A;  2CC1 A;  3UE1 A;  4LCM A;  5EOE A;  3O88 A;  2Y2N A;  4DRT A;  4S2I A;  3ZG9 B;  1TDG A;  5CED A;  3C4P A;  3DWK A;  4OQG A;  4KG6 A;  2EXB A;  3SH7 A;  4OPR A;  1PWC A;  4OH0 A;  2XLN A;  3HLD A;  4PM7 A;  2G2U A;  3A3I A;  3VP1 A;  1BT5 A;  1I2S A;  1XA1 A;  1RGZ A;  1K54 A;  3PAG A;  5G18 A;  3TOI A;  5KZH A;  3UPP A;  3ZG5 A;  4MBK A;  3ZVT A;  4U3T A;  4QY6 A;  3VP2 A;  5KMW A;  4S2N C;  4UHU A;  3I7J A;  1NYY A;  4D2O A;  1LLB A;  3IF6 B;  4YIN A;  3M6B A;  4ZJ2 A;  4ID4 A;  4DF6 A;  4WZ5 A;  5CHM A;  4X68 A;  1FCM A;  2ZC7 A;  1I2W A;  1PZO A;  1L2S A;  4KG2 A;  1SDE A;  4WEK A;  1VM1 A;  5AQA A;  3VFH A;  4DE3 A;  4EWF A;  5E2F A;  2XDM A;  1PIO A;  2R9X A;  1CI9 A;  2WGW B;  3WS4 A;  4IBX A;  1GA9 A;  5D3O A;  5F83 A;  1ES3 A;  4DE2 A;  1BLP A;  4ZJ1 A;  3P98 A;  3ZHH A;  2G2W A;  4Y0U A;  2QPN A;  2XR0 A;  3C7V A;  1IYS A;  3ZDJ A;  1XA7 A;  3PBS A;  4CPK A;  3WRT A;  1Z6F A;  4S2J A;  4LCL A;  3BYD A;  4Q8I A;  3OPH A;  4IVI A;  3NDG A;  3BEB A;  4E6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...