4K9SA

Peptidoglycan o-acetylesterase in action, setmet
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
b'LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
molecule tags Hydrolase
source organism Neisseria meningitidis
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
total genus 110
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k9sA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k9sA01
3DT8A 1VYHA 4Q7QA 4K7JA 4Q9AA 2APJA 4K3UA 3P94A 4S1PA 1JRLA 1Z8HA 1BWPA 2Q0QA 4XVHA 3RJTA 1VJGA 5HOEA 4TX1A 4JHLA 2W9XA 3DT9A 3MILA 5BN1A 1IVNA 4PPYA 3DT6A 1FXWF 3DC7A 2WAOA 3DCIA 4OAOA 5CD9A 5JD3A 3W7VA 1BWRA 1PP4A 1ZMBA 1U8UA 1BWQA 4RW0A 3HP4A 1ESCA 2VPTA 4I8IA 1K7CA 4JGGA 2Q0SA 4K9SA 1DEXA 2HSJA 4LHSA 4JJ4A 4M8KA 4DEVA 4JKOA 4K40A 5A4AA 5B5SA 1J00A 1YZFA 4H08A 4OAPA 1WABA 4IYJA 1ES9A 1FXWA 3PT5A 4JJ6A 1ESDA 3U37A 4NRDA 4RSHA 3C1UA 4HF7A 2WABA 3SKVA 2O14A 1ESEA 3SLRA 1DEOA 3KVNA 4HYQA 2WAAA 1V2GA 3BZWA
chains in the Genus database with same CATH superfamily
2QENA 1Q7BA 3AUYA 1OF3A 3RBVA 1Z7EA 1E3JA 4ZJYA 2CF6A 4MADA 1D9XA 4M1TA 1E8DA 2W11A 1J0XO 1AB6A 1RUH2 3VZRA 3AIKA 3LLVA 1AK2A 1LX6A 2C8VA 4Z7NB 4XR9A 2O06A 3QBJA 1QKJA 1ISRA 4R2MA 1AKTA 2A9FA 3F46A 3C97A 4KODA 4EABA 2O3RA 4RHXA 4BYYA 1KMNA 2ILVA 4LBOA 2WUWE 1DJQA 2RH8A 2PZEA 2OPHA 1CP2A 2BQPA 6GPBA 2BU9A 3OWXA 1WDKA 1XMPA 3QLQA 3VBOB 3OPZA 4D79A 2BMFA 3KWJA 5EJ7A 3IP9A 3D5QA 3W5DA 4HADA 4PLTA 2XWBF 2HWUA 3MJFA 2G83A 1F4PA 2OXIA 1BEZA 1ZJZA 4H1HA 2XB2A 1LX7A 5K3EA 4YRPA 4I3GA 5ECWA 3FTEA 1VBE1 3BGIA 1NCQA 3BD7A 3L04A 1WMBA 2V9PA 4G5RA 1H0RA 4MUBA 4K6BA 2PBFA 4DMHA 3O84A 4G1CA 1JA0A 2ZYSA 3HK2A 5IJZA 3ICCA 4JLAA 4K20A 4A3SA 4L0DA 2R8YA 2ZZJA 3E6DA 4QGSA 4MGQA 2X4DA 4TL7A 3MTEA 3B7MA 2PUJA 4UM5A 4XFFA 4BZQA 5REQA 2JE9A 4YX9A 5FZ3A 5CADA 2PUBA 3AL2A 4ZI3A 2O5RA 2C2WA 1NF3A 4L74A 1YC2A 2HNAA 1HQWA 2K7ZA 3OY2A 4CTOA 3F6PA 1QHHB 4X8NA 1T35A 3O8QA 4CMGA 3KQRA 3WY6A 3M81A 3ZR4B 1AR82 3CVVA 4KQIA 2RVAA 3T6KA 1EU1A 4P1ZA 4KQCA 3QX3A 2KHZA 2AB0A 2DPXA 4TTTS 3MEQA 3HVKA 3OP4A 1H3NA 1XUOA 1S2LA 4EZEA 1R6AA 3UCXA 5M34A 5FBQB 1DG1G 5DPNA 1PT6A 2DECA 3HDYA 1S0DA 1GZ3A 4LYHA 3WLFA 2YMQA 4RIEA 2E4AA 3QTLA 1IVYA 4Y2SA 1MZPA 2HU5A 3CMCO 4RAOA 1K86A 4DYDA 5L3RA 5E9QA 3ZQ6A 1A5BB 5IVKA 3ZQKA 1EWTA 3OC6A 3TW0A 5L4SA 2PQMA 3C5EA 2GEDA 4HCJA 2VYFA 3UTDA 3KHSA 5F1OA 3AP1A 3ZY3A 4YK7A 1Z4NA 2IYPA 4ZYYA 4F3TA 1ND6A 2BZSA 1WZ2A 1U9IC 3VR2A 1HXS3 3KV4A 5ISLA 4EJSB 4IDNA 4Q4W1 3T1MA 2MSNA 4DG9A 1HJFA 3JWEA 4IFIA 4N41A 3PHJA 1GCGA 3DG9A 3FBWA 4P4NA 3ORJA 4Z4GA 4CU6A 3PGKA 2RFLA 1YQUA 3O8DA 4TMYA 4AU1A 1V9U2 3OT5A 3O75A 4RS3A 3PJQA 1SG0A 4EJ2A 4X6RB 1OIVA 4V1CA 4LKEA 2G5CA 1EVEA 4U7HA 1LV8A 3PDQA 1JRLA 1W6UA 2PUWA 2A7QA 2IYRA 4MMZB 1D0VA 2BZGA 3R7SA 1GR3A 2OUIA 1FE8A 1BCRB 4EEXA 4EY4A 1XWFA 1AN9A 2P30A 1ULDA 3WGUA 4B8YA 3FR7A 1LLDA 4LSWA 3SEZA 2OCKA 1HZJA 4F92B 5F77A 1Y4SA 1E3QA 4TL8A 4FPJA 3KZNA 4MNTA 2HU2A 2XMCA 3BIWA 1RYZA 2YFKA 2R8XA 5MN4A 5TF4A 1BS1A 3V1TC 4G1EB 1NW6A 1XZJA 4MTCA 1SQ5A 3HDJA 4MP8A 4FDAA 3FLRA 5FTWA 2GLUA 3GFFA 2EZ8A 1QXRA 3CB2A 4KYVA 4ENUA 3EQ8A 3RT9A 1ZJ6A 1RUH1 3FE5A 3JYOA 4BYMA 1SPPA 4OGGA 1E3TA 5F3DA 1W6MA 2Q07A 4QG7A 1UBMS 3W5JA 2RHOA 1ZA7A 4PHTA 2X19A 2DFTA 3K96A 3WQBA 1KYVA 1MAHA 2G07A 5DTJA 5C7OO 1BH6A 4PXYA 2HLNA 3DP7A 2VW1A 4GRDA 3VH2A 4N01A 4FUTA 4UASA 4BM8A 4G0VA 5JDCA 1K4KA 2IS6A 2DG2A 3PU3A 2PYZA 4QAJA 2D4HA 3OECA 3DC2A 3AERB 2ZRMA 1MS3A 4Q7LA 1RUC1 2JGNA 2EFHB 5SY4A 2UYCA 2RGEA 5COQA 4MHSA 4O4IF 3EG9A 3L0ZA 3RZGA 3IV6A 2ZANA 2C1FA 2CDRA 2W46A 5BYNA 1UEJA 1PZGA 1JSZA 4OPMA 3LPFA 1MAWA 1WDLA 2BTQA 3TNYA 3ZO0B 4M1EA 5I0RA 4GMDA 5FLKA 4DYVA 5LN1A 2XRMA 1OLMA 3MS7A 1QIIA 1S0JA 3LXUX 1N7IA 2E1PA 3BL8A 1UUFA 3CONA 4ZTZB 5D21A 4MIEA 3DDNA 4OP3A 1DBRA 1C3OB 3DL2A 2HMTA 2I6SA 5IHPA 3EIWA 4OA5A 4HSJA 4JQZA 5EYXA 5L51A 4NAMA 1BQ3A 3TH5A 3WGNA 2NU8B 1OWPA 4XJAA 5HF8A 3OKFA 1S3IA 2XGXA 4IF4A 5DZSA 2LCQA 2XVAA 5CDFA 2NMVA 4J0HA 5AP9A 1NJGA 1UQUA 4ZCLA 3F90A 4GQ7A 1UT5A 3WR0A 1M33A 3HRKA 4TRNA 5A4IS 1H69A 2NNLD 2W2KA 1KMCA 4RW0A 4X6XA 2ZSDA 2BOJA 4DREA 4AZ0B 3MBWA 5IPFA 2O57A 5G1OA 1HE1C 3MBIA 3IHLA 3BICA 1C0PA 3T4PA 1HQCA 1SKYE 3DXUA 4D4IA 3CX8A 1T2DA 1NJFA 3OEBA 2NVUB 3LC1O 4Y7DA 3BFKA 4J6FA 3JZAA 2IXHA 1I2ZA 3GT0A 4GPZA 4UFLA 3WK4A 4XCQA 3A6KA 5JH7A 1ZD1A 4GKVA 4E4YA 1P7YA 4CMJA 4XBLA 4F83A 1Q0UA 4J1TA 4B7AA 1F1JA 4AYUA 3SQMA 1VCNA 4RDIA 4OFXA 1RSZA 3NJRA 1U8AA 5KYGA 1YIOA 1GG8A 3GR6A 4HLTA 1FUYB 3GGSA 2XF2A 4BN4A 8ATCA 2G1AA 2R4QA 1QB7A 5ILQA 1FVOA 5T4FA 1S01A 5IM4A 2ISCA 1UBSB 1U4NA 2YJ5A 4G3XA 4RVCA 1Q1GA 2HFJA 5ALZA 3JQAD 1A9XA 1JT9A 3VZLA 3D82A 2JX9A 4EFDA 3U9TA 4BFXA 4DA8A 5CEEA 3D0JA 3S2FA 5ARBA 3FZNA 3DONA 3OGRA 1OPOA 5FA6A 5C46F 2ONCA 2FOXA 2QLNA 2ODAA 3EAGA 4PYOA 1VE9A 3PS9A 1EAMA 5BNNA 2IPLA 3PEWA 1SCKA 5THXA 1F7VA 2OSVA 3R0ZA 4UHJA 5CISA 5AYVA 4YJ3B 2QV0A 3VJRA 5CNJA 1J97A 2PD3A 3A32A 2B9EA 2QT1A 4DDVA 5JSZB 5F2SA 1LOFC 8AT1A 1T8PA 4P9NA 2ENRA 3AHJA 3MPBA 2FFBA 2Y1OA 3M5WA 3MIEA 2BEWA 3THXA 1SUDA 4DINB 4GSKA 5FZGA 2CXPA 2IXEA 2J1AA 1OPXA 3A06A 4LDAA 4RJKA 5EIHA 1RBYA 2XDWA 1I3HA 1J5PA 4COYA 2VWPA 1CR0A 3U0BA 3SVLA 2NGRA 4IXMA 4G2NA 1VBD2 2HEYF 3AEUB 1U8UA 1SKQA 5DGHA 4D44A 1T6NA 2PLNA 1TVGA 2X7HA 2GNPA 3OEAA 2W4IA 5DUWA 4XFKA 5EIBC 1P0MA 2QSJA 2QQJA 2JIOA 1QQ7A 4ATFA 3EVGA 3JAWA 2I5PO 2NZ9A 4PZZA 1AJOA 4U2GA 1ISIA 3ONNA 1JAHA 4NULA 2YXBA 4G0NA 3HABA 2PMFA 3VZPA 1RJ8A 4GEGA 1K5MA 1Z0FA 3T61A 5BURA 5HF5A 2P4SA 2QTNA 3IT2A 3OKAA 4N5HX 3D8TA 1CS4C 1QGYA 1TIBA 2AVNA 2A4KA 2BN4A 2NXEA 3WNMA 2LD4A 4N6GA 4RQAA 2J8ZA 2OP0A 4JHLA 1KYQA 3DBRB 1FTWA 4G5OA 1I7QB 3PC2A 4QNNA 1R1ZA 1VQ1A 3L77A 4ARYA 3HKCA 3N59A 5JCOA 2VOEA 2ZE7A 2J6HA 3E23A 3FF4A 4BVLA 3KZVA 2GO1A 3EVCA 1ODFA 5F5QA 2O0LA 3K09A 1HRKA 4RVFA 1HH4A 5BMVF 3EGWA 3ROKA 1E5IA 4HB0A 4KE8A 4YONB 3PGA1 1E7RA 3TE6A 1DYOA 3GFSA 4R6WA 4EUFA 3A3PA 4O4HF 1QH1A 3TNDA 3ZCSA 4GMP1 5EIFA 3ZHRA 2XLGA 2P40A 2RHMA 5JDBA 1S4QA 3GEBA 1Y3DE 4WOPA 1LZLA 3CJRA 3R5XA 1PMIA 2JAQA 2P34A 1VJDA 3ZGVA 2WMNB 1PF7E 3TWIA 4I2OA 3OHSX 3AG5A 4ALJA 1MGOA 4YW7A 2I4RA 1SACA 1UAYA 5SZIA 1Z08A 3A0NA 2ZSAA 4BXSV 3RUEA 4XD2A 2JVIA 4TZ0A 2GZMA 3G5UA 3MS2A 4JYZA 4WN9B 1MV5A 4Y2YA 1IXSB 3NDIA 4N8EA 2P9QA 1G18A 4F4JA 1OYWA 4BL5A 1BBT3 1DPGA 3ZSMA 2H5LA 4C4ZA 4NMHA 1FYDA 1U1GA 1XDBA 1OHHA 4OL0A 8ADHA 2NPOA 4ZPJA 3EMRA 4URFA 4J4BA 1TL7C 2F64A 4TWZA 1IY9A 4NBLA 3WB2A 5LNK1 1QGAA 4AKGA 4C0KA 2WF5A 4XLTA 5COAA 3SBDA 1X70A 3KXKA 2YV1A 4AFAA 2EFJA 1NAHA 1U7WA 2D3TA 3V8MA 1BJKA 4O9EA 3W2FA 3WWCA 2YUIA 4NBTA 3L46A 4O4LF 3QV2A 1MX3A 4RVNA 5K8JB 4MB0A 1CDDA 2ODBA 1LW7A 4Q4V3 1CFZA 3V48A 1EE9A 2CD9A 5TQ0A 3THSA 4B44A 4ZGWA 4HNGA 3NYRA 1XZKA 2KI5A 5CURA 1FS4A 3RV4A 2JEMA 5GKAC 3KQUA 4FU0A 1LSJA 4BU0A 3GEPA 2YDXA 1N9GA 3LSYA 1Y5NA 5FZ6A 1VE0A 3BWEA 3M34A 3N86A 5TSWA 4NYJQ 4UDYX 2VZPA 3K0CA 2EEPA 1NJ1A 4A2QA 1TAGA 5DKFA 3HR7A 3J8F3 5AKXA 4UPEA 3GEHA 4DR5B 5H3CA 3HC7A 3K46A 2CV6A 3IMGA 4AJKA 2ZYDA 5FOJB 1EK2A 5AM5A 4AYTA 1WA6X 2PHUA 4MI6A 3JU9A 5DHAA 4AAXA 4Q39A 4XXHA 1C57A 3FPBA 5FWXA 4C2BA 3LDKA 3HBKA 1RI1A 3CINA 3H2JA 2KQUA 3WXMA 3M4FA 1RCFA 3HUUA 4OHWA 2HFKA 4XE9A 4FILA 5CB4F 2ORVA 4B80A 4RA9A 1BDJA 3HCNA 3CIHA 1SK8A 4IV1C 2AOTA 3DMTA 1LD3A 1TCAA 3UK6A 2FPGB 2X5IA 2ZAHA 3HCFA 1N4AA 2JL1A 4QKDA 3UW3A 1NURA 3KOOA 2GTPA 4Q9JA 4WLFA 1CX9B 2C4TA 1QMPA 4AEDA 3E4CA 2BI8A 3FMVA 3IT3A 2YXEA 2XNKA 1TME1 2IZOA 2P27A 4GVLA 2JIRA 3PL0A 4F8YA 3LPGA 5IBCA 1AYM1 1BGWA 2WZR1 4H1TA 4MVJI 1QDCA 5DCYA 1ZGHA 4MVJD 2R063 4BC0A 3M5DA 3I6BA 5CT9A 1Y7TA 3HEIA 1M2GA 3PR1A 4J7AA 2VSQA 4UUBA 4TV9F 5CA1F 3G13A 1OAKA 4B4UA 1VYUA 3IAQA 3QXCA 2XONA 3BN6A 2ZEZA 1SC9A 2Q8OA 2W6ID 3U3RA 3FCAA 4FVVA 2QU7A 3KZ4C 1SBIA 4RYLA 4WW0A 5BO5A 1X87A 3OM0A 2CLSA 3K92A 3WHIA 3ES9A 1EG7A 4ME6A 2QIOA 5FKCA 5I91A 4OGLA 4JHZA 1GM5A 3N7UA 3LG2A 2VPYA 2HBUA 4JHXA 4JKIA 2ES3A 2RGCA 1Q7TA 2IYUA 4CIDA 1A34A 4IF6A 2X8WA 3I37X 3L2YA 4G86A 5EYPA 1PYDA 3DBVO 4F3CA 4L72A 1EB9A 4AFBA 1RB8G 1GZCA 4BBAA 2WNIA 1YWKA 4D3FA 2BBAA 3VYVA 1KEPA 4C6SA 4MPDA 1QVRA 5AVZA 3VI4B 4B3NA 5AC92 1AQNA 2JH9A 1JUIA 4CUJA 2JGRA 2XD9A 5FI5A 3T0AA 2BPA2 5GGXA 2UURA 2C7QA 3PQFA 3OJCA 4LKRA 3WISA 1JG7A 3A11A 3P9QA 4NAUA 4JMPA 3TLGB 2R8RA 2QROA 1Q0QA 1ML4A 1KDTA 2OHHA 1ZWKA 4DPKA 3KUUA 1XE8A 1CRZA 1GAWA 4PAGA 1W5SA 3VBFB 2HR1A 4JD5A 3FUUA 2FN4A 1ESZA 4CKEB 3E81A 4LK3A 2X8LA 2WVAA 2BBVA 4BO3A 3NNDA 4EHLA 1ZIPA 3DFZA 2C0ZA 3VR3A 3GPCA 3F6SA 4F1KA 2QN9A 1AK9A 1JBKA 5E0KB 3F5DA 3NIBA 3SZGA 2H2IA 3P9KA 2IUUA 5LU8A 3FPLA 4ZS2A 3HNYM 3IFSA 4K9KA 3OBZA 2PXJA 4RLQA 1MU0A 4CDXA 2I1QA 5JALA 3VOSA 3U09A 1V8FA 4GQAA 5T5OA 3Q3GE 5THQA 3TOXA 2V1XA 3N2KB 3M3PA 4RENA 2ACWA 3VAYA 2JATA 2FWMX 4IYJA 2V4MA 5JAPA 3RZLA 3D3KA 1D5CA 3ONWA 3WNNA 2RI1A 3X2FA 3MIDA 3W5HA 4BB0A 3SYRA 1KU6A 1BXZA 4XF4A 4TYQA 3QU4A 2DFKB 4C0SA 4FGWA 1XB9A 3AP4A 3WO1A 2Z3ZA 3MLEA 4E27A 4NNOA 4RIFA 2BFUS 3AXTA 2Y1GA 4CLXA 2FE4A 3B13B 1R0CA 4Q4CA 3IP6A 3BEDA 1NVAA 2BRUA 3R3YA 3PKZA 1B3RA 4FYKA 1ATIA 3JVDA 4AFNA 4ENVA 4S2GA 2ZEXA 2TSYB 2AHOA 3QWBA 3CRNA 4A0GA 3NWPA 4LGCA 2XCSB 1FFAA 1YV9A 1DX4A 2C58A 1QEXA 2RB4A 1IN7A 4ZTBA 2QYHA 1YUMA 3IQEA 5IJ0B 1JVNA 2ZHNA 1RHMA 4XLZA 4KQJA 1KMHB 2YHUA 3AR4A 1J2EA 1NZIA 1AX2A 3KSAC 5JD4A 5C4MA 1SXJE 5K3SA 4WZZA 1A04A 1SLCA 2R8ZA 1DKQA 1TTHA 3DKKA 4BO6A 3SJCA 3RPQA 4QU0A 3PQCA 1HXHA 5GPBA 4E33A 1F0PA 1JU9A 5JZBA 3CPSA 2OUJA 2PA0A 4TWRA 3EIEA 3IHWA 3N6VA 1LHNA 4LOJA 2ORXA 4OXQA 3EFOA 5BMVB 2RMU2 1T2AA 4N49A 4YWAA 4MR8B 3MERA 1JKFA 2ZTLA 1CW2B 3SG0A 4AZTA 3I52A 3ZZUA 2OQ7A 2FZ4A 1SA0A 1V7ZA 4JKKA 4KXLA 4DA9A 4IW3A 4L8WB 4DLPA 2QXYA 4C4SA 1G21A 3WBKA 5FYYA 2BZDA 3QE3A 3DHNA 2YWEA 4RMNA 3KLBA 2IEAA 1UMIA 2IYFA 4C6TA 2ZHMA 1QE5A 4FT4A 3BU0A 2Q0SA 3GVHA 3BALA 2YS7A 3C1OA 1L5KA 2ZRKA 2DURA 1YDEA 4HHEA 4ERXA 1O95A 4HQNA 2NVWA 2YV3A 2V58A 1NMXA 3QZUA 4EHJA 1EZZA 3GJ4A 4Q3AA 1JDBB 4RK5A 3EGXB 5HV0A 3ZNQA 1B41A 1J24A 2OHFA 3LZCA 2VUHB 5L9RA 3I3DA 4RH0A 2CWDA 4E32A 5F5XA 1OAOC 4AGGA 4WZAA 4F93B 3ZHZA 1M8JA 1B6SA 3VBRB 1G2QA 4ZT6A 1LB2A 3BXXA 3KFXA 2QSZA 5HUQA 1V4BA 3IAEA 2CUTA 4PYIA 3THXB 4L02A 1GSOA 1IHYA 4KQFA 4IEOA 1IY2A 1I3LA 4YFVA 1XGKA 2UXCB 1N6KA 2CHVA 2VF5X 3BGOS 3QVGB 4BIMA 1YQGA 1G8JA 2KM2A 4LO8A 2WAOA 1WDTA 2C57A 1KZHA 5JO9A 2ZJYA 1E7MA 1OURA 4MB6A 3KL2A 4MICA 2H57A 2J7MA 2FHSA 4OJTA 1ACJA 1RPAA 4XPVA 4ISCA 4CDWB 3VH1A 1WE2A 1P80A 3PT5A 3B1KA 5K0JA 4J1TC 1XAHA 3F0TA 2GETA 3LVQE 2FCTA 3W2EA 2UWBA 2HLDD 3DKIA 5E7MA 4ECAA 4HUQB 3V34A 4NAVA 3HDGA 3TBKA 4GWLA 5E1OA 3ELYA 4BISA 2Y71A 3GROA 3IIAA 3JQBA 2DWOA 4V1CB 2KR2A 1Z82A 4LK6A 3V2HA 3UWKA 2PX3A 4RGGA 1EAH2 4CMBA 3RR2A 3VGPA 3QLTA 3SR3A 2QQ0A 4LIPD 4QYMA 3MRXA 4IRXA 1FFXA 5K0SA 1C3XA 3DFKA 2MJLA 5G40A 4Q4V2 5HRCA 4DV4B 1N9KA 4UTVA 5EHDA 3S8EA 4HDNA 2WSIA 4JLWA 1M2OA 3QBEA 5EJFA 1I3NA 1JE1A 4ES9A 1W8OA 1S0BA 4MRMB 1OLUB 2P1DA 3REOA 1SHTX 3DEHA 5F7OA 1UDXA 4HNQA 3AR7A 1BDHA 4R7TA 4P4TA 4ENQA 2NTNA 4KI5M 4JQCA 4PSDA 2YBPA 5MFPA 1JFFA 5BSFA 4EPRA 5IAXA 1DRKA 1XPRA 4FBLA 2VPVA 3BKWA 3UV9A 1Z9BA 3FMPB 1NJ6A 4KFTA 2VCHA 1R081 1P7WA 4HWSA 2DBYA 4AQ7A 3T0GA 4XD7A 1RQRA 3D4NA 3MWGA 2V7UA 5TXGA 2QIPA 3LTEA 3G1WA 1Y1KE 1H4TA 4TX1A 1KWKA 3RADC 4D6RA 3S99A 2PEZA 3OZAA 1C7EA 1UZLA 3ZTTA 2H92A 2BR5A 3KETA 1FU8A 2FRVA 2AS0A 1TZKA 1FYEA 4ESHA 3P9XA 3OD1A 4Q4Y3 1CXZA 1N6RA 7MHTA 6Q21A 4KYUA 3RRNA 5EWJA 1LTHR 2FLKA 2Y1LA 1NOVA 1KOFA 4BJ0A 3I9V1 2PYTA 5JRDS 3HR9A 2IOFA 4P2BA 3JQBC 4R71A 3MF4A 1O91A 4E13A 5F2WA 4IKPA 5ER6A 2W37A 4B0PA 1EDZA 3USUB 3BWXA 1Q0HA 2V97A 4CV2A 1Z6GA 3IRUA 4KRFA 4JLSA 4X1IB 4I2NA 1T3SA 2RKWA 4ZAGA 1TG7A 3VYTB 4FT8A 3OZSA 3A37A 4CGYA 4P0TA 4YAEA 1SG6A 4MOAA 3NHUA 4NMLA 1VGRA 1DKNA 1PR2A 2OCGA 2X0FA 2PU5A 1T1JA 5C8CC 4UI9L 2ZPXA 3KDSE 2E4XA 3AY6A 3OICA 2VJAA 1VJ0A 4CF7A 1XYPA 3L1IA 2QQMA 4D9CA 2F67A 5J47A 5CA0F 1KXJA 1S8OA 4KMMA 4HL0A 1Y6RA 1ZUD1 4M37A 4OMUA 2J0QA 4Y1RB 1OX5A 2EL7A 5FYCA 3ND5A 1MIHA 4YECA 2VDRB 3LE0A 4Q3CA 1W9SA 3CH7A 4CMEC 2TMKA 4JNCA 5EIAA 4LXLA 2GEBA 2WR8A 1UXGA 5JMPA 1W6NB 3BXZA 1NUQA 4DPNA 1L7AA 1WCYA 2ONJA 4Q4JA 2R751 1CESA 3OQHA 4OQQA 3ZE7A 4QQ8A 5FXZA 1MO5A 1GO2A 3QKSB 3LWBA 4TLEA 4N82A 2D98A 1YS1X 4EYOA 3OZVA 3OCZA 2CZCA 1VE3A 4ZO7A 3ZC3A 3H1FA 2W0MA 4F6RA 2Y4NA 3ZCRA 2AT1A 4CWAA 2VMEA 5DSTA 4RIIA 4F56A 1W0KA 2PSEA 3J81A 1A82A 2R6ZA 1QIKA 1QE3A 5AO9A 2JDIA 1GILA 2UUBB 3LEGA 4CKBB 4O8ZA 3GJXC 1PR4A 3UGTA 1MEJA 3FFBA 3QPCA 5H59A 4ZONA 2ERFA 4YJGA 4D4KA 3PPIA 3GLGB 2UU9B 3G0BA 3CH5A 1HKDA 5E88A 1TME2 4ZEOA 2G9FA 5FY5A 3RO7A 5K0BA 3CVXA 3WMGA 3T30A 2WJHA 2QN7A 3RNLA 3M6UA 3VNAA 4YUVA 2NQ2C 1FMD1 1CJUC 5FOTA 3V0AA 3G8YA 1FMD2 3LT4A 2DLNA 2BELA 3FSGD 5AJTA 5AVTA 3KX2A 2QPOA 1OB2A 1MPTA 2DUNA 4GMHA 4XWKA 4EWEA 1QF6A 5DAPA 3R9XA 1IM2A 1ZNWA 4UZEA 4PCVA 2G72A 5FWYA 3KT7A 2YVUA 3FAKA 1MO2A 4IRMA 4NPHA 3QE9Y 3H2HA 3ZX4A 2ZXQA 3R75A 2PHZA 3I5MA 1Q6ZA 3H9QA 2W9XA 5FJIA 4BNLA 4YZ2A 2GPWA 4AURA 4R9UC 5KU1A 1YFLA 4TXJA 1MB3A 4IEYA 4BLWA 1UD1A 2WWUA 2D2XA 4A2UA 1OB5A 3QXSA 1JZQA 3QKRB 5EHXA 4QBFA 1K7YA 3PPVA 4UXAA 3O1TA 2IHZA 3B2QA 4HSLA 4LQDA 4MCHA 2QHXA 4KL8S 4WZBA 4ZCQA 1AGXA 1H6XA 1TB4A 5BN4B 5ERYA 2DUQA 1QZUA 1FW8A 1XCPA 5JMWA 2WBKA 2NZ2A 1NG9A 1F8YA 4O25A 2J5KA 4LHVA 4X1KB 1G3QA 4A45A 4W9RA 4TWBA 2WABA 4Z07A 4CCEA 4EI9A 2QJTA 1ESEA 4K9OA 3IP8A 1URPA 1SBTA 2UZ0A 3OOWA 4BMZA 1JXOA 2VSFA 5EE1A 2BFPA 2JFGA 3AM3A 5CVEA 1KQGA 1KAMA 4XVQA 5E6SB 2VJMA 2WP0A 3O1MA 2UVPB 5HBGA 4BLQA 1PUIA 2MT9A 3M70A 1ONOA 5EWLA 3AYZB 5JT1A 5IAEA 1TD1A 4IIJB 2J48A 3CN9A 3N05A 2YWDA 3NH6A 2GN0A 4BO2A 2VNHA 4ZHNA 4GXNA 1UOOA 5A06A 4ROSA 2JG9B 3A6PC 1WD7A 1U8ZA 1ZWLA 4KR2A 3JWGA 5GZEA 2PVCA 2H1VA 4YW3A 3ZWMA 2ZWVA 2B0CA 4MPJA 2VY0A 2C7VA 3B6EA 3QTBA 3ZHBA 1I7SB 4UW3A 1W35A 1I2AA 1VCOA 5CW2A 3ZNPA 2I66A 1UJMA 3CHXA 5AVQA 1PIV1 1L9XA 4QECA 2RGXA 5LQDA 3TEMA 3U81A 3F7MA 2J9XB 3KOZA 1PGOA 1K8ZB 3Q6IA 5E89A 1ISFA 4PEVA 4YFWA 3ICEA 3IBCA 2AQKA 2BGRA 2EYUA 4GWIA 1DQ6A 3A3NA 2VAPA 3AR5A 3EXIB 4J2HA 2EHDA 2BVNA 1DC7A 1Z17A 3UA3A 2JD0A 4IG4A 3ZCVA 1GZWB 4BIIA 3M49A 4Y26A 1Z5VA 5IJAA 2HF8A 3FYUB 5AM0A 3L0PA 4MULA 3T94A 2I54A 2HHCA 2HQBA 2HSDA 2FW9A 1UEXC 1N5KA 1FXUA 4F1WA 4JI5B 1BTOA 1VBE3 1FTGA 3WG2A 1S0CA 5E0OA 3DYOA 1JS1X 3KXIA 1H0SA 1DKOA 3P2YA 2OA0A 4J43A 1CR2A 1BDIA 1NIPA 3RANA 4GYJA 2GBCA 4MLPA 5GLWA 4PC1A 1DRVA 1NW3A 3C4JA 2G28A 4P5PA 5E2AA 1AD2A 4IDHA 4MW7A 4RHV2 4Z2WA 1Z8NA 2X0KA 3WL8A 2I6FA 5LZ6A 5DF1A 1XTRA 3QXHA 4YXWA 1OKQA 5E6SA 2JFVA 3SEEA 2WKKA 3ND8A 1R6UA 3T9BA 4IJVA 3DMYA 3AJ9A 3HXKA 4LJRA 4ZXPA 4Q9IA 5KHJA 3VHPA 3L18A 1OZAA 1Y42X 2UXDB 3AESB 1WKCA 4KHPB 1XCLA 3TSCA 1E9FA 3LK6A 1Q8OA 5T55A 3GPDG 2VL4A 3AZYA 5IZCA 1JSLA 1BDBA 1NYLA 3TZLA 5JECA 3CY6A 4XSGA 3EEBA 2VH5R 3KUCA 4UAUA 3H5OA 4DQ0A 3VPAA 1U5BA 5JBNA 3KKNA 4RR3C 2FDJA 4UTZA 1UZVA 2JG8A 1Q8VA 4Y4YA 1FP2A 4OG2A 4R51A 1AHIA 1RJ9A 3MV11 1CIYA 2OHOA 3IMEA 1HFKA 4FB5A 4AKIA 2NZVG 4QB6A 2WSYB 1ZN2A 3PSAA 2ECQA 3TFWA 4ITRC 4BFCA 5H83A 5C1IA 1CUYA 3CKLA 1A9PA 5CG8A 2I2CA 5FPYA 2IHBA 5JJBA 2P9JA 5CA0A 1Z06A 2B45X 2E4WA 1RUH3 3N58A 1BKZA 3FNQA 3WJ2A 4H3WA 2J1LA 3WNXA 1OPRA 2CVFA 4TS1A 5B2ZA 1YZTA 4G6ZA 1CJPA 2VECA 5BWMA 3KF5A 4LBQB 5ELXA 2HLPA 4QLOA 4OVKA 1L5HB 3KEQA 4HZFA 3HMKA 3JQ9C 4HGOA 4A0RA 2FH5B 1JUDA 3CLUD 3WVNA 3SJZA 4FFNA 4LBQA 1FIUA 1UAGA 4CG1A 2PKQP 2D5LA 4QTYA 1XV5A 4MPPA 1ZD4A 4L7QA 4DB4A 1QKIA 1DX6A 3BTZA 2QAGB 3F8WA 3TW4A 5CT8A 4KIUA 3EC7A 3VFDA 1QOPB 2B1QA 2R1BA 3KM0A 3C7HA 3CU5A 3KCCA 2PKXA 3NV1A 3OIGA 4CW7A 1M5UA 3O1SA 5D5HA 2ZJOA 4B4OA 2ZUEA 1QHHA 3W7BA 3I3BA 4Q9DA 1KK1A 4PO9A 3PQ7A 3OJ0A 3SP1A 2H5JA 1OMIA 2JXAA 2TYSB 4HEQA 3D8UA 4OK3A 1T4CB 5EJ4A 2Y34A 4LJ6A 1ZVFA 2AE2A 3H3UA 4WVVA 5FPUA 2FV8A 4EA6A 4ZVTA 2WJWA 1Z0ZA 4FMDF 4TGLA 2BCEA 1DKUA 3MC1A 2QY9A 1E77A 3QHAA 3I9NA 1WG8A 2WWXA 5A7SA 2ODWA 4DXRA 3W5CA 5LWBA 1N2GA 1FK8A 4GNKA 5BYKA 4D42A 3DKWA 1FMLA 4D6QA 2FMDA 3WW2A 3PMEA 4CDQB 4BZZA 1HG1A 1JDVA 4KH9A 1X2EA 1CT9A 3QACA 1SXJB 3IUBA 3VU8A 1UEIA 4FPFA 4OYUA 4JYBA 1CE8A 3D0KA 3C1TA 4XDYA 3C3EA 2OORC 1ULUA 1I6LA 4UZSA 1XQ1A 3HO8A 1W0NA 2JA2A 2BJSA 1X9IA 3S5JA 5AI4A 4DUWA 3HCRA 4OHBA 5CVRA 3T5PA 3LYLA 2OQVA 1GL3A 4AB1A 5LYYA 3IPLA 4CUZA 4L08A 5FY0A 3OT1B 3P7MA 2IE0A 3UGQA 2OD7A 3LOUA 1H2YA 7ADHA 4F91B 1FNYA 5EMNA 3ZZ1A 4U9HS 1PV1A 1DAKA 4TSFD 3CURA 3U11A 5THKA 2XWBB 4LV8B 1C3OA 3NJVA 2W0XA 3T3NA 4ASUA 1IL0A 1J20A 1ZMBA 2N0SA 2WPNA 1F6WA 2HWF2 4XUDA 1W4LA 2DF8A 1CUAA 2VBBA 3B7PA 4RVGA 5FXWA 1JYTA 4FE7A 1EV12 2OZPA 1R6TA 3T1NA 2BVVA 5EP3A 1TU3A 4HH1A 4L4YA 4Z0NA 2FMKA 3HY3A 5CB7A 2FOIA 4IV3C 4EAAA 3TQQA 3TAUA 3U7IA 1KKMA 1BVYF 1PD1A 3BHNA 2XMRA 1BIFA 5HSGA 3I0NA 3X1XA 2FMTA 4URAA 4QVIA 3T9FA 3AY0A 3UB4A 4GXLA 4KO2S 1KQNA 1S02A 1RLOA 3CSSA 5ALHA 1ZDMA 1Y98A 4B7UA 1G64A 4R31A 1XU2A 1FFDA 2FZLA 3VYSB 1QQAA 4EPWA 1NJ5A 3BMNB 4KFSA 2Z0MA 3UNPA 1NW8A 1JAYA 4LISA 4UQPA 2Y93A 4HRAA 2JRCA 3HJCA 2FR1A 5KOJB 4B87A 1B43A 4CGZA 3NHJA 3IJ5A 4QYTA 3V2GA 3BI3A 1EFKA 2GFHA 3C70A 2HK6A 1JEEA 4AG4A 1P1IA 1W5FA 3NTOA 5B7GA 3N0TA 3KV9A 1UNBA 2LRPA 3H2KA 1E96A 2JAOA 1ZU5A 1VZ2A 1W6QB 2ZYVX 2DUWA 2D54A 4CCNA 4J7CA 4DJTA 2P3SA 2WU8A 4ZDKA 4UFIA 5TS2A 4U4AA 1R4NB 1JZTA 2O7VA 2PA7A 3GN2A 1KVQA 2MIIA 2OVUA 1SCBA 4ZZ1A 4N5LA 4EQZA 5I8TA 4LLFA 1L7EA 2QRMA 4U3JB 1Q8SA 2PX4A 1ZM4A 1Y9EA 3PKIA 5FDBA 4RHYA 2VULA 1S96A 4LF8B 3H0OA 1TO2E 2B7YA 1XTZA 1R093 3OCWA 1ST8A 3W5IA 3KHCA 3FX2A 1N3PA 4BV8A 1CYEA 4KAXA 3LNTA 1IZ3A 1RAAA 3POWA 2OZ6A 3NWKA 5EIBD 1M1UA 3VBUA 2ZUWA 1CR1A 3DMRA 3RPEA 4KWCA 1PJAA 4HK4A 1G86A 4QU8A 3G5MA 3QLVA 2H6EA 2R44A 1NCRB 1VE6A 1A1VA 1R88A 1D6SA 3MO4A 4YRLA 3IDBB 1G9SA 2NACA 4K6HA 4NY1A 4WESA 3GLFA 2JANA 2TS1A 1IE3A 2B6HA 1SELA 2UZ4A 3A9VA 2D2IA 5HCUA 1FP6A 1UMKA 4KWUA 3V7WA 1FNSA 3RYFA 4EB6A 3EGDA 4KZPA 5KHIA 4YUAA 3QA9A 1GZ4A 1X1BA 4GG1A 3K16A 2Q8DA 3EEOA 1RT9A 1Z33A 5K51A 3C24A 2Z8YM 2BDRA 1PQ4A 5KOHB 5KBYA 4JCKA 1G6NA 4NG4A 2CBGA 3H42B 3DOHA 1YVUA 3BREA 4HT1T 5E95A 1YE3A 4FOSA 1CZHA 3NJYA 2HU8A 3UQZA 1UK6A 2X6TA 5HBAA 4DNFA 3W3AA 4AG5A 3OZFA 6NULA 1T2EA 3ILNA 3T0FA 1AMNA 4K6KA 3MRSA 3KVBA 1K1EA 2X22A 3G9XA 2FPWA 1ORTA 2IEIA 3GLFE 3EX7C 4E4DX 4YRJA 1X13A 2A35A 3AVOA 1P7CA 2X3YA 3EXIA 4ZTUB 2FDFA 1P7ZA 2QR3A 4KQXA 5HFJA 1JEAA 2BERA 4ONUA 5ENVA 1T3LA 3WB9A 4YZ1A 1SHZA 2XECA 4JB3A 4JJZA 1VBD3 5AOAA 4ITVA 2VQDA 1QYRA 4IIEA 1JECA 2VPWA 4JJGA 4KQ6A 2REOA 2QEQA 3QVSA 2R6FA 3P9NA 2WM9B 4RJLA 1GLGA 1MC8A 2REBA 3EZNA 3IP1A 4PHHA 3CLSD 4PZYA 5BRJA 1Q16A 3STYA 3II6X 3VHNA 1XQWA 4PGFA 3D0RA 1ZSNA 3MPPG 4G09A 3ODGA 3ORQA 2EFGA 4HTFB 1CS0B 5AM1A 1J8DA 1ZCBA 2R5WA 4OVEA 3UCEA 4PCLA 3DGTA 2PLV2 4DOUA 1EINA 4P0PB 4Y2TA 3NXKA 3B8EA 3JQPA 3T7DA 1AO0A 4ONEA 3TIVA 3VR6H 1T5TA 1Y4DE 2ZVJA 3KPWA 4E2FA 3MQ4A 2IITA 2ISSD 3MB8A 3WB0A 2Y68A 4BGEA 1LTKA 1GPJA 4G4SP 3FPFA 5BN5B 1J8YF 3FNGA 2QGNA 3WXBA 5KR7A 3ESRA 2HUPA 1KIFA 2FW8A 4EBBA 4AL9A 2VQ3A 2IHNA 3Q15C 1IS6A 2I76A 3MBKA 3OE5A 5AKLA 1ZQ9A 6REQA 2FD8A 3D6HA 4HTFA 3DE2X 4KE6A 2B78A 3KZKA 2OK8A 4KOAA 3NX4A 4CP1A 4PDWC 4IXWA 4FFPA 1JR3A 1Z7WA 2Y0OA 1W36D 1EYZA 4FLFA 1DGRN 3FCSB 2PLV3 4UW9A 2NADA 1GNSA 2H4YA 1RMU1 5KIAA 1COZA 4PYNA 4NCAA 1TF2A 1M34E 3DQQA 3KWFA 1JKMA 3QVXA 3LSTA 1KI3A 1VE7A 4B75A 2WZDA 4AN1A 2W52A 5BXXA 2PGAA 4EI8A 4RLFA 1D4M3 5FZDA 4R1TA 5DM60 3QE2A 2PUDA 1ZS9A 1W9FA 2EVXA 3UIEA 3PPXA 4KGVA 3OJFA 3DZFA 3K2QA 1JR3D 4N43A 4G0UA 1YA8A 1M2VA 3A9UA 4QLBA 3F96A 1YIPA 2OM6A 3AONB 5JNRA 1UIKA 4EYQA 4GAZA 1PK6B 4OYRA 2BCGY 3BC1A 3BERA 4QU5A 1PZ9A 4U8GA 3A1CA 4ZI7A 1US8A 4BNGA 4R7ZA 5DLPA 1LOGA 3PEFA 4L85A 4LYDA 4DO0A 3O1UA 3VM6A 4P2GA 1B76A 4RHCA 3IPXA 3L2HA 2RBGA 1TGVA 3Q8WA 2XQIA 4YRTA 3WLLA 1BXRB 5TF0A 1SCSA 2XZLA 5IG2A 2VRCD 4AP9A 2D5CA 4K21A 1XZGA 1W9MA 4H3HB 3DHWC 2D43A 2QE7A 4FYMA 2BFFA 3LW8A 4MGHA 4Y18A 4CNBA 2JDKA 4Y6LA 3E3AA 3OTHA 4HDKB 3FWEA 3NTVA 1L7OA 4MV3A 3EOBI 2D1QA 3DN7A 1MJHA 1NPTO 8MHTA 1IHXA 4Q9KA 2Y77A 3JQWA 2M6KA 3BDIA 4UDNA 1XI2A 4EPVA 3MTIA 1XO1A 1Y7IA 3OF2A 4YSFA 1ZGAA 4D3WA 3PFCA 3CT4A 1QVZA 4QWWA 5BT9A 5EFOA 3I42A 5CFDB 2MMCA 5H70A 2FPPA 1YQ9A 1PWEA 5A7WB 4CM3A 3BWCA 4GZ9A 5C4WC 3G2KA 3MJRA 1CWUA 3L49A 1ZREA 3RSFA 2YYSA 5F3WB 1O8BA 5JVDA 4RXTA 3GDHA 4I9UA 2VK2A 1IRIA 4KR3A 3TCXB 1N7GA 3EZLA 4QPGC 2FPGA 3B3QA 3LL4A 4K2HA 2HF2A 1TRHA 4Z3DA 3NETA 5EE5B 1T5IA 2C3UA 3AFNA 3TB0A 4LJLA 1AGPA 1HG0A 2KWIA 4PHZA 2VJYA 5JJ5A 4CKBA 1FXSA 3AXEA 4X6LA 3H04A 1P0FA 1PDWA 4ATEA 4GA9A 2IIBA 1AYM2 1Q84A 1CQIA 5EPUA 1C0LA 1OLSB 3TTWA 3C3MA 5B7QA 1ND2A 1IAVA 2H0QA 5CLGA 1O08A 3DLAA 1LVHA 1ACCA 4HRYA 2GZWA 2JH8A 4AEDB 4EUKA 5C1DA 3JARA 2HWF3 5JUVA 1IYZA 3WICA 2UYBA 1SJ9A 3D8HA 5ALVA 3DYIA 4A5OA 2XQRA 1FB5A 3DWIA 3PFHA 5IUJC 3EE6A 2Q3BA 4RHV1 4LVCA 1NW5A 5JFOA 3FUWA 4QQNA 1NV8A 3IUQA 3UAWA 4L6IA 2FPXA 2N46A 5J2TB 2Q9BA 2OAGA 2FQXA 3OE7D 4XAAA 3VTAA 3KG2A 1BQPA 4NOMA 4LBNA 3GF6A 5FTLA 3NP9A 3L07A 1E6KA 4QSHA 3LMKA 1Q1EA 2GBPA 3QWHA 4C30A 3UG7A 3WLIA 3IDSA 4NZYA 2O7SA 1N6HA 3WYEA 5KVAA 5KSWB 4HG2A 2OCPA 1SCNE 4YGCA 1G4AE 3LY5A 1E32A 1ZM2A 821PA 2GCPA 3LYHA 1VKZA 2HPVA 2XCIA 1K7CA 4XEZA 1H8HD 5BSUA 2DHRA 1VBKA 1PGW2 4H6WA 3W20A 4ZRNA 1UFKA 4JRAA 2C1XA 3F3MA 3WYBA 3UUFA 3MPUA 4FHCA 1SVOA 1NIJA 1ZUWA 5K0ZA 2CUZA 3DE7X 1IATA 4ZCPA 2FMYA 3C3AA 2I7VA 3ASYA 4AVVA 5LJIA 3FSRA 1Y1TA 3ZWKA 2O2ZA 5I8YA 1FVXA 3DPRC 1Z0DA 2AACA 2F62A 1ZLYA 2XGJA 1XDUA 1C0IA 2RGNA 4M0KA 3B20A 5LIPA 2ZHLA 2OV2A 4B7EA 1RQPA 2VMIA 2INGX 2VZ9A 5BQ5A 1KYTA 2WC2A 2GF9A 3VVBA 4ALKA 4RR3B 4ZCRA 1G6HA 5I5EA 5K0FA 4UNIA 1IK4A 1UZYA 4I9GA 4LCJA 1ZI6A 1O9BA 1P8JA 1A1SA 1IOZA 2O8FA 4PG7A 4YRZA 4C0LA 1P0CA 1QQP3 1OTHA 1K92A 5HM6A 1N36B 4URTA 3F1KA 3JRXA 4PTZA 2ZTNA 2VTBB 4QOGA 2VNGA 2GAOA 3VU9A 1NX9A 5FWEA 4Y24A 1GY8A 3SC2B 2DGDA 4FO9A 1M1ZA 2SLIA 1NDQA 3E22B 5FI3A 3I4CA 1BMFA 2V5AA 4DNPA 2V0CA 2I91A 4F7WA 5J5CA 1JIJA 2Z5GA 1DCKA 4D9JA 1CQZA 2F1JA 4F7DA 4YDHB 3ENRA 2R86A 3VR5A 4Q29A 1SZBA 2VJMB 2Q1FA 1DGLA 5A4KA 1I5OA 5A5GA 5TMDA 4LKDA 1L3JA 5DSXA 1L4HA 4LDQA 2QBXA 4MV4A 4FFLA 4ND3A 3PC7A 3RS7A 4C43A 4IO0A 3H1WA 3LH5A 1GQHA 1WCXA 1DQZA 1QH7A 2YZKA 3O4HA 1ZNZA 3GJSA 1A96A 3TZEA 3EIUA 1JW9B 4FHFA 5K1ZA 3HMYA 4OLFA 5CNIA 5G4LA 2XKOA 3EZXA 2B39A 1DC3A 2AOWA 2V6MA 1XTTA 3U7EB 5H80A 3H1MA 4HGZA 3VDBA 4ADSG 3SZ3A 5KOYA 1IQDC 1XPUA 2DVFA 2YRXA 1T0JB 5DEOA 1VLMA 4Q48A 3U4SA 1ASJ3 1L1EA 1QYVA 1FPN3 2J32A 5JC1A 1JG6A 3H2YA 5B4VA 2A5DA 3SKVA 3GGLA 4YIKA 4LOSA 3EA4A 5EMMA 1YIFA 4DQUA 1PQPA 4KJZA 2AJBA 4IUYA 3L1VA 5KNLA 1RLUA 1R12A 4F4IA 3KE8A 4JTOA 1KP3A 4WKPA 4OQ9A 5D00A 5HPYB 2HRQA 1HRV2 2PL3A 1N2XA 3F5MA 4AUKA 2RG4A 4DMLA 3ROZA 1OKKA 4H7JA 1G6Q1 3X1YA 1GPDG 2GXQA 2RM21 1T2NA 1LK7A 1TUEA 1IXKA 3IT8A 2IODA 1T6YA 3HI6A 3PPWA 1N1VA 3ZXYA 1H5QA 3NPMA 1S2MA 2QLMA 4R1OA 2IF2A 4BKUA 2ARXA 3ABQB 3THYA 5GLZA 3VPBA 2DR2A 1W2UA 3ZLTA 2DE0X 1XD2A 2ZJ2A 4QYIA 5EKUA 1QDLB 1XZLA 4CZ2A 3JQAB 3O3MB 1G55A 4CRWB 5AW8A 1SB9A 4K2AA 2F1IA 1JS9A 4ORFA 5C5EA 2GFQA 4D5EA 5EXXA 5A1AA 3DTVB 3BMOA 2NW6A 3BK7A 1W6PA 2VTFA 2C59A 1LCIA 3Q8MA 1QC5A 1KGDA 4GH5A 2VXOA 4Z1MA 1G3RA 1YR8A 3B5IA 5EEGA 2R7KA 5F8PA 4YJ3F 4X1OA 1TE2A 3VBEA 1QZTA 4R4XA 2G67A 4Q7QA 1ZHHA 2J1VA 3OE1A 3WGQA 5KNDA 1U8XX 1Z2DA 2BEWB 3T7TA 3N53A 2FEKA 1A8IA 5CTAA 5ALSA 4XQEA 2O0HA 2VPPA 3R0RA 2AGVA 1SMKA 3R6SA 1P75A 1JKJB 3CM0A 1R74A 3CUSA 1JMUB 4IZHA 4U6NA 3FYUC 5AHXA 2WICA 4Z1VA 1S1MA 3Q8AA 3GLHB 3DL7A 2HU7A 3L7CA 1HT3A 2HWC1 3H83A 2F8LA 1W1WA 3S5AA 4HLNA 4HFSA 2IZ1A 2FN8A 1TADA 1A88A 3EH1A 3IYLW 3D31A 3EDCA 1JPVA 4HBGA 4O4IB 3E15A 1Z0JA 2F4NA 3AB7A 2ZT6A 1ECCA 4QX6A 2JI4A 4BNNA 4DXZA 2WR9A 3OFNA 4J49A 1JTZX 1A9QA 1DEOA 2XIJA 4J2OA 3KWMA 5GVSA 2Z56A 2HCTA 4OBXA 3I39X 4BVKA 5K0TA 1JR3E 5CPFA 4KPGA 4AEKA 3GCDA 2YCBA 4L0CA 1YOVB 4I3PA 1LQ2A 1E61A 2Z1NA 3TGWA 3WJAA 1OQ1A 3AL5A 4A3ZA 1T3GA 1X7NA 5AQ1A 5FZCA 3K0AA 4XH9B 4D57A 4UFOA 3DECA 3AU9A 3MN1A 3WKBA 2ZE8A 3NNJA 5HIIA 2WSMA 1AUXA 2OCDA 1ID1A 1EAYA 3CNOA 1OUMA 2OFFA 1KRWA 2IEBA 1PT7A 4MLCA 4AG6A 2CF5A 5FLIA 2G0NA 3GUYA 2G08A 4DWOA 1FP1D 4M00A 4XUOA 4MS4B 3TLGA 3JYHA 1KFKB 1QP8A 2CB0A 1SCQA 4QO7A 2JW5A 3B1FA 4TV9A 3USES 4CCWA 3SYTA 2HB6A 4C4YA 1R5BA 5BR8B 1DIGA 4E09A 3I2IA 1COV3 1E3LA 3SVZA 2BGJA 2P6MA 2Q29A 1RWXA 1GTG1 1CIWA 2I3BA 3RH0A 4M1WA 4OK6A 3ZKWB 5JAIA 1ZRHA 4XJUA 2D44A 4MVWA 3TVDA 3VL9A 3MZHA 2OGUA 1U2GC 1AF7A 3S30A 1LHOA 3CJIC 3QVOA 4R52A 3UK9A 1Z29A 3DLTA 2ORIA 4KREA 5GAJA 2IA5A 2H54A 1KE1A 5I7SA 5IXYA 3L7KA 2WWHA 1V8OA 4AVCA 3OT1A 2CLEB 2QUAA 4XCXA 4NVPA 1C81A 4OUSA 1NT4A 1DU4A 5KOIA 3QF4A 3FVQA 4ZIRA 2FDHA 3FYHA 3GLRA 3SQNA 3I61A 1XNBA 2WMYA 5J2TF 3QH4A 3RGBA 4EJ0A 2VHEA 4R1PA 4DT1A 1QFMA 3AUJB 3VGIA 3VPFA 1EJ0A 4QQ2A 4XAQA 4RGKA 1J3PA 5H02A 1XNDA 1RLMA 5G1PA 2QTHA 2OT7A 3PFWO 2AXNA 1FDRA 3D6MA 3PENA 1W9HA 1CY0A 4FDVA 2BONA 3DKPA 2YWGA 3WQ7A 1CNMA 3NVCA 3UAYA 5FV4A 1XDDA 3LHIA 3UETA 1HEYA 3ME2A 3FLMA 3UK1A 3I5XA 2RCYA 4JCOA 2KMLA 3KZCA 4N0EA 2V4VA 4FPYA 3TR0A 4BN0A 2NN8A 2OEPA 3HU3A 4QPDA 3LRXA 5IFKA 3WOGA 4BMOB 2IP4A 3VR2D 1ODCA 1TD9A 2O2SA 2B9VA 3H2BA 2QX4A 1SHJA 3KQPA 4HATA 5TJ9A 3ZYRA 1DQ1A 4MWTA 4AMUA 3IAFA 3WHLA 1WOYA 3I6ZA 2BP6A 4D43A 2QJWA 3VD5A 3SR4A 3NOXA 3F47A 4OL9A 2QLFA 2QTBA 3PU6A 5AJWA 4C89A 5BRAA 1QM5A 5KJCA 3M9WA 4RPJA 4E4HA 3AHEA 1Z78A 4NPMA 2NSHA 4X7BA 2W2TA 2ICAA 2QP9X 2WN3A 3U1XA 2OMKA 4MW0A 4C78A 1CZVA 1D1SA 2WQ6A 3AR8A 5LP6F 3U26A 3IR6A 4OQDA 4RKEA 3CX6A 3HN7A 4REOA 2ZBFA 3PI7A 3BQNB 2EEZA 1KZYC 2NUPA 4HBNA 1UU4A 2WF7A 3KQKA 4B8ZA 4KI0A 1OBHA 1LU9A 1OC2A 1O8CA 2F3TA 4FP3A 3VAAA 4B7ZA 1SC4A 3DO6A 3IDQA 1FDWA 1C4RA 3K70D 1WCIB 3DOJA 4D8VA 1N0HA 4ZI7F 2CLFB 4HNHA 1TCVA 1YI0A 1MQ8B 3PTZA 2OOSA 4BMEA 4N7JA 2XOMA 2OHGA 4DF3A 2IYWA 4OJNA 4COKA 2EJWA 4QJIA 1JI0A 4AYXA 2DUPA 2D0DA 4LSMA 3QYAA 2Z4FA 1IB0A 2PWPA 3EA5A 4ZQBA 5DNCA 2IHKA 3LW7A 3U9LA 2FMUA 1TJ5A 5K8SA 5CKNA 4FTSA 3VBOC 2QW0X 4BFTA 4TLGA 5A3LA 3L02A 4AGVA 1YRBA 3D5EA 2O3TA 4EMTA 3RAGA 5HPOA 1JAIA 3CZMA 4KV7A 4URUR 3X1KA 1TMOA 3GZJA 2XNDD 1BGXT 5GQSA 4KEAA 5L3ZA 5IS2A 4G36A 4ZQCB 4PF1A 1R50A 1MVEA 4C4XA 2CD7A 3EK2A 4WA7A 3DT8A 3LPCA 4ND8A 5EE3A 1QKKA 1YE5A 2HX1A 4Z49A 1UOFA 1DXHA 5IFTA 3BB6A 1ENQA 3BL5A 5A9TA 1LC0A 1QG6A 3FZEA 3NIFB 4CM4A 4H77A 5GJCA 2KBEA 1IY8A 2Q5FA 1JHPA 5JI7A 1MCZA 2Q4OA 2RARA 3TTTA 1WUIS 3H8RA 2XUAA 3CJXA 1GZ5A 3DPUA 4X90A 5DE3A 3GXUA 3GHYA 4EG0A 3CCFA 3OAAA 1BVUA 4GI5A 1OXTA 2RJ3A 4LZLA 5DIFA 2PJUA 3G6KA 4X62B 1PQWA 3D4BA 3RFCA 3AIMA 3WADA 2JVKA 2I3GA 3ERCA 2GRUA 2ORYA 1CQXA 1VJRA 3S0MA 3IWZA 4J25A 3SQWA 3SE7A 2DOKA 2DWUA 1RM4A 2VC2B 3ZK8A 4MQEA 3PXCX 3DDCA 5F12A 4I0BA 4R5MA 3OFND 2Q4SA 2GMWA 4Q12A 4D6YA 2QP3A 5HKLA 1T3TA 4KMQA 1QR2A 4YPOA 1J09A 3NDRA 1G8FA 1UAIA 1XTSA 4GX0A 4DDWA 2QFEA 1W75A 5ALRA 3FPHA 4NF2A 2A92A 5KHAA 4I4TA 1QNLA 4B32A 1AR83 4GC5A 4HQ6A 3ZYPA 1YR6A 2DVDA 3KAQA 1ZNQO 2J9YB 4OQEA 2VUCA 3SOZA 4RQPA 4MMXB 3HSSA 3J80A 3WD5A 1SXJA 1IDN1 4M0NA 2H4XA 1W2TA 1WXWA 1GU7A 2C9OA 2G4LA 4A8TA 2ZAAA 4F3KA 3KJIA 4PANA 4KPUB 1VPLA 3ADCA 2ZZQA 2BISA 2BJVA 5TVGA 2WT2A 1Z38A 4RXMA 4NPRA 3L43A 5TGDA 3MTQA 2J0UB 1PQYA 1SKBA 2QY6A 3FW1A 1O0SA 1CZOA 4NG5A 1LHVA 5EJMA 3KD3A 3FF1A 1Z62A 2C88A 1GQFA 3MK31 1ULTA 1YRWA 4IWYA 3VDNB 4ND4A 1R8YA 4OKSA 4C22A 1DFHA 3IAM1 4I30A 2IZ6A 1FUIA 5ESRA 3EG5A 4XWWA 4M1ZA 2WZBA 4YMGA 2XMSA 4FXOA 2PYDA 4BRUA 5H9SA 3OQJA 4GU5A 3ZR5A 1AVTA 2WO1A 3QMMA 4UCXA 1ONSA 1WPRA 3ZE8A 1XMVA 4S1OA 4ZQIA 2SBAA 4UTPA 3DT6A 2MHCA 5A02A 5JCZA 2J33A 2XE8A 1Z6QA 5C3SA 3GT3A 4JC5A 3O8RA 5I4IA 4BNDA 1MRZA 2W6OA 1OQEA 1YXMA 1ID8A 2BTVC 5K9YA 2UKDA 4ZI2A 3MJCA 2GH8A 3RFRA 4GVPA 4EY3A 2Q0HA 1KR5A 5F9MA 1GQYA 4XUTA 2UZAA 4ZPXA 4QKFA 1H4HA 1ZP6A 3IN9A 3KSRA 4H7MA 4AWAA 2ADFA 4BRZA 4CN8A 3ZXGA 2Q5LA 2VP0A 5EIXA 1O2DA 3WBJA 1DQSA 2QM3A 1IFXA 2VDOB 1JQJC 5J9FA 1PZ8A 2W6CX 3GPIA 4CF5A 2WIFA 4R9BA 4D3ZA 1MD9A 2V4UA 3C98A 1D4M2 4CM8B 3ZY6A 3G2QA 1A9TA 4IFEA 1TM4E 1PR3A 4Y9TA 4UCQA 3PBKA 4MK4A 4XZ3A 1M1YE 5IT4A 4KXUA 4Q02A 4W5WA 1FOD2 5I6DA 2DQ4A 1DJOA 1E2LA 5C9AB 3DC7A 3QTTA 2QTVA 1AIPA 4LV5B 3DKRA 2YFUA 2CV1A 2QAGA 3M6XA 3VBUB 5DP1A 4NBNA 2DFBA 3QCWA 2P9GA 2EXIA 4JYMA 2UV8A 4WWHA 4EIWA 1FU4A 1AKVA 2D97A 4ARSA 3CF4A 1AQIA 2G71A 1NW9B 3MYXA 1C41A 3AVYA 4Y6RA 1LVUA 3VDMA 3ZSJA 3ADDA 5FWAA 4MEAA 4L97A 3TL2A 2WU1A 3DWEX 4GULA 3MIHA 4S12A 1G3IA 2CXTA 3WHKA 1CS0A 4KXYA 4BJHB 3K20A 2WD8A 5JAMA 3WNKA 2N9UA 4L5JA 5IYYA 3FPKA 2ZG6A 5IAGA 5F5CA 2BSAA 2I78A 2HC9A 3OJXA 4L78A 1UZMA 4BHPA 2H06A 4KSCA 2OCLA 4OM7A 2ZMNA 2VYVD 4D3YA 5DAXA 4HTAA 4ZANA 1S0IA 1LGNA 1G5HA 3WL4A 4OXYA 4JASB 1VBC1 4IEVA 4GHWA 4D4LA 1UU5A 2VXCA 1ODMA 5GMOA 2GJ4A 4ZU7A 1PZNA 2Z2XA 2ODQA 5E6UB 4NDAA 2I4OA 4AZZA 3DMNA 1ZIDA 3N0VA 4UBJA 4U2KA 3T0BA 3OLYA 1H0BA 3ER8A 5JW6A 1C50A 4XZPA 4LJ7A 1OX6A 4ER6A 4ZDWA 1YNOA 4QXBA 3QG5A 1EP9A 1FS5A 3EMKA 5DYNA 4HVQA 5D8AC 2MSWA 1E58A 4HLDA 5JAZA 3SZRA 1WTCA 1I30A 5A1FA 5F5IA 2MSLA 2UYQA 2QMQA 4BTVA 2GEFA 4Q4HB 1LRHA 4QTUB 3KM5A 2PL9A 1FLVA 3KZ1E 2XGOA 4MUGA 2HJGA 3A21A 4C1WA 3LCUA 4WVWA 1DGQA 4FE4A 5EKTA 4OTZA 3P97A 3GBPA 3SHFA 3T4EA 3ZU6A 1I2DA 2EF1A 1JWBB 1BX0A 4ENWA 4D74A 2JLRA 7GPBA 4XUPA 4Y30A 2YGMA 2ZKIA 1KI9A 3DMFA 3I72A 3IS3A 1XA3A 1I4OA 4HAZA 3G2MA 8GPBA 5IW8A 2A5FA 2V7QA 3Q41A 1FFXB 2WLQA 3WAJA 1TZCA 2NO0A 4PRYA 4WFJA 2JFOA 2OAQ1 3BYZA 4X8PA 5EI5A 4XJ8A 4PC3A 3NGXA 5IJ0A 2VDMB 4S2HA 5EXEA 3HDTA 2G4CA 3DZKA 2HLDA 3EY9A 5DHUA 3ZN2A 2BFEA 2AYHA 2G1JA 4C7MA 1NI4A 4WLVA 2PELA 2PYIA 4LOHA 3UXHA 3G0GA 3VX4A 4F72A 2IH4A 2G77B 3X3HA 3H2IA 3IUMA 2WWRA 4NR0A 2ZSEA 3VPDA 3KWLA 1PVC3 2Z8XA 1DAGA 3A4MA 4XDZA 1UDAA 4UATA 4QJ4A 3PDJA 2IC1A 4CUAA 4LX0A 1B0PA 2ERXA 2GOYA 4NARA 3URKA 4KRYA 1FRQA 1GSHA 3KQOA 4LMAA 5I4BA 3NKFA 3BMCA 4YRKA 5BNFA 3H2ZA 5FZBA 1KDKA 4BNMA 2I8AA 3LCPA 5FBRB 3P9ZA 1JH8A 3PYMA 2FTKE 4FZVA 5CFCA 1ONBA 3CGWA 5LA9A 2KJQA 4NO4A 4DADA 5WRFA 3LO5A 2ZB8A 3BA6A 4NJ4A 4F4FA 3EA0A 2PSFA 1WD4A 5F73A 2O5CA 1LJUA 1P3DA 3FVVA 2IWRA 4M8NE 3TPCA 5HCNA 4B3TB 4RTOA 1ENYA 2I3AA 1PV4A 4TLMB 4ZXEA 3NHYA 1E3SA 3FIJA 3RZZA 1FC0A 1VJCA 3LDHA 4RF3A 1NN3A 3QFRA 1GPMA 4W65A 5B3JC 3M4YA 1HQLA 5KOJA 2GN2A 2MCFA 1SQSA 2CKMA 5E7QA 3U80A 5H8WA 3GLGA 2F9LA 3R76A 2UUAB 1QC5B 2G8NA 4TLAA 3JQ6A 5FLXA 1X7ZB 2H2HA 4LTMA 5BV2P 3BDAA 1TEIA 1RUC2 3S6JA 3H1AA 4AYWA 3VKLA 2HYDA 3LDBA 4LVUA 1XKLA 3LP8A 5KYYB 1RBQA 2K4MA 4PVCA 4ENTA 1GRVA 1UJNA 5IEJA 4OSEA 1X7YA 3LWCA 2C9MA 4KQHA 2QQEA 2AWNA 5ED0A 1AMOA 1JB1A 1ODTC 3QITA 2HDWA 1PQUA 1UPBA 3OY8B 3KEOA 3CSDA 4B9AA 3V0AB 5DAVA 3VR6A 4IBOA 2WC1A 1TXGA 3BIJA 2BGCA 1PNTA 3NWBA 1C9JA 5CYGA 1O6FA 3W5UA 4C5AA 4NU8X 2PSSA 2ZB3A 4JMLA 5DHFA 3NFRA 4XXAA 4JGGA 1BJQA 4R1SA 1C0EA 1LZKA 5L7YA 1HSOA 2RJ2A 1M1XB 1N57A 1IUPA 4CU8A 1JYVA 4KKXB 2EP5A 5U1PA 5EMHA 1OFUX 3PUKA 3FOFC 3EIXA 3ZXKA 2A1IA 1DL5A 4HQOA 5A3PA 1FYWA 5K0UB 3HR8A 4RESA 3JBG3 4YBZA 1PVVA 4EX6A 1WCDJ 4TT3A 4OHVA 3HA3A 1DZRA 2AJTA 5I9LA 1YUDA 2AEMA 1N32B 4ZT4A 1FBNA 1UY1A 3CF2A 2DJIA 4MV6A 2Y1XA 1S9HA 5FIXA 1NL3A 1F20A 4KDRA 4KXMA 3JB8A 2XBO1 3U4DA 4HOOA 1WMXA 5AIBA 2M32A 4IOKA 2P9YA 3V4OA 5FAXA 2ZSFA 1RMTA 3K9CA 2MINB 4FQ5A 1E1LA 3E48A 2P0AA 3ZD6A 3THCA 3B52X 4PRKA 1QV6A 4LTAA 3W3AH 2FGJA 3PWZA 4CXMA 5HA5A 3HJGA 1W4ZA 4N43B 1SEVA 4RZQA 4IDCA 2A3YA 3VD3A 1LGYA 2W2PA 1DE0A 2WIJA 3RK0A 2WZCA 5D3KA 1C28A 5JJIA 1W0CA 4P33A 4EDFA 3WIEA 3AEKB 2D0OB 2V6IA 3SICE 5F4ZA 3BIEA 2OBFA 4AY6A 4CMHA 2IZ7A 3N4MA 5EXPA 1UBJS 2BKVA 3TLZA 3FJOA 2NQYA 2C7BA 1N77A 5CBPB 3H3LA 4COZA 3UZUA 3RAEC 1QK5A 4XF9A 1W4BA 4XJZA 4J4TA 4L4RA 2XHEA 2CJPA 5EJEA 4ND8B 2PMCA 3U16A 4TZKA 1LH0A 4H15A 2VUTA 2Q2NA 4AXOA 5DO9A 4ZRMA 3KSMA 3EIFA 3HHEA 4HETA 5CU1A 4IQ8A 4WXHA 2H29A 1IU9A 4KGDA 2EW8A 1MZ6A 1TJNA 2H4ZA 3ISJA 4XIOA 5KVVA 1NBIA 2BFDA 3L6RA 1WV1A 3PEVA 1DG6A 4Y1XA 1CD5A 1SU6A 1QWOA 2RE8A 2FX3A 2YQ5A 5G0SA 3L40A 1N4DA 3SE0A 2CVZA 1PFWA 5G41A 3PCXA 1BQ4A 2HHJA 2P9ZA 5KC5A 4Z3OA 5TQVA 4ENSA 2VAVA 5CDTA 3UBTA 2Q2OA 4FYYA 5IRCD 1K88A 1IJFA 5KCZA 1EWYA 2FPSA 4QEKA 1U81A 2CLKB 4IXNA 4NS1A 4LBMA 4R9CA 2FEWB 5FTJA 3AQIA 3MJEA 1YBHA 1M2KA 1A72A 2EU8A 4YCCA 2PLV1 1INLA 5EYYA 4DANA 4R5HA 3OLZA 4RTJA 1NBAA 1QJEA 3SMHA 2NWQA 1JEYB 1XHEA 4V1PA 4WH0A 4ZT5A 4YXWD 1NM5A 2J08A 2R4UA 1DAOA 2GAUA 1O9HA 3WDXA 2WAMA 5IKOA 4WXEA 3LE8A 1SWWA 3LBIA 3ELNA 3M3QA 4Q66C 2HLHA 4RY2A 2GBGA 3RK1A 4TQGA 3AR2A 1THGA 1TYZA 2C9ZA 2WWFA 2ZIZA 1D7PM 1LLFA 4QATA 3FBTA 1XXHE 5EOVA 4LXXA 2NAFA 2AHRA 3HDQA 2OA2A 1VLNA 2GARA 2F4PA 2Q5OA 3OLQA 4FWTA 4JOBA 3BXFA 3NEJA 3KMHA 5T3NA 4UHEA 1P2DA 4YJFA 5F76A 1M0WA 1MUUA 2VZQA 2UAGA 3RD5A 2C4MA 2ECPA 4AQYB 1DWUA 1QH0A 4R1QA 1QWRA 3AP5A 2JIZA 5BN4A 2ZTUA 4N9WA 1L5HA 2RGAA 1E5XA 1KZ1A 3RTGA 2NP0A 1NFFA 2ZUCA 3ZLVA 3X44A 2IV3A 1PEDA 2B35A 2QLLA 3K6SB 1SBYA 4BPRA 3RSGA 1RRFA 2PHTA 5PNTA 2D13A 5G02A 2R2AA 1YMUA 4WJZA 2PKRA 3ZH2A 5JBQA 4J0DA 2XUFA 3AF6A 4YJGB 4R9NA 3VBFA 4RY9A 1DAEA 4BWYA 3NV4A 4RS5A 1DV2A 2Z04A 2JRLA 3INAA 1YIAA 2X5KO 3TZHA 4U2BA 4KN8A 1ZHFA 1DC6A 3CUTA 1L4FA 2C1EA 4O0MA 5GOTA 4WQMA 1UWVA 4RD1A 1I51A 5LQAA 4TYWA 1ND3B 1HIXA 4JVMA 3TAHA 3LGXA 2FEPA 5FPKA 1KI7A 2W98A 2A0FA 3QI7A 2WSBA 5AXCA 4N12A 2ZUUA 1AUYA 1JGTA 2W0SA 1GRCA 1NQXA 4MW2A 1MIOA 2PZ8A 3MRVA 4U00A 3KHKA 4FR2A 4I9HA 1KQFA 1KP9A 2LCFA 3LXMA 3GNSA 4EI7A 1EPWA 2GN6A 3ASUA 2NMOA 4AZ3B 5FKBA 1YFWA 1C3LA 1OIWA 4KWHA 4DLBA 5LA6F 3UAOA 2FG7C 1RUE1 5DN2A 1VM6A 5KWIA 4D0RA 2RDQA 4H31A 2HMYB 2EGUA 2IJGX 4LJHA 2CHQA 4FBFA 1JX6A 3LP6A 5FJJA 3NASA 2ZB2A 2YV5A 4AUNA 5GZ6A 4JP1A 3TEJA 1VKRA 1CNEA 3SXUA 1JR6A 4FMBB 1CQ9A 2UYHA 1E9SA 1YE8A 3H1GA 2YZ7A 4L9SA 1OI3A 1Q15A 2CDCA 2D7FA 1YS4A 3CZPA 3ILSA 4RPLA 3AFOA 4D9GA 1JXMA 4M6WA 1WMEA 2F1HA 5JMOA 4I0WB 3FR8A 4RTNA 4E5SA 1N3QA 2AUMA 1U9JA 4CLDA 3LC2O 4N39A 4KAFA 2EKZA 1ZH8A 4KTTE 3ZDQA 3EXHC 3W90A 3LP5A 1TW3A 5JV5A 3LF2A 3G0DA 4BAGA 3GALA 1YRYE 3FB1A 1AR81 4O5OA 1PS8A 4DZTA 1DX9A 4DMCA 5AH0A 4HBZA 2PUCA 3GJBA 3JQQA 4K7JA 3B3GA 3SHVA 1AQJA 4X1KA 1TRKA 1R9GA 3BUCA 5BUCA 4OHKA 2HBZA 2Z08A 1Z4PX 4ZXKA 5FBHA 1OUXA 1D5WA 1T6GC 3Q87B 2G36A 4UMEA 3OJLA 3J7NA 4DY5A 3TZBA 2EXHA 1AUPA 1WXFA 2G63A 3PV0A 4QUDA 1Q56A 4POAA 3TB6A 3GLTA 3IVMA 4KXQA 2I34A 4F96A 4PHCA 2O8QA 1QLWA 1ULHA 5E2IA 5F52A 1ZK1A 4HMPA 1FCJA 3AYCA 2QX7A 2YG0A 3R24A 4LHSA 1BXGB 4KGGA 1VSUA 3TIFA 1YR2A 3DD1A 3TQCA 4DV3B 3PITA 1FTSA 2MPFA 1J9ZA 4IE5A 5TE9A 2DU1A 4MUNA 2O0JA 5A7QA 3RB8A 2AG0A 3WWPA 7REQA 3EVEA 3OQBA 3JYLA 3DEIA 5C3PA 3N2GA 2EQBA 3HBLA 2IYLD 4UQLA 1RWOA 2QUIA 3SXUB 4AZSA 1EGQA 2QX9A 1QOTA 2AD1A 5JR3A 2X13A 4OEHA 3DEAA 1V6JA 1X33A 2HDOA 2WU4A 3ADOA 3PUAA 4IJQA 2V5UA 5C3RA 3EIQA 1VI5A 5JXJA 3KHTA 4BQIA 1MBZA 2X86A 2ZX4A 1U99A 5JD3A 1ZKDA 1T0HB 4ZKTB 1LNQA 4HAVA 4XX0B 4Z7QB 1U0NA 2Z8ZA 4WZAE 3LKZA 1BK0A 4WBSA 5GOZA 4QARA 3GUHA 2LRHA 2XCUA 1E1NA 3KT3A 1NZCA 1RQ2A 3J9SA 2GCEA 2B5HA 1XJ0A 3ZHYA 4L7VA 5FP7A 4UPVA 1RKVA 5FPPA 2AZMA 4RCYA 1FP4B 3FUXA 1T5OA 1SVNA 1QOZA 1SBHA 3WWEA 1L4GA 4FSXA 1L5WA 4S3MA 5EWMB 2PUVA 4R9AA 2DUMA 2JG8C 1I7LA 2BFWA 4N53B 1N92A 2A1UB 3P94A 2O6LA 4YY3B 3WRXC 1LK5A 2X0DA 3WLEA 1I8TA 4JI6B 3RJTA 3HY4A 2O1SA 1PW7A 1ZR4A 3B70A 2F8SA 4DE5A 5GIPE 1L5SA 3V6MA 3RJZA 3IOEA 4LW8A 2C7GA 3C48A 3TTYA 3FPJA 4BKQA 5JLJA 4KE7A 3NP7A 4W8HA 1ZZ8A 1OC1A 4FNOA 1BEV3 1HLDA 3POFA 4Q5OA 4NE2A 1W59A 4DRZA 1DUIA 5C8YA 1J00A 4N54A 3TYXA 1ND3A 4IILA 4KBZA 4HDRB 4MSUA 1Q1ZA 2C5GA 3L9WA 2PVSA 4E5KA 2JKZA 2WE8A 1PAUA 2C5SA 1YS6A 3P71T 3NAPC 4IGKA 1HT2E 1I7NA 2VEDA 3S4YA 4XCVA 2FQ1A 4A03A 3Q10A 1YKFA 3AP9A 1MA0A 2C0PA 3A6DA 1PW5A 1CF4A 3O1PA 2VRCA 3AUKA 5TRTA 2H9AA 2O50A 4MV2A 1XD8A 1IPJA 1WY7A 3A4UA 3HH8A 4IOLA 2VZOA 1YB6A 3BH0A 1RJ9B 2XXJA 4ZARA 3OE4A 2E4UA 4KQEA 4LDRA 4P6VF 4HVRA 1W4RA 1E4EB 5IN5A 1ZIYA 1DQ5A 1MDFA 1HQNA 2JIJA 3UHAA 1Y6FA 3W9YA 1CVIA 2H0VA 2I45A 1DRJA 1IWPB 3BBLA 1A2BA 3STHA 1DBVO 4QQPA 4P3XA 4XX1A 2VUSA 1VPVA 1YRQA 3GUCA 2JCXA 2VWGA 4BO0A 4JOQA 1XC7A 4S0XA 2REQB 2P77A 3EXAA 3DYVA 2AG1A 4AJEA 1Z6TA 4DNQA 1MC4A 3UT6A 5A3VA 3K3PA 1UMDB 2BH2A 3FSEA 4BMPB 4KQWA 1C29B 4ZN6A 1IQPA 2ZMLA 1TQDA 3WLRA 2NV2B 4OSOA 3H9BA 4H4CA 2CU5A 2VW2A 4MQFA 4LBQD 2VW0A 2AFRA 5ARDA 2Z4SA 4NYMR 4H2AA 4QC2A 3OTOB 1XL1A 4B6OA 1A9ZA 1KZ4A 3CVUA 3C2QA 3GYDA 1R1A1 4N5MA 1P6XA 3VLBB 1MJGA 2H4JA 4AI0A 4Y1UA 1VL0A 4R9RA 3I73A 2HRDA 3QP9A 2BSXA 4CXXA 2B98A 4G9EA 3RUFA 1QPGA 2BFOA 1UZ0A 2ILMA 1WKYA 3HWJA 1Y4WA 1LPNA 5C80A 4E07A 1ATZA 4IV1B 5ACA2 4LE3A 3DPRB 2ZGOA 3E1SA 4IUDS 3NNFA 1PVDA 1RXFA 2PN1A 2E51A 4ALLA 4C9BA 3Q9SA 4NSNA 1QU3A 4TWTA 3AF5A 1YASA 1K66A 2VTKA 1M8FA 3S2UA 4AZWA 5M29A 3H8XA 2A0XA 2HA4A 2JGAA 3K1YA 1KR2A 1P39A 3C0KA 1C3HA 1SXJC 1IN8A 1C7JA 2WG0A 2J9RA 3AU8A 1GZTA 1QG0A 1T8WA 3IULA 4YNBA 3BTUA 4JDUA 4Z4CA 4AOCA 5HKBA 1CTQA 2G25A 2PX6A 4YMTA 3OM9A 1D4ZA 2A9PA 1V8PA 1AZSC 3FGZA 1G38A 3NT4A 4KXWA 5DJ5A 1C9YA 3LU1A 3JCZA 4PYJA 2YUTA 5KPJA 1LULA 4NYIQ 3HI4A 3OBTA 2VQEB 3DL0A 2P3QA 4P9IA 2BR3A 1NR5A 5JZSA 1FF9A 2PUAA 3HQ4O 3PRYA 1VBB2 1M34A 2RMKA 1OLSA 5DNEA 3FDXA 4UAGA 4F4DA 1CWPA 1AZTA 1ESMA 4MSVA 4PAOA 3QIAA 4J0FA 1RC6A 1GSIA 1OYVA 4JP3A 3WO0A 2F90A 3OA0A 4RNCA 2RG7A 1DHKB 5H68A 1D1QA 5EL0A 1DTSA 2PJDA 1EXVA 5EXDA 4QDKA 3ZJTA 4PPGA 2WYSA 4YM2A 2AX4A 4WASA 5D2AA 4KIWA 3LHDA 4HZGA 5HKAA 1RXWA 1H6BA 4ZP1A 2YCLA 2W08A 1GKUB 2BKEA 2ZGLA 1UXIA 4ZEWA 4DLTA 2YVLA 3VMFA 1EUDA 1NVKA 3AZPA 3EXHA 2XKPA 1MH1A 2CNKA 3OUUA 1MS5A 5LATA 3I3SR 1CONA 5DTIA 2VH1A 1I13A 4LQRA 3AZWA 4DJDC 4X00A 4MXDA 3OX4A 1CD3G 4I3FA 2X1LA 1CZKA 1A9OA 1NLRA 1IB6A 1O1YA 4P3PA 5HIKA 5JZGA 4Z6KA 1A3KA 4J0IA 4E9KA 3IDAA 1GKKA 2VYQA 2D1TA 3HGMA 4X63A 4G2TA 1A3CA 3DAGA 1RAIA 3ET4A 2WS93 3ZWWA 2WB2A 1R9JA 5FBWB 2IW1A 3UH1A 4HWKA 4JI2B 3FCEA 4MGTA 3G9TA 3ZN6A 4FFRA 1F0NA 1SD1A 1SVUA 1MEC3 1U3UA 1LJ7A 5IATA 1HW5A 4LGMA 2W2MA 3PX2A 2XZOA 3N0RA 3BZUA 4Q0SA 3ENVA 5EY5B 3TPZA 2PPLA 1P18A 2VNJA 3TNQA 4ISBA 4RA6B 1XZCA 3LA8A 3OBBA 1PUJA 3DUFB 3H0CA 3KPUA 2X9GA 2V8OA 2VHXA 3KQ4B 3R77A 2AC1A 2JLSA 3FD8A 1M2VB 2QVYX 1IY1A 4F4HA 2R1ZA 1SHLA 3GUUA 4ZZ0A 4MITA 2PDAA 5FD8A 3REFA 1RWBA 3QFFA 4CE6A 3RBZA 1K63A 1VBA2 3AX6A 5AM4A 3T2TA 1ULZA 3P32A 2OCIA 3CBQA 3BX1A 5KDOA 3S2GA 1NNUA 5LZ5A 3HPQA 4MQMA 3WP4A 1KSGA 2W2IA 3WW1A 2ZRGA 3TXYA 1QUFA 1CR4A 1AR73 1UL9A 3K30A 2Y6GA 2JBHA 5J59A 5I7OA 1KP2A 1J2YA 2VT7A 3BKXA 3JZFA 2ZQYA 2WZR3 1OLQA 1RYHA 2WWJA 3X2SA 4DM4A 1JIIA 2VUAA 4Q3OA 5LR6A 3MDPA 1OYOA 2EOAA 1E2HA 5BOVA 5I01A 1TO1E 1BAPA 2FDRA 1K75A 2P5TB 5KX5B 3DCIA 4U7FA 3WKCA 3FCOA 4U2EA 1YOBA 1SEFA 3ZBQA 3AX4A 1NUUA 3OGGA 4LZZA 1KO5A 2AMYA 4FN4A 4TXNA 3KHUA 1BH2A 3K9FC 1G7SA 2VF4X 2QNBA 4Q4Y2 1XLVA 3RSLA 2W83A 3AUXA 5BSGA 3ZHXA 1G9AA 3BIOA 1PSDA 2C9CA 5EHZA 1BN7A 2CGEA 2JIBA 5GGYA 5T4BA 5K45A 3O0XA 3R6DA 1RBZA 2A1TS 5CNAA 3EC1A 3AOGA 5BNNC 1X1CA 1TVCA 1KMHA 3UF0A 3T7JA 4MAMA 3TGPA 4GM1A 4JDOA 4QFDA 5K8LA 4REMA 2HEWF 4ZHQA 3BWBA 2JECA 4GWMA 3FMGA 2PS9A 5CH3A 1HR0B 2WQ8A 4LS3A 4G23A 3A1UA 3LKBA 1ZOOA 4FXGB 3GWGA 2KLHA 1NSTA 3J8F1 3M9LA 1O6BA 3ZHTA 1C0KA 4F9TA 4ER5A 4AY5A 4DWWA 1YHFA 1HN1A 3AKPA 1E5HA 5ACA1 2I2BA 4GPD1 3GRKA 2YHSA 2FSHA 4WI1A 5EZ6B 2D6PA 1RW4A 4CF4A 1XR3A 2B9UA 2ZRJA 3ZDEA 5EYPB 5KO2A 1MR5A 1AQLA 2DRIA 3S1AB 3UEOA 4GDFA 1A9YA 1IWOA 3KJHA 3TD6A 4JC8A 3GZUC 4WL0A 1P45A 3E5HA 1J2TA 1BBT2 2XNSA 2RS11 3GUVA 1H2KA 5AMXA 2GSDA 4WSOA 3KS9A 5B55A 1OFIA 5GM0A 1D4FA 1Z13A 3O1JC 4MDYA 5B58T 3MW8A 1MZVA 3U56A 5BW5A 4CP0A 3RFTA 1EZ4A 4Q7JB 3TW8B 2HWB3 1NKTA 1VIVA 2P1RA 3GQVA 5T4HA 2H51A 3WP0A 1W9YA 5CYOA 2CFTA 3R7BA 1MH9A 4L4ZA 1REQA 4DTIA 3NDPA 3SHRA 4O2AA 3WP6A 3MFAA 5IARA 3EXUA 2P3YA 4Y9DA 2I4MA 1F8FA 5EMJA 4H1WA 4C0HA 4MVXA 4WN9A 2AWOA 1H5NA 2J5RA 1AURA 2O0KA 1UJBA 3LQKA 1WA4A 1DOAA 2JHCA 3INNA 2XPCA 4MPRA 2PKWA 3OQ6A 1U3WA 3D1LA 1L5YA 3QSGA 1DQ0A 4WAUA 4MQBA 1ZA1A 3EWIA 2BFUL 3N8HA 7YASA 5T41A 2AXQA 1FSGA 2Q1UA 1FFWA 5ALLA 1QRUA 2A94A 3TCNA 1O3QA 1XMOB 4CCYA 4E4RA 3QKWA 1ZA4A 4MCJA 1FMD3 3A4TA 5CKMA 2IYTA 2QX8A 5E16A 4KO4S 5JANA 1XFAA 4XPIB 5DGXA 1I2CA 1MQTB 2QRVA 2OXEA 4OGFA 3Q0TA 4XPIA 3U1BA 2R49A 2DQSA 1I6WA 3JATA 4IVRA 2VZ1A 1VKOA 4J4HA 3PVZA 2QQUA 2SCUA 1ZRCA 1XKQA 2FP3A 2ZGVA 2OZJA 2WKWA 3KT0A 4QDJA 2Q1TA 2C84A 1X92A 2PQ0A 1HDXA 4F3RA 2JDPA 1SDWA 3LLSA 2JFZA 4BGUA 2NYRA 3LT2A 3H84A 2HTEA 2ZEJA 3CW2A 3O0DA 1JU3A 1RJGA 4J1WA 3LB9A 5K8TA 1V7CA 4BX0A 4V0SA 2IU6A 4YIHA 4RSRA 4JZKA 4ROTA 2YMMA 1SURA 2RR12 3IKTA 1SDDB 2QTRA 3V7YA 1PVXA 1PSZA 3T3GA 3P0JA 2PD4A 4O4HB 1AR62 3JBG2 4PGAA 1ZC3A 3SF8A 1E7SA 3I8OA 3WLOA 3ANLA 3MGBA 4AQTA 4JI0B 3NPAA 2V6BA 1M2HA 1A78A 5A05A 3C7DB 3L8GA 3LX5A 5D86A 1T9CA 1FNMA 3FMFA 4DZRA 4TN1A 1VPEA 5FY7A 3QIVA 3I9KA 5EJIA 4FPCA 5C1OA 3L9XA 2XVKA 3FPGA 2EG5A 1WOMA 1LK0A 4RQPC 3NZEA 3H7YA 1PFQA 1B73A 4RZSA 2F3UA 5CMLA 3PNKA 3OUHA 4Z8YA 1RVV1 3IELA 3IJRA 4NL4H 5GM1A 1YA6A 3EGVA 4HEA6 1MQTA 4EVQA 2JD9A 3L6OO 5JR2A 4Q3KA 2WUGA 3QYPA 5GLUA 1W2AX 4RKRA 1K42A 3ZPXA 1PFKA 3AL0C 1H66A 2Q8CA 1T9AA 1VHLA 2JGFA 2VHJA 4BQNA 4DVJA 5FP9A 1W8TA 3OVMA 9ATCA 2JLYA 1G66A 5FWJA 4DRXA 4BEWA 2H7YA 3SF0A 5U4QA 2REXB 4PQRA 4K9LA 4U0JA 4H3SA 1MG0A 4FP9A 4OYLA 4EEZA 2R47A 1HRI3 1M34B 1ZSVA 1L9KA 4B5LA 5AKYA 3MTDA 2GF0A 5AKEA 1SUPA