4K9SA

Peptidoglycan o-acetylesterase in action, setmet
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
total genus 110
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k9sA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k9sA01
4Q7QA 1ESDA 4K9SA 1DEOA 1ESEA 1YZFA 4HYQA 4OAPA 3MILA 1VJGA 2VPTA 4HF7A 5A4AA 2WABA 1WABA 1ES9A 5JD3A 3RJTA 1BWQA 1V2GA 3DT9A 4I8IA 2Q0QA 4K7JA 1BWRA 4IYJA 2W9XA 4DEVA 3DC7A 4JGGA 4LHSA 1K7CA 3PT5A 1J00A 1JRLA 4NRDA 5B5SA 3P94A 1PP4A 1Z8HA 2O14A 1FXWF 4H08A 3KVNA 4K40A 2HSJA 3DCIA 1VYHA 3W7VA 4JJ4A 4K3UA 2WAAA 1DEXA 2WAOA 1ZMBA 2Q0SA 5BN1A 5CD9A 2APJA 4PPYA 4TX1A 4JJ6A 4RW0A 1ESCA 1U8UA 3DT6A 1IVNA 3BZWA 4Q9AA 4M8KA 1FXWA 4OAOA 3U37A 3SLRA 4S1PA 5HOEA 4XVHA 3SKVA 3C1UA 4JKOA 3DT8A 4RSHA 4JHLA 3HP4A 1BWPA
chains in the Genus database with same CATH superfamily
2XYPA 3D6MA 4PZZA 4O25A 4C7XA 2CTVA 3GYDA 2OVBA 4DEXA 2PUBA 1W19A 3FFTA 3ZVRA 3ZUPA 4JBHA 4AGGA 2ZETA 1NXMA 3CISA 1CQJA 1TKCA 3GGJA 2IYWA 4CDXB 2VWGA 5EC8A 4BTVA 1TYDE 5J4YA 2WS91 5JVDB 2IDZA 1PDVA 5GZEA 4Q0QA 1HQNA 2HZBA 4CKWA 3PT5A 4P9GA 1NUHA 2BF7A 2DUUA 4LSMA 4D98A 4OXIA 1S7GA 1UMDA 5CG9A 3OOWA 1K9VF 2F1RA 5GM0A 5IDWA 5LEJA 5M34A 2GKOA 4NK5A 1OLRA 4F3JA 3PSAA 3BS4A 5E3IA 2XXAB 5C9AC 2RGNC 4F8JA 4Y20B 1YFUA 1I51A 2IUWA 4AQ6A 1KMHA 4WA7A 1U5AA 4HK9A 4ZXEA 4DBVO 3HO6A 3CU7A 1SB9A 2XRFA 3ZX7A 1MQ8B 1SXJC 2P6PA 4QDZA 4P80A 2MSWA 1DQ0A 5FUPA 4JHLA 4P82A 3WMGA 1Q22A 1Y7BA 1QAQA 3HXPA 5HV4A 4IJVA 5FOVA 1UPXA 1F12A 3SI7A 4NCHA 1T3ZA 1XELA 3BWEA 4U7TB 1FDIA 5GQSA 1WBFA 3ABQB 5FYDA 2WIBA 1ZVMA 1YR2A 3HIFA 5LXTA 3QHQA 1M2NA 3CEAA 1GKYA 1HQYE 3EWNA 1ZK2A 1SHWB 2A7QA 3CS3A 4UJ3A 1C8M2 1JBEA 3OPWA 3ZO0B 5M7EA 2IIBA 1R9GA 4DTIA 3TRIA 2QI9C 3J7TA 3N2EA 1JA0A 3GPBA 2JIZA 1DX4A 1XNRB 2IXJA 2AUYA 1B42A 3HXKA 2O0HA 4M7WA 4PSKA 5CCEA 4OLAA 1T6GC 2WNUB 4WKBA 3ONFA 1Z29A 3LKDA 1SCBA 4Y6PA 1MU0A 4LCBA 2I1QA 2ET6A 3RNSA 3G88A 3OZVA 3RVLA 2X7XA 1EGMB 5CMLA 2ZBJA 3BX1A 3EWIA 1B76A 1EDZA 3C7EA 1UWKA 2PHLA 1K7XB 4NSNA 1YRQA 1BA2A 1MIHA 1NZIA 4GX2A 2C9BA 4H3HB 3HM2A 5ACA1 2ZJZA 3SIWA 3ASZA 5HZKA 2ROQA 3HK2A 1T2CA 3CX4A 4CDXC 3OPVA 1IS3A 4YAOA 4TMFA 1ZITA 1WMXA 3STYA 1GPDG 5DAXA 2XDWA 2FMHA 3M33A 3PA8A 3BIOA 4Y6OA 2C9YA 3I0NA 1RMTA 4V02A 4NCNA 3VDDB 1Q95A 4PO3X 2CMDA 3KT6A 2YR0A 4MV8A 4ENVA 1JN0A 4QQNA 1U3UA 4JVNA 1T4MA 4TMTA 3GUZA 1MIOB 3NDBB 3H7YA 1CQXA 3DH0A 2YZKA 4RZ2A 1YOBA 2F1OA 1C2YA 2ZBQA 2ZE7A 3TJMA 2KM1A 3UW1A 3T5BA 1ZRDA 4FHFA 1C7QA 4DBLC 2CAVA 1Z0FA 4W5JA 4JP3A 4OHPA 3BXOA 2FOXA 1CBUA 2K9ZA 1IS5A 1KVRA 3O2SB 1Z8DA 2DBVO 1DBIA 4O1HA 5JD4A 1HRI3 1Q15A 5CHEA 2I03A 4MA0A 2LP4Y 5ARCA 2Y99A 4JD5A 4RPGA 2AD1A 1AL21 1Q0QA 2FMXA 6REQA 4O3MA 3IT1A 3H1YA 1RZ3A 1P1KA 4WNIA 1PFYA 1AYM1 3GAZA 4P5HA 1XQXA 2QSJA 3S0JA 5KTOA 5FWYB 2DFTA 4R2WA 3KLMX 5A1LA 1AKEA 2G06A 1V5IA 5AI4A 3ZS9A 4B4KA 5AMXA 2V4ZA 4I9UA 3GRZA 4QTYA 2OKXA 5I7OA 3ZTTA 2VEDA 3C3WA 5CB8A 2XXZA 1C5IA 5FT9A 1QF7A 5K9ZA 2ZRJA 2Q6IA 1QH1A 4KQIA 1XOIA 2ZZKA 1E96A 2Z9BA 3G8YA 4ZT7A 3OTHA 5H5JA 4G37A 4GL4A 1C9EA 1VE3A 5KREA 4Y4RA 3UUWA 1JJVA 1JLKA 5KX5A 2Z9DA 5JI7A 3UHOA 5EP9A 3D6JA 5KDLA 3GOQA 5KHIA 3C97A 1KDTA 3AW8A 3ST7A 3RNLA 2BHLA 1N7JA 2W94A 3O1OA 4QU2A 5KYWA 4HB3A 2J9GA 3WIOA 4QGNA 4Y0NA 3FLRA 2BISA 2ICAA 3TRSB 1ESZA 3QUBA 5H68A 2DTWA 1UFKA 3D1LA 2NO6A 2OBYA 4WAUA 2YY1A 1G8KA 2RHWA 1PX4A 3DM5A 4QARA 3C98A 4BNUA 5JV5A 2WTUA 2QE7D 2MEV2 1VCOA 3OMXA 2J6HA 1XNKA 1O08A 1W90A 5A3WA 1SCQA 4DIBA 3K8OE 3RZHA 2QJFA 2IXEA 2Q2WA 1OSGA 4PIXA 5FWNA 2J3QA 1JJFA 1EUCB 2JEYA 2R1VB 5B4XA 1E9DA 3R0RA 2PBLA 2FDXA 1MB0A 5DT9A 2LW8A 4PPGA 4C05A 1G8FA 1R091 2P2LA 4H1HA 4K3VA 4E33A 3CB4A 4J07A 4XC9A 1Y1LA 2QTFA 2W2MA 3LGSA 3R09A 1EK5A 2QQEA 3WSWA 5TR9A 4H3SA 3DECA 3HYCA 3GRFA 3V1LA 3QMVA 2DJ5A 1I5RA 1AA9A 1KNQA 3D9QX 1RUJ1 3RZLA 4X7PA 3LYAA 3VDQA 1UXOA 5C8CB 3IULA 3NGLA 4DCTA 1CIPA 3RJ2X 4I2OA 1RQLA 1XVTA 2BMEA 1JYTA 3T08A 4IDOA 3UHFA 5EMLA 2HWF1 1ZVJA 1P0IA 3MF6A 3OKFA 4AF7A 1QZZA 1CX1A 3S68A 2CD9A 4PHGA 5A9TA 5LBTA 4ZK2A 1ZXXA 1N2IA 3H3LA 2AW5A 3DKPA 3LBFA 4MYTA 3O14A 3MOGA 4ZYVA 1NMEA 5ADUS 1W49A 2WJVA 2HPVA 1G8WA 3NM6B 1RMYA 3BF8A 3E4CA 3TINA 1UBJS 1CIVA 1T2EA 2BWJA 3MCUA 5F51A 4A36A 3ZHRA 2QN8A 3S2EA 2WLTA 1ZONA 1LOFA 3E23A 4G4FA 4PLWA 5IUKC 3PVOA 1BHSA 5FYBA 2OGWA 4YW6A 3DE3X 2HA6A 2E1RA 2JFWA 4GQAA 1YDEA 3B1YA 3VKFA 2FCTA 1TK9A 1CZRA 3R0QA 4GZ6A 2CNOA 4ENPA 5A4KA 2HOQA 3FHLA 1OI4A 3LHDA 3FNBA 2O2HA 3FHIB 1YNOA 3V2IA 3PGJA 4OL9A 3FI0A 3FPAA 3PEEA 3WBKA 2YV2A 3UYJA 2B8NA 3AFOA 3IPLA 1QKIA 3LHKA 1U2GC 2O0KA 3NBZC 3OESA 2W1WA 3WAJA 4BUCA 2ZDHA 2OSVA 2C5FA 2NXCA 2YC4C 3VR1A 4RHTA 2ZJ6A 2FSPA 1P1BA 1EK2A 4HV4A 1E63A 2OIIA 1RHRA 2FMDA 1SXPA 4EHFA 1EM8B 4BZZA 3R6DA 2GKGA 4NIDA 1U8UA 4HYYA 1RIRA 3OE7A 4HLNA 3BZUA 4H6PA 1ULBA 4XD7D 1B00A 1DO8A 2GO7A 5C8CC 4G26A 4WY8A 1UK9A 3DD5A 3QNMA 3VR3D 1KSGA 1OA1A 4AC9A 4FVTA 2WO7A 4QVGA 3FCSB 4G23A 4U2BA 5ICGA 2Q5TA 4N5HX 3OZDA 1J2UA 3I39X 1KSHA 3ZN5A 2FQQA 3MWLA 1Y9EA 4IGQA 4B3IA 2V1XA 3T99A 1MOZA 4EUKA 2XOKD 3O4FA 4IXDA 4E2QA 3MK31 4DXSA 5EP3A 3OOHA 4R8VA 4DPLA 3DZDA 4D0RA 3GJ4A 3KZMA 2G71A 2PA0A 1LR5A 3Q15C 1AJEA 5EJ7A 1BQ4A 3DV0A 4P53A 3H2HA 4ZVKA 1HI9A 4NNOA 4MHSA 2DHCA 1V39A 3D1VA 3CLVA 1JZ2A 2VQSA 1JX6A 4EEZA 1IIRA 2H2AA 3G2PA 2X29A 2YWBA 4P2GA 3BFKA 3PTYA 3DO5A 3VO2A 2QN1A 2VRBA 2WAXA 1T9GR 2QTNA 4ZOCA 4W82A 2YXSA 1E69A 2Q8DA 1VZ2A 1O5OA 3SP1A 4MI9A 4JC1A 5A3RA 3IHLA 2VNKA 5F35A 1KU6A 1Z7S3 3QTBA 3M5DA 2FE4A 1PLJA 2EVWX 1UC5B 1NXQA 1TKBA 1EM6A 3ZI7A 5KTMA 2CY0A 4LXGA 4G1CA 3O7MA 2TEPA 4RK7A 3KYCA 5L3VA 2Y68A 1U0JA 1XC6A 4TWTA 2GAOA 1DMSA 3G0OA 3VJLA 4LXYA 1RMQA 3P20A 5FRAA 4CUGA 2WO1A 3FWNA 1ZA2A 4MVJP 4UMVA 5MDHA 4MW0A 2MCFA 3C1AA 4YW7A 5ELMA 2IXDA 3GEMA 3CVOA 4I3PA 5K0EA 4KIJA 4TZDA 2E18A 4JVOA 2Q0AA 4X6QB 4FGJA 3AEZA 1ITZA 1RIFA 1RZUA 1CESA 1H1TA 1KDKA 3L4JA 4RR3A 3W5JA 5HF6A 1MHPA 1GYRA 3DEZA 2QNKA 4TT3A 1JMUB 3Q9SA 4DNYA 4C4PA 4B4PA 1WHTA 1HDRA 2HH9A 4OVEA 2BP7A 2ZTVA 1WVGA 5FR1A 2AQHA 2C0ZA 3C3XA 2HT6A 2VDMB 2XUIA 4UMEA 4DKJA 5B3LA 1ZRRA 1RC1A 4XEZA 4MINA 5B30A 2HWC2 2I34A 2ZYIA 4KVGA 4Q5IA 4DANA 1XEWY 2P0YA 3DW1X 3EMVA 3K0FB 1UPTA 2VSXA 3ZDZB 4R52A 1D2CA 1Q7EA 4E5VA 3OF1A 1I9CA 1BH2A 3GJQA 5ER6A 1OJ7A 1L5LA 5IHRA 4Z9YA 4ZEWA 1XWWA 4N53A 2P4QA 2J5BA 3OKPA 3ANSA 2XKAA 1JWLA 2C7QA 4Q8KA 2CJXA 5IF3A 1D2AA 3E9EA 4R0MA 1YONA 1LOBA 3RYCA 1F9EA 3U49A 3N2NA 1E5SA 1DYPA 4ZY9A 5J98B 4EG7A 1QANA 2NVWA 5ANQA 2XMBA 1CLEA 2B7CA 3KIPA 3ZHSA 2VCCA 3I72A 2NU7B 1H2RS 3ZWVA 5M2QA 1Q83A 1O03A 4NDAA 2VRNA 2WA4A 1L5HA 1L7DA 3ZE2B 3ZJ5A 1RUD2 3TNQA 5A1AA 1CULC 3IZOA 2Y6VA 3FPJA 1NJSA 4FCCA 5LM3A 2VSQA 3A1EA 1VG1A 2ZBRA 4KNYA 5IKEA 4RH3A 1TCCA 4KLNA 1S4CA 1APBA 5FI0B 2XDQB 1WDTA 2HPHA 2Z79A 5CT8A 4O4LF 3ESAA 1GPH1 5DG1A 2ZPAA 3UAWA 3TLGA 5JC1A 3G17A 2NM0A 4BFSA 2CZGA 3VR0A 4HQNA 2XWJI 4Q3BA 5HRAA 4IFIA 2HJVA 3MI8A 2X0IA 5A6SB 1K8ZB 2FFJA 2YFHA 4HDRB 1DLLA 1HTWA 2E4AA 2VJKA 1LENA 3IOCA 3AZZA 4ZU7A 3OUUA 4GR9A 2EIHA 2W7TA 1NIJA 4IUGA 2ZX1A 2WZR3 3V6MA 3E0QA 4FK8A 3CNHA 3WW1A 3K20A 2PYTA 1GAEO 4KFUA 4CDUC 1KTVA 1QBGA 2F8SA 3CE6A 1NXVA 4G97A 4X00A 4Q66C 2FMYA 2I7DA 3DM9B 1CD3G 5GGXA 2WU4A 3LL4A 4E1VA 5REQA 4UBNA 4Y22A 3RYPA 3LBAA 2VPTA 4FPGA 2RAPA 1V5EA 2ZM5A 4WZ6A 1NX6A 3AJEA 2CVZA 4GBGA 2XPJA 1E5IA 4ITCA 3LEMA 4RWEA 1R4MB 4CE6A 1LOCA 3KB8A 2GFQA 2IEAA 2OYRA 3EE6A 2B6NA 1PP4A 4CMEA 2XCLA 4DVJA 1UW8A 1WMBA 3TN92 2DWOA 2G1PA 4EG1A 3CRW1 2JAWA 1HZJA 5SYAA 3UWPA 3VPXA 2DJIA 1VA4A 1XLUA 4HFNA 3ZK9A 5FBHA 1KAQA 3H42B 1OLMA 3PBKA 2EF1A 2XECA 5EP1A 4ZRMA 1XNCA 4L72A 5JUVA 2PMBA 3L7IA 3U44A 5JADA 4KXNA 2CHUA 5JFTA 5HIKA 4BY9E 3HY3A 1MVNA 5I9IA 1VAVA 1NE2A 2O3JA 4ER3A 3L49A 5LIPA 3MRVA 4UASA 4PO9A 2ZYRA 3MJEA 3Q7RA 3DFZA 1PO22 2E0IA 1RNLA 5GJVC 3URMA 1TMF2 2KD7A 2RHRA 4E21A 2MNGA 4GWJA 5FADA 1NJGA 2PL1A 5AWFC 4QUJA 5MN6A 4DTCA 3UGFA 4WEOA 1CFZA 1BFUA 3K6SA 2REXB 1IXSB 4WUVA 2DY1A 1GZWB 1XEAA 1B8NA 3PXCX 1REEA 4IV3B 4QOEA 2AOUA 1FPN1 4HGRA 3ZLIA 3PHGA 1UKCA 4EPWA 2A1UB 1DRKA 1Z75A 4BWYA 4MPTA 1TW3A 3ZU6A 4YBZA 2QD1A 5CD9A 1KFXL 4AMBA 3HP1A 1W0KA 4J1QA 3WJ1A 2NZ8A 4NV0A 3AK0A 1TUBA 4MO9A 4N3CA 3DMTA 2BCGY 5A6YA 1HT0A 4CDRA 3P9SA 1FJHA 4EHLA 4I3FA 1GU1A 4WM8A 3FAKA 2NXNA 3EQZA 3TLZA 2XD4A 4ALMA 1QMJA 1O94A 2GVZC 3UXEA 3VBHC 4P34A 4I81A 3U4GA 1NDQA 1Q21A 3RSCA 1MV5A 1JBQA 2J9FB 1B41A 2D5FA 1A5SB 5BMVF 3QEMB 2CK3A 3I09A 2OAP1 2HGSA 1H2LA 5DCWA 6NULA 3CXRA 5HM8A 4W5TA 1HW5A 1B8VA 3MIGA 1WL8A 5JAPA 3JASA 1M4WA 1LI5A 5LBEA 2VAPA 3P26A 3U6KA 1G6NA 5DNCA 1TIKA 3WK6A 4NBKA 4N7IA 1NV8A 2ZB8A 1Y7HA 2V4UA 3IOEA 1KJLA 2FN4A 2O50A 2Y60A 3OBRA 2OPHA 3S40A 4C14A 3DBIA 1TKAA 1RUF2 5AHRA 3TZLA 5F77A 4ZZ3A 3R2JA 2I45A 1Q0HA 5FPVA 1NPDA 1RE0A 3GLRA 1QGUA 2AXPA 4A0HA 4GMP1 4OGFA 2RS51 3W1WA 3GH3A 1U8TA 3NDIA 1QU0A 4DNOA 1QAOA 3B5EA 4N0PA 3S8MA 4B82A 4QD3A 4R9CA 3SXUB 4AOCA 5JZGA 3ZVLA 4OJTA 1PCXA 4NVRA 4BB9A 2RGGA 4GB32 4CMJA 4NQZA 2WA1A 3EW7A 4W6YA 2SKCA 2IYQA 3TS1A 3I52A 1TYBE 1IULA 4LYYA 4UHEA 3Q3HA 4ZOEA 2R061 2JH3A 4IV3C 2WR8A 2Y34A 3EC1A 4BMNA 3FF4A 1GGJA 1C9NA 4J43A 3T3IA 1LHUA 5HQ3A 5FZ9A 1ZICA 1O7FA 4E27A 2WP8J 5JISA 2TYSB 5NLLA 4RJJA 2B5VA 2FUG6 2BFEB 4TTQA 3WP4A 2JLBA 1CVRA 3RUAA 1MAVA 1I94B 1VI6A 4JQSA 2BKAA 2QTHA 1X77A 3RTGA 3WMFA 2EQ5A 3H84A 1G86A 1G5FA 1YJ8A 4LCEA 1XRNA 3N76A 5IC4A 5BSWA 1KEEA 3KSDO 4O0MA 1D2GA 1P0PA 4RX1A 4BTLA 5E9JA 5FFNA 2XBO1 4TQGA 1PS8A 3UJAA 4E2GA 2KS6A 2JRCA 3RPQA 1RKXA 2IIQA 2V9CA 2VDRB 3QFCA 4JLWA 4WXYB 4P3KA 1E8DA 2GD1O 4BN5A 3P2OA 2VI5A 1DHRA 3EFEA 4HG2A 1KI3A 4B6SA 3Q0TA 2Y1LA 1U0TA 1JHUA 3KFXA 5MGBA 2RC5A 3RG0A 4BVHA 2J9ZB 3D4OA 2H1WA 4BQYA 3G5MA 2VWQA 1E2JA 1T6NA 4LBWA 3VU9B 4DJFC 1E1RD 3PUAA 4QJBA 5KHGA 5EERA 1GVNB 4TTTS 1W6MA 2MSDB 3DTVD 1GQ2A 2PSSA 2JVKA 3NEYA 4BBAA 4BAZA 3I83A 3SGLA 4E11A 2VNAA 2XA2A 2DEUA 4NU8X 1S4MA 1UWCA 4UHBA 2ZX3A 4CDGA 1GUBA 4KN6A 1KQ3A 4HN1A 2MR5A 4GULA 4RSMA 1OX5A 4BO8A 4QGSA 2FPLA 4OV6B 4RD2A 1G3RA 4PDWA 4V2IA 1WV0A 2AI3A 3G9QA 4I1YA 5KU7A 5EPOA 5GLWA 3CUVA 4BVEA 3VUOA 2Z3ZA 3FYTA 3QXGA 3T2TA 3TTXA 2VBGA 4AVSA 5DASA 1YVDA 2OD2A 5JXIA 1VHQA 3O7OA 4KI5M 2PH3A 2PS1A 3ND5A 3RZZA 2XADA 5JI3E 5KNCD 5TE9A 1OI2A 1NXOA 5JXJA 3MGKA 1ZZGA 4RFRB 2ONZA 5FMCA 4ZOLB 3A25A 4NMWA 3FSGD 2XRZA 1WF3A 2FZEA 2WVHA 2CFOA 4D02A 4MJXA 4MR7B 4GX1A 1P80A 1GWNA 4D9JA 1T4CA 1L6IA 2XTAA 4OQDA 3AIOA 3GD5A 1POV1 2CNWD 3KXLA 4JS0A 1T8YA 4O02B 5F2EA 5SV8A 1KRWA 2FMTA 3RSJA 4RDXA 4ZCMA 2CXHA 2P9BA 4P5EA 4QUGA 2FEWB 2G0AA 1SKYB 3H87A 2ET1A 2OXBA 2ZTLA 4YMVA 3DLHA 1DTWA 2PIDA 3WQ0A 4L7QA 4B6QA 1K27A 2XUJA 1RBMA 4QUBA 1MNQA 4NZPA 4YUXA 2XVYA 1A9QA 1XNJA 4ESVA 4CIAA 4FKZA 3QQPA 5GAJA 4J1XA 4JC5A 1DT3A 3ZYBA 8ATCA 1I5PA 2HXYA 3P0RA 1U8YA 5KQGA 3AFGA 1HEYA 2Q8QA 4XWGA 4HJRA 1FQWA 2VHVA 4RSHA 2WIIB 1YI1A 3AESB 5ITVA 1F3OA 4HWKA 2BJWA 3CJIB 2ZIWB 4TSFA 3LX6A 1Z6TA 1QIEA 2C0QA 3JYHA 4GWGA 4AKGA 1TW2A 2FI1A 5DNEA 2NQYA 5LA1A 4O65A 1OY1A 4AICA 2X0KA 2RMU1 5FZ6A 1W88B 4YJDA 4P3YA 2ETVA 4IDCA 2WHQA 1BKYA 5LATA 2PMWB 1JU3A 2QT9A 1WNFA 2YGMA 1AB5A 1C5HA 4B3TB 5BWCA 4Z8XA 5I8PA 2H0QA 3GGLA 5I7FA 4QGAA 2QMEA 4KGGA 2P2DA 1EWQA 5DUWA 5KWSA 2QNIA 3FKSA 2Q4BA 4TL7A 1KI6B 2ZJYA 3TDKA 2IHYA 1OHFA 3D7SA 3MAJA 1M6NA 2IXLA 1PO12 2HA5A 1FK8A 3LQYA 4NHLA 3JVUA 4EUNA 3CB2A 2JG9B 3A4VA 4YALA 1H22A 2OSBA 3K48A 3X1ZA 13PKA 1HJGA 3FLBA 4KXUA 4HSEA 4DLBA 3SYKA 1ZBE2 1EDOA 1QFXA 4MQEB 5IAOA 4H3WA 3TM5A 1VJGA 3SBOA 2DFNA 4CA9A 2VTEA 1G98A 2XUHA 3U2QA 4KUGA 3UJPA 5T50A 4AJKA 1WQ1R 3HM9A 4TTGA 1AV6A 5A71A 2C26A 1TYZA 2R6R1 2KXLA 2FPUA 4PLMA 1NNSA 3ZDBA 5CB0A 1JRLA 1X6VA 3M6VA 3F2IA 2MU1A 4JLUA 3N7KA 3LWZA 1JG3A 3WLKX 4XZPA 1WNTA 1UMIA 4B47A 1ZRIA 2A30A 3BA6A 4M4SA 2JGAA 5L7TA 3OCYA 1WETA 2P9EA 4EE2A 3I45A 5KIAA 4D6YA 4OXNA 1CP2A 1M73E 3QG5A 3VDAA 4CM4B 5KU1A 5EKDA 4UQOA 1O4WA 5I7VA 1DKRA 4MGYE 3LVRE 3UGHA 3D81A 1K12A 1ZZ9A 1N6KA 1XD2A 2H92A 3WRXC 2QAIA 3CPJB 4XEHA 4L6CA 4AN4A 3QMPA 4U2GA 3MT9A 3R4VA 2Q9CA 3PX2A 4J8PA 2F3TA 2HPZA 3VZSA 1L4LA 3LH5A 1EK0A 4MW5A 2Y6UA 1CF4A 1JDUA 4JYCA 3FNQA 5BPFA 4RK4A 3U16A 1RI1A 4FN5A 1ZDMA 2R1BA 2XMZA 3CF0A 4QWWA 1CETA 1E1NA 1JPVA 4FNGA 1SLAA 5CISA 1Q0UA 5AKGA 2JBAA 4CKBA 2J48A 1FLDA 1H5UA 4LHLA 1P72A 2R00C 5D8DA 4LK3A 4IQ0A 4LZNA 1KORA 2IV7A 5G3ZA 2JG9C 1MR3F 3R5KA 1E6WA 4I30A 1UDXA 3QU4A 4YP6A 1N1VA 4GUAA 3NO4A 1EE9A 1S2MA 2TMDA 1WKCA 2I4MA 2P5YA 4G0NA 4PBRA 1XRJA 3CNNA 4LRSB 2ERFA 1CYEA 4TT8A 3O83A 4L50A 2BGTA 3ES9A 1F7VA 2VG9A 1NR1A 2C92A 3JQPA 4NOJA 2PUWA 4E5PA 5IK7A 2OAGA 2XB8A 3C8UA 1AK1A 4ZFNA 2PKYX 3WQQA 4KPFC 3JQ6A 4IVRA 3K5WA 1DF0A 2OUHA 1NM5C 5J58A 4H7KA 2XMPA 1HX6A 4R2HA 3J7MA 2VJOA 3MJHA 2IP2A 2NSHA 2BPOA 3AEQA 5JJCA 2JFNA 3BE4A 4B3NA 3T7AA 4J16A 1MGPA 5EL0A 3H2YA 1O0SA 3EXIA 2OGSA 4DCNA 1YE5A 2RH5A 5FO8B 4F1KA 5TQ2B 5IASA 4B80A 1K92A 2IYEA 2OT3B 1C5KA 3A22A 1KZ1A 2AYXA 4PSAA 3FWPA 3R9WA 1YIDA 2X23A 3EBPA 1CUAA 1NQTA 4I1OA 4JTNA 3DVRX 3KWVA 2P8SA 4DCVA 1A3CA 3C5CA 1AR81 4FGUA 4QQPA 4Y67A 1J49A 3NKVA 2X42A 2VCBA 4O4LB 4PAMA 3ZNQA 3J7HA 1P9OA 2FKAA 3BK7A 3QRWA 1W6NA 4BBPA 4WLUA 1EKXA 5LP1A 1YUMA 5EIXA 5C1BA 2FUG1 3JQGA 4EABA 2PZMA 4P4UA 3ZY5A 4IJMA 2AJLI 4BJ6A 2YBSA 4KR0A 1Q2UA 3ZD9A 4ZOAA 1YCDA 1BKDR 2AR0A 2WWTA 2AMFA 2ZRQA 1XQVA 2XUOA 2IYNA 3MIDA 3GW8A 4N18A 1MT0A 4GIQA 5GVRA 1QIDA 1IY8A 4YV0A 1YFLA 2QXYA 4EI7A 4LBQD 1H2MA 1TMGE 3ZXGA 3KJEA 1WCYA 3VNUA 1UC9A 1HSOA 3RKUA 1B7GO 1BZYA 3AKCA 1E0SA 3DTNA 1VBE3 1UR5A 4JQZA 3P32A 2K2QB 2W5FA 4BRUA 1UT5A 1Y80A 5A3LA 1KPGA 5FLXA 3HJUA 1ZN9A 4C0SA 4XFJA 4MUXA 2WFF2 1KS9A 5A7OA 3L0SA 2ZRAA 3DL2A 2UXBB 2Z09A 3CEWA 4JLPA 4Q3OA 2ARCA 3BTVA 5BN5B 3TLXA 3WNCA 2V0CA 5K3DA 1BFDA 4MWTA 3JZMA 3I2KA 3SM9A 3F5MA 4KBFA 4Q4DA 2VHCA 3ZWMA 3V34A 1X80A 3K1AB 3DBLB 4IXLA 4M0DA 4BFWA 3R3JA 1U7HA 1YNAA 3NOQA 1J20A 4J7XA 1Z7YA 1R6TA 1IWBB 5JBIA 3KR0A 5JQGA 5FBKA 3B8EA 3MT7A 4F6LA 3HKBA 2MSNA 4X85A 2WABA 2IP1A 1VB3A 1E2IA 3IQGX 3E3AA 4AFAA 2TMGA 5JXHA 4KAAA 4JBGA 3GF4A 2FDFA 1L8XA 4AZ0A 2RJLA 4G67A 1PNQA 1FVXA 3DE5X 3NORA 3ABIA 3PNVA 3DEMA 1QWOA 5FPHA 4BPZA 1QP8A 4JQCA 4ZARA 2BWAA 1A04A 1ZD5A 4KPUA 1ZA1A 3BE8A 2F9FA 1N9KA 3DR3A 4LKEA 2YHUA 1XZ8A 5A2QA 4YR7A 3DAYA 2ASVA 2ZIUB 3RYIA 2GEVA 2PRKA 4CXMA 2G1MA 3ABZA 3B51X 3N6VA 3PTAA 1SBCA 2ORWA 3W5AA 2A67A 2RHGB 2VDOB 1FFXA 4IDGA 4A1FA 5L7WA 5JAMA 4YJFB 3E8XA 5IDQA 3KMHA 2WWXA 3H8UA 1YT5A 1GRRA 5JZSA 3UL2A 5IVIA 2WYIA 1JV2B 3GZAA 5LEKA 2W71A 3UUGA 4O2BA 3OCPA 3SJUA 4GYWA 5EJFA 2FWMX 1SC1A 3EQ8A 3VOBA 1WW5A 5C4MA 1JR2A 3RSZA 4ZPIA 1X70A 2OBLA 4NEHB 4OLBA 2E4XA 3DL4A 5AC92 1WCIA 3LA3A 2NZXA 4UDXX 4PYRA 3LNCA 4A1OA 1ZISA 5T41A 5C46F 5I8ZA 4B7CA 1RRVA 1DAMA 2HWE1 3FE2A 1C3XA 3F6CA 2A6VA 4MDYA 1GP6A 1UAYA 1YK1A 1EV11 2BWCA 5ANRB 3URKA 1GYKA 1F8XA 3E3NA 1N4AA 4S1VA 3TPCA 5AD1A 1V95A 3MIFA 1G8MA 3UMYA 3KSBC 3FSEA 2CLHB 3F3KA 2CV0A 1X7GA 3AMPA 2QQLA 1C8LA 2PMKA 3NVAA 3BXEA 2B30A 3LT1A 2CGEA 2EJVA 3RBAA 3O1IC 3EG9A 3T4PA 2KW5A 3RK1A 2BHTA 3WYDA 1BQPA 3SSOA 1W8NA 1C8BA 3FMIA 3IJ5A 4EJRA 1PVOA 2VTXA 2VXCA 1BX1A 3WMEA 1GTVA 3BMCA 5ETJA 1R0YA 1MP0A 1FV2A 1VMDA 2WV7A 1GL6A 2A57A 4RNDB 1Y1KE 1SA0B 1SKYE 3ISVA 2YWCA 3M3HA 1YCHA 3LA7A 3BB1A 5CA0A 1F15A 1G9AA 2VDLB 1NQJA 2A9OA 5IZCA 3IDCB 2SBTA 4JSYA 4IUBS 2JZOA 3RUFA 3QA9A 1KI4A 4F5EA 2HWB2 1V7CA 1ZMOA 1PHRA 3Q2IA 2OT7A 2QMQA 3C3MA 4ITVA 3FWHA 4GQ7A 5C3QA 2V5YA 3BYWA 2ANBA 3MW8A 4ZAXA 2NG1A 4ZCLA 4RD6A 4BWFB 1RUE1 4C0AC 3WLUA 1JQBA 2MDTA 2XTZA 2BR4A 3RU7A 4C4YA 4RK6A 2JB9A 5LUAA 1YAHA 5K6TA 1T1EA 1DWPA 1YR9A 4CQJA 4TL9A 4KO3S 1WR8A 3HVDA 1KGDA 1ZD2P 3PCXA 4I46A 2BTQA 5LMNB 1OPOA 3IR6A 4B5LA 1KAHA 3ED5A 4ZHQB 3IKVA 4Y2UA 4XCXA 5T3YA 1CY8A 4LCJA 1QH0A 1E61A 5AHXA 1QGED 3I2YX 2CNNA 5C70A 3H4MA 4UATA 3BWBA 2A0XA 2WWGA 3SJCA 3ZFGA 4AHXA 4N7JA 1RXUA 3F6PA 3L5KA 2P6UA 2D1QA 1RRFA 4PXSA 4KQCA 1MZVA 5AW4A 2MSLA 3LRXA 2P65A 4ZJYA 2QRUA 4QJ4A 2DLCX 4BAUA 1LZLA 5FZ7A 1Q1QA 4E5NA 3GDGA 1PNFA 1LF0A 1OVSA 3KT3A 4R1SA 4BU1A 2PFWA 3DOFA 1I1NA 2QPOA 2JDMA 3NP9A 4YGEA 3M1HA 1BRTA 1JFRA 2XMLA 2IW1A 2YBKA 3KWMA 2SKEA 1HSZA 2X13A 4ENSA 3BTUA 4QDTA 4C78A 2O2IA 5IXSA 1GWLA 2AA3A 3CRRA 1EHIA 2EIDA 1G9XA 4ZA2A 4WVFA 3ZBTA 4HZGA 2P6MA 3KPYA 4G4JA 1VB5A 4NUBA 2SCUB 5LQKA 3ETPA 4XF4A 2HIHA 3H1EA 2VQ0A 2V1UA 2IF0A 5E9AA 1JEQA 3FDZA 4W9NA 1PKEA 4DMLA 3X3HA 4R9NA 4GXQA 1FSSA 4JDUA 5C1DA 2VQUA 3VYRB 4J4HA 2JWPA 3JBG1 4JCOA 5I01A 1ISGA 1FXWF 3OE7D 1MEOA 4JIMA 4QMAA 2NX2A 4QHBA 2ZM6B 3PFWO 1GQGA 4E70A 4Y30A 4N3BA 1VRH1 4U8HA 2JPDA 2HIGA 1XXNA 3E2PA 3U07A 3LQ4A 1E5TA 3HYRA 4QB1A 1H05A 1C1DA 1FUYB 5D2CA 5A02A 2AHOA 3W4JA 2XLFA 3KL4A 3K4AA 2VZPA 4TS4A 3DJYA 5F32A 5CT4A 2AI1A 1VBNA 2O7RA 4MVYA 4YZ5A 4NXMB 2Y8EA 4Y6LA 2HJWA 3MTGA 1XMIA 3MTJA 1IOWA 1SLBA 2CWWA 1PLLA 3EAFA 4B44A 3T2PA 3PHJA 5GGYA 2XITA 2DC1A 4WBSA 4GQBA 3S2YA 3W06A 2Y67A 4DIUA 5H9QA 1R64A 1B8PA 2NNLD 1FW6A 2OCPA 3S7EA 1WCKA 1RTVA 2ZVQX 2XYRA 2GEKA 4NLLA 4M3CA 4D7SA 3CNLA 3UAXA 3RZJA 3IPCA 4PBOA 3PIJA 3ANYB 4A91A 1EX7A 5B6PA 3TLKA 2VAVA 3WXBA 4G1EB 3IQIX 4OKNA 3LX8A 1JAYA 3TIXB 3V4PB 3OOEA 1RXFA 3VYUB 2PUCA 1HORA 2JGDA 2VRCA 3H5AA 2R85A 2VUCA 4X8NA 5FPSA 4H2AA 1KFBB 3WNBA 4QNMA 4KQ6A 4D92A 1EFAA 1DQ4A 1V16A 3K1YA 1CUXA 1KD7A 3M3QA 1PFGA 3GAFA 2PD6A 1HDIA 3CUSA 4M9SA 3ZV3A 2J1LA 2H85A 4LHZA 1ZNWA 4OLLA 2OESA 4B48A 3NBUA 3E4DA 3HFGA 3RM3A 3NYIA 3DVAB 3NBMA 1DKUA 3FROA 1XQWA 4AEDB 3IE2A 4O5OA 4CDMA 1VCMA 4UCFA 2JEMA 2VQDA 5C37A 2MHCA 4WZFA 1W48A 5JHGB 5JWPA 5F1KA 2BKLA 3ROQA 1JKFA 3U4HA 1XXHA 1BGWA 4Q4X2 1QLJA 4H14A 4U7FA 4IGAA 5ITZB 3DD1A 3COWA 2AH2A 1X8KA 1G8AA 4YV7A 1UMBB 1S2EA 3HSKA 4W5NA 1NCQC 4TT3D 1RWNA 4DOMA 2ZBPA 4ROSA 3EDRA 2A0YA 2Q5CA 2Q8OA 5CFZA 2IV3A 1XRMA 2X9LA 4NYMR 3A05A 4LW8A 2DZDA 1UUFA 2FMFA 2IOYA 2XJ9A 3E3OA 4A6DA 2EZ9A 4LY0A 4NC9A 3DYOA 3ZXAC 4RQAA 2UXCB 3NHZA 3I59A 1A7AA 3EEQA 1ASJ1 3PIGA 1RJ9A 1GWKA 4DZGA 4PFQA 3LPDA 3NHFA 1JP7A 4EMBA 4YG3A 1UFQA 3BL8A 3RSGA 1QFJA 1XF1A 1AZLA 3V32A 3TL2A 2V5DA 2BOVA 1CT9A 5K7PA 4GMFA 2FQXA 2PH1A 1QCDA 4HQKA 1DGRN 3EFHA 2ORZA 1M1XB 2CWSA 5KUTA 4ADSG 4EO9A 4JT2A 1JEDA 3ZEAA 1CN1A 4PW0A 2OXTA 4OHRA 3GXBA 2VQAA 2FWRA 2A7XA 3I9FA 1XD8A 1WUYA 2ZYDA 1I5EA 5AW7A 4I4TA 3WLNA 2EFEB 4KXXA 1KH1A 3QZUA 3HDVA 2PQSA 2X6TA 2KBEA 4LA4A 4HVTA 4XJ9A 3F96A 4P4LA 5FPBA 1Z4NA 2OXFA 3KBBA 3AJRA 2JE8A 1I7QB 1QZUA 1NG0A 5BW4A 3OLXA 3J7NA 2HJIA 3LUKA 1B93A 2E87A 3PHHA 4YIHA 1D7PM 4AEDC 2RHDA 3B6ZA 2SHKA 3VOSA 1SUBA 2DTYA 3VBSA 4FBFA 4RKWA 3ZV4A 1MG5A 2PEZA 4I6GA 4C1XA 4TUYF 3VHNA 3ZXJA 5AW6A 4JL8A 2CDRA 3ES1A 2WNUC 1FLNA 5KMGA 5E4YA 4P02B 3MUFA 3LCVB 4BFYA 3CMCO 3O0WA 4Y1FA 2BW8A 3STUA 4M83A 5H0IA 3ZK8A 1C7EA 5BW6B 2J42A 4EWEA 2O1SA 3T52A 3AF2A 1H3FA 4HVQA 2WLQA 4CCYB 2ZGRA 2XODA 3JALA 1YR3A 3B6MA 2EW2A 3ZWKA 3V4ZA 1PK9A 5IK8A 3ZDYB 2X8KA 1KJQA 5FTNA 3RVSA 1YO8A 1K7YA 4AX4A 3PDWA 2QXUA 3WO1A 3VDXA 4EMUA 1H85A 2BGJA 3N7MA 3EVTA 1JTVA 3UEOA 1GIAA 4AMVA 3DUIA 2I2DA 1K8YB 1HL7A 4KV7A 4B7AA 1TM7E 1OTXA 1LOAA 3NIBA 3VDDC 4LXLA 3ANNA 4DYHA 4HT3B 1W75A 2R042 4H1WA 4QDQA 4UDNA 1J0BA 1NVVR 4C0QC 4Z82A 4TN1A 1MOSA 2DR3A 5JS2A 2GB4A 1VLZA 4KIUA 1QE5A 2UXDB 3FBGA 1EQUA 1OLXA 4B76A 3RASA 1HE4A 2IUYA 4UW4A 1VBKA 3B20A 1WLTA 3W77A 4M98A 3WYEA 2QY6A 4MKXA 1OGIA 2YVQA 3FUOA 1JLLB 3VBRB 2QUKA 1ONSA 4TOIA 2PFKA 3O8DA 4EZIA 2QUAA 3VC1A 4QU5A 1LI7A 3CURA 1NY72 1MQTA 5A7QA 2VA9A 3LPLA 1HE8B 2ZRIA 4YXWA 2WUHA 1P18A 1P9WA 5F1YA 2PAEA 3LSEA 1MV8A 1QFYA 5K8JB 4IE5A 2RGEA 3DP7A 1KEKA 1Z2PX 1ORWA 1Z0KA 4FI9A 1FNCA 4EUEA 3DA8A 2OOSA 1TECE 2ILVA 1WDMA 2XCIA 3Q8EA 2ZEZA 3IESA 3RFVA 4G25A 1O96B 1V7QA 2QPTA 3IAAA 4WY2A 3ESZA 4Y9DA 4JELA 1CS0B 2X19A 1DIHA 4PIMA 3OEAA 4WL0A 3WZLA 4M6WB 2OKGA 1GTSA 2PL9A 5HIAA 3HXTA 4FGSA 3C7CB 2HMWA 1QORA 4AULA 4ZI7A 5SZKB 3TNFA 1F8VA 3N3AC 1Z5PA 5LUBA 3T95A 3J7AC 3HU5A 5CGQB 5AJXA 4ZQHA 1XV5A 2H4YA 4ZOLF 3U7JA 2HAEA 3POJA 1JFFB 1CFJA 1W0KD 2Q7OE 2E37A 5ITSA 5DDJ1 3F73A 2GZHA 1SC3A 2RK4A 3BUCA 3DDSA 3B13B 3VKUA 1BXKA 2HEVF 1H2NA 4F3TA 5EHDA 4P0PB 4Y1RB 1O94D 5HZGA 3B3QE 3KVYA 3T0DA 3S1SA 2WZEA 2AC4A 4G81A 4Q0PA 1FP1D 3MIBA 1E4VA 3EUEA 2Y6KA 1T9DA 2B8MA 4YRCA 1XZHA 5DRYA 3DXYA 3AYCA 3VV2A 2QBXA 2EAKA 2CK3D 4ZHNA 3SIPA 1CY1A 2AGVA 1T5SA 4RADA 3EVDA 2WLPA 1NBIA 2A9RA 4BQ4A 4GRDA 2OD9A 3AZXA 3T7EA 2HTEA 2NVUB 2FZ1A 1FFDA 1ZG3A 2JFHA 3OIUA 5C8YB 3PR3A 3VBRC 5EIBC 2E49A 2JDIA 1CZLA 3FZQA 4NYMQ 3OIGA 2ADMA 3KDPA 3OCXA 3TZ6A 4HDMA 1J59A 4M1ZA 2WSBA 4NTZA 1DAHA 3QVOA 4P98A 2DB3A 4FD3A 3A7DA 1SRRA 4EB6A 3ZVXA 3FBWA 2WT8A 3DWFA 4XIOA 1PVC2 3L0ZA 4F4IA 5AIBA 4OUMA 3NBQA 2Q7DA 2YY7A 1D7AA 1L4HA 4PS1A 3ZKWA 1VRWA 3QK7A 2WOOA 5ITWA 3HN7A 1MFZA 3RFFA 2Z5WA 1DCMA 1RC0A 5A5EA 4QQ2A 2FWBA 2B42B 4I1SA 1GR3A 3NVCA 4WACA 3WG2A 1KY4A 5JYDA 5IK4A 5J2TF 5LU8A 4Q4V3 1ZJZA 2QMYA 1M5TA 2JARA 4RTSA 3WK4A 4ZKTB 4LE1A 4ALIA 5TQJA 3CT4A 3TLMA 1TVKA 1UEIA 1BE6A 2DKNA 3MOIA 5EMJA 4PLFA 5CURA 1WW6A 3MEPA 5A06A 4H7LA 2EWWA 4CM3A 2G40A 5FK7A 3QKSB 4D3FA 2E85A 4IGFA 1FDSA 4D3YA 5LA6A 1Y4SA 1G60A 2DX7A 2I7CA 1L5MA 1UN1A 1PAUA 2M1XA 2W6NA 4HTAA 1VJ1A 2RJKA 3LF2A 1RADA 5EWMB 4NMIA 2OB2A 2FP4A 3NHAA 1KHHA 4II3A 2R071 1Y43B 2RH4A 3DXTA 4IOLA 1MB4A 1FOD1 4N43B 3UQZA 4OQNA 2B9EA 4EPTA 1ZVKA 4EGAA 5EJ4A 1I14A 3GPDG 1ULDA 1P8AA 4CF4A 4AJLA 3THXA 4J76A 4JUBA 3UTCA 4EW1A 4X64B 2W91A 1OWMA 4XF3A 5I48A 5H9RA 4QUAA 4NXNB 4Q1CA 2DCMA 3RRBA 3D54D 3PTLA 2RGUA 3VMMA 5IJRA 4IDQA 1W6PB 3K0HA 3PXUA 1KMNA 2XGGA 3G6KA 1XTIA 4U7WA 1VBA3 1AX1A 5FJIA 3UWOA 1QYIA 1H6DA 1K08A 3TIGA 2DVAA 2II6A 3I8SA 4I8IA 1SG9A 1CY0A 1II8B 4OGGA 4XYEA 2BN4A 4CCSA 1VBC2 3NL1A 5IEBA 4IXTA 1J1LA 2LWIA 4L9SA 3V64A 4D9GA 1ZA7A 1TYAE 3BQNB 1CX9B 1W9SA 4XR9A 3ZOKA 2C2ZA 2J0UB 1DDIA 4AYUA 2WF5A 1XZPA 4BECA 1Z17A 4UEQA 3ZU3A 1RE1A 2YDXA 1YE3A 2DKFA 3Q7QA 5DH9A 3OUTA 5IWCA 1WLYA 1T5DX 3TQIA 2WN2A 3K94A 4R8HA 1NVVQ 2BE7A 1VHLA 1JSXA 4IMIB 3V4SA 1C4KA 2VYNA 4YGBA 4D4MA 2QYHA 4OBXA 3AH8A 1L4MA 1A95A 4B9AA 4L02A 3AP9A 3AYZB 1QRDA 3OZIA 5EYXA 1LW7A 4CV2A 5DLDA 3B3AA 4BXOA 1EB8A 2F3QA 3RRYA 2GSYA 4HGNA 4NV3A 1EXDA 1YA8A 4V3CA 1YBMA 3LW7A 4WDRA 4WFJA 1NJ6A 4X20B 1OFSA 3WNPA 1OW3B 3MLLA 3D0SA 1VFNA 5F78A 5D7NA 5DP1A 3ZWYA 3QFRA 1AHIA 1DJNA 2M6RA 1U0HC 3RADC 3PXEA 1QJFA 4EFKA 1F38A 4DW8A 3AL5A 1FP4A 4N43C 2ZIZA 5FY7A 1T36A 4NJEA 5IN4A 4D26A 3RSHA 4ZVPA 4TMYA 1DAOA 2O2ZA 3QWIA 3I0MA 3D2LA 2A9PA 2D97A 3COPA 1ULSA 3Q88A 4LHKA 1NOIA 2JE7A 1W8WA 2JNWA 2W2NA 1I4EB 4KG8A 3IERA 3HBLA 1UMCA 3R3ZA 1ODLA 4TSFD 1GZSA 1XJ0A 4MX8A 4UCXA 4TTAA 3RC9A 1JPNA 2B1RA 1WW8A 2OBNA 2EX0A 1BU5A 1QLHA 1UXGA 3DZGA 2FSSA 3KYDA 3JD1A 4L8GA 5AI8A 1GGHA 1JFSA 3O0VA 1J1IA 3FN9A 4W7IA 2RAVA 2RCNA 4NBSA 1U8EA 3D8RA 1ULEA 1V11B 1Z34A 2OXRA 3A6GA 1CUFA 2JC3A 4HGPA 1LEMA 4GMKA 4IDNA 4Y1UA 4H3KB 2X3FA 5AKEA 1D7OA 3GEBA 3FKSD 4AP9A 1LDMA 3ODPA 1H0HA 3L0BA 1YC5A 5AVJA 4HFRA 3LDRA 1O5UA 5HEKA 3HCOA 4QGLA 3PC6A 3HN1A 4PLNA 1K3UB 4G9GA 5FBRB 2X5OA 2R3SA 2JKBA 1LPNA 2I67A 3UF0A 1L5OA 1Y4AE 4PLZA 2FRXA 1IOAA 1R88A 4V0NA 2PLWA 4HZUB 3S81A 4PSDA 4OBEA 1LSSA 2W6JA 1EFTA 3ZZUA 3CLTC 3PLRA 1FMD2 3SJ7A 3VZQA 5CFCA 3LAWA 1XB2A 2AE2A 1E5RA 1AUPA 3U4AA 1HO3A 1IAVA 5JD5A 3UWMA 4MYHA 5T8KA 2I9KA 1GQPA 3CPHA 1JYFA 2XF8A 5EUMA 1W39A 4RGKA 3DBOB 1Q1AA 4IDBA 3MXOA 4YXFA 721PA 5FA8A 4BB6A 2QP3A 4LYAA 3BXHA 4YYZA 2Q5OA 1OLOA 5EKSA 1B73A 2ERYA 3SR4A 4MHRA 4ISCA 2CXOA 1XDWA 2YBEA 1VL6A 5LQCA 2X8AA 4LE4A 5DGCA 4YH1A 1N0WA 1O6GA 3DCIA 1VG9B 3VH1A 1CUBA 1YDWA 4XQGA 2E2WA 4BNVA 2RCYA 4QQHA 5F5XA 2Q0SA 1AYN2 3POGA 5SY9A 2O8FB 1VE1A 5K0UA 3H65A 2QEQA 3BKWA 2VP5A 2FZ4A 3ZIUA 3WOHA 4NYIR 5KSOA 1SZJG 2C4NA 1RHI3 3SXPA 4QAQA 5BN4B 1HN1A 2G67A 3SNKA 1PGSA 1JHNA 3NWBA 3FOZA 2PD4A 4S1NA 1XL0A 2G88A 4WCDA 3NEJA 2DTXA 4DR3B 3SLKA 3N75A 3ICWA 1DI0A 3D5OA 1ZMXA 2WFLA 1XE7A 2YASA 4DF3A 2IXAA 4D45A 2GSDA 4X54A 4OQEA 3D6VA 3L8DA 5C1PA 3THRA 3ZWXA 2NO4A 1TLFA 1UK8A 5F33A 1E3TA 2WC2A 2QTWB 3C7KA 2LV8A 2L42A 4OXYA 5LB4A 2H5LA 3O4HA 3FOCA 1JIQA 3WP3A 2XCRB 3T2QA 3MAAC 2DHDA 1LD3A 2NU6A 3E6DA 1DC3A 1VMEA 5B53A 3UXMA 3WLEA 3SH5A 1WZUA 4DVGA 4QPIB 4PGAA 3NHLA 4ARAA 4NECA 1N25A 4ZQEA 1EXMA 4EI2A 2PSEA 4B6JA 2ZJOA 1Z68A 1B23P 3IT3A 4POOA 2Y1KA 1Y3TA 3OKAA 2NSLA 3RSLA 3SR3A 3GL9A 4K2AA 2YV3A 4YUZA 3HUDA 3GMDA 4LOSA 2LUOA 3JQ9A 3ZV6A 1YJCA 1DCKA 3R3YA 4KGXA 3LFTA 1XJAA 2OO5A 3V0AA 1G7TA 3AI3A 4E03A 3ZGZA 3DCNA 3N2KB 4FN4A 1Z0IA 3EGXA 2ZYHA 4YUWA 2Q3JA 3IPRA 1KSJA 2OZLB 1J07A 2OORA 2VQFB 3HYTA 2XMDA 3WHKA 2I1LA 1TJ4A 2FU5C 2I66A 1M34B 1NOJA 3G2JA 1CF2O 4AZZA 1HRV3 4RVNA 1VMJA 3I4LA 2C98A 4TUYB 5D01A 2CXNA 3VC7A 3VX3A 3RHTA 3IHTA 2X1LA 3TNPB 2A3WA 2ZUEA 2HWD2 5HRCA 2JFPA 1JZ8A 1AKRA 1ZOIA 5GTDA 5FKCA 2WSVA 5DBHX 3NTLA 4HONA 5IYYA 3OWHA 2BCJQ 3TIVA 1ETUA 1QKJA 2AG0A 3B1VA 4B7UA 2XY4A 3SX4A 3V4FA 1JE0A 1SCRA 3PRYA 3WWDA 1QB8A 2QM3A 3QV1A 5E4FA 3H6GA 5K3BA 3ODGA 1JTZX 2I5PO 1C8NA 1Z83A 1MENA 4LITA 3FDXA 4ITUA 1T6BX 3ZW8A 3ZM8A 3PT9A 2AEEA 3WNKA 3GGGA 4UFLA 4JL6A 3VZOA 1JUHA 2CDPA 3W9BA 4WZBA 3NNDA 3ICVA 4RMNA 3HDJA 4ENQA 2I9PA 1SUDA 4EAAA 4IUCS 2YNMC 2XVGA 3QELB 3CKYA 1NUKA 1QIQA 1V3TA 3GQBB 4QPIC 3LPAA 4ZHQF 4LOKA 5CH8A 4LQ4A 2C77A 4MSUA 1KAEA 3ERCA 1VB2A 1EXWA 2IYVA 3LMKA 1OYYA 1JZ7A 5JI9A 2AR9A 2XBUA 2IEZA 1B1AA 1XZFA 1V45E 1R0SA 1JAIA 3FOWA 3WNOA 3COJA 5FJKA 3PNAA 3WP6A 1W96A 2A6PA 4ARSA 4CRWB 1E2UA 1PIV2 1OH3A 1FYEA 4AG4A 2VT3A 3GRCA 3DPRA 2BL4A 4WASA 4ZRNA 2CHVA 3KZ1E 2A84A 1A4XA 4O3FA 4CDNA 2GRJA 5AVKA 2IXHA 1PGNA 1OPXA 2QU8A 1X14A 1P1FA 5HM6A 1N6LA 4LZOA 4QXRA 4JBIA 4ZXFA 3UMVA 3MMZA 5IVHA 3ZWOA 1KBOA 3GHNA 4LO7A 2FW7A 3C5VA 3PKIA 2PQMA 4GLFA 3UUFA 2OK8A 1AUYA 3QVVA 3F49S 5B55A 1YMQA 2J0EA 3LUGA 2ZX2A 3TVYA 3BBPA 3L8MA 3EZXA 4QKQA 1R8XA 1F8UA 3TZHA 1CAUA 4LYHA 4WK2B 5C81A 4M46A 4PFSA 1B0PA 3MBIA 2NUPB 4PRYA 4K9KA 3S99A 2XCUA 2RR13 5BURA 3QKIA 3H6KA 1Y63A 5TMPA 4YC7A 3VBEA 3QU7A 4FEGA 1E0DA 2RI6A 5J4LA 4IDAA 3AM5A 4KXQA 3EF3A 4E1AA 2XAAA 4BPBA 4TLBA 4IG9A 3ZHQA 2R60A 3EOBI 3KE9A 5EKTA 1PK6A 2O20A 1UBGA 1Y1PA 4GZMA 5E89A 5EJZB 4RF3A 3TQSA 3FCYA 5FKBA 1XLWA 2V7UA 2ZQ5A 2Z1NA 4WLOA 1C9YA 3ONWA 2QD2A 1XTVA 5BSUA 4TRMA 2XKPA 3B2QA 3NAQA 1PM4A 2IHBA 1HB1A 4UEJA 2O8EB 3C3CA 3RS9A 1ES9A 2ZI9A 2XQRA 2PD3A 3ZZTA 4IHAA 3PIRA 2E82A 2DFCA 3NP7A 5KZMB 1DAKA 4QT6A 3DWGA 1UFOA 1VPEA 4PLYA 4QDOA 3JQ7B 2L18A 3LDBA 2B7LA 4B2IA 2VVFA 4XJZA 2NNWB 3FJOA 2HD4A 1JMYA 2FEXA 1Y7TA 3IAM6 3W1VA 3USSA 4NYIQ 1W46A 1B3BA 5J5AA 4C0WA 5E8RA 1WSDA 3AGPA 4IQGA 4RYLA 4DLYA 3PWZA 2EL7A 2QJRA 4UXHA 4N7RA 2CUKA 4YN3A 3HCRA 4AKHA 5KOHB 4DDUA 4CG3A 4JJGA 1JAXA 2BLLA 3SBEA 3S29A 4W8HA 1U3DA 4HKLA 3T1HB 1VZ3A 3OQNA 3WB0A 2AQ8A 1UYXA 5JUWA 4TYPA 3MJDA 3L8YA 1SQ0A 2FPGA 1A2BA 3QVGA 1GWMA 1PUXA 2YC2C 4MPJA 2QMUA 3AF3A 1YVEI 4PY2A 4XAEA 5AK4A 4UF0B 3UWSA 4OIFA 4PCLA 2FFHA 4XF1A 1T8UA 2VG8A 5LN1A 1JXQA 2NPOA 5DZFA 1UJ6A 2OLKA 3STHA 3TCNA 3WBJA 4CKXA 4IEXA 4RK1A 1Z2EA 3CGWA 4TKZA 3R9XA 3IMGA 2J5XA 4C4TA 4DR1B 2FN8A 2P1ZA 1UKGA 5J2TB 3PPIA 2C5LA 3W9YA 2VPYA 5DNVA 2PSFA 3PEUA 3JYOA 4A73A 1E20A 2YOFA 1E4YA 1QQ5A 1RWPA 3GK3A 4K6OA 1NVMB 2C54A 2ZS8A 1WQ3A 4DRXB 1WO8A 5DMYA 2KYRA 1C7ZA 5I3ZA 1UBNA 4LSGA 3ZQJA 5HJEA 4EAQA 2MPFA 4R1OA 4IERA 3TLYA 2P2CA 3R74A 4XOGA 3U9LA 4ZEVA 4XX0B 2D6LX 3SHOA 2PY6A 1ZC4A 2L17A 4YBRA 1NYRA 2HUPA 2GCIA 1RUC3 2BJSA 2XR1A 3NC4A 1G2IA 1E0AA 2G72A 3TW8B 5F5IA 4KODA 1WV1A 4O0LA 4BMYA 1N4DA 3VKMA 4ZONA 2VZUA 2QLFA 2ZPTX 1EZZA 2QVXX 4D9FA 5DOZA 2ORED 4XUOA 1CVNA 3RSSA 3GI1A 4AP6A 2PS9A 1IVSA 1EQAA 2HUNA 1BJQA 1FRZA 3A6HA 4R1QA 2QF7A 4I55F 4OXKA 1HRI2 1XF9A 2EX4A 3HA7A 1W99A 2FSIA 2PKWA 1Z6XA 3ETDA 4J7CA 4ABYA 1YS1X 2XZOA 1OQ1A 3KUUA 2I74A 2OB1A 3LCRA 3CJIC 1NP6A 5F37A 1IDN1 1YZYA 5A70A 4D43A 3JZIA 3AKSA 1ZH2A 2ETEA 1LRLA 1JNYA 1X2EA 1MX1A 4YMSA 4NIGA 1T2FA 4JVMA 1W2WB 2OY0A 2DAPA 2C5AA 2LTNA 3TPZA 2EF0A 3L8ZA 2EG5A 4M00A 4RDCA 3S30A 1QTIA 1VGRA 3CVJA 2CHGA 5LY1A 1SWVA 3GGCA 4KNVA 4A3ZA 4GMXA 4TKVB 3WSTA 3O4VA 2NVOA 4JGZA 5LR6A 2Q0HA 2EV9A 1HZZA 4XFKA 4RJTA 1X7HA 4S05A 4QSMA 2ZTNA 4AKIA 3FLTA 4KNCA 4RTPA 3QPWA 1E8MA 4PTZA 4EARA 5T64A 1G291 2FQ1A 3DNMA 3G9ZA 2O4UX 5DCYA 3D6FA 3DZIA 5BWOA 4D42A 4OYLA 2F90A 2I4TA 3LW8A 2R8BA 1OU4A 2QFEA 1CUWA 4JI2B 3SNHA 1PFVA 3L7CA 3H1GA 2QROA 3IXLA 1EI9A 4HDNA 1WLCA 4RKFA 1OXVA 1RKUA 3KSMA 2VT2A 4JKIA 1TNFA 3H05A 4FOTA 3H7JA 3NT2A 3LKBA 1XCJA 2GZSA 3E9YA 3LQFA 5D7BA 1I7PA 2W42A 3AJZA 5B4TA 2DXIA 4X44A 3DOUA 4UNSA 4WNAA 1SCSA 4MGZE 4MS3A 5LK5A 2BEVA 3WDWA 3MIEA 3HXOA 2GH8A 3SCGA 1UM8A 1KP2A 4H59A 4B8EA 4NEQA 1K6XA 1QYDA 3JD3A 1HDOA 3KQOA 1U98A 3WP1B 5FLKA 4JI8B 3ME2A 2W83A 3ZX5A 4GMDA 3NNGA 1VQ1A 4GGOA 1STOA 4Y1ZA 3G8CA 4I6JA 3RNOA 3G0CA 3RF6A 1Q44A 3E9NA 5H8WA 2X5IA 2BI4A 4WXHA 1KDPA 3DEKA 1YBAA 3WCRA 2BZSA 4XE5A 2DF7A 2H7XA 2VRCD 2GN9A 3P5SA 1RLMA 2ZSJA 5L95A 4C0JA 2W48A 4KQ2A 4E09A 1BKZA 2WINB 1ULFA 4AYTA 1NTOA 4ZQIA 3NWEA 1UYPA 3GUYA 2FPXA 3N8KA 4BWVA 4CEYA 1JYVA 3OPZA 3TZQA 1P9RA 1V7PC 4DIDA 4N01A 1ZUIA 5JDBA 4CCMA 2UUCB 4DQKA 3DB2A 4CXXA 2YZ7A 4DADA 1V43A 4Q34A 4CUAA 1JQ5A 2XB9A 1N1DA 2HA2A 5BMOA 1E4OA 1RZRA 5E6RB 3P7MA 1ENYA 3T1NA 2JIZD 5EHZA 5JT1A 4OG2A 1UJMA 1LK5A 3K73O 2OZJA 3IC5A 4NZYA 2WIKA 3VOAA 3RRFA 4GKYA 2FPOA 4MO2A 4XF9A 3UB3A 2QB5A 1OQEA 1WB4A 1ISPA 1JA1A 1T1SA 3EGVA 4HUQB 3C7DB 3LP6A 2BEKA 3L2YA 1JUDA 3QUTA 1KMIY 4P5PA 1H3EA 3H4TA 1NI4A 3QXHA 1POQA 3JU9A 4LLFA 1M34E 3V7NA 3POSA 2JIJA 1XKLA 2AOWA 5BV8A 1DEKA 2V3CC 1GADO 3CNBA 2QVZX 4FFMA 4YQYA 1A8HA 1VMKA 1N3QA 1UP4A 2WA3A 2C5EA 1WS6A 1GY8A 1Q3HA 2V8OA 4OAQA 3W7AA 9MHTA 3ENVA 2HV8A 4IRUB 5DX8A 3GROA 3S2ZA 3AETA 1IN5A 1U6JA 2E89A 2WM9B 4JMLA 4XJVA 1FFAA 5GONB 1M83A 4J0KA 1ZZ7A 1RKVA 2QMHA 2PLV1 1WVIA 1VMHA 2QNRA 2B94A 3GLHA 1VJDA 3UCEA 3ELUA 2QQWA 3LVBA 5LP6F 1RWVA 3I0ZA 3ETNA 3PD0A 3WS7A 4F2DA 5CVEA 2ETXA 1K1EA 2ERXA 2WRZA 2BDTA 2D6MA 1A9XB 3BM5A 4RHV3 3R4SA 1XWFA 4H18A 4S2HA 1QC5B 5EIOA 3WGZA 2ID4A 4J94A 5LA9A 2F1IA 5C8YF 4CU5A 5A4DA 5ED0A 2VPIA 1HE2A 1N9GA 3MNFA 4Z7NB 4HN9A 1IXZA 4ISQA 1MRSA 1Z2DA 2OLEA 1U7UA 3GCGA 1KY2A 4PGFA 1T4DA 3NAMA 1H2FA 1ULHA 5CXSA 1YMVA 4QYWA 2DSTA 3JATB 1LBIA 3KWLA 3H83A 3JZDA 4YI3A 4W5RA 5DHSA 2ZEXA 3V1YA 1T3GA 1WULS 4XFDA 3MQ4A 3BHMA 3JPYA 4F2PA 3GDWA 4TLDA 4IE7A 1YYNA 1K75A 3L9XA 1DQZA 1D4M1 1MORA 3Q7TA 5A6VA 3BUSA 4ESEA 5J9FA 4RABA 4AY3A 1US2A 1YK0A 1ZPDA 1RWMA 4FVVA 3MFAA 2Z69A 3QPDA 4AZWA 1X9TA 3NR2A 3W5SA 1X13A 2Z6QA 3OECA 1Z7S2 2PN5A 3RC7A 2X0NA 5FR3A 3D7RA 4W8GA 1NVXQ 4LEIA 3A70A 1FDVA 3WMXA 1K8XB 3IJEB 1Z12A 4D0SA 1DKLA 1U5YA 1BMTA 4PAGA 4W8OA 5D6OA 1C0LA 1O5TA 2IDJA 4MHOA 3I9KA 2MJLA 1E5LA 4YRSA 2Z4RA 4GUDA 2WWWA 5IVKA 1U0OC 1DJQA 4FX2A 1CXZA 1X3LA 4Y2GA 3D4LA 4URVR 3X43A 1C1HA 1GTG1 5HI0A 4JI7B 4MCIA 1TAUA 5IK2A 2LKDA 3FCXA 2H31A 2GCOA 4HQ0A 2JH8A 4A2QA 3BCRA 1LBEA 2VD7A 5EZSA 3JQRA 5D8AA 2ZE6A 1HDKA 4JRAA 1VSQA 2WSIA 4KE8A 3IE0A 4BKOA 4JYAB 1O6CA 1CRWG 1ULAA 1AR73 4J1WA 5FQNA 3KGZA 3V33A 4YXWD 2AJ8A 3GLFA 3P2EA 3RVMA 1EG7A 3K15A 3BIWE 4J6EA 4NU6A 4K6CA 3TTTA 2JK0A 1TCAA 3TBFA 1N32B 4EPRA 4A3SA 3F1LA 4TYMA 1YFWA 4L74A 3GU3A 4BMDA 3ZBUA 3MRSA 4AL9A 2CMGA 1WOYA 3EDMA 4YNBA 5J47A 2YYYA 4FIDA 4BQWA 1MPXA 3JQDA 3AR6A 3SSNA 1ZM9A 2W2OA 2X0FA 4HDAA 4CV3A 2PXXA 4DLLA 1QO0A 4FINA 1ZYBA 1VAKA 1HIXA 3G5TA 3MBWA 4IEWA 3TQCA 1S2LA 2FD8A 3PCTA 1IONA 2BBOA 1XZQA 4DXRA 1SBFA 3H8XA 3R8CA 4G0VA 5IK5A 3C3YA 3HJAA 1T34A 2R1TB 1EX6A 4PRKA 1E3JA 3HDHA 4MO3M 5I7RA 1HEIA 3QPBA 1IMOA 3I5XA 2P2GA 1IOZA 1GDDA 2YDYA 3KZCA 2HFJA 3I3BA 1ZJJA 3P9YA 3O1TA 4D6PA 4CIDA 2NYAA 6CHYA 2VW2A 3NT4A 1BYIA 4B3XA 1XA3A 2OPBA 2CMKA 3HHEA 2IPOA 3T1YB 4FE7A 5FMBA 2E4WA 4FQ4A 2VF8A 2WIJA 4C88A 2XWBF 1KK3A 3M0EA 1IM8A 2XAUA 3RTBA 5GLUA 3OX2A 2IYZA 3DS8A 2GJ9A 3T4VA 1VC2A 4ON9A 4AWBA 1V4BA 3LOUA 2OFOA 1X15A 1JQJC 3V46A 3NDJA 1AH2A 2JDID 1PYOA 5H16A 1CB7A 2QAGA 4TQ9A 2JKXA 1JZ6A 4LNVA 2C4TA 3JQCA 1XL1A 3NRUA 4RJIA 3T3DA 4Q18A 1Z45A 4XFBA 4LOJA 5ADVA 4N9HA 4AL4A 3T6KA 3JW8A 5SYMA 2WZR2 4NR0A 5F3RA 2VUUA 4MVJG 5CBLA 1D0VA 5H9WA 2V7XA 3QH7A 2H2FA 1YHFA 1PTJC 3GHHA 3C2UA 4HAIA 1DQ1A 1X74A 2PMDA 4L2NA 5K8TA 4ME6A 1WUJS 4Q0VA 4K6KA 3Q1KA 4XTCS 5I51A 3PYMA 3WSVA 3VNRA 3WP5A 1F9KA 2IVJA 4KMQA 2QL5A 1TD1A 4EB8A 2N75A 2O7NA 1G5HA 4UPVA 4CL0A 2EFGA 1E2FA 4CKYA 4ATEA 3H9JA 1UJNA 1Z26A 3ZWQA 4QX2A 2V4MA 3HL4A 1BHO1 3K1JA 1M75A 2AR6A 2IEYA 1HRDA 3D0OA 4IH9A 1L7QA 2IFWA 4WZCA 1KVTA 1SBHA 5DGDA 3QSGA 3RVOA 4OBWA 3ZWBA 3MVEA 4EGFA 1B14A 1PT8A 3WQBA 1SVUA 3ZDEA 2ZE5A 1VSVA 3H9BA 1E0KA 1E2DA 2QRHA 4K9LA 4Q4LA 1AXZA 4RKEA 1DQRA 1G3QA 3WEZA 3RWOA 2HSZA 2WT2A 3UETA 5DI3A 4WVMA 4Y5SA 1P8JA 5HKLA 4R9DA 1N8SA 4BS9A 2FHPA 3O2QB 4NOMA 2IU6A 5FZAA 4WM7B 4RVOA 3ZEIA 4ZIRA 3NUQA 1A7JA 4FXKB 4FBGA 4P4SA 4AAXA 2H1RA 2GK7A 1ADBA 5AVUA 2D7FA 3OCZA 1U2PA 4OJQA 4AEJA 1SKBA 2JIQA 4O8CA 2HNKA 2Q46A 3A27A 3TIIA 3FUWA 2MTBA 2LM3A 1QS0B 2VHTA 3L4EA 2ATEA 3IQWA 5BR1A 4UFIA 1V1MA 4JOCA 2IA5A 4Z1VA 1QHXA 4MA4A 1VBD3 3ORJA 2GO1A 2OP0A 1S3IA 1IE3A 2Z6UA 1XRPA 2C04A 5FZOA 3JRXA 4NAVA 3PNYA 2WF7A 1HG0A 3CH4B 2OCLA 4O4HA 1OC2A 1TEZA 3OY8B 1B6GA 4BVBA 5AM3A 4MQFB 3PHBE 1UL1X 5J1SB 4ANFA 1GG9A 4EY6A 5IMSA 4RXTA 1N2CA 2HLPA 1NQAO 1U04A 1SNYA 4F1WA 2C5BA 2QXTA 1W6QA 4J2OA 1DG1G 4FMDF 5K0BA 4JSRA 1JHVA 3H97A 1KAOA 3IAHA 5JDCC 2VYND 3G23A 5JOWA 4MW1A 3OTGA 3TEWA 3PVCA 1IQUA 4AQSA 4B4WA 3CHXA 5CX1A 2BR5A 4KE6A 3EJKA 2XJ4A 4CG2A 5DUVA 4FPFA 5B7GA 2F1HA 1R4AA 4REQA 1OD5A 4GH4A 3ITEA 3OT1B 4TKUA 1C1XA 3NTUA 4I55B 5GIOE 5CA1F 3UW3A 3LSDA 2WIAA 4OJYA 2B5WA 1JQDA 3WGHA 1MS9A 2L69A 4Q3EA 5JASA 4FOVA 3PEYA 4R40A 3EMDA 1KQFA 2CLFB 3EY9A 4G5QA 1N0UA 3UUEA 1N3OA 1UFVA 1OXBB 2RSLA 3CW2A 1X7XB 2VP6A 4BFCA 2RB4A 3PFHA 3BH0A 5LPNA 1EYZA 2DTDA 2O5EA 3OBBA 4MV3A 4ZYZA 2VT7A 1K4YA 1GQHA 3IAPA 1A34A 3BCSA 4OUDA 2R0HA 2Z98A 4NKRA 3GALA 2ZUCA 4TGLA 4UBLA 2W43A 5TNXA 5IBRA 3IELA 3MMSA 4WXRA 4C6RA 4WKOA 4GPD1 4CF5A 5BV2P 1KH3A 4RETA 4C06A 3QLQA 1ND2A 3AHFA 1M5UA 3X1YA 3M83A 3BWMA 4G2TA 3ZDXB 1MS0A 5LD2B 2P5UA 3FMOB 1RLUA 4X1IA 2W92A 5DZSA 2D13A 4OQ9A 2Z8YA 1OBOA 2C83A 1M8JA 4KN5A 1UQXA 4HQFA 2XUGA 3G0GA 2RS11 4C6TA 4QLOA 3VSCA 3I32A 1TZKA 2IP4A 1X1SA 1ECFA 3VSEA 1JVSA 5EWSA 4QNRA 3D8TA 2B7YA 4KO2S 1DQ6A 4DMUB 4FPYA 3LXUX 2ARKA 2PVCA 1U65A 1H1LB 3D64A 2XJTA 5BNWA 1ODNA 2VXBA 1ZRNA 4QULA 2PLRA 4FEYA 3BK2A 1PG0A 4A27A 2PX4A 3ACGA 2OZVA 2VNHA 2UAGA 3K5PA 4S1OA 5TGDA 1G63A 2PX5A 4YP0A 2EGGA 3J9SA 3GD7A 3HFSA 4L0QA 3ZW9A 1VAMA 3FYUB 4BNZA 4NMMA 3CBGA 2I07B 2QV7A 1IZ7A 2Q4DA 1LV8A 4YMLA 1GQQA 1Z4KA 1NYLA 2DM6A 2HRQA 5EIAA 3NMUF 4KKVA 5JYCA 2PKRA 3W20A 3ZBPA 4UE3S 2VCYA 3C3EA 2C9KA 2XXJA 3ZV5A 5CFMA 1UANA 2JEZA 3HO8A 4CXWA 3DAOA 2B4TO 2DVFA 3I3DA 5IAVA 5JRDS 4S1TA 4N8DA 5ALFA 1XVAA 3VKNA 3TD6A 1S9DA 5IVYA 3AILA 2WYWA 1FX0A 1M5RA 3LWCA 2PX8A 2PQ0A 3WZMA 1Y9ZA 3WHIA 5CNAA 3MDPA 4FGLA 1X1BA 4LC9A 4BKPA 2FPRA 4X7BA 3RBVA 1FUUA 5LD2C 4CT0A 1R9JA 1FMLA 3WGMA 2WAOA 1W5FA 3PDCA 4CF6A 3L43A 2QVGA 3P9IA 3L07A 4O5AA 2CSXA 1LFAA 2O1QA 1Y1TA 3IS3A 3KQPA 3K0AA 3IEKA 3W21A 4QFMA 1IK6A 5C9ZA 1OLUB 4KO8A 3SC6A 4BATA 2P3SA 2X58A 2GAFA 4AZ3A 1AD2A 1K6EA 2ZSHA 4A8JA 1I6KA 2GYUA 1A76A 2ZTSA 4MXWB 3EVGA 2IEIA 3PD1A 3HKEB 2V0GA 5L9BA 2YIVX 2ZUWA 2EOAA 3CJXA 3M9LA 5T6BA 4RN5A 1F6WA 1H8TA 3FE5A 2ODEA 1P4JA 4FPLA 2HA7A 1D4ZA 1EXVA 1NW6A 1U2RA 3W8NA 3L5OA 4XB2A 3AJYA 2R32A 4QQOA 5LP6B 5E7QA 4A15A 1YVUA 1A9RA 3FYUC 4LHVA 2R1ZA 4PHZA 4HK4A 3IOYA 4B5KA 3PUHA 4BRZA 3WGUA 4QBTA 4KQFA 2C5DA 4G2NA 4F2GA 5LOVA 4META 4IBOA 4AVBA 1G66A 1GQOA 4N82A 1BKSB 3EYAA 2WMDA 4KPYA 4HTFA 3KE8A 4ARZB 2YJZA 4IW3B 1T6YA 2VMDA 1EAMA 3RUHA 5JSFA 3MB5A 4EKEA 2XKKA 3PVZA 4IICA 3FSRA 4B4UA 1OYWA 3SS8A 5EZYB 1UP6A 1OFGA 1KFUL 3MCVA 2DCUA 4BASA 4O2AB 2NZVG 3LWNA 4Y2TA 2ES3A 2B99A 2IZ6A 3TBDA 2WSMA 2R1UA 4F06A 2RGXA 1X86B 1FU4A 1P7ZA 5JCOC 3EXHB 3KKLA 2VQ3A 5KNBH 3A36A 2Y1DA 4KH0A 1FI2A 2OYSA 3KKNA 1U9IC 2G1UA 1EUDA 2WNOA 4IVNA 2GPYA 3PJQA 1S5PA 4HDSA 5MHTA 1O4YA 3G7DA 3WW2A 3DPSA 3IDAA 3NTRA 4YAJA 5ALMA 3VO1A 2HLHA 1BJTA 2ODNA 1LBQA 1IN8A 4PS0A 3BMNA 3JAWA 2EAAA 3HKDB 2Y0OA 4B3BA 1YQ8A 4HAXA 1QGZA 3AVVA 2CJWB 2VAUA 2G9RA 4B34A 1M7HA 1PSZA 2E21A 3HR7A 3RIXA 3G9UA 2AOTB 3EUAA 4AN0A 4BNWA 3CLRD 1HETA 4UCQA 3A3OA 1OX4A 2WB2A 5AP9A 3DKRA 3R8XA 4EDHA 1REFA 5LP6C 1B26A 2ZWVA 4YCLA 5TJHA 1LPSA 4M7RA 2QW1A 1PGW2 3L1UA 1UJ2A 4J3FA 1WZIA 2GPAA 2HLNA 4BP8A 4EEXA 2ZHLA 1ZXBA 3B1XA 5I9TA 3DHWC 4CM9A 2E53A 4ARBA 4GOKA 3ASYA 3G82C 2R6FA 4KDCA 4CDWB 3LOIA 2GLUA 2C42A 4L15A 5CU1A 4AS1A 4RLFA 3RIHA 1JLRA 3RWBA 4QAWA 5AUPB 5JMTA 4EJSA 3B9QA 2GDJA 1BBT1 1E1YA 4XAAA 3DNFA 3EIQA 3PIDA 4D9KA 1CW2B 1PR0A 2BI7A 2GBIA 4N3NA 4CEJA 2VZ3A 4CMKA 5A4FS 1H8VA 2JVJA 2WYSA 3GNLA 4J03A 4TVBA 1YQUA 4OVKA 3OVMA 3AU9A 2HRCA 2RONA 1JH5A 4S35A 3RVJA 2XQIA 4BEWA 3W5HA 1SZCA 4MGSA 2ZJAA 3ZY3A 1AUQA 5FMOS 5A32B 4IKPA 2FUKA 4E9KA 3E81A 1AKYA 3Q5GA 4DWJA 5A0VA 4XUGB 2RGDA 4Z9AA 3EXHC 3DMGA 2ZRBA 2FKNA 1G3UA 5BSTA 2WWFA 1CP3A 4KWJA 2X3YA 2FK8A 4JJZA 1BGXT 4R98A 4DDWA 5IJ0A 4UOJA 4EUHA 1KO1A 2J5RA 4ZOBA 4WLVA 3T5CA 3H2KA 1JWAB 5DK4A 1SGWA 5H82A 2YICA 4PIZA 4EYGA 2YWJA 3ZSEA 2YCLA 3GFBA 4FJ1A 1SXIA 4AUMA 3R7AA 3FDIA 3KPVA 3A7QA 1P1CA 1Z6YA 4FLEA 4E4HA 2O1EA 9GPBA 3STVA 4JAAA 3ZN6B 5LY2A 1MA3A 4WDQA 1UL9A 4U9IS 4KLRA 2DPXA 4RIIA 3PUQA 2D7JA 3THYA 2P7HA 3M3CA 1SULA 5AH0A 4D3DA 3OPQA 4I0WB 3ROFA 5FZKA 1UAAA 3U5TA 4G1BA 4C03A 4GSYA 1XFAA 1F35A 1EWVA 1VBFA 3OQOA 4DQDA 2XWBB 1NBMA 1OI3A 3D6EA 5ALEA 5DK6A 2FWNA 1HOTA 1YIAA 5K4GA 4R1UA 5EHGA 4RZHA 3WXMA 1QOPB 4YCAA 4YECA 1V6KA 2AYHA 4XA8A 1GGMA 2Z0MA 2QTVB 4GPAA 2YW9A 4QKNA 2FPIB 2VA8A 4XF0A 2PKQO 3E97A 3D3WB 1SD5A 3K4DA 4NROA 2JJ2A 3HNYM 4CIVA 1E32A 3LK7A 2CFTA 4LUMA 3VBFB 5CHYA 5HV0A 5T4FA 3TAXA 3P52A 3WGTA 5AHKA 2RVAA 1V00A 4LF6B 2X0JA 2W0MA 1ZFNA 4CM5A 5L4SA 1ISRA 2QW0X 1NXTA 1DQYA 1W7AA 3TEMA 4B4OA 1YDGA 2CXUA 4RVSA 2GEJA 1VBE2 4FXGB 4PQEA 4EHIA 4C1WA 3QKUA 3DUFA 4A0SA 1O4ZA 2RDSA 4MVCA 1HGXA 2I7TA 4YG6A 4MPDA 3R7WA 1SIBE 4I1RA 3H16A 1NRWA 1KF0A 1PX3A 1NE4A 1J2JA 1W0PA 4E5MA 4C43A 4KLAA 1IEXA 4LRYA 2PH7A 1UWVA 4NHMA 2H4XA 2VPPA 2PMFA 4IAOA 4R0NA 4YRKA 1IWOA 3E3LA 1WKBA 5ARBA 3E8SA 4TLEA 1KO7A 2GTIA 3P9PA 4P1ZA 4NRDA 4GXLA 3GDFA 3TXXA 1QOOA 1MZFA 3HH8A 4U3JA 4WZAA 5JXWA 3FPGA 1TZJA 1E77A 2NUTA 1HURA 1QEXA 2FSUA 4FWIB 5LB6A 4QYIA 1XEXB 3F7NA 3C7AA 2PVSA 1EX9A 3JAKB 2CMHA 2CNKA 2BEWB 3ZXYA 1ZO8A 5G4KA 4COZA 3QKTA 2FG5A 4XWYA 1RPJA 5JE8A 2UWCA 5BNFA 2PT5A 2ZROA 4XASA 4LF9B 2CXSA 5D3MB 3EPLA 3NBYC 5DYIA 3SKVA 4KWEA 3BMOB 1O97D 3JCIA 4MB2A 2EJWA 3IB3A 3DQPA 4Q4CA 4ZP1A 3IQHX 5IVBA 1BC5A 4FSJA 2WUDA 3SVTA 3OLCX 5GONF 5IDYA 3AVWA 3B93A 1HYHA 3M4NA 3SMVA 1SMVA 1SPPB 2DOKA 2PQ6A 5KI6A 3TB6A 4N0EA 2J41A 2MOKA 1OA2A 2OQVA 3WGVA 5TQ0A 4AQDA 2FJ0A 3BGWA 3F8TA 4YJ3A 2ZOSA 1ANKA 1D6NA 1FXUA 1QDUA 5ISLA 3NTXA 2D3SA 3ETQA 4KRYA 2RDQA 4QYSA 1CE8A 3DBRA 4EN6B 1XZDA 3VBFC 1EFKA 1KS2A 2ZRNA 3C45A 4KNWA 3E9QA 3Q9LA 5SY6A 4Y6GB 3J7LA 4RTNA 5KKNB 4GT1A 5ARDA 3MIHA 5JJIA 5CNJA 4TS1A 3CEHA 4Q3NA 4YAGA 2GBFA 3A10A 1AR93 3IHKA 2PUGA 4PX9A 3QX9A 1J1ZA 1Q91A 1XG5A 4OMUA 1I6XA 1GVHA 3RGGA 4HWGA 5DB4A 1ZIDA 2H08A 4S2GA 3WOGA 2RE8A 4CLHA 4BLTA 1WE2A 1ZH4A 1I2AA 4YV1A 4JNCA 1C4OA 1EUQA 1Y8QA 4FMDB 2VOWA 3HNPA 2EXHA 3NRBA 1AO0A 4YRPA 2IBSA 2P5SA 4QBHA 4ZO7A 2ZPXA 3V00A 2WT1A 4XETA 2XUQA 2AG6A 4JZKA 1ZX1A 4W6WA 5FY8A 4CHTA 1WD3A 3PQ4A 4O1IA 1PFUA 1RUH3 1P5FA 2VXYA 2BBVA 3RDIA 1AXRA 4MVJH 2BFDA 3K09C 5HRUA 1F2UB 3DV8A 5CA1B 1QNLA 2MSEB 221PA 2JZCA 3NV2A 3KOMA 4U4AA 5IM4F 3LA8A 5JIAA 2FVYA 4PIYA 5BW8A 2VPVA 3ZE6A 4PEVA 2HF7A 2AFIA 3TO5A 2YGLA 4LHNA 3B48A 2NP0A 4XGNA 2A6ZA 4PC1A 4F4UA 4MOWA 4EFLA 1MABA 3HGTA 3I2IA 2AXNA 3QF7A 1YSCA 1MH9A 4E2SA 4IS2A 5LZ2A 4AHWA 3SVZA 1M0SA 1NA1B 5KHOC 4PRZA 3F3YA 5DTRA 3SDBA 1XE0A 2I8AA 4NE9A 3JWEA 3OTOB 4X6YA 2R9VA 4BFLA 4MGQA 1K2VN 1BYHA 5KTPA 1CQIB 4J9UE 1PN3A 2VTBB 4Z9BA 5EXOA 4LXIA 1L6RA 5CM8B 2CL0X 3ONNA 4MHTA 2HB6A 1GFSA 1QYWA 2Y1CA 2FW0A 5CIRA 5E6HA 4FYIA 4PG5A 1PJAA 3GNEA 3F5QA 5AXCA 1BD3A 1YJ5A 1J8YF 2WTEA 3E1SA 4D9MA 1J58A 5JEDA 3QJYA 1QP4A 3BSWA 5HK8A 4BWGA 3PQ3A 3NOXA 4MA5A 4QPCA 2NAPA 5IARA 2CFSA 3D6TB 3G2HA 3LBIA 2QJVA 5TPWB 3CWZA 4XM0A 4MUVA 2ZI6A 5JAUA 1JEOA 3JQWA 5ALXA 1TME1 3IUYA 5K6AC 4EHHA 1YE8A 4DZRA 3DP9A 4DJDC 3MWDB 3APBA 3D3AA 1ARZA 5HGJA 3IFSA 1REQB 4XFGA 1XRSB 4JGYA 2P9YA 2VWPA 4X3PA 3OBIA 2GRUA 3F4KA 1KDVA 1PQ4A 1ID1A 2X8JA 1TCUA 5GV7A 3PNKA 4MW2A 2PNJA 2DQ4A 2ZZNA 1LSOA 2F64A 4BRSA 2C9OA 4PZEA 3WLOA 3F9IA 5ALLA 4JI5B 1M7GA 4GKXA 3G6WA 1DKPA 2AFHA 1P1IA 1OH8A 1QVAA 2OV4A 3DMYA 3AWIA 1OAAA 4ZS2A 4A03A 5I7EA 2ET7A 1W3XA 2GBLC 2C4UA 3H0OA 3HQRA 1PSWA 4DLPA 4C7VA 2CBZA 1RHJA 5L7YA 3NTQA 1GOGA 1UOFA 4YG0A 3BJZA 4ZCPA 4A45A 5IKMA 2A0UA 3WWCA 4FSXA 5L3SA 2F9LA 4CDQB 3KQLA 5DSXA 3ZYPA 2R44A 3U9SA 4FPCA 2QR5A 1G20A 5DBFA 2OQ2A 4H6WA 4CR8A 2H3HA 1ZKDA 3P2IA 2DYCA 1DAPA 4PICA 5HF8A 3S70A 1YRYE 1RAEA 3FMFA 4P9YA 3CRNA 2I7VA 3CLUD 3T5PA 4ISBA 3I3EA 2O3TA 1UMHA 1LULA 2CUZA