4K91A

Crystal structure of penicillin-binding protein 5 (pbp5) from pseudomonas aeruginosa in apo state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
342
structure length
342
Chain Sequence
b'ESMVPAPPQLAAKSYVLMDGESGQVLVENNGDQRLPPASLTKLMTAYIATKEIEAGRIGENDLVTVSEHAWRTGGSRMFIKVGSQVSVSDLLHGIIIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLPNPDHYSSARDMAVLARAIIYGEPSHYAIYAQKEFLWNNIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCLVASAVRDGQRMIAVVFGTNSEQARAAETQKLLTYGFRFFESRNFYKKGTELTKGLVWKGSEHEVKAGLAEDLTMTLPRGQMQKLQASMVLEPQLMAPIQQGQVIGKVEVKLDDKVIRSADLVALNAVEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ala-D-ala-carboxypeptidase
publication title Structural analysis of the role of Pseudomonas aeruginosa penicillin-binding protein 5 in beta-lactam resistance.
pubmed doi rcsb
source organism Pseudomonas aeruginosa ucbpp-pa14
molecule tags Hydrolase
total genus 101
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase
A PF07943 PBP5_C Penicillin-binding protein 5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.410.10 Mainly Beta Sandwich Peptidoglycan synthesis regulatory factor (PBP3), Domain 2 D-Ala-D-Ala carboxypeptidase, C-terminal domain 4k91A02
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4k91A01
5FA7A 1K55A 2H0TA 1NZOA 2Y2OA 3HLBA 3ISGA 1ALQA 2QPNA 4GB7A 4B4XA 2ZJ9A 3G2YA 5F82A 4N9LA 2WZXA 3WRTA 4S2NC 3IF6A 2HP5A 4WBGA 5HAPA 1LL5A 3S4XA 1PZPA 1IYQA 5DF9A 4BL2A 3NDEA 1YLZA 4ZTKA 4QD4A 5EECA 1FCMA 4R4SA 3M6BA 2Y91A 4R3JA 4Y0TA 1NZUA 2ZM2A 4E3JA 3LCEA 5TR7A 4ZDXA 4QU3A 3M2JA 1IYOA 4R1GA 2BLSA 5CERA 1PW8A 1J9MA 2J9PA 1S6RA 4P87A 4Y0OA 4BJPA 1ZKJA 3BFGA 4JXSA 4OKPA 1BLSA 1EI5A 4M3KA 3RXXA 5GLBA 3ZCZA 3G4PA 1LL9A 2H5SA 2X01A 3ZVTA 3I7JA 4LCMA 2J9OA 1W8YA 1O7EA 4XXRA 5HARA 3UPOA 1KE0A 1KE4A 3BM6A 1PWCA 3MXSA 4MLLA 3E2KA 1CK3A 3A3IA 2P74A 3WWXA 2RCXA 3PBSA 2EFXA 3NCKA 2G2WA 4KZ4A 1FOFA 1CEFA 5TFQA 2XD1A 3FZCA 4S2KA 4KZ3A 1XKZA 3A3JA 1XPBA 1DJCA 1L2SA 3DWKA 4KG2A 2A49A 1LHYA 1I2WA 2WK0A 4JF4A 1K54C 3LY3A 4QJGA 2Z2LB 3WS4A 3UN7A 1Y54A 3UE3A 4LCLA 1N9BA 5E2EA 5CGXA 4ZAMA 2WKIA 5GHYA 5A93A 1YMSA 3QHYA 5GHZA 1I2SA 4IBXA 3IWQA 5FQKA 2V20A 1JVJA 4ZJ2A 3SS5A 3SS4A 3ZG8B 1NYMA 2XDMA 1HD8A 1ZG6A 3CJMA 3UPPA 2XFSA 1RGYA 5EUAA 4OH0A 1GHIA 3AGFA 4GD8A 5EVIB 2ZMAA 5CEBA 1N4OA 2Y2NA 4EBPA 3VP1A 1NYYA 1ONHA 1XXMA 1ZC2A 5CTNA 3IWOA 5FQJA 5FQQA 5HAQA 3E2LA 3WS0A 4DRTA 5EVIC 2OLVA 2Y2IA 1TDGA 1AXBA 1SHVA 1E3UA 5AQAA 4GDBA 4NETA 4S2PA 1Q2PA 5FASA 4X69A 3GR2A 3N4IA 4KG5A 1W79A 2PBYA 2IWDA 1JTDA 3IQAA 3OZHA 4S2IA 3VP0A 4L0LA 5CGWA 3S22A 3WS2A 4BENA 3IWIA 1DJBA 2Y59A 4LV3A 2Y55A 3IXBA 4X6TA 4Y0UA 5CXWA 4HESA 3V3SA 3ZDJA 4BLMA 2WKEA 2Y2KA 5CHMA 1L0FA 2IWCA 2JE5A 1FR1A 1K4FA 1MWRA 3BLSA 4KQOA 4OPRA 1Q2QA 2HDQA 3HLCA 1FSWA 3BECA 1ES5A 1BTLA 4LV0A 4WMCD 4R4RA 3VFHA 4DXBA 4OOMA 2HDRA 3SH7A 1H8ZA 4B88A 4DE1A 3Q7VA 4X55A 3BEBA 3M6HA 4OPQA 3CZDA 3C4OA 4KZ9A 4FH4A 4N92A 3Q81A 1XP4A 1BT5A 3NDGA 3PBOA 5DTKA 3TG9A 3ZFZA 3MKFA 2EXBA 3IF5A 3O87A 4P85A 1IYPA 3HUOA 4U0XA 2JCHA 5BOHA 4S2NA 1MWTA 4R0QA 2Y2JA 4ZJ1A 3CMZA 4IEDA 2HDUA 1JTGA 4E3KA 1IEMA 3BFDA 4JXVA 2WGIA 3BFCA 3G35A 3GTCA 1E3UD 5FATA 5FQ9A 5CECA 3IXHA 4DXCA 1KGGA 3ZG0A 1W7FA 2WADA 4QY5A 3UPNA 4JKTA 1YM1A 3N7WA 1M40A 2DCFA 1YLWA 4GDNA 5DF7A 4OOYA 1PWDA 3N6IA 3G2ZA 3ZNTA 5FAOA 4FSFA 1YLYA 4DE0A 2QZ6A 4F94A 1G6AA 3P09A 3GVBA 4C6YA 1MKIA 5AQ9A 2Q9NA 1E4DA 4XUXA 3MFDA 4JXWA 4DDSA 2HPBA 1XGJA 3GMWA 1YLTA 4OPYA 4PMAA 3Q82A 2WKHA 5I94A 2EX6A 3WS5A 4MBFA 3EQUA 1ESIA 3N8SA 4FH2A 4D2OA 3C4PA 1VQQA 2Y2PA 5A92A 4OONA 1TVFA 3G30A 2A3UA 3N8LA 3HBRA 1GA9A 1PZOA 1K54A 3TOIA 1PI4A 3IT9A 4IVKA 5CHUA 4OP5A 4KG6A 1PWGA 5GLAA 3MKEA 1GCEA 1BLCA 3A3FA 1SDNA 4ID4A 4JLFA 1ERMA 3HUMA 1M6KA 1MWUA 4HBTA 2Z2MB 5M1AA 3HLDA 4OOLA 1K56D 1K55C 3OCNA 1GA0A 3C7VA 2XD5A 1KDWA 4YFMA 3EQVA 3P98A 3GV9A 5JYOA 5EVIA 4GOGA 2WGVA 2XF3A 1CI9A 4OVDA 4U3TA 2Y2LA 4E3OA 1NJ4A 2C6WB 5F1FA 1XA1A 3FKWA 3IH8A 3S1YA 1K57C 1IKGA 1YMXA 3GRJA 1BUEA 4Y7PA 2EX2A 2JBFA 2Y2QA 3DW0A 3G32A 1YLPA 3G31A 3AGDA 3VP3A 4DF6A 5DTSA 3TSGA 2V1ZA 1RP5A 4K0XA 2XFTA 1ES3A 4JPMA 4OPZA 5EOOA 2V2FF 4RX2A 2ZM8A 3WS1A 5JYPA 1XX2A 1NY0A 3PBTA 3ZVWA 4U0TA 2Y2HA 2ZLYA 1JWZA 2Y2GA 2OV5A 1OMEA 2X02A 2R9XA 1GHPA 4KZ5A 3GQZA 2ZQ7A 3IXDA 5CHJA 3ITBA 3JYIA 5DTTA 3RJUA 4E3MA 4PPRA 3MZDA 1Z6FA 4WZ5A 5GHXA 3SOIA 1H8YA 3FV7A 1K4EA 3LEZA 3V3RA 1WE4A 2EX8A 2ZC4B 4S2LA 4S2OA 4FD8A 1NXYA 2BG1A 4H8RA 3PBRA 4RVAA 4KZAA 5FAPA 3B3XA 1JWVA 4PM8A 1SDEA 2WUQA 4JF5A 3QNBA 4B4ZA 4EWFA 4GN2A 4OP8A 4UA7A 1K6SA 2ZC5B 3VOZA 1E25A 1TEMA 3HLFA 3M2KA 3SS3A 3UDFA 2WGWB 2J7VA 2ZQ9A 4WELA 4X56A 4E3NA 1WYCA 1L0GA 1FQGA 3W8KA 2WAFA 3OPRA 3ZHHA 4C3QA 2X71A 3C5AA 4OLDA 2XLNA 5CGSA 1KVMA 3NI9A 1ESUA 4A5RA 3HVFA 5E2GA 4EBLA 4P6BA 1U60A 2ZD8A 3IHAA 4CPKA 5KSCA 2HDSA 4JXGA 4ZJ3A 4E3IA 5FQMA 5HL1A 3PBQA 4OQIA 1ES4A 1PYYA 2I72A 4OQGA 4GKUA 4QY6A 5FSRA 3ZG7B 4LV1A 1LI0A 1HVBA 1PIOA 3FYZA 3V50A 4UHUA 5J8XA 2ZQDA 4YINA 3HREA 4CJNA 4GNUA 2XQZA 4EV4A 4RYEA 1W5DA 3AGEA 2ZC6B 4PM9A 5EOEA 3WRZA 2DNSA 3MZEA 2FFYA 4QB8A 5L2FA 5DF8A 1C3BA 2WZZA 2HP6A 4PM7A 1RCJA 2ZQAA 5F83A 3OPLA 5A91A 2DRWA 4N1XA 1BSGA 4HBUA 1KDSA 3SH8A 1MBLA 2H10A 1BULA 3PTEA 3CG5A 1L0DA 3IH9A 3V39A 3W4OA 2WAEA 2OSUA 1BLPA 5AQ7A 3UO9A 3VSLA 4O7DA 1ONGA 3DTMA 2C5WB 2P9VB 1G68A 3BYDA 4WZ4A 4WEJA 3VFFA 1K38A 3O3VA 2XR0A 1FSYA 3G34A 5E2FA 5KMWA 5A90A 3UE0A 5F1GA 1PI5A 2JC7A 5FI7A 1DJAA 1K57A 3OPHA 4S2JA 5FQIA 1ES2A 5GLCA 4MBKA 4JBFA 1MPLA 2QMIA 2XH9A 1FCOA 4BD1A 2VGJA 5U47A 1QMEA 2EX9A 3LY4A 5E43A 4Z9QA 1ZG4A 4Q8IA 5FI6A 4MBHA 1ERQA 2ZC7A 5FAQA 3IXGA 3IF6B 5KZHA 1EROA 4NK3A 1IYSA 1WYBA 1BZAA 3MXRA 3HLWA 3ZG9B 4EBNA 1KE3A 3IF6C 5FDHA 3DWZA 2FFFB 5IHVA 1MXOA 2OLUA 1NRFA 2XGNA 2ZQ8A 2Q9MA 3HUNA 4JF6A 2IWBA 4LV2A 4E3LA 4LENA 3D4FA 1KGEA 5AQBA 4BD0A 4MNRA 2EXAA 5HAIA 2PU2A 4E6XA 4GZBA 3LO7A 4UA9A 5EPHA 1CEGA 1LI9A 2ZC3B 4IBRA 3FWLA 4KENB 3V5MA 1K6RA 3PAGA 4KZ6A 2HP9A 4WMCA 5HX9A 4S2MA 1PW1A 3QNCA 3UDIA 4WEKA 2J8YA 4IVIA 4BL3A 4RX3A 1YLJA 2VGKA 3NC8A 4DDYA 1VM1A 4BQMA 1LLBA 1RGZA 3GSGA 1DY6A 4ZBEA 4GD6A 4QHCA 4KQRA 4FCFA 5D3OA 1TDLA 1KVLA 2UWXA 1GHMA 5EE8A 1HTZA 4UA6A 5GLDA 2B5RA 4EUZA 4PM6A 4N1HA 3A3DA 1HZOA 4P0MA 5E2HA 5G18A 1W8QA 2WGWA 2H0YA 4C75A 3ITAA 3NBLA 1XGIA 5KSHA 1KGFA 1O07A 4OQ0A 1IKIA 3IHBA 2E8IA 4KZ8A 3UNWA 1I5QA 5EVID 3W4QA 3ZGAB 4XUZA 5HW3A 1FR6A 4HEFA 4RA7A 3HLEA 4N9KA 1SKFA 3NIAA 4R3BA 4UAAA 1S0WA 2PU4A 3HL9A 4X68A 3RXWA 4K91A 3MBZA 1IELA 1SCWA 1L0EA 3NY4A 2XEPA 4DE2A 5M19A 3BRMA 3VP2A 3OC2A 1EWZA 4DKIA 3VMAA 5CEDA 1CI8A 4KZBA 3PBNA 1BLHA 1MY8A 1MWSA 3PAEA 4KQQA 3FKVA 2CC1A 2G2UA 2R9WA 1YQSA 3O88A 4WM9A 4DE3A 4K0WA 5GL9A 3VP4A 2XK1A 3ZG5A 4OLGA 5CTMA 3A3EA 3Q1FA 4KZ7A 3UE1A 2Y2MA 1FCNA 3W4PA 4MEZA 4E6WA 3HLGA 3BLMA 4WZ5C 3VSKA 1H5XA 3N8RA 5TGFA 3SH9A 2RL3A 2ZQCA 1XA7A 3OPPA 3OCLA 5CRFA 1K25A 3O86A 4R23A 3UY6A 4EQIA 3C7UA 3Q7VB 5FI2A 5M18A 3MZFA 3BFEA 3ZNYA 2P9VA 2GDNA 1YT4A 3BFFA 5DVAA 2Y4AA 3UDXA 5HFOA 4PM5A 2EFUA 1JWPA 3Q07A 3VOYA 2WYXA 1K56A 5EVLA 2ZM0A 4WYYA 4X53A 4OQHA 3Q7ZA 1QMFA
chains in the Genus database with same CATH superfamily
2Y2OA 3R7WB 1NZOA 3ISGA 1OTDA 2ZMVA 2QPNA 5TBMB 5F82A 2YKHA 4B4XA 4LFUA 2HJ9C 3ZQ5A 5HAPA 5L10A 1IYQA 3VE4A 3NDEA 4JGOA 4DMZA 3M6BA 2V9AA 5LBRA 4Y0TA 1YPRA 5FEGA 4EU0A 1GSWA 2ZM2A 4E3JA 3LCEA 4IUKA 4DN0A 3M2JA 1PW8A 2J9PA 1ZKJA 4JXSA 4OKPA 1BLSA 4LPZA 5HARA 3UPOA 3MXSA 3A3IA 2P74A 2IA2A 2RCXA 1XFQA 5HD3A 1T1BA 2FH5A 1L2SA 3NJAA 2WK0A 1K54C 4QJGA 3WS4A 4BBTA 4GS9B 4LCLA 4DJ2A 1I2SA 3H7WB 3IWQA 5FQKA 2V20A 2VEAA 3ZG8B 1NYMA 1S67L 2H28A 3CJMA 3UPPA 5EUAA 3AGFA 2V0UA 2PR5A 2ZMAA 2Y2NA 4EBPA 3VP1A 1XXMA 5CTNA 3KSFA 3IWOA 5HAQA 4R70A 1V9YA 5EVIC 3IS2B 2Y2IA 1AXBA 3GR2A 1W79A 3LIEA 3F1NA 3IQAA 4L0LA 5CGWA 3IWIA 1DJBA 4X6TA 3ZDJA 3QP1A 1L0FA 2D01A 1GSVA 1ES5A 4WMCD 3S7QA 4OOMA 3SH7A 5IT5A 3BEBA 3CZDA 4KZ9A 4N92A 3T4QA 4K08A 1XP4A 3NDGA 3PBOA 3CPTA 3TG9A 2EXBA 1IYPA 2D02A 2PRFA 5BOHA 4R0QA 2J80A 4EETB 1IEMA 3DBAA 1VETA 3BFDA 4NG2A 3GTCA 4QY5A 5FEFA 3T50A 4OOYA 5AJGA 1YLYA 3GDIA 4DE0A 3GVBA 4C6YA 3MFDA 4JXWA 4DDSA 1XGJA 3H9WA 1YLTA 4HJ6A 2Y79A 2EX6A 3EQUA 5F6AA 2GZAA 2EWWA 4D2OA 2PD8A 1VQQA 4OONA 1TVFA 1K54A 1IFQA 3IT9A 3MR0A 1ERMA 3T1SA 3NOUC 1T19A 4L9GA 1K56D 4QWOA 1F9IA 1K55C 3BQAA 2XD5A 4YFMA 5EVIA 4GOGA 4U3TA 4E3OA 1MC0A 1K57C 1IKGA 3GRJA 4Y7PA 2EX2A 2HGVA 2Y2QA 3G32A 1PNEA 2W0NA 4YNRA 2V1ZA 4MN7A 3LR3A 4JPMA 4OPZA 2ZM8A 5JYPA 4U0TA 2ZLYA 3LYXA 1OMEA 1GHPA 4LGWA 3EEHA 5DTTA 4PPRA 3BY8A 2W3DA 1Z6FA 1XFNA 3FV7A 2NUTC 2ZC4B 4FD8A 2BG1A 4GW9A 4WLAA 1N9NA 4PM8A 2WUQA 3QNBA 3M2KA 3HLFA 5C5KA 4UQIS 4E3NA 3KX0X 1L0GA 3W8KA 4C3QA 2WAFA 3OPRA 3HCYA 4PHTA 4ETZA 4NEED 4ZJ3A 2JHEA 3PBQA 2I72A 5DFXA 1PIOA 4UHUA 5J8XA 4YINA 4GNUA 5EM0A 3IX8A 2FFYA 4ARZA 1CF0A 5L2FA 5DF8A 3F1OB 4R3AA 3T1XA 4PM7A 3E0YA 1BSGA 1V9ZA 3PTEA 3IH9A 3L9KA 4CQHA 4ARZB 3W4OA 4X25A 3DTMA 1G68A 4BBVA 4WEJA 4Y13A 1K38A 1LT0A 3G34A 5A90A 3UE0A 1BYWA 5FI7A 3C38A 3D72A 1K57A 3OPHA 4S2JA 1YSQA 1FCOA 2VGJA 4Q8IA 4Z9QA 5HDCA 4EUVA 3IXGA 3JVUA 5KZHA 4NK3A 1WYBA 3UMDA 3IF6C 1NRFA 2XGNA 1KGEA 5AVEA 4MNRA 5HAIA 2PU2A 3LO7A 4I3JA 3OBFA 4IBRA 3FWLA 5DKKA 1NLZA 5FL3A 4B9OA 4WN5A 4KQRA 1TDLA 1SZVA 3T1RA 1HTZA 4UA6A 4EUZA 4YWZA 2XSSA 1NWZA 5E2HA 4CLCB 5KSHA 1XGIA 1KGFA 1X0OA 3UNWA 1VEUB 3ZGAB 2W1TB 4RA7A 1MZUA 3HLEA 4CLCE 1OT9A 4R3BA 4UAAA 2OOLA 2I9VA 1STZA 3RXWA 2L4RA 4I3AA 3MBZA 1L0EA 3NY4A 4X1LA 4DE2A 1ZTUA 2PHYA 3PAEA 3TRCA 4KQQA 3FKVA 4WM9A 5HD5A 4K0WA 1N9OA 5GL9A 3VP4A 3ZG5A 4OLGA 2ZMFA 1FCNA 3W4PA 4UQIM 3BLMA 4WZ5C 3VSKA 3N8RA 3SH9A 4H6JA 5KIZA 3MF0A 5CRFA 1K25A 3O86A 3Q7VB 4FOFA 2GDNA 1N9LA 3H82B 3LR5A 3QP2A 2EFUA 4L9FA 3Q07A 3T4JA 2B18A 3T4TA 4WYYA 3RJUA 4EXOA 1ALQA 3T4LA 3G2YA 4N9LA 3WRTA 4AFIA 4G3VA 5I5LA 3IF6A 2HP5A 2M7UA 1PZPA 5DF9A 3LIBA 4Q0IA 4D60A 2P04A 4R4SA 4R3JA 1NZUA 5A8BA 4ZDXA 5K5BA 2PYPA 3FPVA 3ZCZA 2X01A 4LCMA 4XT2A 1W8YA 1KE0A 1PWCA 4MLLA 3E2KA 1CK3A 1F98A 3PBSA 4KZ4A 5TFQA 1TD5A 3FZCA 4NXEA 4KZ3A 1XKZA 3EEAA 2XRNA 4KG2A 3VE3A 2Z2LB 3UN7A 3UE3A 1N9BA 3KYQA 5HDDA 4IBXA 4BBUA 3GECA 3SS4A 2XDMA 3TW8A 4OH0A 1GHIA 4GD8A 3E2LA 4DJ3A 2Z6DA 4HIAA 4DRTA 2VLGA 2OLVA 1XJ3A 5AQAA 4NETA 4QPRA 3T12B 2PBYA 2IWDA 3VP0A 3S22A 3WS2A 1ODVA 2WKEA 3O5YA 1FR1A 3BLSA 3HLCA 2HDQA 4Z1WA 1G6OA 3HJIA 3BECA 1BTLA 2W3FA 1LL8A 4DE1A 4LLOB 3C4OA 4FH4A 3ZFZA 3IF5A 4U0XA 3UB6A 3HUOA 1MWTA 3R7WA 2Y2JA 4ZJ1A 2JKRM 4E3KA 5TBMA 4JXVA 2WGIA 5FQ9A 5CECA 4DXCA 1KGGA 3ZG0A 2V8CA 3UPNA 1M40A 1PWDA 3E4PA 3G2ZA 2V1BA 4F94A 2ACGA 1MKIA 1E4DA 1UGUA 3MXQA 4PMAA 2WKHA 3A0SA 1TS6A 3WS5A 4MMNA 2Y2PA 2VZWA 5A92A 2A3UA 4WUJA 3HBRA 1GA9A 5CX7A 1YSPA 2Y8HA 2ZL1B 4IVKA 5CHUA 1PWGA 1GCEA 5MC7A 3A3FA 3R4KA 2CMNA 1SDNA 4ID4A 1MWUA 4GS9A 5M1AA 3HLDA 4BWIA 4R38A 3H7WA 4Q0JA 4GHIB 1K0KA 3GV9A 1CI9A 4OVDA 4IJGA 3T4KA 1XA1A 3FKWA 1A0KA 1BUEA 3EOIA 2J3WA 2JBFA 3IS2A 1YLPA 3G31A 3T4SA 1DRMA 3KYZA 3AGDA 3VP3A 1LSWA 2UV0E 3TSGA 2XFTA 1ZHHB 2YKFA 1NY0A 2M1CA 1JWZA 3UMEA 4I3IA 2GX5A 5IU1A 2ZQ7A 3JPUA 4HNBA 3ITBA 3NULA 3MQQA 4E3MA 3VOLA 1S4SA 5GHXA 3G6OA 1P9RA 3V3RA 4S2OA 1NXYA 4H8RA 2KOIA 4KZAA 2K2NA 1SDEA 1EW0A 4OP8A 3VOZA 3UDFA 5DKLA 4NXGA 3VV4A 1YAXA 1KVMA 5L8MA 1ESUA 4EBLA 4P6BA 1D7EA 2DMWA 4HH3A 5HPIA 4JGQA 2QWSA 1ES4A 1PYYA 4GKUA 4QY6A 5FSRA 4LV1A 1LI0A 4RYEA 3AGEA 2ZC6B 2QJ5A 3WRZA 3F1PB 2W3HA 1VB6A 2HP6A 4HJ3A 5F83A 5J7EA 2MJ6A 4N1XA 1ACFA 1KDSA 2H10A 1BULA 3U4LP 1L0DA 4O8GA 3V39A 5AQ7A 1TS8A 3VSLA 3LR0A 4ME4A 2OWHA 4WZ4A 3VFFA 2XR0A 4G3WA 5KMWA 1OTEA 5F1GA 1G5UA 1OTIA 3C30A 4O01A 1MPLA 2QMIA 2XH9A 5E43A 3LY4A 2HJEA 1ERQA 1IOUA 1EROA 1IYSA 3K2NA 1BZAA 1PRQA 3MXRA 3QP6A 3HLWA 2QJ7A 5FDHA 2O9AA 1MXOA 2OLUA 3EWKA 2ZQ8A 2Q9MA 3HUNA 3RH8B 4JF6A 3D4FA 5AQBA 3OOVA 1KOUA 4E6XA 5EPHA 4KENB 2JN7A 1S4RA 4S2MA 1PW1A 3QNCA 4NXFA 4WEKA 4BL3A 4RX3A 1YLJA 2VGKA 1VM1A 1RGZA 4ZBEA 2W3EA 1VHMA 1KVLA 2J3TC 5EE8A 3UB9A 1UWNX 5GLDA 2A24B 3A3DA 1HZOA 1P97A 4C75A 2P08A 1O07A 4KZ8A 3IHBA 1LSXA 1I5QA 1J3WA 5EVID 4XUZA 4CLCC 3B47A 1SKFA 4X68A 4K91A 2BASA 1IELA 1TS7A 3TJZC 2XEPA 5M19A 3BRMA 3ICYA 5CEDA 4KZBA 3FG8A 4IHQA 2CC1A 2G2UA 2L0WA 1OTAA 3F1OA 4DE3A 4MCWA 3Q1FA 3UE1A 2Y2MA 3HLGA 2ZQCA 2HV1A 3NHQA 2PBDP 3KSGA 3UY6A 4EQIA 3FPWA 3ZNYA 3EGDC 2VV8A 3UDXA 3PYPA 1JWPA 3VOYA 2ZM0A 4X53A 4DKIA 3Q7ZA 5FA7A 1K55A 3HLBA 4GB7A 3S7OA 1T1CA 4II7A 4S2NC 4WBGA 3BJNA 3S4XA 5HL6A 1S66L 4ZTKA 4QD4A 5EECA 1FCMA 4QU3A 4R1GA 2BLSA 2KLIA 1J9MA 4BJPA 1AWIA 3RXXA 4M3KA 2Z6CA 3G4PA 1LL9A 2H5SA 3UB8A 3I7JA 1O7EA 2VA0A 1KE4A 3BM6A 3W2ZA 3WWXA 1FILA 2G2WA 3JVVA 1FOFA 2XD1A 2KDKA 3S7NA 2A49A 1LHYA 3LY3A 4HJ4A 3MQ0A 1Y54A 1SKOB 4ZAMA 1D06A 2WKIA 5GHYA 5A93A 1YMSA 3QHYA 5GHZA 4CLCA 5F69A 1JVJA 1HD8A 1VEUA 1RGYA 3A0VA 3OLOA 2W1TA 5EFWA 1N4OA 4HQAA 1NYYA 5HWWA 3BWLA 5FQQA 3CITA 2GJ3A 1SHVA 1E3UA 5FASA 4GDBA 1Q2PA 2M7VA 3N4IA 3IX3A 4KG5A 1JTDA 2VGLS 4S2IA 4BENA 3V3SA 3IXBA 5CXWA 4HESA 3K3CA 2Y2KA 5CHMA 2IWCA 2JE5A 1K4FA 1MWRA 4PKYA 1FSWA 4PAUA 2HDRA 3Q7VA 4ESPA 4X55A 3M6HA 4OPQA 3H82A 3MKFA 4G3KA 2G7UA 2JCHA 1MKMA 4S2NA 3BQ8A 3CMZA 4EEUA 3BFCA 1E3UD 5FATA 2JKRI 2VV7A 2OAQ1 2WADA 3DTKA 4I39A 5HPFA 4GDNA 5DF7A 2DCFA 2K7SA 3N6IA 3ZNTA 3LIDA 3RTYA 3CHWP 2K31A 1CQAA 2HPBA 3GMWA 1OJ5A 3Q82A 5I94A 2AVXA 2XA7S 1ESIA 3N8SA 4FH2A 5J4EA 4F3LB 4FUWA 1XJ6A 1PI4A 4M4XA 4HH2A 2XROA 4OP5A 5GLAA 3MKEA 4ZRRA 1BLCA 1M6KA 1TF1A 4HBTA 3PR6A 1P9WA 4GJ4A 4KUOA 3C7VA 2PAVP 5JYOA 3IX4A 2WGVA 2XF3A 4HHDA 2Y2LA 2C6WB 3IH8A 4GLQA 3S1YA 2QKPA 3B33A 4DF6A 1OPXA 4IUHA 4K0XA 1F5MA 4RX2A 3BW6A 3WS1A 1S1YA 3PBTA 4KUKA 2Y2GA 2OV5A 2R9XA 4KZ5A 5HDSA 3MZDA 4R6LA 4WZ5A 3SOIA 1K4EA 1DP6A 5HWVA 2Q0OA 1OTBA 3B3XA 3KYEA 4EWFA 4GN2A 3LR4A 1E25A 1TEMA 3SS3A 2VGLM 2WGWB 2J7VA 4WELA 1WYCA 2PD7A 3NOTC 2X71A 4OLDA 3NI9A 2VV6A 3HVFA 4ETXA 5E2GA 1U60A 2ZD8A 5KSCA 2HDSA 4JXGA 1LSVA 3S7PA 4LRYC 1T1AA 3ZG7B 1HVBA 4L9EA 3V50A 2O9CA 2ZQDA 3HREA 4EV4A 3T4OA 1W5DA 5EOEA 2DNSA 3HJKA 3MZEA 4QB8A 3D3OA 1C3BA 2WZZA 1HLUP 1RCJA 5A91A 2ZL1A 2O99A 3SH8A 3CG5A 2WAEA 1BLPA 1ONGA 3CAXA 2C5WB 2P9VB 3O3VA 4WL9A 1FSYA 1W63M 2JC7A 3CLOA 4GHIA 5GLCA 3FC7A 4MBKA 4JBFA 5U47A 1ZG4A 5FI6A 2ZC7A 4HP9A 2XA7M 3LICA 2BTFP 3A0RA 3ZG9B 2FFFB 5G4ZA 5DFYA 1NRJA 3MJQA 4NKPA 1XJ2A 2EXAA 2WKPA 4UA9A 4BMWA 4LRXC 2ZC3B 1LI9A 4Y2FA 1K6RA 3MSHA 4KZ6A 4HP4A 4WMCA 1WA9A 2JKFA 3LFVA 2J8YA 4IVIA 4DDYA 1OT6A 1LLBA 2OWJA 4QHCA 4FCFA 5EV0A 1P0ZA 5TJJA 2B5RA 4N1HA 3KSIA 3NBLA 1DP8A 4OQ0A 3KO6A 3W4QA 1Z09A 1JNUA 2HZ5A 4N9KA 1NLYA 2PU4A 3HL9A 3U2AA 1DP9A 4P6ZS 3C8CA 2O9BA 3OC2A 3QP4A 4GCZA 3VMAA 1CI8A 3F1NB 1BLHA 3F1PA 1MY8A 4Y17A 2R9WA 3PXPA 3BY9A 2XK1A 4EESA 5CTMA 3A3EA 4KZ7A 5TGFA 3OPPA 2QYBA 1UWPX 3MZFA 4PM5A 3CPTB 2WYXA 1K56A 5EVLA 4R23A 2H0TA 2ZJ9A 2JKTI 2WZXA 1VETB 1LL5A 4BL2A 3RFBA 1YLZA 4Y15A 3B42A 2Y91A 4MN5A 5TR7A 3LEQA 2VK3A 1IYOA 5HWTA 5CERA 4Y0OA 1S6RA 4P87A 4Q0HA 3BFGA 1EI5A 5GLBA 3ZVTA 2J9OA 4XXRA 2JKGA 2EFXA 3NCKA 3UB5P 4HOIA 4Y3IA 1CEFA 4MDZA 4S2KA 2WKQA 1XPBA 3A3JA 4I38A 1DJCA 3DWKA 1I2WA 4JF4A 2A24A 3E98A 5E2EA 5CGXA 3CWFA 3SS5A 4ZJ2A 3EGXC 1ZG6A 2XFSA 2P7JA 1XJ4A 5EVIB 5CEBA 3IBJA 2FZ0A 1ONHA 1ZC2A 3KSHA 5FQJA 3CUEC 1PFLA 3WS0A 1TDGA 4S2PA 4X69A 1D1JA 3MQOA 1H8MA 2B02A 5J3WA 3OZHA 3LIFA 4I5SA 2HF6A 1Y4OA 2Y59A 4LV3A 2Y55A 4Y0UA 4BLMA 2EWVA 3E4QA 3LI9A 4KQOA 4OPRA 1Q2QA 3MMHA 4LV0A 4DXBA 4R4RA 3VFHA 1H8ZA 4B88A 1FIKA 3IBRA 3Q81A 1BT5A 5AVFA 2W3GA 5DTKA 3ZYTA 3O87A 4P6ZM 3MS6A 4P85A 4MN6A 2ZBBA 5F68A 4IEDA 2HDUA 1JTGA 2ZOHA 1H3QA 2PT7A 3G35A 5FDSA 2JKTM 3IXHA 2WKRA 2V8FA 1W7FA 4JKTA 1YM1A 3N7WA 1YLWA 4JGRA 5L09A 5FAOA 4FSFA 2QZ6A 1G6AA 3P09A 2EA9A 5AQ9A 2Q9NA 4XUXA 4JGPA 2A2LA 4OPYA 4MBFA 3LGOA 3DTIA 3D9YA 3C4PA 1CJFA 3ULFA 3G30A 3N8LA 4O0PA 1PZOA 2VX8A 3TOIA 4KG6A 4UEYA 4JLFA 1S1ZA 3HUMA 1SKOA 2Z2MB 4PKYG 4OOLA 3OCNA 4LRZE 4YOFA 1GA0A 1KDWA 3CUEA 3EQVA 3SZTA 3P98A 3NOPC 1F2KA 1NJ4A 2OAP1 5F1FA 1YMXA 1Y28A 4KQDA 3DTEA 3MFXA 3NECA 3DW0A 3TE8A 5DTSA 3UE6A 1L3LA 1RP5A 1ES3A 3C2WA 5EOOA 4X1MA 2V2FF 1XX2A 3ZVWA 2R78A 2Y2HA 3T1QB 2X02A 5IS1A 2PYRA 3GQZA 5CHJA 3IXDA 3JYIA 2PDRA 2J3TD 3E4OA 1H8YA 3LEZA 1WE4A 2EX8A 4S2LA 3PBRA 4RVAA 3QP8A 5FAPA 1JWVA 2ZOIA 4JF5A 4B4ZA 4UA7A 4WF0A 1K6SA 2ZC5B 4CLCD 1GSXA 3P7NA 2ZQ9A 4X56A 1FQGA 3ZHHA 3C5AA 4Y5FA 3UB7A 4EERA 2XLNA 5CGSA 4A5RA 4NXBA 3LUQA 4CPKA 3IHAA 4E3IA 3P01A 5FQMA 5HL1A 4OQIA 4OQGA 5DJUA 3LI8A 3FYZA 4CJNA 2XQZA 4FTXA 1OJGA 4PM9A 5F5YA 3LIAA 4F3LA 5HZHA 2ZQAA 1G28A 3OPLA 2DRWA 4HBUA 4EW7A 1MBLA 2VKSA 4H6JB 2OSUA 3UO9A 4O7DA 3BYDA 4EQ1A 4EEPA 5E2FA 2V1AA 2E8JA 1PI5A 1DJAA 3K3DA 5FQIA 1ES2A 4BD1A 1QMEA 2EX9A 1T18A 4MBHA 5FAQA 4HI4A 3IF6B 2W27A 4E04A 4RQ9A 5HSQA 1TS0A 5EM1A 4EBNA 1KE3A 3DWZA 5IHVA 2IWBA 4LV2A 4E3LA 2KX6A 4LENA 4BD0A 1H0MA 4GZBA 3CI6A 1CEGA 3QP5A 4XT2B 4HY8A 3V67A 3V5MA 2LB5A 3PAGA 5L07A 2HP9A 5HX9A 3UDIA 2QHKA 3NC8A 4B93A 2L1MA 4BQMA 3GSGA 1DY6A 4GD6A 5D3OA 2UWXA 1GHMA 5EVEA 2V0WA 4PM6A 4P0MA 5G18A 1W8QA 2WGWA 2GNXA 2H0YA 3ITAA 1IKIA 2O0YA 2E8IA 5HW3A 1FR6A 2W1RA 1YKDA 5DJTA 2LB9A 4HEFA 2INWA 5G4YA 3NIAA 1S0WA 2B95A 1SCWA 1W63Q 3VP2A 1EWZA 3PBNA 1MWSA 2NUPC 3O88A 1YQSA 2PR6A 2VJWA 3L7HA 4MEZA 3DAVA 4E6WA 1H5XA 3SW1A 2RL3A 1XA7A 3OCLA 3C7UA 5FI2A 5M18A 3BFEA 3PHYA 2P9VA 1YT4A 3BFFA 5DVAA 2Y4AA 5HFOA 4OQHA 1QMFA
chains in the Genus database with same CATH topology
5FA7A 1K55A 2H0TA 1NZOA 2Y2OA 3HLBA 3ISGA 1ALQA 2QPNA 4GB7A 4B4XA 2ZJ9A 3G2YA 5F82A 4N9LA 2WZXA 3WRTA 4S2NC 3IF6A 2HP5A 4WBGA 5HAPA 1LL5A 3S4XA 1PZPA 1IYQA 5DF9A 4BL2A 3NDEA 1YLZA 4ZTKA 4QD4A 5EECA 1FCMA 4R4SA 3M6BA 2Y91A 4R3JA 4Y0TA 1NZUA 2ZM2A 4E3JA 3LCEA 5TR7A 4ZDXA 4QU3A 3M2JA 1IYOA 4R1GA 2BLSA 5CERA 1PW8A 1J9MA 2J9PA 1S6RA 4P87A 4Y0OA 4BJPA 1ZKJA 3BFGA 4JXSA 4OKPA 1BLSA 1EI5A 4M3KA 3RXXA 5GLBA 3ZCZA 3G4PA 1LL9A 2H5SA 2X01A 3ZVTA 3I7JA 4LCMA 2J9OA 1W8YA 1O7EA 4XXRA 5HARA 3UPOA 1KE0A 1KE4A 3BM6A 1PWCA 3MXSA 4MLLA 3E2KA 1CK3A 3A3IA 2P74A 3WWXA 2RCXA 3PBSA 2EFXA 3NCKA 2G2WA 4KZ4A 1FOFA 1CEFA 5TFQA 2XD1A 3FZCA 4S2KA 4KZ3A 1XKZA 3A3JA 1XPBA 1DJCA 1L2SA 3DWKA 4KG2A 2A49A 1LHYA 1I2WA 2WK0A 4JF4A 1K54C 3LY3A 4QJGA 2Z2LB 3WS4A 3UN7A 1Y54A 3UE3A 4LCLA 1N9BA 5E2EA 5CGXA 4ZAMA 2WKIA 5GHYA 5A93A 1YMSA 3QHYA 5GHZA 1I2SA 4IBXA 3IWQA 5FQKA 2V20A 1JVJA 4ZJ2A 3SS5A 3SS4A 3ZG8B 1NYMA 2XDMA 1HD8A 1ZG6A 3CJMA 3UPPA 2XFSA 1RGYA 5EUAA 4OH0A 1GHIA 3AGFA 4GD8A 5EVIB 2ZMAA 5CEBA 1N4OA 2Y2NA 4EBPA 3VP1A 1NYYA 1ONHA 1XXMA 1ZC2A 5CTNA 3IWOA 5FQJA 5FQQA 5HAQA 3E2LA 3WS0A 4DRTA 5EVIC 2OLVA 2Y2IA 1TDGA 1AXBA 1SHVA 1E3UA 5AQAA 4GDBA 4NETA 4S2PA 1Q2PA 5FASA 4X69A 3GR2A 3N4IA 4KG5A 1W79A 2PBYA 2IWDA 1JTDA 3IQAA 3OZHA 4S2IA 3VP0A 4L0LA 5CGWA 3S22A 3WS2A 4BENA 3IWIA 1DJBA 2Y59A 4LV3A 2Y55A 3IXBA 4X6TA 4Y0UA 5CXWA 4HESA 3V3SA 3ZDJA 4BLMA 2WKEA 2Y2KA 5CHMA 1L0FA 2IWCA 2JE5A 1FR1A 1K4FA 1MWRA 3BLSA 4KQOA 4OPRA 1Q2QA 2HDQA 3HLCA 1FSWA 3BECA 1ES5A 1BTLA 4LV0A 4WMCD 4R4RA 3VFHA 4DXBA 4OOMA 2HDRA 3SH7A 1H8ZA 4B88A 4DE1A 3Q7VA 4X55A 3BEBA 3M6HA 4OPQA 3CZDA 3C4OA 4KZ9A 4FH4A 4N92A 3Q81A 1XP4A 1BT5A 3NDGA 3PBOA 5DTKA 3TG9A 3ZFZA 3MKFA 2EXBA 3IF5A 3O87A 4P85A 1IYPA 3HUOA 4U0XA 2JCHA 5BOHA 4S2NA 1MWTA 4R0QA 2Y2JA 4ZJ1A 3CMZA 4IEDA 2HDUA 1JTGA 4E3KA 1IEMA 3BFDA 4JXVA 2WGIA 3BFCA 3G35A 3GTCA 1E3UD 5FATA 5FQ9A 5CECA 3IXHA 4DXCA 1KGGA 3ZG0A 1W7FA 2WADA 4QY5A 3UPNA 4JKTA 1YM1A 3N7WA 1M40A 2DCFA 1YLWA 4GDNA 5DF7A 4OOYA 1PWDA 3N6IA 3G2ZA 3ZNTA 5FAOA 4FSFA 1YLYA 4DE0A 2QZ6A 4F94A 1G6AA 3P09A 3GVBA 4C6YA 1MKIA 5AQ9A 2Q9NA 1E4DA 4XUXA 3MFDA 4JXWA 4DDSA 2HPBA 1XGJA 3GMWA 1YLTA 4OPYA 4PMAA 3Q82A 2WKHA 5I94A 2EX6A 3WS5A 4MBFA 3EQUA 1ESIA 3N8SA 4FH2A 4D2OA 3C4PA 1VQQA 2Y2PA 5A92A 4OONA 1TVFA 3G30A 2A3UA 3N8LA 3HBRA 1GA9A 1PZOA 1K54A 3TOIA 1PI4A 3IT9A 4IVKA 5CHUA 4OP5A 4KG6A 1PWGA 5GLAA 3MKEA 1GCEA 1BLCA 3A3FA 1SDNA 4ID4A 4JLFA 1ERMA 3HUMA 1M6KA 1MWUA 4HBTA 2Z2MB 5M1AA 3HLDA 4OOLA 1K56D 1K55C 3OCNA 1GA0A 3C7VA 2XD5A 1KDWA 4YFMA 3EQVA 3P98A 3GV9A 5JYOA 5EVIA 4GOGA 2WGVA 2XF3A 1CI9A 4OVDA 4U3TA 2Y2LA 4E3OA 1NJ4A 2C6WB 5F1FA 1XA1A 3FKWA 3IH8A 3S1YA 1K57C 1IKGA 1YMXA 3GRJA 1BUEA 4Y7PA 2EX2A 2JBFA 2Y2QA 3DW0A 3G32A 1YLPA 3G31A 3AGDA 3VP3A 4DF6A 5DTSA 3TSGA 2V1ZA 1RP5A 4K0XA 2XFTA 1ES3A 4JPMA 4OPZA 5EOOA 2V2FF 4RX2A 2ZM8A 3WS1A 5JYPA 1XX2A 1NY0A 3PBTA 3ZVWA 4U0TA 2Y2HA 2ZLYA 1JWZA 2Y2GA 2OV5A 1OMEA 2X02A 2R9XA 1GHPA 4KZ5A 3GQZA 2ZQ7A 3IXDA 5CHJA 3ITBA 3JYIA 5DTTA 3RJUA 4E3MA 4PPRA 3MZDA 1Z6FA 4WZ5A 5GHXA 3SOIA 1H8YA 3FV7A 1K4EA 3LEZA 3V3RA 1WE4A 2EX8A 2ZC4B 4S2LA 4S2OA 4FD8A 1NXYA 2BG1A 4H8RA 3PBRA 4RVAA 4KZAA 5FAPA 3B3XA 1JWVA 4PM8A 1SDEA 2WUQA 4JF5A 3QNBA 4B4ZA 4EWFA 4GN2A 4OP8A 4UA7A 1K6SA 2ZC5B 3VOZA 1E25A 1TEMA 3HLFA 3M2KA 3SS3A 3UDFA 2WGWB 2J7VA 2ZQ9A 4WELA 4X56A 4E3NA 1WYCA 1L0GA 1FQGA 3W8KA 2WAFA 3OPRA 3ZHHA 4C3QA 2X71A 3C5AA 4OLDA 2XLNA 5CGSA 1KVMA 3NI9A 1ESUA 4A5RA 3HVFA 5E2GA 4EBLA 4P6BA 1U60A 2ZD8A 3IHAA 4CPKA 5KSCA 2HDSA 4JXGA 4ZJ3A 4E3IA 5FQMA 5HL1A 3PBQA 4OQIA 1ES4A 1PYYA 2I72A 4OQGA 4GKUA 4QY6A 5FSRA 3ZG7B 4LV1A 1LI0A 1HVBA 1PIOA 3FYZA 3V50A 4UHUA 5J8XA 2ZQDA 4YINA 3HREA 4CJNA 4GNUA 2XQZA 4EV4A 4RYEA 1W5DA 3AGEA 2ZC6B 4PM9A 5EOEA 3WRZA 2DNSA 3MZEA 2FFYA 4QB8A 5L2FA 5DF8A 1C3BA 2WZZA 2HP6A 4PM7A 1RCJA 2ZQAA 5F83A 3OPLA 5A91A 2DRWA 4N1XA 1BSGA 4HBUA 1KDSA 3SH8A 1MBLA 2H10A 1BULA 3PTEA 3CG5A 1L0DA 3IH9A 3V39A 3W4OA 2WAEA 2OSUA 1BLPA 5AQ7A 3UO9A 3VSLA 4O7DA 1ONGA 3DTMA 2C5WB 2P9VB 1G68A 3BYDA 4WZ4A 4WEJA 3VFFA 1K38A 3O3VA 2XR0A 1FSYA 3G34A 5E2FA 5KMWA 5A90A 3UE0A 5F1GA 1PI5A 2JC7A 5FI7A 1DJAA 1K57A 3OPHA 4S2JA 5FQIA 1ES2A 5GLCA 4MBKA 4JBFA 1MPLA 2QMIA 2XH9A 1FCOA 4BD1A 2VGJA 5U47A 1QMEA 2EX9A 3LY4A 5E43A 4Z9QA 1ZG4A 4Q8IA 5FI6A 4MBHA 1ERQA 2ZC7A 5FAQA 3IXGA 3IF6B 5KZHA 1EROA 4NK3A 1IYSA 1WYBA 1BZAA 3MXRA 3HLWA 3ZG9B 4EBNA 1KE3A 3IF6C 5FDHA 3DWZA 2FFFB 5IHVA 1MXOA 2OLUA 1NRFA 2XGNA 2ZQ8A 2Q9MA 3HUNA 4JF6A 2IWBA 4LV2A 4E3LA 4LENA 3D4FA 1KGEA 5AQBA 4BD0A 4MNRA 2EXAA 5HAIA 2PU2A 4E6XA 4GZBA 3LO7A 4UA9A 5EPHA 1CEGA 1LI9A 2ZC3B 4IBRA 3FWLA 4KENB 3V5MA 1K6RA 3PAGA 4KZ6A 2HP9A 4WMCA 5HX9A 4S2MA 1PW1A 3QNCA 3UDIA 4WEKA 2J8YA 4IVIA 4BL3A 4RX3A 1YLJA 2VGKA 3NC8A 4DDYA 1VM1A 4BQMA 1LLBA 1RGZA 3GSGA 1DY6A 4ZBEA 4GD6A 4QHCA 4KQRA 4FCFA 5D3OA 1TDLA 1KVLA 2UWXA 1GHMA 5EE8A 1HTZA 4UA6A 5GLDA 2B5RA 4EUZA 4PM6A 4N1HA 3A3DA 1HZOA 4P0MA 5E2HA 5G18A 1W8QA 2WGWA 2H0YA 4C75A 3ITAA 3NBLA 1XGIA 5KSHA 1KGFA 1O07A 4OQ0A 1IKIA 3IHBA 2E8IA 4KZ8A 3UNWA 1I5QA 5EVID 3W4QA 3ZGAB 4XUZA 5HW3A 1FR6A 4HEFA 4RA7A 3HLEA 4N9KA 1SKFA 3NIAA 4R3BA 4UAAA 1S0WA 2PU4A 3HL9A 4X68A 3RXWA 4K91A 3MBZA 1IELA 1SCWA 1L0EA 3NY4A 2XEPA 4DE2A 5M19A 3BRMA 3VP2A 3OC2A 1EWZA 4DKIA 3VMAA 5CEDA 1CI8A 4KZBA 3PBNA 1BLHA 1MY8A 1MWSA 3PAEA 4KQQA 3FKVA 2CC1A 2G2UA 2R9WA 1YQSA 3O88A 4WM9A 4DE3A 4K0WA 5GL9A 3VP4A 2XK1A 3ZG5A 4OLGA 5CTMA 3A3EA 3Q1FA 4KZ7A 3UE1A 2Y2MA 1FCNA 3W4PA 4MEZA 4E6WA 3HLGA 3BLMA 4WZ5C 3VSKA 1H5XA 3N8RA 5TGFA 3SH9A 2RL3A 2ZQCA 1XA7A 3OPPA 3OCLA 5CRFA 1K25A 3O86A 4R23A 3UY6A 4EQIA 3C7UA 3Q7VB 5FI2A 5M18A 3MZFA 3BFEA 3ZNYA 2P9VA 2GDNA 1YT4A 3BFFA 5DVAA 2Y4AA 3UDXA 5HFOA 4PM5A 2EFUA 1JWPA 3Q07A 3VOYA 2WYXA 1K56A 5EVLA 2ZM0A 4WYYA 4X53A 4OQHA 3Q7ZA 1QMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FA7 A;  1K55 A;  2H0T A;  1NZO A;  2Y2O A;  3HLB A;  3ISG A;  1ALQ A;  2QPN A;  4GB7 A;  4B4X A;  2ZJ9 A;  3G2Y A;  5F82 A;  4N9L A;  2WZX A;  3WRT A;  4S2N C;  3IF6 A;  2HP5 A;  4WBG A;  5HAP A;  1LL5 A;  3S4X A;  1PZP A;  1IYQ A;  5DF9 A;  4BL2 A;  3NDE A;  1YLZ A;  4ZTK A;  4QD4 A;  5EEC A;  1FCM A;  4R4S A;  3M6B A;  2Y91 A;  4R3J A;  4Y0T A;  1NZU A;  2ZM2 A;  4E3J A;  3LCE A;  5TR7 A;  4ZDX A;  4QU3 A;  3M2J A;  1IYO A;  4R1G A;  2BLS A;  5CER A;  1PW8 A;  1J9M A;  2J9P A;  1S6R A;  4P87 A;  4Y0O A;  4BJP A;  1ZKJ A;  3BFG A;  4JXS A;  4OKP A;  1BLS A;  1EI5 A;  4M3K A;  3RXX A;  5GLB A;  3ZCZ A;  3G4P A;  1LL9 A;  2H5S A;  2X01 A;  3ZVT A;  3I7J A;  4LCM A;  2J9O A;  1W8Y A;  1O7E A;  4XXR A;  5HAR A;  3UPO A;  1KE0 A;  1KE4 A;  3BM6 A;  1PWC A;  3MXS A;  4MLL A;  3E2K A;  1CK3 A;  3A3I A;  2P74 A;  3WWX A;  2RCX A;  3PBS A;  2EFX A;  3NCK A;  2G2W A;  4KZ4 A;  1FOF A;  1CEF A;  5TFQ A;  2XD1 A;  3FZC A;  4S2K A;  4KZ3 A;  1XKZ A;  3A3J A;  1XPB A;  1DJC A;  1L2S A;  3DWK A;  4KG2 A;  2A49 A;  1LHY A;  1I2W A;  2WK0 A;  4JF4 A;  1K54 C;  3LY3 A;  4QJG A;  2Z2L B;  3WS4 A;  3UN7 A;  1Y54 A;  3UE3 A;  4LCL A;  1N9B A;  5E2E A;  5CGX A;  4ZAM A;  2WKI A;  5GHY A;  5A93 A;  1YMS A;  3QHY A;  5GHZ A;  1I2S A;  4IBX A;  3IWQ A;  5FQK A;  2V20 A;  1JVJ A;  4ZJ2 A;  3SS5 A;  3SS4 A;  3ZG8 B;  1NYM A;  2XDM A;  1HD8 A;  1ZG6 A;  3CJM A;  3UPP A;  2XFS A;  1RGY A;  5EUA A;  4OH0 A;  1GHI A;  3AGF A;  4GD8 A;  5EVI B;  2ZMA A;  5CEB A;  1N4O A;  2Y2N A;  4EBP A;  3VP1 A;  1NYY A;  1ONH A;  1XXM A;  1ZC2 A;  5CTN A;  3IWO A;  5FQJ A;  5FQQ A;  5HAQ A;  3E2L A;  3WS0 A;  4DRT A;  5EVI C;  2OLV A;  2Y2I A;  1TDG A;  1AXB A;  1SHV A;  1E3U A;  5AQA A;  4GDB A;  4NET A;  4S2P A;  1Q2P A;  5FAS A;  4X69 A;  3GR2 A;  3N4I A;  4KG5 A;  1W79 A;  2PBY A;  2IWD A;  1JTD A;  3IQA A;  3OZH A;  4S2I A;  3VP0 A;  4L0L A;  5CGW A;  3S22 A;  3WS2 A;  4BEN A;  3IWI A;  1DJB A;  2Y59 A;  4LV3 A;  2Y55 A;  3IXB A;  4X6T A;  4Y0U A;  5CXW A;  4HES A;  3V3S A;  3ZDJ A;  4BLM A;  2WKE A;  2Y2K A;  5CHM A;  1L0F A;  2IWC A;  2JE5 A;  1FR1 A;  1K4F A;  1MWR A;  3BLS A;  4KQO A;  4OPR A;  1Q2Q A;  2HDQ A;  3HLC A;  1FSW A;  3BEC A;  1ES5 A;  1BTL A;  4LV0 A;  4WMC D;  4R4R A;  3VFH A;  4DXB A;  4OOM A;  2HDR A;  3SH7 A;  1H8Z A;  4B88 A;  4DE1 A;  3Q7V A;  4X55 A;  3BEB A;  3M6H A;  4OPQ A;  3CZD A;  3C4O A;  4KZ9 A;  4FH4 A;  4N92 A;  3Q81 A;  1XP4 A;  1BT5 A;  3NDG A;  3PBO A;  5DTK A;  3TG9 A;  3ZFZ A;  3MKF A;  2EXB A;  3IF5 A;  3O87 A;  4P85 A;  1IYP A;  3HUO A;  4U0X A;  2JCH A;  5BOH A;  4S2N A;  1MWT A;  4R0Q A;  2Y2J A;  4ZJ1 A;  3CMZ A;  4IED A;  2HDU A;  1JTG A;  4E3K A;  1IEM A;  3BFD A;  4JXV A;  2WGI A;  3BFC A;  3G35 A;  3GTC A;  1E3U D;  5FAT A;  5FQ9 A;  5CEC A;  3IXH A;  4DXC A;  1KGG A;  3ZG0 A;  1W7F A;  2WAD A;  4QY5 A;  3UPN A;  4JKT A;  1YM1 A;  3N7W A;  1M40 A;  2DCF A;  1YLW A;  4GDN A;  5DF7 A;  4OOY A;  1PWD A;  3N6I A;  3G2Z A;  3ZNT A;  5FAO A;  4FSF A;  1YLY A;  4DE0 A;  2QZ6 A;  4F94 A;  1G6A A;  3P09 A;  3GVB A;  4C6Y A;  1MKI A;  5AQ9 A;  2Q9N A;  1E4D A;  4XUX A;  3MFD A;  4JXW A;  4DDS A;  2HPB A;  1XGJ A;  3GMW A;  1YLT A;  4OPY A;  4PMA A;  3Q82 A;  2WKH A;  5I94 A;  2EX6 A;  3WS5 A;  4MBF A;  3EQU A;  1ESI A;  3N8S A;  4FH2 A;  4D2O A;  3C4P A;  1VQQ A;  2Y2P A;  5A92 A;  4OON A;  1TVF A;  3G30 A;  2A3U A;  3N8L A;  3HBR A;  1GA9 A;  1PZO A;  1K54 A;  3TOI A;  1PI4 A;  3IT9 A;  4IVK A;  5CHU A;  4OP5 A;  4KG6 A;  1PWG A;  5GLA A;  3MKE A;  1GCE A;  1BLC A;  3A3F A;  1SDN A;  4ID4 A;  4JLF A;  1ERM A;  3HUM A;  1M6K A;  1MWU A;  4HBT A;  2Z2M B;  5M1A A;  3HLD A;  4OOL A;  1K56 D;  1K55 C;  3OCN A;  1GA0 A;  3C7V A;  2XD5 A;  1KDW A;  4YFM A;  3EQV A;  3P98 A;  3GV9 A;  5JYO A;  5EVI A;  4GOG A;  2WGV A;  2XF3 A;  1CI9 A;  4OVD A;  4U3T A;  2Y2L A;  4E3O A;  1NJ4 A;  2C6W B;  5F1F A;  1XA1 A;  3FKW A;  3IH8 A;  3S1Y A;  1K57 C;  1IKG A;  1YMX A;  3GRJ A;  1BUE A;  4Y7P A;  2EX2 A;  2JBF A;  2Y2Q A;  3DW0 A;  3G32 A;  1YLP A;  3G31 A;  3AGD A;  3VP3 A;  4DF6 A;  5DTS A;  3TSG A;  2V1Z A;  1RP5 A;  4K0X A;  2XFT A;  1ES3 A;  4JPM A;  4OPZ A;  5EOO A;  2V2F F;  4RX2 A;  2ZM8 A;  3WS1 A;  5JYP A;  1XX2 A;  1NY0 A;  3PBT A;  3ZVW A;  4U0T A;  2Y2H A;  2ZLY A;  1JWZ A;  2Y2G A;  2OV5 A;  1OME A;  2X02 A;  2R9X A;  1GHP A;  4KZ5 A;  3GQZ A;  2ZQ7 A;  3IXD A;  5CHJ A;  3ITB A;  3JYI A;  5DTT A;  3RJU A;  4E3M A;  4PPR A;  3MZD A;  1Z6F A;  4WZ5 A;  5GHX A;  3SOI A;  1H8Y A;  3FV7 A;  1K4E A;  3LEZ A;  3V3R A;  1WE4 A;  2EX8 A;  2ZC4 B;  4S2L A;  4S2O A;  4FD8 A;  1NXY A;  2BG1 A;  4H8R A;  3PBR A;  4RVA A;  4KZA A;  5FAP A;  3B3X A;  1JWV A;  4PM8 A;  1SDE A;  2WUQ A;  4JF5 A;  3QNB A;  4B4Z A;  4EWF A;  4GN2 A;  4OP8 A;  4UA7 A;  1K6S A;  2ZC5 B;  3VOZ A;  1E25 A;  1TEM A;  3HLF A;  3M2K A;  3SS3 A;  3UDF A;  2WGW B;  2J7V A;  2ZQ9 A;  4WEL A;  4X56 A;  4E3N A;  1WYC A;  1L0G A;  1FQG A;  3W8K A;  2WAF A;  3OPR A;  3ZHH A;  4C3Q A;  2X71 A;  3C5A A;  4OLD A;  2XLN A;  5CGS A;  1KVM A;  3NI9 A;  1ESU A;  4A5R A;  3HVF A;  5E2G A;  4EBL A;  4P6B A;  1U60 A;  2ZD8 A;  3IHA A;  4CPK A;  5KSC A;  2HDS A;  4JXG A;  4ZJ3 A;  4E3I A;  5FQM A;  5HL1 A;  3PBQ A;  4OQI A;  1ES4 A;  1PYY A;  2I72 A;  4OQG A;  4GKU A;  4QY6 A;  5FSR A;  3ZG7 B;  4LV1 A;  1LI0 A;  1HVB A;  1PIO A;  3FYZ A;  3V50 A;  4UHU A;  5J8X A;  2ZQD A;  4YIN A;  3HRE A;  4CJN A;  4GNU A;  2XQZ A;  4EV4 A;  4RYE A;  1W5D A;  3AGE A;  2ZC6 B;  4PM9 A;  5EOE A;  3WRZ A;  2DNS A;  3MZE A;  2FFY A;  4QB8 A;  5L2F A;  5DF8 A;  1C3B A;  2WZZ A;  2HP6 A;  4PM7 A;  1RCJ A;  2ZQA A;  5F83 A;  3OPL A;  5A91 A;  2DRW A;  4N1X A;  1BSG A;  4HBU A;  1KDS A;  3SH8 A;  1MBL A;  2H10 A;  1BUL A;  3PTE A;  3CG5 A;  1L0D A;  3IH9 A;  3V39 A;  3W4O A;  2WAE A;  2OSU A;  1BLP A;  5AQ7 A;  3UO9 A;  3VSL A;  4O7D A;  1ONG A;  3DTM A;  2C5W B;  2P9V B;  1G68 A;  3BYD A;  4WZ4 A;  4WEJ A;  3VFF A;  1K38 A;  3O3V A;  2XR0 A;  1FSY A;  3G34 A;  5E2F A;  5KMW A;  5A90 A;  3UE0 A;  5F1G A;  1PI5 A;  2JC7 A;  5FI7 A;  1DJA A;  1K57 A;  3OPH A;  4S2J A;  5FQI A;  1ES2 A;  5GLC A;  4MBK A;  4JBF A;  1MPL A;  2QMI A;  2XH9 A;  1FCO A;  4BD1 A;  2VGJ A;  5U47 A;  1QME A;  2EX9 A;  3LY4 A;  5E43 A;  4Z9Q A;  1ZG4 A;  4Q8I A;  5FI6 A;  4MBH A;  1ERQ A;  2ZC7 A;  5FAQ A;  3IXG A;  3IF6 B;  5KZH A;  1ERO A;  4NK3 A;  1IYS A;  1WYB A;  1BZA A;  3MXR A;  3HLW A;  3ZG9 B;  4EBN A;  1KE3 A;  3IF6 C;  5FDH A;  3DWZ A;  2FFF B;  5IHV A;  1MXO A;  2OLU A;  1NRF A;  2XGN A;  2ZQ8 A;  2Q9M A;  3HUN A;  4JF6 A;  2IWB A;  4LV2 A;  4E3L A;  4LEN A;  3D4F A;  1KGE A;  5AQB A;  4BD0 A;  4MNR A;  2EXA A;  5HAI A;  2PU2 A;  4E6X A;  4GZB A;  3LO7 A;  4UA9 A;  5EPH A;  1CEG A;  1LI9 A;  2ZC3 B;  4IBR A;  3FWL A;  4KEN B;  3V5M A;  1K6R A;  3PAG A;  4KZ6 A;  2HP9 A;  4WMC A;  5HX9 A;  4S2M A;  1PW1 A;  3QNC A;  3UDI A;  4WEK A;  2J8Y A;  4IVI A;  4BL3 A;  4RX3 A;  1YLJ A;  2VGK A;  3NC8 A;  4DDY A;  1VM1 A;  4BQM A;  1LLB A;  1RGZ A;  3GSG A;  1DY6 A;  4ZBE A;  4GD6 A;  4QHC A;  4KQR A;  4FCF A;  5D3O A;  1TDL A;  1KVL A;  2UWX A;  1GHM A;  5EE8 A;  1HTZ A;  4UA6 A;  5GLD A;  2B5R A;  4EUZ A;  4PM6 A;  4N1H A;  3A3D A;  1HZO A;  4P0M A;  5E2H A;  5G18 A;  1W8Q A;  2WGW A;  2H0Y A;  4C75 A;  3ITA A;  3NBL A;  1XGI A;  5KSH A;  1KGF A;  1O07 A;  4OQ0 A;  1IKI A;  3IHB A;  2E8I A;  4KZ8 A;  3UNW A;  1I5Q A;  5EVI D;  3W4Q A;  3ZGA B;  4XUZ A;  5HW3 A;  1FR6 A;  4HEF A;  4RA7 A;  3HLE A;  4N9K A;  1SKF A;  3NIA A;  4R3B A;  4UAA A;  1S0W A;  2PU4 A;  3HL9 A;  4X68 A;  3RXW A;  4K91 A;  3MBZ A;  1IEL A;  1SCW A;  1L0E A;  3NY4 A;  2XEP A;  4DE2 A;  5M19 A;  3BRM A;  3VP2 A;  3OC2 A;  1EWZ A;  4DKI A;  3VMA A;  5CED A;  1CI8 A;  4KZB A;  3PBN A;  1BLH A;  1MY8 A;  1MWS A;  3PAE A;  4KQQ A;  3FKV A;  2CC1 A;  2G2U A;  2R9W A;  1YQS A;  3O88 A;  4WM9 A;  4DE3 A;  4K0W A;  5GL9 A;  3VP4 A;  2XK1 A;  3ZG5 A;  4OLG A;  5CTM A;  3A3E A;  3Q1F A;  4KZ7 A;  3UE1 A;  2Y2M A;  1FCN A;  3W4P A;  4MEZ A;  4E6W A;  3HLG A;  3BLM A;  4WZ5 C;  3VSK A;  1H5X A;  3N8R A;  5TGF A;  3SH9 A;  2RL3 A;  2ZQC A;  1XA7 A;  3OPP A;  3OCL A;  5CRF A;  1K25 A;  3O86 A;  4R23 A;  3UY6 A;  4EQI A;  3C7U A;  3Q7V B;  5FI2 A;  5M18 A;  3MZF A;  3BFE A;  3ZNY A;  2P9V A;  2GDN A;  1YT4 A;  3BFF A;  5DVA A;  2Y4A A;  3UDX A;  5HFO A;  4PM5 A;  2EFU A;  1JWP A;  3Q07 A;  3VOY A;  2WYX A;  1K56 A;  5EVL A;  2ZM0 A;  4WYY A;  4X53 A;  4OQH A;  3Q7Z A;  1QMF A; 
#chains in the Genus database with same CATH topology
 2Y2O A;  3R7W B;  1NZO A;  3ISG A;  1OTD A;  2ZMV A;  2QPN A;  5TBM B;  5F82 A;  2YKH A;  4B4X A;  4LFU A;  2HJ9 C;  3ZQ5 A;  5HAP A;  5L10 A;  1IYQ A;  3VE4 A;  3NDE A;  4JGO A;  4DMZ A;  3M6B A;  2V9A A;  5LBR A;  4Y0T A;  1YPR A;  5FEG A;  4EU0 A;  1GSW A;  2ZM2 A;  4E3J A;  3LCE A;  4IUK A;  4DN0 A;  3M2J A;  1PW8 A;  2J9P A;  1ZKJ A;  4JXS A;  4OKP A;  1BLS A;  4LPZ A;  5HAR A;  3UPO A;  3MXS A;  3A3I A;  2P74 A;  2IA2 A;  2RCX A;  1XFQ A;  5HD3 A;  1T1B A;  2FH5 A;  1L2S A;  3NJA A;  2WK0 A;  1K54 C;  4QJG A;  3WS4 A;  4BBT A;  4GS9 B;  4LCL A;  4DJ2 A;  1I2S A;  3H7W B;  3IWQ A;  5FQK A;  2V20 A;  2VEA A;  3ZG8 B;  1NYM A;  1S67 L;  2H28 A;  3CJM A;  3UPP A;  5EUA A;  3AGF A;  2V0U A;  2PR5 A;  2ZMA A;  2Y2N A;  4EBP A;  3VP1 A;  1XXM A;  5CTN A;  3KSF A;  3IWO A;  5HAQ A;  4R70 A;  1V9Y A;  5EVI C;  3IS2 B;  2Y2I A;  1AXB A;  3GR2 A;  1W79 A;  3LIE A;  3F1N A;  3IQA A;  4L0L A;  5CGW A;  3IWI A;  1DJB A;  4X6T A;  3ZDJ A;  3QP1 A;  1L0F A;  2D01 A;  1GSV A;  1ES5 A;  4WMC D;  3S7Q A;  4OOM A;  3SH7 A;  5IT5 A;  3BEB A;  3CZD A;  4KZ9 A;  4N92 A;  3T4Q A;  4K08 A;  1XP4 A;  3NDG A;  3PBO A;  3CPT A;  3TG9 A;  2EXB A;  1IYP A;  2D02 A;  2PRF A;  5BOH A;  4R0Q A;  2J80 A;  4EET B;  1IEM A;  3DBA A;  1VET A;  3BFD A;  4NG2 A;  3GTC A;  4QY5 A;  5FEF A;  3T50 A;  4OOY A;  5AJG A;  1YLY A;  3GDI A;  4DE0 A;  3GVB A;  4C6Y A;  3MFD A;  4JXW A;  4DDS A;  1XGJ A;  3H9W A;  1YLT A;  4HJ6 A;  2Y79 A;  2EX6 A;  3EQU A;  5F6A A;  2GZA A;  2EWW A;  4D2O A;  2PD8 A;  1VQQ A;  4OON A;  1TVF A;  1K54 A;  1IFQ A;  3IT9 A;  3MR0 A;  1ERM A;  3T1S A;  3NOU C;  1T19 A;  4L9G A;  1K56 D;  4QWO A;  1F9I A;  1K55 C;  3BQA A;  2XD5 A;  4YFM A;  5EVI A;  4GOG A;  4U3T A;  4E3O A;  1MC0 A;  1K57 C;  1IKG A;  3GRJ A;  4Y7P A;  2EX2 A;  2HGV A;  2Y2Q A;  3G32 A;  1PNE A;  2W0N A;  4YNR A;  2V1Z A;  4MN7 A;  3LR3 A;  4JPM A;  4OPZ A;  2ZM8 A;  5JYP A;  4U0T A;  2ZLY A;  3LYX A;  1OME A;  1GHP A;  4LGW A;  3EEH A;  5DTT A;  4PPR A;  3BY8 A;  2W3D A;  1Z6F A;  1XFN A;  3FV7 A;  2NUT C;  2ZC4 B;  4FD8 A;  2BG1 A;  4GW9 A;  4WLA A;  1N9N A;  4PM8 A;  2WUQ A;  3QNB A;  3M2K A;  3HLF A;  5C5K A;  4UQI S;  4E3N A;  3KX0 X;  1L0G A;  3W8K A;  4C3Q A;  2WAF A;  3OPR A;  3HCY A;  4PHT A;  4ETZ A;  4NEE D;  4ZJ3 A;  2JHE A;  3PBQ A;  2I72 A;  5DFX A;  1PIO A;  4UHU A;  5J8X A;  4YIN A;  4GNU A;  5EM0 A;  3IX8 A;  2FFY A;  4ARZ A;  1CF0 A;  5L2F A;  5DF8 A;  3F1O B;  4R3A A;  3T1X A;  4PM7 A;  3E0Y A;  1BSG A;  1V9Z A;  3PTE A;  3IH9 A;  3L9K A;  4CQH A;  4ARZ B;  3W4O A;  4X25 A;  3DTM A;  1G68 A;  4BBV A;  4WEJ A;  4Y13 A;  1K38 A;  1LT0 A;  3G34 A;  5A90 A;  3UE0 A;  1BYW A;  5FI7 A;  3C38 A;  3D72 A;  1K57 A;  3OPH A;  4S2J A;  1YSQ A;  1FCO A;  2VGJ A;  4Q8I A;  4Z9Q A;  5HDC A;  4EUV A;  3IXG A;  3JVU A;  5KZH A;  4NK3 A;  1WYB A;  3UMD A;  3IF6 C;  1NRF A;  2XGN A;  1KGE A;  5AVE A;  4MNR A;  5HAI A;  2PU2 A;  3LO7 A;  4I3J A;  3OBF A;  4IBR A;  3FWL A;  5DKK A;  1NLZ A;  5FL3 A;  4B9O A;  4WN5 A;  4KQR A;  1TDL A;  1SZV A;  3T1R A;  1HTZ A;  4UA6 A;  4EUZ A;  4YWZ A;  2XSS A;  1NWZ A;  5E2H A;  4CLC B;  5KSH A;  1XGI A;  1KGF A;  1X0O A;  3UNW A;  1VEU B;  3ZGA B;  2W1T B;  4RA7 A;  1MZU A;  3HLE A;  4CLC E;  1OT9 A;  4R3B A;  4UAA A;  2OOL A;  2I9V A;  1STZ A;  3RXW A;  2L4R A;  4I3A A;  3MBZ A;  1L0E A;  3NY4 A;  4X1L A;  4DE2 A;  1ZTU A;  2PHY A;  3PAE A;  3TRC A;  4KQQ A;  3FKV A;  4WM9 A;  5HD5 A;  4K0W A;  1N9O A;  5GL9 A;  3VP4 A;  3ZG5 A;  4OLG A;  2ZMF A;  1FCN A;  3W4P A;  4UQI M;  3BLM A;  4WZ5 C;  3VSK A;  3N8R A;  3SH9 A;  4H6J A;  5KIZ A;  3MF0 A;  5CRF A;  1K25 A;  3O86 A;  3Q7V B;  4FOF A;  2GDN A;  1N9L A;  3H82 B;  3LR5 A;  3QP2 A;  2EFU A;  4L9F A;  3Q07 A;  3T4J A;  2B18 A;  3T4T A;  4WYY A;  3RJU A;  4EXO A;  1ALQ A;  3T4L A;  3G2Y A;  4N9L A;  3WRT A;  4AFI A;  4G3V A;  5I5L A;  3IF6 A;  2HP5 A;  2M7U A;  1PZP A;  5DF9 A;  3LIB A;  4Q0I A;  4D60 A;  2P04 A;  4R4S A;  4R3J A;  1NZU A;  5A8B A;  4ZDX A;  5K5B A;  2PYP A;  3FPV A;  3ZCZ A;  2X01 A;  4LCM A;  4XT2 A;  1W8Y A;  1KE0 A;  1PWC A;  4MLL A;  3E2K A;  1CK3 A;  1F98 A;  3PBS A;  4KZ4 A;  5TFQ A;  1TD5 A;  3FZC A;  4NXE A;  4KZ3 A;  1XKZ A;  3EEA A;  2XRN A;  4KG2 A;  3VE3 A;  2Z2L B;  3UN7 A;  3UE3 A;  1N9B A;  3KYQ A;  5HDD A;  4IBX A;  4BBU A;  3GEC A;  3SS4 A;  2XDM A;  3TW8 A;  4OH0 A;  1GHI A;  4GD8 A;  3E2L A;  4DJ3 A;  2Z6D A;  4HIA A;  4DRT A;  2VLG A;  2OLV A;  1XJ3 A;  5AQA A;  4NET A;  4QPR A;  3T12 B;  2PBY A;  2IWD A;  3VP0 A;  3S22 A;  3WS2 A;  1ODV A;  2WKE A;  3O5Y A;  1FR1 A;  3BLS A;  3HLC A;  2HDQ A;  4Z1W A;  1G6O A;  3HJI A;  3BEC A;  1BTL A;  2W3F A;  1LL8 A;  4DE1 A;  4LLO B;  3C4O A;  4FH4 A;  3ZFZ A;  3IF5 A;  4U0X A;  3UB6 A;  3HUO A;  1MWT A;  3R7W A;  2Y2J A;  4ZJ1 A;  2JKR M;  4E3K A;  5TBM A;  4JXV A;  2WGI A;  5FQ9 A;  5CEC A;  4DXC A;  1KGG A;  3ZG0 A;  2V8C A;  3UPN A;  1M40 A;  1PWD A;  3E4P A;  3G2Z A;  2V1B A;  4F94 A;  2ACG A;  1MKI A;  1E4D A;  1UGU A;  3MXQ A;  4PMA A;  2WKH A;  3A0S A;  1TS6 A;  3WS5 A;  4MMN A;  2Y2P A;  2VZW A;  5A92 A;  2A3U A;  4WUJ A;  3HBR A;  1GA9 A;  5CX7 A;  1YSP A;  2Y8H A;  2ZL1 B;  4IVK A;  5CHU A;  1PWG A;  1GCE A;  5MC7 A;  3A3F A;  3R4K A;  2CMN A;  1SDN A;  4ID4 A;  1MWU A;  4GS9 A;  5M1A A;  3HLD A;  4BWI A;  4R38 A;  3H7W A;  4Q0J A;  4GHI B;  1K0K A;  3GV9 A;  1CI9 A;  4OVD A;  4IJG A;  3T4K A;  1XA1 A;  3FKW A;  1A0K A;  1BUE A;  3EOI A;  2J3W A;  2JBF A;  3IS2 A;  1YLP A;  3G31 A;  3T4S A;  1DRM A;  3KYZ A;  3AGD A;  3VP3 A;  1LSW A;  2UV0 E;  3TSG A;  2XFT A;  1ZHH B;  2YKF A;  1NY0 A;  2M1C A;  1JWZ A;  3UME A;  4I3I A;  2GX5 A;  5IU1 A;  2ZQ7 A;  3JPU A;  4HNB A;  3ITB A;  3NUL A;  3MQQ A;  4E3M A;  3VOL A;  1S4S A;  5GHX A;  3G6O A;  1P9R A;  3V3R A;  4S2O A;  1NXY A;  4H8R A;  2KOI A;  4KZA A;  2K2N A;  1SDE A;  1EW0 A;  4OP8 A;  3VOZ A;  3UDF A;  5DKL A;  4NXG A;  3VV4 A;  1YAX A;  1KVM A;  5L8M A;  1ESU A;  4EBL A;  4P6B A;  1D7E A;  2DMW A;  4HH3 A;  5HPI A;  4JGQ A;  2QWS A;  1ES4 A;  1PYY A;  4GKU A;  4QY6 A;  5FSR A;  4LV1 A;  1LI0 A;  4RYE A;  3AGE A;  2ZC6 B;  2QJ5 A;  3WRZ A;  3F1P B;  2W3H A;  1VB6 A;  2HP6 A;  4HJ3 A;  5F83 A;  5J7E A;  2MJ6 A;  4N1X A;  1ACF A;  1KDS A;  2H10 A;  1BUL A;  3U4L P;  1L0D A;  4O8G A;  3V39 A;  5AQ7 A;  1TS8 A;  3VSL A;  3LR0 A;  4ME4 A;  2OWH A;  4WZ4 A;  3VFF A;  2XR0 A;  4G3W A;  5KMW A;  1OTE A;  5F1G A;  1G5U A;  1OTI A;  3C30 A;  4O01 A;  1MPL A;  2QMI A;  2XH9 A;  5E43 A;  3LY4 A;  2HJE A;  1ERQ A;  1IOU A;  1ERO A;  1IYS A;  3K2N A;  1BZA A;  1PRQ A;  3MXR A;  3QP6 A;  3HLW A;  2QJ7 A;  5FDH A;  2O9A A;  1MXO A;  2OLU A;  3EWK A;  2ZQ8 A;  2Q9M A;  3HUN A;  3RH8 B;  4JF6 A;  3D4F A;  5AQB A;  3OOV A;  1KOU A;  4E6X A;  5EPH A;  4KEN B;  2JN7 A;  1S4R A;  4S2M A;  1PW1 A;  3QNC A;  4NXF A;  4WEK A;  4BL3 A;  4RX3 A;  1YLJ A;  2VGK A;  1VM1 A;  1RGZ A;  4ZBE A;  2W3E A;  1VHM A;  1KVL A;  2J3T C;  5EE8 A;  3UB9 A;  1UWN X;  5GLD A;  2A24 B;  3A3D A;  1HZO A;  1P97 A;  4C75 A;  2P08 A;  1O07 A;  4KZ8 A;  3IHB A;  1LSX A;  1I5Q A;  1J3W A;  5EVI D;  4XUZ A;  4CLC C;  3B47 A;  1SKF A;  4X68 A;  4K91 A;  2BAS A;  1IEL A;  1TS7 A;  3TJZ C;  2XEP A;  5M19 A;  3BRM A;  3ICY A;  5CED A;  4KZB A;  3FG8 A;  4IHQ A;  2CC1 A;  2G2U A;  2L0W A;  1OTA A;  3F1O A;  4DE3 A;  4MCW A;  3Q1F A;  3UE1 A;  2Y2M A;  3HLG A;  2ZQC A;  2HV1 A;  3NHQ A;  2PBD P;  3KSG A;  3UY6 A;  4EQI A;  3FPW A;  3ZNY A;  3EGD C;  2VV8 A;  3UDX A;  3PYP A;  1JWP A;  3VOY A;  2ZM0 A;  4X53 A;  4DKI A;  3Q7Z A;  5FA7 A;  1K55 A;  3HLB A;  4GB7 A;  3S7O A;  1T1C A;  4II7 A;  4S2N C;  4WBG A;  3BJN A;  3S4X A;  5HL6 A;  1S66 L;  4ZTK A;  4QD4 A;  5EEC A;  1FCM A;  4QU3 A;  4R1G A;  2BLS A;  2KLI A;  1J9M A;  4BJP A;  1AWI A;  3RXX A;  4M3K A;  2Z6C A;  3G4P A;  1LL9 A;  2H5S A;  3UB8 A;  3I7J A;  1O7E A;  2VA0 A;  1KE4 A;  3BM6 A;  3W2Z A;  3WWX A;  1FIL A;  2G2W A;  3JVV A;  1FOF A;  2XD1 A;  2KDK A;  3S7N A;  2A49 A;  1LHY A;  3LY3 A;  4HJ4 A;  3MQ0 A;  1Y54 A;  1SKO B;  4ZAM A;  1D06 A;  2WKI A;  5GHY A;  5A93 A;  1YMS A;  3QHY A;  5GHZ A;  4CLC A;  5F69 A;  1JVJ A;  1HD8 A;  1VEU A;  1RGY A;  3A0V A;  3OLO A;  2W1T A;  5EFW A;  1N4O A;  4HQA A;  1NYY A;  5HWW A;  3BWL A;  5FQQ A;  3CIT A;  2GJ3 A;  1SHV A;  1E3U A;  5FAS A;  4GDB A;  1Q2P A;  2M7V A;  3N4I A;  3IX3 A;  4KG5 A;  1JTD A;  2VGL S;  4S2I A;  4BEN A;  3V3S A;  3IXB A;  5CXW A;  4HES A;  3K3C A;  2Y2K A;  5CHM A;  2IWC A;  2JE5 A;  1K4F A;  1MWR A;  4PKY A;  1FSW A;  4PAU A;  2HDR A;  3Q7V A;  4ESP A;  4X55 A;  3M6H A;  4OPQ A;  3H82 A;  3MKF A;  4G3K A;  2G7U A;  2JCH A;  1MKM A;  4S2N A;  3BQ8 A;  3CMZ A;  4EEU A;  3BFC A;  1E3U D;  5FAT A;  2JKR I;  2VV7 A;  2OAQ 1;  2WAD A;  3DTK A;  4I39 A;  5HPF A;  4GDN A;  5DF7 A;  2DCF A;  2K7S A;  3N6I A;  3ZNT A;  3LID A;  3RTY A;  3CHW P;  2K31 A;  1CQA A;  2HPB A;  3GMW A;  1OJ5 A;  3Q82 A;  5I94 A;  2AVX A;  2XA7 S;  1ESI A;  3N8S A;  4FH2 A;  5J4E A;  4F3L B;  4FUW A;  1XJ6 A;  1PI4 A;  4M4X A;  4HH2 A;  2XRO A;  4OP5 A;  5GLA A;  3MKE A;  4ZRR A;  1BLC A;  1M6K A;  1TF1 A;  4HBT A;  3PR6 A;  1P9W A;  4GJ4 A;  4KUO A;  3C7V A;  2PAV P;  5JYO A;  3IX4 A;  2WGV A;  2XF3 A;  4HHD A;  2Y2L A;  2C6W B;  3IH8 A;  4GLQ A;  3S1Y A;  2QKP A;  3B33 A;  4DF6 A;  1OPX A;  4IUH A;  4K0X A;  1F5M A;  4RX2 A;  3BW6 A;  3WS1 A;  1S1Y A;  3PBT A;  4KUK A;  2Y2G A;  2OV5 A;  2R9X A;  4KZ5 A;  5HDS A;  3MZD A;  4R6L A;  4WZ5 A;  3SOI A;  1K4E A;  1DP6 A;  5HWV A;  2Q0O A;  1OTB A;  3B3X A;  3KYE A;  4EWF A;  4GN2 A;  3LR4 A;  1E25 A;  1TEM A;  3SS3 A;  2VGL M;  2WGW B;  2J7V A;  4WEL A;  1WYC A;  2PD7 A;  3NOT C;  2X71 A;  4OLD A;  3NI9 A;  2VV6 A;  3HVF A;  4ETX A;  5E2G A;  1U60 A;  2ZD8 A;  5KSC A;  2HDS A;  4JXG A;  1LSV A;  3S7P A;  4LRY C;  1T1A A;  3ZG7 B;  1HVB A;  4L9E A;  3V50 A;  2O9C A;  2ZQD A;  3HRE A;  4EV4 A;  3T4O A;  1W5D A;  5EOE A;  2DNS A;  3HJK A;  3MZE A;  4QB8 A;  3D3O A;  1C3B A;  2WZZ A;  1HLU P;  1RCJ A;  5A91 A;  2ZL1 A;  2O99 A;  3SH8 A;  3CG5 A;  2WAE A;  1BLP A;  1ONG A;  3CAX A;  2C5W B;  2P9V B;  3O3V A;  4WL9 A;  1FSY A;  1W63 M;  2JC7 A;  3CLO A;  4GHI A;  5GLC A;  3FC7 A;  4MBK A;  4JBF A;  5U47 A;  1ZG4 A;  5FI6 A;  2ZC7 A;  4HP9 A;  2XA7 M;  3LIC A;  2BTF P;  3A0R A;  3ZG9 B;  2FFF B;  5G4Z A;  5DFY A;  1NRJ A;  3MJQ A;  4NKP A;  1XJ2 A;  2EXA A;  2WKP A;  4UA9 A;  4BMW A;  4LRX C;  2ZC3 B;  1LI9 A;  4Y2F A;  1K6R A;  3MSH A;  4KZ6 A;  4HP4 A;  4WMC A;  1WA9 A;  2JKF A;  3LFV A;  2J8Y A;  4IVI A;  4DDY A;  1OT6 A;  1LLB A;  2OWJ A;  4QHC A;  4FCF A;  5EV0 A;  1P0Z A;  5TJJ A;  2B5R A;  4N1H A;  3KSI A;  3NBL A;  1DP8 A;  4OQ0 A;  3KO6 A;  3W4Q A;  1Z09 A;  1JNU A;  2HZ5 A;  4N9K A;  1NLY A;  2PU4 A;  3HL9 A;  3U2A A;  1DP9 A;  4P6Z S;  3C8C A;  2O9B A;  3OC2 A;  3QP4 A;  4GCZ A;  3VMA A;  1CI8 A;  3F1N B;  1BLH A;  3F1P A;  1MY8 A;  4Y17 A;  2R9W A;  3PXP A;  3BY9 A;  2XK1 A;  4EES A;  5CTM A;  3A3E A;  4KZ7 A;  5TGF A;  3OPP A;  2QYB A;  1UWP X;  3MZF A;  4PM5 A;  3CPT B;  2WYX A;  1K56 A;  5EVL A;  4R23 A;  2H0T A;  2ZJ9 A;  2JKT I;  2WZX A;  1VET B;  1LL5 A;  4BL2 A;  3RFB A;  1YLZ A;  4Y15 A;  3B42 A;  2Y91 A;  4MN5 A;  5TR7 A;  3LEQ A;  2VK3 A;  1IYO A;  5HWT A;  5CER A;  4Y0O A;  1S6R A;  4P87 A;  4Q0H A;  3BFG A;  1EI5 A;  5GLB A;  3ZVT A;  2J9O A;  4XXR A;  2JKG A;  2EFX A;  3NCK A;  3UB5 P;  4HOI A;  4Y3I A;  1CEF A;  4MDZ A;  4S2K A;  2WKQ A;  1XPB A;  3A3J A;  4I38 A;  1DJC A;  3DWK A;  1I2W A;  4JF4 A;  2A24 A;  3E98 A;  5E2E A;  5CGX A;  3CWF A;  3SS5 A;  4ZJ2 A;  3EGX C;  1ZG6 A;  2XFS A;  2P7J A;  1XJ4 A;  5EVI B;  5CEB A;  3IBJ A;  2FZ0 A;  1ONH A;  1ZC2 A;  3KSH A;  5FQJ A;  3CUE C;  1PFL A;  3WS0 A;  1TDG A;  4S2P A;  4X69 A;  1D1J A;  3MQO A;  1H8M A;  2B02 A;  5J3W A;  3OZH A;  3LIF A;  4I5S A;  2HF6 A;  1Y4O A;  2Y59 A;  4LV3 A;  2Y55 A;  4Y0U A;  4BLM A;  2EWV A;  3E4Q A;  3LI9 A;  4KQO A;  4OPR A;  1Q2Q A;  3MMH A;  4LV0 A;  4DXB A;  4R4R A;  3VFH A;  1H8Z A;  4B88 A;  1FIK A;  3IBR A;  3Q81 A;  1BT5 A;  5AVF A;  2W3G A;  5DTK A;  3ZYT A;  3O87 A;  4P6Z M;  3MS6 A;  4P85 A;  4MN6 A;  2ZBB A;  5F68 A;  4IED A;  2HDU A;  1JTG A;  2ZOH A;  1H3Q A;  2PT7 A;  3G35 A;  5FDS A;  2JKT M;  3IXH A;  2WKR A;  2V8F A;  1W7F A;  4JKT A;  1YM1 A;  3N7W A;  1YLW A;  4JGR A;  5L09 A;  5FAO A;  4FSF A;  2QZ6 A;  1G6A A;  3P09 A;  2EA9 A;  5AQ9 A;  2Q9N A;  4XUX A;  4JGP A;  2A2L A;  4OPY A;  4MBF A;  3LGO A;  3DTI A;  3D9Y A;  3C4P A;  1CJF A;  3ULF A;  3G30 A;  3N8L A;  4O0P A;  1PZO A;  2VX8 A;  3TOI A;  4KG6 A;  4UEY A;  4JLF A;  1S1Z A;  3HUM A;  1SKO A;  2Z2M B;  4PKY G;  4OOL A;  3OCN A;  4LRZ E;  4YOF A;  1GA0 A;  1KDW A;  3CUE A;  3EQV A;  3SZT A;  3P98 A;  3NOP C;  1F2K A;  1NJ4 A;  2OAP 1;  5F1F A;  1YMX A;  1Y28 A;  4KQD A;  3DTE A;  3MFX A;  3NEC A;  3DW0 A;  3TE8 A;  5DTS A;  3UE6 A;  1L3L A;  1RP5 A;  1ES3 A;  3C2W A;  5EOO A;  4X1M A;  2V2F F;  1XX2 A;  3ZVW A;  2R78 A;  2Y2H A;  3T1Q B;  2X02 A;  5IS1 A;  2PYR A;  3GQZ A;  5CHJ A;  3IXD A;  3JYI A;  2PDR A;  2J3T D;  3E4O A;  1H8Y A;  3LEZ A;  1WE4 A;  2EX8 A;  4S2L A;  3PBR A;  4RVA A;  3QP8 A;  5FAP A;  1JWV A;  2ZOI A;  4JF5 A;  4B4Z A;  4UA7 A;  4WF0 A;  1K6S A;  2ZC5 B;  4CLC D;  1GSX A;  3P7N A;  2ZQ9 A;  4X56 A;  1FQG A;  3ZHH A;  3C5A A;  4Y5F A;  3UB7 A;  4EER A;  2XLN A;  5CGS A;  4A5R A;  4NXB A;  3LUQ A;  4CPK A;  3IHA A;  4E3I A;  3P01 A;  5FQM A;  5HL1 A;  4OQI A;  4OQG A;  5DJU A;  3LI8 A;  3FYZ A;  4CJN A;  2XQZ A;  4FTX A;  1OJG A;  4PM9 A;  5F5Y A;  3LIA A;  4F3L A;  5HZH A;  2ZQA A;  1G28 A;  3OPL A;  2DRW A;  4HBU A;  4EW7 A;  1MBL A;  2VKS A;  4H6J B;  2OSU A;  3UO9 A;  4O7D A;  3BYD A;  4EQ1 A;  4EEP A;  5E2F A;  2V1A A;  2E8J A;  1PI5 A;  1DJA A;  3K3D A;  5FQI A;  1ES2 A;  4BD1 A;  1QME A;  2EX9 A;  1T18 A;  4MBH A;  5FAQ A;  4HI4 A;  3IF6 B;  2W27 A;  4E04 A;  4RQ9 A;  5HSQ A;  1TS0 A;  5EM1 A;  4EBN A;  1KE3 A;  3DWZ A;  5IHV A;  2IWB A;  4LV2 A;  4E3L A;  2KX6 A;  4LEN A;  4BD0 A;  1H0M A;  4GZB A;  3CI6 A;  1CEG A;  3QP5 A;  4XT2 B;  4HY8 A;  3V67 A;  3V5M A;  2LB5 A;  3PAG A;  5L07 A;  2HP9 A;  5HX9 A;  3UDI A;  2QHK A;  3NC8 A;  4B93 A;  2L1M A;  4BQM A;  3GSG A;  1DY6 A;  4GD6 A;  5D3O A;  2UWX A;  1GHM A;  5EVE A;  2V0W A;  4PM6 A;  4P0M A;  5G18 A;  1W8Q A;  2WGW A;  2GNX A;  2H0Y A;  3ITA A;  1IKI A;  2O0Y A;  2E8I A;  5HW3 A;  1FR6 A;  2W1R A;  1YKD A;  5DJT A;  2LB9 A;  4HEF A;  2INW A;  5G4Y A;  3NIA A;  1S0W A;  2B95 A;  1SCW A;  1W63 Q;  3VP2 A;  1EWZ A;  3PBN A;  1MWS A;  2NUP C;  3O88 A;  1YQS A;  2PR6 A;  2VJW A;  3L7H A;  4MEZ A;  3DAV A;  4E6W A;  1H5X A;  3SW1 A;  2RL3 A;  1XA7 A;  3OCL A;  3C7U A;  5FI2 A;  5M18 A;  3BFE A;  3PHY A;  2P9V A;  1YT4 A;  3BFF A;  5DVA A;  2Y4A A;  5HFO A;  4OQH A;  1QMF A; 
#chains in the Genus database with same CATH homology
 5FA7 A;  1K55 A;  2H0T A;  1NZO A;  2Y2O A;  3HLB A;  3ISG A;  1ALQ A;  2QPN A;  4GB7 A;  4B4X A;  2ZJ9 A;  3G2Y A;  5F82 A;  4N9L A;  2WZX A;  3WRT A;  4S2N C;  3IF6 A;  2HP5 A;  4WBG A;  5HAP A;  1LL5 A;  3S4X A;  1PZP A;  1IYQ A;  5DF9 A;  4BL2 A;  3NDE A;  1YLZ A;  4ZTK A;  4QD4 A;  5EEC A;  1FCM A;  4R4S A;  3M6B A;  2Y91 A;  4R3J A;  4Y0T A;  1NZU A;  2ZM2 A;  4E3J A;  3LCE A;  5TR7 A;  4ZDX A;  4QU3 A;  3M2J A;  1IYO A;  4R1G A;  2BLS A;  5CER A;  1PW8 A;  1J9M A;  2J9P A;  1S6R A;  4P87 A;  4Y0O A;  4BJP A;  1ZKJ A;  3BFG A;  4JXS A;  4OKP A;  1BLS A;  1EI5 A;  4M3K A;  3RXX A;  5GLB A;  3ZCZ A;  3G4P A;  1LL9 A;  2H5S A;  2X01 A;  3ZVT A;  3I7J A;  4LCM A;  2J9O A;  1W8Y A;  1O7E A;  4XXR A;  5HAR A;  3UPO A;  1KE0 A;  1KE4 A;  3BM6 A;  1PWC A;  3MXS A;  4MLL A;  3E2K A;  1CK3 A;  3A3I A;  2P74 A;  3WWX A;  2RCX A;  3PBS A;  2EFX A;  3NCK A;  2G2W A;  4KZ4 A;  1FOF A;  1CEF A;  5TFQ A;  2XD1 A;  3FZC A;  4S2K A;  4KZ3 A;  1XKZ A;  3A3J A;  1XPB A;  1DJC A;  1L2S A;  3DWK A;  4KG2 A;  2A49 A;  1LHY A;  1I2W A;  2WK0 A;  4JF4 A;  1K54 C;  3LY3 A;  4QJG A;  2Z2L B;  3WS4 A;  3UN7 A;  1Y54 A;  3UE3 A;  4LCL A;  1N9B A;  5E2E A;  5CGX A;  4ZAM A;  2WKI A;  5GHY A;  5A93 A;  1YMS A;  3QHY A;  5GHZ A;  1I2S A;  4IBX A;  3IWQ A;  5FQK A;  2V20 A;  1JVJ A;  4ZJ2 A;  3SS5 A;  3SS4 A;  3ZG8 B;  1NYM A;  2XDM A;  1HD8 A;  1ZG6 A;  3CJM A;  3UPP A;  2XFS A;  1RGY A;  5EUA A;  4OH0 A;  1GHI A;  3AGF A;  4GD8 A;  5EVI B;  2ZMA A;  5CEB A;  1N4O A;  2Y2N A;  4EBP A;  3VP1 A;  1NYY A;  1ONH A;  1XXM A;  1ZC2 A;  5CTN A;  3IWO A;  5FQJ A;  5FQQ A;  5HAQ A;  3E2L A;  3WS0 A;  4DRT A;  5EVI C;  2OLV A;  2Y2I A;  1TDG A;  1AXB A;  1SHV A;  1E3U A;  5AQA A;  4GDB A;  4NET A;  4S2P A;  1Q2P A;  5FAS A;  4X69 A;  3GR2 A;  3N4I A;  4KG5 A;  1W79 A;  2PBY A;  2IWD A;  1JTD A;  3IQA A;  3OZH A;  4S2I A;  3VP0 A;  4L0L A;  5CGW A;  3S22 A;  3WS2 A;  4BEN A;  3IWI A;  1DJB A;  2Y59 A;  4LV3 A;  2Y55 A;  3IXB A;  4X6T A;  4Y0U A;  5CXW A;  4HES A;  3V3S A;  3ZDJ A;  4BLM A;  2WKE A;  2Y2K A;  5CHM A;  1L0F A;  2IWC A;  2JE5 A;  1FR1 A;  1K4F A;  1MWR A;  3BLS A;  4KQO A;  4OPR A;  1Q2Q A;  2HDQ A;  3HLC A;  1FSW A;  3BEC A;  1ES5 A;  1BTL A;  4LV0 A;  4WMC D;  4R4R A;  3VFH A;  4DXB A;  4OOM A;  2HDR A;  3SH7 A;  1H8Z A;  4B88 A;  4DE1 A;  3Q7V A;  4X55 A;  3BEB A;  3M6H A;  4OPQ A;  3CZD A;  3C4O A;  4KZ9 A;  4FH4 A;  4N92 A;  3Q81 A;  1XP4 A;  1BT5 A;  3NDG A;  3PBO A;  5DTK A;  3TG9 A;  3ZFZ A;  3MKF A;  2EXB A;  3IF5 A;  3O87 A;  4P85 A;  1IYP A;  3HUO A;  4U0X A;  2JCH A;  5BOH A;  4S2N A;  1MWT A;  4R0Q A;  2Y2J A;  4ZJ1 A;  3CMZ A;  4IED A;  2HDU A;  1JTG A;  4E3K A;  1IEM A;  3BFD A;  4JXV A;  2WGI A;  3BFC A;  3G35 A;  3GTC A;  1E3U D;  5FAT A;  5FQ9 A;  5CEC A;  3IXH A;  4DXC A;  1KGG A;  3ZG0 A;  1W7F A;  2WAD A;  4QY5 A;  3UPN A;  4JKT A;  1YM1 A;  3N7W A;  1M40 A;  2DCF A;  1YLW A;  4GDN A;  5DF7 A;  4OOY A;  1PWD A;  3N6I A;  3G2Z A;  3ZNT A;  5FAO A;  4FSF A;  1YLY A;  4DE0 A;  2QZ6 A;  4F94 A;  1G6A A;  3P09 A;  3GVB A;  4C6Y A;  1MKI A;  5AQ9 A;  2Q9N A;  1E4D A;  4XUX A;  3MFD A;  4JXW A;  4DDS A;  2HPB A;  1XGJ A;  3GMW A;  1YLT A;  4OPY A;  4PMA A;  3Q82 A;  2WKH A;  5I94 A;  2EX6 A;  3WS5 A;  4MBF A;  3EQU A;  1ESI A;  3N8S A;  4FH2 A;  4D2O A;  3C4P A;  1VQQ A;  2Y2P A;  5A92 A;  4OON A;  1TVF A;  3G30 A;  2A3U A;  3N8L A;  3HBR A;  1GA9 A;  1PZO A;  1K54 A;  3TOI A;  1PI4 A;  3IT9 A;  4IVK A;  5CHU A;  4OP5 A;  4KG6 A;  1PWG A;  5GLA A;  3MKE A;  1GCE A;  1BLC A;  3A3F A;  1SDN A;  4ID4 A;  4JLF A;  1ERM A;  3HUM A;  1M6K A;  1MWU A;  4HBT A;  2Z2M B;  5M1A A;  3HLD A;  4OOL A;  1K56 D;  1K55 C;  3OCN A;  1GA0 A;  3C7V A;  2XD5 A;  1KDW A;  4YFM A;  3EQV A;  3P98 A;  3GV9 A;  5JYO A;  5EVI A;  4GOG A;  2WGV A;  2XF3 A;  1CI9 A;  4OVD A;  4U3T A;  2Y2L A;  4E3O A;  1NJ4 A;  2C6W B;  5F1F A;  1XA1 A;  3FKW A;  3IH8 A;  3S1Y A;  1K57 C;  1IKG A;  1YMX A;  3GRJ A;  1BUE A;  4Y7P A;  2EX2 A;  2JBF A;  2Y2Q A;  3DW0 A;  3G32 A;  1YLP A;  3G31 A;  3AGD A;  3VP3 A;  4DF6 A;  5DTS A;  3TSG A;  2V1Z A;  1RP5 A;  4K0X A;  2XFT A;  1ES3 A;  4JPM A;  4OPZ A;  5EOO A;  2V2F F;  4RX2 A;  2ZM8 A;  3WS1 A;  5JYP A;  1XX2 A;  1NY0 A;  3PBT A;  3ZVW A;  4U0T A;  2Y2H A;  2ZLY A;  1JWZ A;  2Y2G A;  2OV5 A;  1OME A;  2X02 A;  2R9X A;  1GHP A;  4KZ5 A;  3GQZ A;  2ZQ7 A;  3IXD A;  5CHJ A;  3ITB A;  3JYI A;  5DTT A;  3RJU A;  4E3M A;  4PPR A;  3MZD A;  1Z6F A;  4WZ5 A;  5GHX A;  3SOI A;  1H8Y A;  3FV7 A;  1K4E A;  3LEZ A;  3V3R A;  1WE4 A;  2EX8 A;  2ZC4 B;  4S2L A;  4S2O A;  4FD8 A;  1NXY A;  2BG1 A;  4H8R A;  3PBR A;  4RVA A;  4KZA A;  5FAP A;  3B3X A;  1JWV A;  4PM8 A;  1SDE A;  2WUQ A;  4JF5 A;  3QNB A;  4B4Z A;  4EWF A;  4GN2 A;  4OP8 A;  4UA7 A;  1K6S A;  2ZC5 B;  3VOZ A;  1E25 A;  1TEM A;  3HLF A;  3M2K A;  3SS3 A;  3UDF A;  2WGW B;  2J7V A;  2ZQ9 A;  4WEL A;  4X56 A;  4E3N A;  1WYC A;  1L0G A;  1FQG A;  3W8K A;  2WAF A;  3OPR A;  3ZHH A;  4C3Q A;  2X71 A;  3C5A A;  4OLD A;  2XLN A;  5CGS A;  1KVM A;  3NI9 A;  1ESU A;  4A5R A;  3HVF A;  5E2G A;  4EBL A;  4P6B A;  1U60 A;  2ZD8 A;  3IHA A;  4CPK A;  5KSC A;  2HDS A;  4JXG A;  4ZJ3 A;  4E3I A;  5FQM A;  5HL1 A;  3PBQ A;  4OQI A;  1ES4 A;  1PYY A;  2I72 A;  4OQG A;  4GKU A;  4QY6 A;  5FSR A;  3ZG7 B;  4LV1 A;  1LI0 A;  1HVB A;  1PIO A;  3FYZ A;  3V50 A;  4UHU A;  5J8X A;  2ZQD A;  4YIN A;  3HRE A;  4CJN A;  4GNU A;  2XQZ A;  4EV4 A;  4RYE A;  1W5D A;  3AGE A;  2ZC6 B;  4PM9 A;  5EOE A;  3WRZ A;  2DNS A;  3MZE A;  2FFY A;  4QB8 A;  5L2F A;  5DF8 A;  1C3B A;  2WZZ A;  2HP6 A;  4PM7 A;  1RCJ A;  2ZQA A;  5F83 A;  3OPL A;  5A91 A;  2DRW A;  4N1X A;  1BSG A;  4HBU A;  1KDS A;  3SH8 A;  1MBL A;  2H10 A;  1BUL A;  3PTE A;  3CG5 A;  1L0D A;  3IH9 A;  3V39 A;  3W4O A;  2WAE A;  2OSU A;  1BLP A;  5AQ7 A;  3UO9 A;  3VSL A;  4O7D A;  1ONG A;  3DTM A;  2C5W B;  2P9V B;  1G68 A;  3BYD A;  4WZ4 A;  4WEJ A;  3VFF A;  1K38 A;  3O3V A;  2XR0 A;  1FSY A;  3G34 A;  5E2F A;  5KMW A;  5A90 A;  3UE0 A;  5F1G A;  1PI5 A;  2JC7 A;  5FI7 A;  1DJA A;  1K57 A;  3OPH A;  4S2J A;  5FQI A;  1ES2 A;  5GLC A;  4MBK A;  4JBF A;  1MPL A;  2QMI A;  2XH9 A;  1FCO A;  4BD1 A;  2VGJ A;  5U47 A;  1QME A;  2EX9 A;  3LY4 A;  5E43 A;  4Z9Q A;  1ZG4 A;  4Q8I A;  5FI6 A;  4MBH A;  1ERQ A;  2ZC7 A;  5FAQ A;  3IXG A;  3IF6 B;  5KZH A;  1ERO A;  4NK3 A;  1IYS A;  1WYB A;  1BZA A;  3MXR A;  3HLW A;  3ZG9 B;  4EBN A;  1KE3 A;  3IF6 C;  5FDH A;  3DWZ A;  2FFF B;  5IHV A;  1MXO A;  2OLU A;  1NRF A;  2XGN A;  2ZQ8 A;  2Q9M A;  3HUN A;  4JF6 A;  2IWB A;  4LV2 A;  4E3L A;  4LEN A;  3D4F A;  1KGE A;  5AQB A;  4BD0 A;  4MNR A;  2EXA A;  5HAI A;  2PU2 A;  4E6X A;  4GZB A;  3LO7 A;  4UA9 A;  5EPH A;  1CEG A;  1LI9 A;  2ZC3 B;  4IBR A;  3FWL A;  4KEN B;  3V5M A;  1K6R A;  3PAG A;  4KZ6 A;  2HP9 A;  4WMC A;  5HX9 A;  4S2M A;  1PW1 A;  3QNC A;  3UDI A;  4WEK A;  2J8Y A;  4IVI A;  4BL3 A;  4RX3 A;  1YLJ A;  2VGK A;  3NC8 A;  4DDY A;  1VM1 A;  4BQM A;  1LLB A;  1RGZ A;  3GSG A;  1DY6 A;  4ZBE A;  4GD6 A;  4QHC A;  4KQR A;  4FCF A;  5D3O A;  1TDL A;  1KVL A;  2UWX A;  1GHM A;  5EE8 A;  1HTZ A;  4UA6 A;  5GLD A;  2B5R A;  4EUZ A;  4PM6 A;  4N1H A;  3A3D A;  1HZO A;  4P0M A;  5E2H A;  5G18 A;  1W8Q A;  2WGW A;  2H0Y A;  4C75 A;  3ITA A;  3NBL A;  1XGI A;  5KSH A;  1KGF A;  1O07 A;  4OQ0 A;  1IKI A;  3IHB A;  2E8I A;  4KZ8 A;  3UNW A;  1I5Q A;  5EVI D;  3W4Q A;  3ZGA B;  4XUZ A;  5HW3 A;  1FR6 A;  4HEF A;  4RA7 A;  3HLE A;  4N9K A;  1SKF A;  3NIA A;  4R3B A;  4UAA A;  1S0W A;  2PU4 A;  3HL9 A;  4X68 A;  3RXW A;  4K91 A;  3MBZ A;  1IEL A;  1SCW A;  1L0E A;  3NY4 A;  2XEP A;  4DE2 A;  5M19 A;  3BRM A;  3VP2 A;  3OC2 A;  1EWZ A;  4DKI A;  3VMA A;  5CED A;  1CI8 A;  4KZB A;  3PBN A;  1BLH A;  1MY8 A;  1MWS A;  3PAE A;  4KQQ A;  3FKV A;  2CC1 A;  2G2U A;  2R9W A;  1YQS A;  3O88 A;  4WM9 A;  4DE3 A;  4K0W A;  5GL9 A;  3VP4 A;  2XK1 A;  3ZG5 A;  4OLG A;  5CTM A;  3A3E A;  3Q1F A;  4KZ7 A;  3UE1 A;  2Y2M A;  1FCN A;  3W4P A;  4MEZ A;  4E6W A;  3HLG A;  3BLM A;  4WZ5 C;  3VSK A;  1H5X A;  3N8R A;  5TGF A;  3SH9 A;  2RL3 A;  2ZQC A;  1XA7 A;  3OPP A;  3OCL A;  5CRF A;  1K25 A;  3O86 A;  4R23 A;  3UY6 A;  4EQI A;  3C7U A;  3Q7V B;  5FI2 A;  5M18 A;  3MZF A;  3BFE A;  3ZNY A;  2P9V A;  2GDN A;  1YT4 A;  3BFF A;  5DVA A;  2Y4A A;  3UDX A;  5HFO A;  4PM5 A;  2EFU A;  1JWP A;  3Q07 A;  3VOY A;  2WYX A;  1K56 A;  5EVL A;  2ZM0 A;  4WYY A;  4X53 A;  4OQH A;  3Q7Z A;  1QMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...