4K9SA

Peptidoglycan o-acetylesterase in action, setmet
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 110
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k9sA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k9sA01
1YZFA 4TX1A 1ES9A 2WABA 5B5SA 3PT5A 3DT9A 4NRDA 1ESCA 3SLRA 3C1UA 4DEVA 2Q0QA 4OAPA 1DEOA 1ESEA 1FXWA 3DT8A 4Q9AA 4RW0A 4K40A 1J00A 2Q0SA 3DC7A 4M8KA 1VJGA 2O14A 3KVNA 1PP4A 4HF7A 2APJA 1V2GA 4PPYA 3U37A 1DEXA 1FXWF 4XVHA 3P94A 1IVNA 5HOEA 4K3UA 1U8UA 4S1PA 4JGGA 4K7JA 1WABA 4RSHA 4OAOA 3DT6A 2WAOA 3RJTA 4Q7QA 2W9XA 5CD9A 1JRLA 4JHLA 1Z8HA 3BZWA 1ZMBA 4H08A 2WAAA 1BWQA 4JJ4A 1BWPA 3SKVA 4JJ6A 4HYQA 5BN1A 1ESDA 1K7CA 4LHSA 4IYJA 4JKOA 3HP4A 3MILA 3W7VA 2VPTA 4I8IA 2HSJA 5A4AA 5JD3A 3DCIA 1VYHA 4K9SA 1BWRA
chains in the Genus database with same CATH superfamily
1JHAA 1GQYA 1QORA 3NTOA 1LV7A 1B23P 3F9CA 1Z28A 2HMSA 1CZHA 3IELA 1FTQA 2R44A 2AR7A 5CT6A 1HRI1 3E3NA 3UWOA 5BOVA 3CZAA 3LYHA 4Q4JA 2V7PA 5TEWA 4OGGA 2XMPA 3FOBA 1H6DA 5DN9A 4E4YA 3CM0A 1DGWA 4M53A 4LXYA 1V9U3 3GOHA 5DSZA 1FPN2 2XYPA 1KAOA 5ALJA 4BV3A 4RV4A 2CGEA 3CE9A 3HPNA 4EA9A 1PU2A 2HNBA 2Q9BA 2AUMA 2XDAA 2B45X 2HNAA 4MQ6A 4LOAA 5CD9A 1RUJ1 1P61B 2R8XA 5AM0A 2NU9A 1XTQA 4P9XA 4C5AA 4HQLA 5B7NA 1I4TD 4Q1VA 1V0AA 2H1FA 3FPEA 4K6GA 1PEYA 1O58A 1NXTA 4X6RB 2XONA 2VOEA 4LKOA 3TJMA 4HOOA 1KH2A 4DV4B 5LA9A 2AHRA 3DTVA 1KNXA 3O93A 1U1IA 3KV9A 3FHIB 1OX6A 1M2NA 3OZTA 1OT5A 2VZQA 1PGNA 2A59A 1UMCA 2FJ0A 3H8SA 4FP9A 3QMPA 4W8JA 1JHOA 4ITCA 1ZJYA 1AR82 3ASYA 1YZQA 1ZWKA 2RBKA 1G98A 2ONKA 5C5DA 5JZVA 5GJ6A 4UOJA 1PBNA 1T5BA 5TQ2A 3VI3B 1Z6ZA 4JWTA 3FG9A 4YT5A 3BQ9A 5IDYA 1X9PA 1L4YA 2Q28A 4R01A 4NMWA 5LUAA 5H81A 3ZR5A 3ZO0B 1NDUA 5HF5A 1QLJA 4RTPA 3H5VA 1U31A 1KI4A 3CX4A 2Y1OA 4RHV3 5E2AA 1CQIB 1NUAA 3F0TA 1SQ0A 1T1JA 2ARAA 4DC9A 1ZZ9A 4LBOA 1T2AA 3OUTA 1KJYA 1AB5A 2ZJ7A 1V41E 3VTFA 4I1VA 3MWJA 1F5SA 5L3QA 1GLNA 1MF7A 4BIIA 4PZUA 1DX6A 2WS91 1C7FA 3WZ2A 5JAXA 2QZJA 4UBLA 4KZPA 2FUKA 2BR3A 2OHOA 4EROA 2BIFA 3EZLA 4O5AA 1GLGA 1AS0A 5F1YA 5D3QA 5JXJA 4DR7B 4AURA 1DBIA 4I1UA 2Z42A 4RVUA 3ILSA 3WIDA 1DBVO 1TVCA 1JHRA 4FDLA 4GQIA 2V96A 4A7YA 5F52A 3WIEA 1GTSA 1BH2A 4IWNA 3WYEA 3GGDA 3CINA 4YGEA 4PYJA 3TB4A 4YUZA 1OXBB 3PXXA 3SZUA 2WT8A 1V1JA 3TKAA 4NWWA 5A05A 3FFZA 2YWXA 1U2ZA 1U7HA 3TTTA 4ZPXA 4EG8A 3VKMA 1BLZA 1R4AA 5FTTC 2HA2A 2DWUA 1JHNA 3UA3A 2XUAA 2D98A 3WCRA 3OF5A 4GMKA 5LMNB 3ORSA 1RZRD 3TTVA 4YCBA 4UTNA 3NTQA 5K6RA 4I50F 5E3HA 1KL7A 2BRUC 5IFPA 1HLFA 1QK5A 1VRH1 4B4PA 3CVUA 3VDDC 2QL6A 1YULA 4M0DA 2HLPA 4ZZ5A 3T4EA 4IYJA 1SUCA 3RWMB 1C30A 4TMYA 1QF6A 1SELA 1ZISA 4EZBA 4OQQA 5G02A 1H6AA 1HYEA 4YRRA 2W2IA 1KQFA 4LWPA 3EMRA 1EZZA 1HT2E 4EMUA 1GKUB 1URPA 3JQ9C 5ITSA 3W20A 3CHYA 2H92A 3W6UA 3SY8A 2C20A 3E61A 3PMSA 1ZH8A 1T4CA 2Q5IA 5E6SA 4DCJA 1TZKA 5CVRA 1XRPA 2ZEWA 3FYSA 2WFZA 4RZHA 2MINA 1BEZA 4OQEA 2B1JA 4CDGA 1SDDB 4TLAA 3OD4A 5F77A 1SWVA 4W6QA 3JRNA 3G9QA 1STMA 1Z63A 1JR3D 5EP3A 2BDUA 4KFRA 1TDJA 5KEIA 3RBZA 4ZCLA 4XWGA 3BB1A 3PGXA 3ZTWA 1I4OA 2OK7A 5FMOL 3RU9A 1DBPA 1NNI1 1NF3A 2EBUA 2BEVB 3LC7O 1YGPA 4H60A 2WIFA 3ONNA 4EECA 5E9QA 2P2GA 1V37A 3I0ZA 1IN4A 5E6UA 3WUDA 3AM1A 3WI7A 2UXBB 2AG0A 4QWNA 5J1SB 4UVHA 3H7YA 3I9MA 1S3GA 1B8NA 3WNQA 2CDRA 9ABPA 1JIIA 4OQ9A 4Z3KA 5KMGB 1F31A 3ZVNA 1QHHA 4K86A 3FWYA 4PDWC 4RAOA 3S28A 4Q2FA 2O6LA 3KV3O 2Y1FA 2H11A 3HY4A 1PHPA 1QYVA 2C1ZA 1A4XA 3KOMA 3E6CC 2Q3MA 1PT7A 4ZOLA 3OPYA 4OXXA 2QV7A 5K0UC 1DZ3A 1NYQA 2N46A 1MIOB 3EC1A 2ZGKA 1GRQA 1E1LA 3LHFA 1GMMA 1AL21 2BE7A 3ATGA 3MRXA 5KB3A 4M7WA 3N7JA 3EMBA 3N5CA 1TF2A 4JEHA 2A0YA 4I08A 4HJRA 2Y0CA 3DTVD 2RE9A 1QVWA 3KZ1E 3QA9A 4WM8A 2BFPA 1QLWA 1N5DA 4ZGGA 3SFZA 3ZSMA 2NXNA 1ZMTA 3SIPA 3VBEA 1PFUA 3X3HA 3T3HA 5EESA 2VBFA 3MPBA 3OFVA 3HQ4O 2W4QA 1WD5A 4N0EA 3Q7PA 3OGSA 5L9VA 1GZ3A 3UMFA 2GBLC 2QJVA 1NHGA 1VBD2 3TFOA 4KBFA 1WE2A 3SXUB 3H04A 4LE0A 2QE3A 1CEYA 1YB2A 2A86A 4H7LA 2WLTA 3W78A 5AI0A 2UY8A 4M8SA 4HR7A 4B0PA 3O1MA 2QS9A 2BM8A 4EQ6A 4A6XA 5LOVF 2ZRFA 2RK3A 2VK1A 3ONVA 4NAUA 2R061 1USUA 4HQ0A 2XDWA 1NUSA 4JR1A 1OF4A 4JI6B 1J21A 3MUFA 1OKKD 4OFXA 1O97C 2VG8A 3QX3A 3LI2A 4NHXA 1QO0A 3ZY2A 3OJXA 4XB6B 5FP3A 3V1KA 3NWPA 1GA6A 3IAS1 3WXMA 4MYSA 4BZWA 5FLHA 3OIUA 2QQPA 3GIWA 2ODQA 4PS0A 4WY2A 4H4DA 4YJ3A 3M6VA 5L19A 2IU4A 1HNWB 3IUPA 1PWHA 5AXCA 1ZCJA 3UMGA 4JGBA 4QRIA 4J25A 5DM0A 5FOWA 1TIKA 2Q8OA 4HWSA 4LHEA 1FT9A 1EGAA 2HDNB 3DV9A 3J9SA 3KB1A 3NAPC 4FFFA 4UCQA 3CN9A 4D45A 2R0HA 2OV2A 3EOZA 5AKGA 4ZREA 4YS6A 1W4AA 5JSUA 1LOGA 4CF4A 1LS6A 2SICE 4D4HA 4U2KA 4L5BA 5B58C 3MHTA 5AD1A 3D7MA 3OLZA 1XHLA 1DG3A 5LCXA 5IVYA 1JG3A 1IHXA 3I59B 1FSGA 4NU8X 5IN4A 2P9GA 3JQ7B 2XNJA 1JXMA 3WGYA 3R9XA 4S05A 3F8TA 3LL7A 3W5CA 1MOSA 4TL6A 4C4OA 1FPMA 2HDHA 3DBVO 2GF2A 5BNOA 1E9VA 4HHEA 4HDMA 4LOIA 3N2ZB 4LJ6A 5JROA 2WFF3 1EYZA 5C9AA 5JXGA 2ZRJA 1E3MA 1A9ZA 4KPUB 1AMNA 3F8WA 4KQJA 5AVOA 2UWCA 4EHKA 4HTFA 4M98A 3TB0A 1V1MB 4RLHA 1UBGA 5GOTA 1U9JA 4TUYB 1TYDE 4XIJA 4R9DA 3MW3A 1R0ZA 3QELB 1DOHA 4O1HA 1JYFA 1WXHA 3RF7A 1WCDJ 1UC4B 1ML4A 4QC2A 4HH4A 3Q6IA 3FCSB 2YV5A 5CD1A 3RYIA 1IU9A 3UJPA 4B7ZA 4FZVA 1WW3A 2MYTA 4WK2B 3MT0A 1AK9A 3ABSB 2WR9A 2Y60A 1XYVA 4GLOA 2RIPA 1IBLB 1OTHA 2NU9B 1V2GA 5D1NA 3U9TA 3ZD9A 1SBHA 4RIIA 2Q6KA 2Q21A 1W25A 1RUG2 3R8XA 1GVHA 3ILNA 1ULGA 3ZE1B 3EY4A 4DPMA 1REDA 1LF0A 1F48A 4Y9UA 1M34E 3S3TA 4QVGA 2IUTA 3G2MA 5JD4A 1OI7A 2XF8A 1HV8A 2EVXA 5T5QA 2C59A 1QVAA 4NCAA 4R98A 4DPNA 2J87A 1LC3A 2PEZA 3GT4A 1DUSA 3WOHA 1P9NA 5CU1A 2PU5A 3K05A 4TYMA 2RAVA 4K26A 2JCBA 4EFLA 1TMF1 2X0KA 5B64A 4IIVA 2MEV1 5FWAA 2YYAA 3K0BA 4N43A 4UMEA 1BU8A 3WB1A 2FN8A 5FOVA 4C6TA 3MW2A 4DRVA 3REOA 3W2TA 4IHKA 3EVZA 1K5HA 4G85A 1G42A 3P26A 4A36A 1FE8A 1K4MA 1L5VA 4UC0A 3ZWWA 1GQFA 2DFNA 3THXB 4LYJA 2M1ZA 6YASA 3VBFB 4BB9A 2JRLA 4PC1A 3H3LA 4AL9A 3WG1A 1RUD3 5ALKA 3E9ZA 3VHPA 3CC8A 1YKSA 3PSHA 1Q0TA 3LOUA 2GRAA 3KKMA 1Z7S3 1MENA 1Q17A 1NVBA 3VU1A 3DZIA 2ZIEA 4NBKA 4X1KB 5BUZA 2C5SA 1NLMA 3ZD7A 4P82A 3URFA 2XVYA 4QG3A 2VDOB 1HK7A 2I4OA 4EAQA 5IDXA 3M5PA 5E8JA 3KSRA 3T34A 1G5TA 2GM4A 2E1RA 4YALA 2AVNA 1T3TA 3CBGA 3TN7A 3QFFA 3DKWA 1J9EA 3VNRA 2HBYA 4HZGA 3BD7A 3FZYA 4YV2A 2MSEB 2H16A 2CLHB 1V6SA 1AL22 1E9SA 3AUAA 2LTNA 2XMLA 2RB5A 1PQUA 1DJNA 4BKMA 4HQOA 5IYZF 4IUYA 4A6EA 1X9HA 1XXLA 1KO4A 5ERXA 1B35B 2Y8EA 1Z2AA 3CUUA 1R6VA 3WJ7A 3ONWA 4CIBA 2H65A 2BBTA 1F8FA 5IJ9B 4MI6A 4COOA 2ZM6B 3WLQA 5J3JA 4CVUA 2PJUA 1OH3A 1NAEA 2G25A 2OUJA 3V0BA 5KIAA 3IPYA 3EXG1 5EWJB 3DVSX 4ZYVA 1U4NA 4LJHA 4C3UA 1W39A 1MA0A 2D62A 3PV0A 1AH2A 4IFIA 1VBA1 2GCPA 2BOJA 1NVTA 2X40A 4YBZA 2PKEA 2CGPA 1C3HA 1DQ0A 1USVA 4AGVA 5EJGA 4QX6A 4LXTA 4J29A 4LISA 5I0RA 1TQ2A 5E6SB 2WHXA 2ZHKA 1QPGA 5KX5A 3H7AA 1XEFA 3UANA 2Q4BA 3AV0B 2O0LA 1VIAA 2BGKA 2EW1A 3OOYA 1GNYA 3A9VA 3NCTA 2XMDA 3N58A 3E5NA 5C0OE 4BXOA 1N9GB 2Y1EA 5LC1A 1C4XA 3HCAA 3C3CA 2O9JA 2ATXA 4XRGA 2B3TA 2AN9A 5FMBA 4IDAA 2BEVA 3RVDA 4M0LA 5BN3A 2ZKLA 2HJHA 5F51A 4RESA 2CYBA 2Y1CA 3AOEC 3AEXA 3AILA 3L8GA 4MPTA 4NBSA 3FTFA 1K4KA 2EC5A 1YJ8A 3FNFA 1KK1A 3VDQA 3R4UA 1EFLA 4MYRA 3ZH2A 3D5QA 4CN9A 1IL0A 3DP7A 2P4QA 4PLTA 4RDIA 3B6EA 5H4HA 1VCMA 5IVHA 4Z9AA 2G0AA 2VAXA 4PIYA 1QHIA 3LT1A 3AXTA 3HEBA 3VQTA 3IXMA 4IDOA 3WQHA 6CHYA 1O5IA 4EAAA 4HDKB 4WUTA 5FXZA 3S99A 4J1XA 5C8XA 4FW8A 4GXRA 2WTUA 3P9CA 1JHYA 3WGTA 5EFZA 3NVMB 4UVIA 2AC2A 1CPMA 1Q12A 3E6AA 4YZ1A 4AVSA 4R83A 4CU6A 4MA0A 2J85A 2JA1A 4HFSA 1GXSB 4DIQA 2ZOEB 4JKIA 3IJPA 4CP2A 3ZCTA 5K9ZA 3WLRA 4YZ2A 4F06A 4HL0A 6REQB 5HS4A 5TC4A 5K9YA 3F78A 2PCJA 4H7KA 3KOOA 2Y99A 1SOMA 3KLMX 4XVQA 5FL7A 5ACA3 2IHYA 4E46A 2VT7A 4P35A 1C8KA 2AMYA 2OL4A 3ID6C 4DA0A 2VUTA 4UM5A 3WRYA 3CJRA 4TLCA 5H3HA 4BJ5A 5FYYA 1Y1KE 4R1TA 1TW3A 2VP2A 1YA8A 3ESAA 5C7IO 1OZAA 3VPCA 3IEMA 3OE1A 4ASKA 3HMQA 4F92B 5AKZA 5EJAA 1YFWA 3TSYA 3MS7A 2XTZA 2V74B 2CV2A 2G40A 2QY6A 3GT7A 4H35A 2NAPA 5J1XA 4RGVA 3H13A 3BCWA 2MHCA 4EMTA 4L9SA 1GUFA 2B8EA 1T43A 2R751 1TU3A 3WAKA 2YN0A 3ZYJB 3KAPA 3MN1A 1UJCA 2AKYA 1XU9A 1AGXA 2XWSA 3OY2A 1QX4A 3ZLUA 3WDTA 4C3ZA 3VD5A 3COSA 4K40A 1PQPA 3K9CA 3ORYA 5C4WC 1V47A 2I3ZA 1EVJA 2JLCA 4A5OA 4Z2YA 2CFRA 3WV4A 4A1OA 3BTXA 2WM8A 3HBFA 5D8AA 2ODWA 1H1LA 4PANA 4L4YA 1KI8A 1GQGA 3ZXLA 2PLV1 2B8MA 2YRXA 4BQ3A 1RUD2 4C7MA 2RJKA 2JD2A 3LHIA 2RDSA 3UYKA 1U02A 3ZHCA 5D00A 4TYYA 4WWHA 1YLLA 4AVTA 3EZ7A 4L15A 4RADA 3SF8A 4MG2A 5L3SA 3GY0A 1DV1A 3VJRA 1QV6A 1P33A 5ADWA 5AHOA 3ZHTA 1PF7E 1RAFA 1CUWA 5JCOC 4LF9B 5L73A 2P2ZA 4IV3A 3HJUA 4IOMA 4XASA 5E4JA 1GKIA 5DAVA 2IHBA 1M7BA 1TRHA 2HV8A 1ZGGA 2QVYX 3LXXA 3I0NA 1HMYA 2E4WA 4H0NA 2H4FA 5ILQA 3HZRA 2OSVA 2DT8A 2R30A 4M21A 4H3WA 4M8LA 4XSVA 3M8KA 5KSWB 3L4KA 3A1CA 3FWKA 3JZFA 4C1XA 3B38A 4ZP1A 2QTZA 5EEHA 3NORA 1RZ3A 3B7GA 4GYWA 2ECOA 3WQSB 2JJ6A 3BL8A 3TX2A 2Q7XA 1IEXA 4MDFA 3DLHA 2I22A 1CPNA 1VBMA 4OGLA 5DGDA 2F43A 4YLZA 4FYKA 1E5XA 4PPYA 3RZZA 2BGUA 4LRYA 2BGMA 2H8GA 5CX1B 3BYZA 3WGOA 4BQIA 3HR7A 4MWCA 4CN8A 2ZS9A 3SSAA 3ELBA 3V1NA 4CDQB 3TRFA 4V3CA 2RJ3A 3MIBA 2FN7A 1FQOA 5F5XA 1UH5A 3LSDA 2ZTHA 1DAFA 1VHTA 3BB3A 4ZTUB 4W7IA 4H6PA 4UUPA 3CNOA 2XZOA 2ZZNA 3QSYA 1PO23 2R7NA 3P97A 2NVUA 2FWNA 2WVHA 5A9SB 1EA7A 1MX9A 3B5EA 1SURA 1GSHA 2H1HA 4DEVA 4WRRA 5B2GB 3TLZA 4BIOA 3TQTA 2N47A 4LLOA 5EP1A 3WTBA 3DSRA 4AY3A 3HBMA 4B4QA 2HADA 1FDIA 3RAJA 1PJZA 4W5JA 5E1MA 2WKRA 1TTTA 3FUUA 1CR1A 5ECYA 1G7YA 3GLTA 2BVNA 4ZQCB 1TFRA 2FK8A 1CJTC 1WUIS 3G13A 5EL0A 5EEGA 3BIWA 3GQBA 2IEBA 1LENA 4DUZB 3HUUA 2RK4A 2J5QA 3TSCA 5HA5A 3FJYA 4R9SA 1AR61 1XNGA 4XH9B 3KR0A 4CHTA 1GOFA 4UW4A 3IQDB 1B1AA 5CT4A 3ZTTA 1KP2A 4X91A 3SD7A 1H2YA 4YAGA 3L8YA 3KOUA 2O8DA 3ZYZA 2CBZA 2WU3A 2ENRA 2VULA 1PK8A 4OXYA 2PL3A 5F3IA 3KB5A 4EG4A 1EDZA 1H4SA 4D0RA 2IC1A 1BDMA 1B41A 1JXNA 1W99A 1AUPA 4ND3A 4YNIA 3IH5A 3VBUA 2P6RA 5L4SA 1CUCA 1R5JA 4EH1A 1DARA 5K6AA 1M83A 2ZB3A 4LMPA 4G4SO 1PSZA 1C29B 1KMNA 3OJLA 4K9OA 2DHQA 3NXKA 3UFXA 4AICA 4B0OA 4J9VA 3VOBA 2VDWA 1NBMD 4RHXA 5H9WA 2ACVA 1TX4B 1G4HA 4X65B 3L6RA 5FUQA 5EYPA 3WWOA 3I7DA 5F76A 2R2GA 5FOJB 2JI4A 4X64B 4MGKE 4YAOA 4JKYA 2WIKA 3VU0A 2GBLA 2PXAA 3ZIWA 2BOIA 1AX9A 1QO7A 2GC3A 1W8DA 1AR92 3T9CA 3MAGA 2H5EA 2IEDA 1CR2A 4AT1A 4CMAA 4HANA 4DQLA 4CKWA 4COYA 2AUTA 4LT5A 4HYYA 4TVOA 4GPAA 3T5PA 1TAQA 4N0PA 1ID1A 1L5NA 4KK3A 5DMYA 3KLNA 4OGWA 4H15A 4S2FA 4ZI2A 4GWLA 4RS4A 1QIJA 5JZBA 1KBZA 1RVF2 2BGCA 2ATEA 1F1BA 5HYVA 1PK6B 3F3YA 1T1EA 2VHVA 1DGRA 1H2LA 5F9TA 1AC5A 1ULFA 3IE0A 1QJX3 4IETA 1JDNA 3HCRA 2GKOA 1KC3A 3GJ4A 7REQA 3RVMA 1E8NA 2FV8A 2XCUA 1GL6A 3TN92 1TEXA 1S8OA 5FIUA 3VVBA 3VH3A 3H75A 2PHTA 3HM2A 1N36B 2AN5A 5K01A 3AL3A 1UJMA 2VBBA 3KCNA 1ZZ8A 2ET1A 2HJGA 3KKEA 3LOBA 4EFDA 4KITB 3KF5A 4ED9A 2O8CB 1EBBA 3P8ZA 5JZGC 2IUEA 4U6NA 2QU8A 2VTEA 3OCZA 1JB9A 1A8HA 2OZ6A 1CX1A 1US3A 3FPFA 5EHZA 2ARXA 1E5SA 1QQTA 1WMFA 5A6YA 4AF8A 2AYHA 4N8SA 1SLBA 2B5WA 1A04A 4E5DA 4P7BA 4CYDA 3ACCA 3AVOA 3L79A 3DOOA 5EJEA 4Z99A 3Q7EA 4FOLA 1BXGA 2CYFA 3DEKA 3U61B 1U2QA 3BGDA 5JSYA 5EJ1B 3J8F1 1UF2C 3UXEA 1CQ9A 3L0BA 2IU6A 4M00A 1ZD4A 3ZHVA 3O73A 4YV1A 2PD6A 4N8EA 2DTEA 4DBLC 2PGIA 1JNYA 3ZY5A 1HRV2 1J8QA 4QHSA 1EJBA 1X3LA 3L49A 3ZVRA 3VVMA 2D2IA 4PWZA 5EUBA 5BOSA 2VSNA 3B6JA 3SPXA 3OT1A 1J3QA 1ZUD1 1G19A 4DVJA 1UMZA 5LVAA 1AQ6A 3NONA 3BDAA 4LVUA 2CLCX 5JXHA 3QACA 4M3CB 3FHJA 1K8YB 4Q4HB 3I64A 2HQSA 3ZSJA 2XXAA 1WRBA 3IQFA 3DZJA 4P9IA 1NZFA 3NETA 2ZUSA 3RS9A 2YS7A 3RRYA 2GZWA 4MGIR 2Z9DA 1G55A 2OD7A 2XIQA 2XTNA 3RYHA 3E48A 3E84A 4F6LA 3T0GA 4BGUA 4E6PA 2IYVA 3VGPA 4NH4A 1NUPA 4XIOA 1N6OA 3MTIA 3ROZA 4ZIRA 1JSZA 1VL6A 4IEPA 1KZYC 4LYAA 4ER5A 2CU5A 3JZVA 3D31A 2NZWA 4XTRA 2WVJA 4E4DX 1USKA 3GN1A 2LW8A 3H9BA 4RL6A 1ZMOA 2P35A 4XVHA 1Z82A 4CCDA 5IULC 1KARA 1NGSA 4LYDA 1JLRA 3KJHA 5FWJA 3A1TA 3TZCA 3PNMA 2GFHA 3PUYA 1CETA 3UZUA 3CJQA 2BLNA 2AN4A 1XZPA 3MPPG 2VTXA 1YNOA 4MGQA 3OETA 4O63O 1OGIA 4MS1B 5B58T 4Q4W1 4FT4A 4B17A 4FVVA 5IM4F 2H18A 4KFTA 2Z5VA 3EB9A 2UWAA 1FMD2 1W90A 2VZLA 4H1TA 1UANA 5CBPB 2XX3A 5CNKA 3JVDA 2OYZA 2JGAA 5HVNA 2SKCA 4QARA 5FREA 3KEQA 4WBNA 1OSNA 4D56A 4PONA 3VH2A 3ZIAD 3DD1A 4BNDA 2GPWA 2AC7A 4LHVA 4V1CI 2FK7A 1GFWA 2X1MA 1ST8A 3OB8A 2IW3A 5L3SB 3KZNA 5NULA 5ALIA 4PTLA 1AR62 3AMHA 4V0RA 2HK9A 4Q3CA 2AREA 3S2ZA 3UT5A 2JD0A 1JQAA 3DW3X 4AK3A 2CY6A 1WSBA 5LD2B 1JXOA 4M3NA 3HO6A 3NUGA 2P6CA 1H2HA 2WAAA 1EEXB 5AUQA 5JXWA 1OT3A 3PGA1 2IF0A 3AFKA 3RADC 2VDLB 1UMHA 2CGOA 4FI9A 4L07A 4J1SA 5LWBA 1R6DA 1JS1X 1GNQA 5EIHA 3CPEA 2I4MA 3ROXA 4J6GA 1W0JA 4P81A 3W5AA 3O1PA 1J2UA 4D2IA 1PJSA 1W1WA 5HQ3B 4Q7JB 3I6BA 3HXPA 1P1BA 1INLA 4TMFA 1D6SA 1BE1A 4BCCA 1V43A 3DE6X 1CD3G 1Z6TA 3L82B 1KFCB 1TC1A 3BE6A 4C7BA 3FMGA 3SKYA 2Q3BA 1E4YA 3WNCA 4OLHA 1W06A 3VBRB 3T15A 1WMSA 4MR7B 4OUDA 3QW2A 2X7JA 5HKKD 5CX1A 4IHAA 1UZNA 1KXZA 2YWCA 2GBFA 1LBEA 4LK6A 4AMUA 5DABA 4EJFA 1CJPA 4D3DA 3KQTA 3MUNA 3FFAA 1Q15A 4IL7A 4FHZA 3WA7A 2AHOA 5KQSA 2QUZA 3GAMA 1IRIA 3LY5A 3IE2A 3U1BA 1SA0A 5IBQA 1NLFA 4D0QA 4UFOA 3GT3A 1U5BA 3JALA 4OMCA 2HU8A 1WKVA 2XUDA 2X86A 1WEKA 3UAGA 4QHTA 5F98A 5AVKA 1LAJA 4QPWA 3ETPA 3AR4A 4MR9B 1NJFA 1DAGA 1JLLA 3IP8A 2W2TA 2ZS7A 4OQ8A 3JBG1 1P4JA 2F3UA 3W7BA 5ES4B 3SEAA 2AE1A 4ORFA 2G04A 4Z0NA 3S2SA 1E89A 3LY8A 3NP9A 4TYQA 1PGL2 1DC8A 3GOQA 3TFWA 3WZ1A 3SHTA 1AR93 4LUMA 3A1WA 1JHPA 3WIOA 5EJ5A 5IJ0A 5DTRA 1X7YB 3DPRB 1BEV3 2JIOA 3LBNA 4F60A 1O6UA 5JCOA 1XJWA 2C0CA 5LQMA 3USUA 2BBVA 4G1BA 1TM7E 4J4BA 4RUKA 3B2EA 1EHYA 2H29A 4ABYA 4ZTBA 3OQNA 2YHBA 4F2DA 2A73B 1S2GA 5FOXA 2J0UB 3JD73 4R6WA 2OCBA 4R4ZA 4MS4A 2FHPA 5SICE 1E3SA 1QJEA 4R1NA 1SZPA 3D43A 1NMSA 2WJPA 3KU1A 3PXGA 4Q4X3 4IS3A 3NNJA 5DISB 4OQMA 1BXKA 3OEAA 4MVJA 2R11A 2YXEA 3WNLA 3L6CA 3PVZA 4PQGA 4GB33 3WYDA 3EQ8A 4JLPA 4J7CA 5JPNB 3WK9A 3VBSA 4OJMX 3IBYA 3KDPA 4WKPA 5D7BA 2PX6A 5JMWA 3TLJA 2B39A 4Z1VA 1UU5A 4KRXA 4QXMA 3R4DB 1R37A 5K3DA 3I4CA 3D7SA 4LX8A 5FPXA 4YRTA 4LC9A 3N2NA 3S29A 2YY7A 5BVGB 1CRWG 1I2BA 1CEQA 4J07A 2DE0X 2C3MA 3OTOB 2RG1A 5J48A 2I8AA 2P9CA 4RZIA 4P84A 4UHBA 3R23A 4EWLA 4CDXB 2QQNA 2R6GA 1H6YA 4ZO8A 1JAYA 2PYZA 1BHGA 3PFBA 5IT6A 4HUQA 1AF9A 4H59A 4UF0A 4XVUA 1UOEA 4FI3C 3UUGA 4L28A 1NCQA 4MI1A 3MLAA 3A9UA 3N0XA 1Q44A 1ABFA 5GZEA 4BVJA 2SECE 2Q9UA 5J4VA 3S0JA 2PGJA 3M33A 2QKDA 1JU3A 3SC2A 4HVRA 4RDHA 3PTRB 1C7RA 1DTWA 3EDOA 3AXSA 3NYRA 3K70D 1PK6A 2WWFA 9LDBA 2WU0A 2ZBGA 4KKXB 4CLXA 5JAOA 3P2IA 3EW9A 2A71A 3WAJA 5ALWA 2IFRA 1PUIA 3N7UA 4F7DA 4IGIA 1L3CA 4TTGA 3OD5A 4B6RA 3RTGA 1N1SA 3BA6A 3ZK7A 4KBGA 3NRUA 2OHXA 1CZKA 1CNEA 2GT1A 2HWE3 2E26A 2J3EA 3MJRA 1DLJA 4OHWA 1JWAB 3I5YA 3BVPA 3WGQA 1WCSA 4ZC8A 1BU5A 2RGXA 1DYOA 5KVAA 1WCYA 4P9WA 3RZJA 4XEUA 3PHGA 4PZLA 4U63A 4BFTA 1ZXBA 2I66A 1WTCA 3IXQA 5G0UA 1K6JA 3WW3A 4U3JA 4CPDA 3PX3A 4R0MA 3ESDA 2DU1A 4G07A 1U8XX 5B2ZA 2JAHA 3I1IA 4RLFA 2XECA 5A3QA 1BDJA 5EQJB 3W8RA 2B8NA 1E2BA 1Q83A 1N1DA 4TT3A 1BXGB 3SIWA 1O59A 3WS7A 4DADA 3E7XA 4X41A 2LKCA 1EWKA 1TYEB 1A34A 2PR7A 1E2MA 2FLVA 1T6GC 4UREA 3PC8A 1F4PA 4UBMA 2QMHA 3ZN6A 3OT1B 4F8EA 5FY8A 1YUNA 4WEQA 1QTRA 4CMCA 2O2CA 2VBDA 2PZLA 5DYTA 1MZ5A 2C6SA 4EY7A 1XQNA 5K4HA 3ZUPA 1POV3 2R7EB 1OFNA 3AR7A 5JQGF 1Y1PA 2JVJA 3SWWA 4PR0A 3GGGA 3K1JA 3LRXA 3PF8A 2GD0A 4KHPB 4A8TA 4RQPA 1YAHA 4FYXA 1VB2A 3NJZA 2VMCA 1GZDA 2XR4A 1V7ZA 2JATA 5L9AA 5LM3A 3O3NB 3FPKA 3JQAA 5CH3A 3O0XA 2C00A 3D4KA 2CVHA 3ZWKA 1YJLA 2A3NA 1QIFA 5DZGA 3TOJA 3G8YA 2A6WA 2YFKA 1ORRA 4PNZA 2ZR7A 4IZOA 3K9FC 4HMPA 2VAVA 1SC9A 1T5SA 1WBDA 1N2GA 1U0TA 4IKEA 1Y81A 3TI7A 4MV2A 1LD3A 5EE5B 3WP5A 2OG1A 2V5UA 5D1HA 1GPWB 4Y1RB 5I9MA 3PCXA 1SXHA 4A6SA 1QWSA 2VJNA 3UMJA 2C8JA 4MIOA 4WOPA 1RKXA 4Z2AA 1KEZA 1FSFA 4ZOQI 1CQZA 1E7WA 4K1YA 4MKFA 3WKCA 4XQWA 3AU8A 4A1FA 3QHPA 1KZ6A 3CVWA 3UC9A 3UJNA 1B35C 4TTSA 2H1WA 4EGFA 1Q1AA 1NBEA 3H1GA 4HRXA 5FNVF 4DY5A 4GWKA 4LY0A 4LFBB 3MCWA 3AYDA 1GGEA 1NQTA 1SACA 5ESDA 1N0UA 3M5CA 3HFJA 4ARSA 1M5RA 3KUXA 3GH3A 5CCBA 4QD3A 3AUJB 5ED0A 4PC6A 1E0SA 1G9BA 3IRVA 3GBFA 4LYGA 5HF6A 3LUHA 1WB9A 1ACJA 2J45A 2JIDA 4RMGA 2VF2A 1KYZA 4YW4A 5K45A 3TR0A 2I45A 3QF4B 5GZCA 3R3UA 3Q9UA 3QVTA 1PTJC 5CIQA 2W43A 5FZDA 4C4PA 2JFHA 1DZRA 4AHWA 4DY4A 4HXFB 3D5OA 1XRQA 3NBQA 4B6SA 4KEAA 1HFEL 3EBLA 5DGHA 2BPOA 2WIDA 3NOVA 2KWIA 1YWKA 4JI0B 4BMYA 4DLNA 3ABIA 2EJTA 1EP9A 1CC1S 5EZQA 1P4RA 2PZMA 5I7OA 4RKYA 1ZGJA 3GC6A 1GOGA 3BL5A 5FV4A 1T8PA 3CONA 2QTFA 4JFRA 4DM7A 2F8MA 1Z68A 1C57A 3ND8A 4I8XA 2VKQA 3FMIA 3HP4A 5KJ1A 2IOQA 4AF6A 1GGKA 2CXQA 4FWIB 1JSRA 3C7CB 2ZGLA 1IZ9A 1FFGA 4O2BA 5KREA 2X5JO 3TLGA 1SIOA 2PKXA 1E4EA 2HXSA 4A2WA 4LHXA 5LMCA 1MEJA 1WXFA 2HQRA 3NDPA 3BRWA 1W6PB 4DRZA 1M1YA 2RCYA 4DDKA 4P0PB 2A88A 3RGWS 2Q5TA 3QKRA 1PJBA 2WFF1 1V8FA 5T4EA 3D7NA 3PT9A 2YR0A 2LP4Y 2VRWA 2XKOA 2YUEA 2E0IA 3GFSA 4Z0TA 4ZEOA 1HQCA 1X13A 2QTTA 3ZFFC 2DVFA 2Z69A 4MWBA 5DIFA 2PHXA 1SA0B 1W4BA 1SKYE 3HKDB 4CCCA 2BWCA 1IAQA 3BPZA 1U5BB 4G09A 3FRHA 5LDDC 3STUA 1ZC4A 4QODA 1C1XB 1TECE 2GBGA 3CCCA 3BQMB 1YFXA 2GDFA 4A10A 1J20A 1LGCA 1Z26A 3HYLA 5AJUA 4Q0UA 2O7NA 2GLUA 2W83A 2BSXA 2SKEA 4R9NA 5HZKA 3CLTC 1UQRA 1FTSA 2J6CA 1LDMA 5A3OA 3DL7A 1LOEA 4LW8A 3E70C 4TRMA 4BFZA 2BQPA 3QUBA 3T54A 3VR6D 5J7MA 1I01A 1OKOA 1G6HA 4HDQB 3VDCA 5ALNA 1KAEA 2XCOA 2AN3A 1MABB 1N77A 1QDEA 5U4QA 2GCGA 2K87A 3RASA 4EN9B 4PG7A 3SC4A 3HA3A 4N12A 4BEVA 4EABA 5BSMA 3EZXA 4G0WA 2ZSEA 1O5TA 4EL0A 1NV8A 1G86A 1LEMA 2CXRA 1B8UA 4NF2A 3H6GA 1RUC3 3ZKUA 5L53A 1E0JA 1IOZA 5K0UB 3M3OA 3O7WA 2OQIA 4KC0A 4BBPA 4EUSA 2LZ0A 1EVEA 3H2HA 4RSHA 1CX9B 1X1AA 5LBIA 1GNTA 1O6GA 1E18A 3RDPA 3MTGA 4PTZA 1E6KA 4D44A 4IJQA 1SFRA 5DHUA 3HI4A 4DJTA 3FVRA 5E9WA 1VJDA 1ZGHA 2RIRA 3DYVA 3LPMA 3PQ8A 4CQMD 1QFJA 4C90A 4QE3A 4L9BA 5J5VA 2GSYA 1YMVA 1L4UA 3IHWA 3IIJA 3R9IA 4EY5A 1O94C 1J5XA 5K8CA 2PQSA 4TYNA 3BSSA 4Z8XA 4K0KB 4KQWA 1RIRA 3NNFA 1WCV1 2NLOA 1GT6A 1ENOA 3N3HA 3R09A 2OO5C 2K7FA 1P5ZB 4M0UA 2RK6A 3UMCA 4HN1A 2A6PA 4BMOB 1JBCA 1S2IA 3IERA 3MELA 4TV9A 1E2EA 2QD4A 2XRZA 2KSQA 3TX6A 3E6DA 3ITEA 2HWWA 3DHYA 5ES3A 3M8LA 3BN6A 4DXAA 2IHJA 4FFVA 2QZPA 2P4HX 1WBBA 4HMQA 4E12A 4J7XA 1IOLA 1KI6A 5CYGA 3WC4A 2DJ5A 2WYVA 1D1PA 2PSHA 1DQNA 5AIAA 3T0BA 1PR4A 3RUHA 1AYM2 2X4LA 4S1WA 1OLSB 5EVCA 5KJ6A 3MHPA 4CEYA 1Y3DE 2Q8NA 1P9RA 1NL3A 5SZHB 1EFDN 1BBT1 3NBMA 1FQJA 1KY3A 3ER6A 3GBPA 3UMVA 3RSHA 1CUSA 1GGVA 3UGKA 4OQZA 4G0ZA 1FLDA 4HDAA 3KKPA 3GFPA 3CURA 3JARA 2GKGA 2LS6A 5LQCA 5DWQA 2ZSBA 2J8ZA 3REGA 3NX4A 4MLZA 2NWQA 2JD4A 2R6CA 1AZSC 5KYXA 1EB8A 2OT7A 1KS9A 4QKDA 3AZWA 1TTQB 3NM6B 3W5HA 2XOXA 3FPSA 1CVLA 2SBTA 1B42A 2OQ6A 1ZLYA 3WAGA 2DX7A 2QBXA 2BZDA 2QLNA 2AL7A 2O06A 5FP9A 3OA0A 4RHEA 4AJNA 1RW4A 2WFLA 3V00A 3U09A 3KKLA 2AZTA 4NESA 1QIQA 4YG6A 4BFCA 2VCAA 1E1DA 3SICE 4ZMBA 1VKHA 4E11A 3QWBA 2CW5A 2HHAA 2D5IA 1X80B 3NYQA 4Q9LA 3SR0A 1WS6A 1OF3A 2UYBA 3G85A 2O5RA 5K99A 2FYTA 4ZN6A 1RYHA 1X7DA 4XUCA 4D1YA 1L7BA 4DXSA 3C85A 4UNPA 16PKA 4CDXC 1XZFA 4EY6A 5IANA 2XLAA 3ILFA 2J7PD 2ILMA 2I4RA 1KK2A 3TL2A 4LF8B 5D3ZA 3EVCA 4KAXA 4OUSA 1RCTE 4GSYA 5JAQA 2WNSA 1CRLA 2Y77A 4KG8A 2C2KA 4HKLA 4I30A 1J00A 3BIOA 3DBRA 4LBMA 7YASA 4FYWA 1RUI1 3SYNA 2FRVA 2VBCA 1X9TA 4L2IB 1IHYA 2H51A 2YPDA 1N2IA 3MICA 2C1EA 1Z22A 1O03A 3TOXA 2QX7A 3FIUA 1VRCA 3SEQA 2XUIA 2XB9A 1Z34A 3L7MA 3KYDB 3NGXA 2XJTA 3LUCA 1SOVA 1ZX5A 1R4MA 2GESA 3W7AA 4AQSA 1KRWA 3IMFA 4JGZC 5K6TA 2OTCA 1RHRA 2QUHA 2A0KA 3WLMA 4L95C 3T3YA 4KXMA 4Q26A 1LDBA 3AETA 5CVVA 3ZK8A 5B4VA 2G4CA 2PXJA 5IC4A 3PIJA 3W5JA 1FV3A 1BX0A 3R7AA 4GKJB 3BK1A 1C81A 4YRZA 2D44A 3OZSA 2AMJA 1JIQA 5LQRA 3EXEA 3QUAA 1CP2A 3DNMA 2IXEA 2PTHA 2BGPA 2IXKA 3ETNA 4I55A 1XUOA 4HNGA 4KV9A 5LDHA 1WCWA 1STOA 1O3RA 3ZNNA 1B16A 4ES6A 2XJRA 3HKEB 3DXFA 4YQZA 3GO4A 4JX0A 4W9NA 3BT7A 3ZGVA 1RC0A 4KQMA 3JQ6A 1LJ7A 1PR2A 1SQGA 1IVSA 2CZQA 2JKZA 4CXMA 4H0CA 5JVDF 3MBWA 5AICA 5DK6A 4X9XA 1OFHA 5FO9B 1FBTA 3ZE2B 4A91A 1RKVA 5FZOB 4NH0A 3F9IA 5YASA 4I1YA 1SMKA 1F5FA 2UZIR 3J81A 2VT2A 2QQEA 4KBYA 1K8XB 1KAHA 3FLTA 1YBMA 4NDAA 1OMIA 2G5CA 2W2LD 2J1RA 1VJCA 3EAGA 4IJUA 1SEPA 5BNNB 5AKXA 4MO2A 4HT1T 1OOPA 1PT9A 2HBQA 2BDRA 1BFKA 3A3PA 4B3SB 4W5WA 2WIAA 3UA4A 4O61A 3HEIA 2VAUA 3VZLA 3DV2A 3NDJA 4J3FA 3ROFA 2WNEA 3ZSKA 1RAHA 3ZSEA 4R8HA 5KCMA 1IQPA 3OEHD 1VB5A 4X8OA 1OC2A 1BJRE 2ZI9A 3EIEA 2FJPA 1UKVY 4Q0MA 3L0DA 2EXJA 4TTQA 2JEOA 1UT8A 1O4ZA 2J0VA 5EJ6A 3DV0B 1RRKA 4CG2A 3E97A 5LZ4A 1GPYA 2FEKA 2YZ7A 3ZR6A 1AX1A 2A3RA 3ZPYA 4NK4A 3ZLBA 4B3CA 1Z83A 1Z74A 2FF5A 2QW0X 5L7OA 2QK4A 4B4WA 4HJXA 3EBPA 4J0IA 5FPSA 3M3EA 4Y1ZA 2YVQA 3L8MA 3X29B 5BN1A 4GA9A 3MSXA 5C7YA 2VUCA 1S0BA 5KQMA 1P5FA 1MEC3 3ICWA 5LD2C 3L1JA 4YJ3F 1HTBA 4DCNA 3NEAA 4GUAA 5IW0A 3DFZA 1HF3A 1T36B 5C5TA 4I9FA 2C24A 2Y0OA 2HD4A 4KSYA 1V2HE 4G0PA 1BKSB 3CF4A 2HL6A 4ZT5A 3GYDA 4OXQA 5LBFA 3B3QE 1FU7A 3CVJA 2KHZA 5FLKA 3QWIA 5LPNA 3MCTA 2PXXA 4C0LA 2C4WA 5JAIA 4LFAB 5GOZA 4G5YA 2PY6A 4FK8A 4B80A 3RLFA 3U19A 1X9GA 3LZ6A 3MLKA 4AVBA 4ILEA 1K4YA 2P1BA 2QVCA 2CVZA 3OPMA 1N3IA 3FGOA 1DGLA 2WZBA 5BV2P 5DTJA 1Q0QA 3AI7A 2H7VA 4I9GA 1IBRA 4IGFA 3HCBA 4S2EA 4TQGA 4BUJA 1NPDA 3ZIDA 4PBSA 1EHCA 3FRJA 5DHAA 3UL2A 3OCYA 4CIDA 2E4XA 1MVEA 1N7JA 5CYPA 5AW7A 1KZ1A 4TQAA 1H42A 1PJ4A 2DUQA 4H1WA 4F4IA 1ILWA 5EERA 2QJFA 2HHLA 2PX0A 3CH6A 3KFVA 2C98A 2Q7OE 1X6VA 4XX0B 2NZ2A 2ODEA 4MUBA 1XWIA 2NNLD 5JIUA 4QPGC 4RIHA 1NOIA 3RSLA 3QX9A 1I1OA 1RQNA 3BU7A 3WHIA 1E9DA 3R5XA 1ACMA 3VU3A 2FSHA 3PPYA 2WP0A 3LFHA 3EWIA 2GAAA 3KQHA 4MV8A 1KSGA 4A0QA 2SBAA 1A4IA 1Z0DA 3RIGA 1NY5A 3DR5A 4Q12A 3UWPA 1RIFA 3IMNA 1DG9A 5FZFA 1CD5A 4YJHB 2LTAA 3LLUA 2VJPA 4NPRA 2WSMA 4I50A 1XDDA 2IIPA 1TUEA 3N7AA 3EDYA 3MMNA 4BQNA 5JECA 3SN6A 3L8ZA 4HMZA 2RHHA 2C2MA 2MINB 2PJZA 4B4VA 4NWVA 3ZE9A 5TRTA 4FQZA 2ZI7A 1Y8RB 1FJHA 2FMFA 2O2DA 4BGDA 4LBZA 2VZ0A 3B9CA 1H0RA 2XUZA 5C31A 4NFYA 4NG5A 5FBHA 1ML3A 2X0JA 4M4RA 1QZZA 4DR1B 2GBCA 1R0BA 3PXAA 2Y4NA 4QVKA 3W8EA 2WC1A 4P7FA 4AF9A 5EE1A 2LKDA 2QDNA 1NIPA 4GOJA 2IPLA 2BGWA 4KO3S 3W0LB 2NAFA 3VZKA 3QZUA 4AQTA 2ZM5A 3P0HA 1I0IA 4Q8LA 2H5JA 2XCSB 3OFJA 4HPKB 4TTJA 1GZUA 2YWJA 3POJA 1X0XA 2V3VA 1UPUA 2ZJBA 1YZLA 4N47A 2WJSA 1C9NA 3DPSA 5FO7B 2H4HA 4QRDA 4WOCA 3D3KA 4DR2B 5F2EA 4GKYA 2X8KA 5BYBA 3CRZA 4AFMA 4Q4AA 3MA0A 2VVEA 5KNCA 2OPBA 4JC8A 4Z5XA 2OY0A 4YJ2F 1N75A 4U9HS 2ZJ4A 1XSQA 5C8CC 1P60A 1D4AA 2JIPA 4JI3B 1HXS3 1AL0G 1XEAA 1MS3A 4IUDS 4BQ5A 1AKNA 4LV5B 4NOJA 1YJKA 2LIPA 4ZRNA 4PC7A 5FNVB 1PEAA 4BQ4A 4CCMA 4G5GA 1WA6X 3I5MA 4PXAA 1HE1C 1U4OA 3K5PA 1IWOA 2I0FA 4Z53A 5JUWA 4EPXA 3I3DA 5KYYA 4RPGA 1J8FA 3MF6A 3H5OA 1CQPA 4PS1A 3QNWA 2X29A 4P2GA 2D3SA 3VJLA 4RYDA 1GSAA 3PB3A 2WQZC 1M74A 3ZKAA 2PA3A 1OFIA 3W1EA 3O4RA 5HCHA 5A0FA 3B8HA 4JV4A 1XXHB 4AP9A 2FMTA 3K6SA 4GI7A 3RFVA 4QLOA 2KI5A 3RSJA 1X2BA 5FMDA 2XB6A 1RUJ3 2HCJB 1PJ8A 4C21A 4HLUC 1Y5NA 2YC2A 3U40A 2FMKA 1HN0A 4XB2A 1Q3TA 4NCXA 3VKUA 3Q12A 3P2OA 3UXYA 3P0RA 2AG8A 3MIDA 1YO6A 3DE5X 2HKXA 2D1SA 3G8BA 3GDBA 3A0KA 2CWSA 4PLVA 1N8TA 3ZLTA 3WVJA 2ODPA 1RXSA 3ZY4A 1GDHA 5FB3A 1PZFA 4QYTA 2FWJA 5CK5A 1R1A1 5IJRA 2W6PA 4C4SA 4MW6A 2YRFA 3MUEA 3A0NA 5TS3A 3ZWPA 5FZ6A 1I4LD 3TE6A 5A6SB 5A5GA 5KTSA 3UWDA 5D6OA 4XHBA 4S2DA 4IGPA 2FOIA 3NLLA 3AR8A 3PWKA 3TL3A 1V8ZA 3OPYI 4QU2A 4GMXA 4X6XA 1TNDA 5F4BA 4MVJM 3Q8WA 1JHQA 3OQVA 3VSAA 1KJRA 3LPNA 3K1TA 4YGYA 3AETB 3T95A 3V7UA 3ZHZA 2CLEB 1V7PC 1D03A 3L8HA 3CV3A 4IP0A 2F62A 5IAXA 1RYMA 2EBFX 3ESBA 1XJ0A 4WJKB 2RGGA 1E5LA 2JZCA 2YCBA 3N39C 3HFSA 4IEQA 3C5HA 4L7VA 2OC4A 2ZUTA 4G23A 1E4VA 5BNOB 4FBLA 2P7HA 4ROTA 1E7QA 1KEPA 4CRWB 2XVAA 1NJ1A 4PEVA 4ILKA 5APAA 2GVNA 3EDRA 3KHTA 2Y71A 1Z0HA 1FVOA 1NULA 3DBLB 2VH5R 3LYAA 1U5YA 1DEOA 5DLYA 2BV4A 3AW9A 4G36A 3D1VA 4P4GA 3V97A 5AM5A 2WMOB 4JBLA 1VBD1 4EN7B 1XK7A 2QQKA 5A4KA 4F5DA 2RR13 4J4HA 2G1MA 1Q0UA 1AY0A 1W6MA 1H2MA 4DILA 1CV2A 1TZBA 1PX2A 4FNGA 5LNK6 4H6XA 5COAA 1GV9A 2QUBA 2WV9A 3QHQA 4M88A 5IZCC 5CFQA 2GK4A 1IJKA 1EJ6A 4FOYA 4AJHA 1QG0A 3ND7A 2QX9A 2WYIA 1UD1A 3BGIA 1CJUC 3LFTA 3MWKA 4BWGA 3HCDA 1W44A 4OTZA 3QLJA 3IP9A 2UVPA 2NQ8A 3PP8A 3V8MA 2H0RA 1D2MA 3QJYA 4OZXA 3R3SA 1WSDA 4GMDA 1AR63 1NLSA 4G67A 5F32A 2A1IA 4AUNA 2B6HA 4P54A 4LV6A 1A7UA 4DB4A 2A5LA 4ZEWA 3VBOB 4GWNA 3UVEA 3GRPA 3BK7A 2VW2A 2ZJ3A 1ZM4A 4B34A 2GN6A 2HF9A 3GJXC 3K3PA 4LSMA 4A6PA 1ESEA 1RQ2A 3EUEA 1HDRA 4WM7B 2ZLBA 1R66A 1WAMA 1PJCA 4BX3A 2Q1XA 1OXVA 3RRFA 2WF9A 1H8ED 2I6XA 3NIDB 2X8LA 4DXRA 5JCJA 1Z6YA 1SLCA 1M34B 1PX4A 4UVDA 3WYCA 4BNKA 1XVIA 4U7HA 4MA5A 1TA0A 4YIHA 5FWNA 4WLOA 1OZ0A 1MU0A 4EB3A 1VSUA 4HN2A 1QE0A 3R0QA 4FZ3A 3D5TA 4E30A 3BTYA 3PVBB 3OWXA 1SHJA 2BDEA 3U78A 3AWDA 5CFOA 2GXQA 4YRCA 4WVFA 4E14A 1X7NA 1M2OA 1SFPA 1Y8CA 4J3JA 1AJOA 1SHZA 4NECA 4ZAWA 4NPHA 3DLTA 4G9SB 2XR1A 1IPEA 1I5ZA 2R60A 2W37A 3K77A 1YIFA 3K53A 1PG0A 2CJFA 2Z2IA 1Y5IA 3IGFA 4K9NA 4US1R 2L82A 3DECA 4PF5A 3BS4A 2JX9A 2FQYA 1E9BA 2YJGA 1TJYA 3VD7A 3OEBA 4DWVA 3W2EA 1QJU3 4X60A 4EYUA 4TMXA 2XT6A 2YXPX 5KSYA 4IZHA 2VXJA 2EGHA 1S0FA 1ZZ6A 3QSGA 3VDDA 3DE4X 3E3OA 1HYBA 2WPNA 1XT6A 4XGKA 4GBJA 2D2FA 4WKGA 3F1LA 4YHBA 5H9SA 1Z0JA 3R7BA 1UK9A 4YX9A 4D26A 2D5HA 1JI6A 3RMYA 5T41A 1E6LA 3HP1A 2VP9A 4KBBA 1KDZA 2ZGSA 2CV0A 4V0QA 1PWYE 4KPFC 1RP1A 1R15A 3Q9LA 3S4YA 4MVJI 4KTTE 1J1LA 1VSVA 4A16A 2G9QA 4E32A 5A7WA 3ML1A 1UW8A 1XMVA 1J07A 4UARA 3PRYA 5EGNA 5CFNA 1OVPA 4TKVB 4IDDA 1ESNA 2HA3A 2QEQA 3QVVA 3UKTA 1OV6A 2BF7A 2F1HA 1GPKA 2B37A 1DAHA 4ACBA 1TJ3A 4POOA 2JA2A 4KLZA 5J3UA 4JKMA 5E3JA 2FPIB 3WWDA 3T08A 1TMF2 2FUG6 4NBRA 1FX1A 3N0WA 3LQCA 3T52A 3EGEA 2DT5A 4URZR 3UPTA 2FUEA 4UNNA 5LZ2A 2R5FA 1D9ZA 4JLAA 4CKZA 2QVLA 4DQAA 3GLIE 4DHEA 3FOEC 4MROA 5D7NA 2XWJB 1ZCFA 2MYNA 3RWKX 4C1NA 1KITA 5DMXA 3RNLA 3C4QA 4RQPC 1F5JA 2ZCWA 1JFTA 3P2MA 1T6NA 3IUQA 1GCUA 2B7YA 2PKQP 1G3IA 1A71A 3E6BA 4MUHA 3GPLA 1DFQA 5LRRA 2A70A 5KWEA 2F7SA 4M3CF 2EFJA 4NYMQ 3CKHA 3H5WA 1FW8A 3N2IA 4IQ8A 3E5MA 4HGRA 3DJYA 2VDVE 1SHUX 5CM2Z 4UHHA 2X1HA 3PC4A 3WSVA 3RGBA 3RQ0A 4XFCA 4CUAA 2PBZA 2Z2JA 5CZKA 2BZGA 3W5VA 3QTLA 5IM4A 2CFIA 2D1TA 1M1YE 3QBQA 4JSTA 1XTRA 2W2KA 4N3NA 4JZYA 3ZZNA 3EBRA 4Q01A 4JR2A 3CLRD 2ZEJA 4B47A 1X7ZA 2R1DA 5FZCA 1PV1A 4M89A 4JOBA 4Q4AB 3RUFA 3KOWA 4DMHA 1CN1A 4XIGS 5F5IA 4DEYA 2WS92 1EGHA 1P1FA 3N9MA 3JYPA 3V0AB 2QMYA 2PO7A 3IKVA 1MX3A 1GZVA 2Z1DA 4LF7B 2FZ1A 4L9WA 2NTEA 2GA8A 1L5ZA 4OU5A 1SVKA 2ZSDA 2WO7A 1HDEA 5FNVA 3PQFA 3DXZA 4WASA 3U4CA 1HFJA 3EXG2 3KL4A 1IGOA 2GJAA 3M2MA 3DEIA 3PFWO 1RRCA 4BWVA 1PZ7A 3VYRB 4HTAA 3FGNA 4O02B 1OWOA 2F00A 4FPXA 3DHWC 3E8SA 4LIVA 4UXHA 3FYUB 3Q11A 4ZOEA 4HNAA 2W2OA 1XPRA 4CM4B 1RJDA 4TWAA 1PR9A 5BSUA 5L3VA 5KKNB 3GZAA 3AP1A 1HB4A 1KPHA 3RKRA 1C1DB 5KWRA 3PD7A 2UYOA 3VBHB 3WTCA 3VNUA 4AE2A 4JGIA 1XG5A 3DAPA 2AX3A 4XJTA 2IQIA 2WUDA 1MTOA 4R1PA 2VYQA 2OXIA 3FB1A 2GJKA 4FYMA 1J2JA 3UMMA 4QYMA 3AMNA 3RIEA 3SS7X 4KO4S 2POQX 1GADO 1UOQA 4NHOA 1FRZA 3KPYA 1PO13 4FCAA 1N33B 3MD9A 4D6QA 3RODA 1AIPA 2QPOA 4IV1A 3SF8B 4PGAA 1R27A 3DGTA 2VRCA 3MRVA 4NO4A 5ALXA 3AGPA 5A6SA 4FDAA 2XQXA 1FNMA 2CL5A 5CUQA 3DTYA 2V03A 1POV0 1TU0A 2ORWA 4NABA 3RI8A 2C03A 5L9BA 4U7DA 1QEXA 2Y0EA 1CY1A 1VHQA 3DS8A 3ZHXA 1Z4LA 2POCA 4UTRA 1XNJA 1OU4A 1EYBA 3ZKWA 3PR2B 3BOPA 3NVDA 3CO2A 3MMZA 3O1RA 2QGFA 5EHGA 1FFHA 1M6VA 4PT6A 3DGFC 4WA7A 1ZPDA 1DOZA 4FOSA 4RPLA 1GPAA 5I7FA 2WFPA 4FSHA 4HK9A 2FFJA 1ISPA 3W5IA 1TUBA 3ED5A 2EJUA 3PDIA 1WULS 3BB4A 1N34B 2JG8B 3GK3A 4I7EA 4KTVE 1SU4A 3BTSA 2NQTA 1KHTA 4CM6A 4JQSA 5B7GA 3D8HA 4EUNA 4BNTA 1QKQA 3MTJA 3EH1A 4AJLA 3DEFA 4L72A 2JFBA 4CEJB 5FJIA 4Z4EA 3FF4A 3A3KA 4ZZ1A 1AMUA 2DFPA 4KRFA 1R0LA 3KETA 4Q4Y2 2J32A 1DG6A 2VQAA 2Q8PA 2ZI5A 2NIPA 5SYAA 4Q18A 3LQYA 3KQWA 3KXLA 1RPZA 2NMOA 3DF7A 3VKOA 2ZT5A 4ETMA 3N53A 3TH5A 1KQOA 4DQDA 4IFEA 4Q02A 3FZQA 2WSUA 3K0AA 4AX8A 4EX7A 4ZU7A 3O95A 4IUBS 5IH7A 3DLCA 2H1RA 2QIPA 2YJ6A 2DTDA 4UOQA 1XD2A 1TT5B 4EO9A 3BAFA 5I5EA 2JDKA 1HQWA 3NRJA 1L5HB 4QPCA 1ZBA3 4AAXA 1EM8B 2BWJA 3PMEA 1TZMA 3ZU3A 4LHKA 2ZWPA 4HDSA 3V4OA 4INZA 1Y3HA 3ZYIB 2X2EA 3DEYX 1V6KA 1RC6A 4IRXA 3ASIA 2Q6VA 2GVZC 1KI9A 2W2MA 1XJ5A 1Z5UA 5FRDA 3NM5A 1QQ7A 4QB1A 3AU9A 3MINB 2OVFA 2VFAA 4I4TA 3L77A 2YG0A 1XHFA 1W9WA 3RNOA 5DZFA 2IFWA 5CM8B 2O8DB 3FNQA 3NEPX 3CX6A 1QSGA 4IKPA 3LA8A 1S2DA 4IG9A 3ELNA 1B0UA 3OUJA 2C82A 5F6LB 1ULUA 1DTSA 1ORDA 3TG8A 4U2CA 1ZM2A 1S8AA 4MEAA 3JVUA 2QVBA 4OH7A 3GGPA 2IHVA 4MIKA 4RK6A 2ECQA 3BCHA 4TS9A 1PR6A 1N3YA 4Z7QB 5FYUA 3AUKA 1ZH2A 4DR3B 4GOND 5TQ0A 2GH8A 4GXQA 2VXRA 4OHZA 5JYBA 4UFNA 4JC1A 3O14A 3C1TA 5C3QA 1CUDA 5H1YA 3LCPA 1U5IA 2HRDA 4FB4A 4YREA 1E5IA 2PFWA 2JHPA 2W00A 1W48A 1VHWA 3P96A 5CU7A 5D51S 5A4AA 1EP0A 2H57A 2ZYIA 3UWKA 3ZWVA 4DA7A 3CNEA 2P6UA 3WE7A 4YH1A 5WRFA 2RARA 3T5MA 4FBMA 1M2HA 1E9CA 2NQ2C 4LRWA 3B02A 1EXDA 5FR3A 2FSGA 1WIWA 3KYJB 1A2OA 2LUOA 2CVPA 2QF7A 4RLQA 1I2CA 4CBVA 3AVSA 5REQB 4MS3B 1YBVA 2IFTA 3DZFA 2X6QA 3K71B 3QY0A 2WOOA 4IEZA 2D3WA 4M0EA 5JHGB 2NMVA 5KXEA 1U6IA 3AKZA 3J26N 4UU1A 3H8UA 1D1QA 1K42A 1IPKA 1QHGA 1AV7A 4MPPA 3NKTA 2GPNA 2ECKA 3D8RA 8OHMA 5KYKA 2FPXA 4XDYA 3AFMA 1RFLA 2X8JB 4B74A 4ZDIA 1P3JA 3VNAA 3GLGE 4QPGA 1YL5A 1NPYA 2EXKA 3C7FA 1NA1B 1AXGA 3O1TA 3IB6A 1BWPA 2PM8A 3CPJB 1BTOA 1WY7A 1VI2A 1A0OA 1P7WA 4JI2B 3N6VA 3X1DA 1V4VA 2AVDA 3BQNB 7REQB 1IK4A 5FYMA 5KBFA 3EFEA 1YNSA 3VBSC 3SHFA 1H8HD 4X97A 4FN5A 3KWFA 1C9DB 2WWWA 4Z9XA 4A7PA 3UK9A 2Y8KA 5BSHA 2YASA 1BBT3 4BOYA 3V2UA 1MOZA 4W6WA 1W28A 2JGNA 4OFGA 3HA2A 1RRMA 3U81A 3SHWA 1KVQA 3AOEA 2RHGB 4NRQA 2V72A 4B7AA 3D0OA 1U5ZA 3EGXB 4ETWA 3WO1A 3IIAA 3PRHA 5ALFA 2HLNA 4OVEA 3EEOA 5HS6A 5LN1A 4M1EA 1Q8VA 3FUWA 1YQGA 3LKBA 4MCAA 3NHYA 2OVUA 1GPDG 2L42A 3OUUA 3ZLJA 1XLTC 3OAAD 3LXUX 1YZTA 1NZJA 1VOTA 3G5AA 4EO4A 4JB8A 5EC8A 3T7CA 4GR4A 4FEEA 4MGZR 5GKAC 1GAXA 4YECA 2FCUA 2PZBA 3W6PA 3ZXUB 2HJWA 3W5BA 3KPVA 3INAA 2IV3A 1TKCA 2F48A 1FJGB 2YNMD 3VNBA 4QX0A 1W8ZA 1SXJA 3K20A 1FB5A 1NQXA 4BLIA 5BOSB 2I2DA 3Q3EA 3OJEA 3DPIA 4CF3A 4KWIA 3G89A 4XIFA 4YCAA 3KT0A 1WMEA 5CNJA 3IUYA 4LPLA 5K0SA 5CT9A 1PT6A 2OHFA 3E9QA 4AZ3B 2XYVA 4A8JC 1HV1A 1ZK2A 4LO4B 3BXFA 3AP2A 1H94A 3FSGA 4OJYA 2Z4TA 1PO12 4WZ6A 4KACA 4XVCA 3BXGA 3PQ6A 5K0GA 4BDVB 3UJ8A 1E0KA 3R3JA 2VEDA 4KV7A 3V1YA 2VDRB 5A2GA 1PNRA 4GH4B 1MJ5A 1VMJA 5E7MA 1OROA 3T4XA 2D0IA 2A3WA 2O2EA 1VZ2A 2YCLA 1BQPA 2SNIE 4GPBA 1V8PA 2W6IA 1JQ5A 4XAQA 5KVVA 1HBJA 2A9JA 3WGIA 4ENQA 2BJHA 2X4IA 5FKBA 3EPJA 4J3NA 2NP6A 3I1JA 4ZQFA 2C3UA 4TWJA 4ZAXA 1DT5A 1A97A 1II8A 1TCVA 5LP6F 3DDNA 5ER6A 4AMVA 5GV7A 3R24A 1T9DA 3ZGLA 3KFLA 2OCAA 4Y2PA 3TQHA 3ZV7A 1W4LA 5FY0A 4RQBA 2H54A 4NZZA 2I3DA 3QUTA 2DECA 3R0VA 1NG9A 2ZG6A 3C2UA 1N6IA 4I5IA 2WTBA 1E57A 3UIEA 5EMLA 4INAA 2F17A 2V73A 3B2QA 3ICPA 4RVGA 4YUYA 4YMWA 1QTQA 4CVNA 3P4YA 4KE7A 3CZJA 3ANTA 3NAPA 1GPLA 2WWHA 5I4CA 4IERA 1OPMA 5M04A 4DR6B 3S5QA 2UV8A 1ZRCA 2RHPA 1DG1G 4TLGA 1U0SY 4MKRA 3JCZA 4X5OA 1GUDA 4Z6KA 1QJX2 4TROA 3EODA 2VQFB 3ZXSA 3S1AA 3VXKA 2AOUA 3WK6A 3PQDA 2DQSA 3PFGA 4JQYA 3BODA 2JLRA 3TXXA 5LA6F 3MV01 3CGWA 4D6YA 1XPOA 1Z2EA 4ARYA 2HDOA 5KNDA 4LSWA 1F06A 1NXXA 2XYRA 5HJ2A 3SIRA 3DTVB 1J59A 1RQRA 4ETNA 5TGDA 1G21B 4I1SA 2H48A 4QGAA 1JT9A 3H8WA 5HKLA 5BPXA 1X1SA 3IUNA 4WOBA 3U2QA 1PAUA 1ZINA 1WEHA 1PD0A 5E0KB 3THCA 2P2KA 2PSSA 3BMQA 3ZKWB 2WIJA 1WA4A 1MS4A 1NKGA 3RJRA 1VLNA 2G09A 1SC1A 1DINA 1AXKA 1EUUA 4C87A 3MAAC 3NUQA 4YEDA 1BWSA 4DZRA 4US0R 2DP4E 3LW8A 3LK6A 1D1TA 2DYKA 2CMKA 2V7BA 3GMTA 2VZEA 4JEUA 2YWEA 2B82A 4HNHA 4P00B 4BRSA 2JJ1A 2YN4A 3BWBA 1C4KA 2D6PA 2QDRA 4DG8A 1XKTA 4R1QA 1SMVA 4J0QA 5BW8A 1XVVA 2FEXA 4NBWA 2ZBRA 1T2XA 4CEJA 3UEOA 4MX8A 1Z12A 3GRAA 1JZ3A 4M38A 1U3DA 1H0HA 3D7KA 1QHEA 1EWQA 4DDWA 3I28A 1CDZA 3DNPA 4ZDWA 4JUAA 4FPYA 2P3OA 3NHMA 1UEXC 3U9SA 4RS5B 1JFSA 5CADA 3FSEA 3DXYA 5HP4A 1J3PA 1HZZC 6ABPA 4XWWA 4NR0A 3ZGNA 3QLEA 1MS1A 3OURA 4LRQA 4HEJA 4F8JA 1QQ6A 1GUYA 4LOSA 2EAUA 3TTYA 1SKMA 1KZ9A 4YONB 4IH4A 2ZR8A 5FK7A 1U28A 2R8PA 4X7RA 4X63A 1RABA 1YE3A 1F15A 1A2KC 2VAWA 3ZNOA 4G1UC 3WX0A 3IP7A 2GS9A 3A6DA 2D6MA 4M1TA 5IVEA 2I1WA 4ZCTA 3A32A 2C2XA 1X7YA 2I2FA 3LA2A 5EQDA 1LHVA 1GZTA 2DLNA 3USUB 4HQRA 4XCQA 4JLWA 4WLUA 1SK8A 2VM9A 3WZMA 2UVDA 3A05A 4AIRA 3GHHA 2PHRA 3OYWA 3IOCA 1IZ7A 2P4EA 4HDRB 1DLIA 5ITVA 4KPGA 1QJU2 2OFPA 5C33A 4M87A 1WW8A 1V9CA 4QOSA 1BJTA 1YC2A 2N7GA 4F1KA 3NNGA 4LY6A 1T0UA 3ZE7A 1RUD1 3PJFA 2VGDA 1QMGA 4DB2A 3WG4A 1T9BA 4QPYA 1T4CB 1WD7A 3ECQA 4P4SB 2ERYA 4P5EA 2CT8A 4UYBA 2IDJA 5KNBD 1IN8A 2YV1A 4PIZA 4QKFA 1J06A 1PZ8A 3D8NA 3KVRA 4JGZA 1HLDA 1QOOA 4R1UA 4OHUA 2B46X 1DMRA 2O8NA 4TTPA 2LVBA 1MZFA 1F8VA 5E9JA 1V71A 1C3XA 1NBOA 5CXSA 1GNLA 8GPBA 2H1CA 3PSAA 1SOAA 2OO5A 4XBNA 5BMVB 4BCUA 1N1EA 4KI5M 3ESYA 2MEV3 1C1LA 4W6XA 1KJNA 1I4WA 3MZ0A 1WB5A 1JZ2A 2J6IA 2W1QA 2A6VA 2GM9A 3BH0A 5HZHA 1AUVA 1M4WA 2G80A 1QHYA 1Z7EA 5G4KA 2C4UA 2O4UX 1VBE2 2RG4A 4W50A 1E62A 1U2RA 3ZVLA 1HI9A 2QL5A 4HUJA 2RGRA 2FUNB 5DDJ2 4MS3A 1VPDA 1CEEA 2R6FA 3I01M 2JS7A 3RS5A 4YT2A 3S1SA 3HT1A 4KDRA 3UAYA 2A58A 1XE7A 1DEKA 1J8VA 1YR3A 2IXTA 3JBG2 2XWBB 3T99A 1DIWA 2OLKA 1N6RA 4EGJA 2Q1SA 4IIBA 5FTMA 4GAEA 2LD4A 3GA0A 1MFZA 4R3NA 1LDEA 5AK5A 4S1OA 1SBYA 4KODA 1L4LA 1K8QA 4IEIA 1IZ3A 5DGCA 5DKFA 1HNZB 3NGMA 4F2PA 1JTVA 3MJEA 4CXWA 2IY8A 1C7JA 2Q1YA 2A1TR 4JYPA 2WJWA 4FCTA 5DGIA 5C80A 5FO8B 3PEYA 1VG9B 1TM2A 4YZ5A 3KV6A 1GQ2A 3W2GA 4YGCA 2VJMA 3RM3A 5IC5A 3N2KA 1N2ZA 1XTSA 3HDTA 3DNFA 5A9RA 4EZEA 4C04A 2B1RA 1XQ9A 2Z6VA 3D0RA 3IQGX 4FTBA 1GV1A 2AFHB 4N5NA 4MV1A 4ALLA 1KNQA 1PLLA 3GU3A 2CCKA 1OFTA 3KB2A 2H7YA 1REQB 4JDOA 4H7JA 3VLBB 3BCUA 3AX4A 2YFYA 3VBUC 3DOFA 4FQ7A 4URVR 4YACA 4TVSA 4PLWA 1RC8A 5FOUA 4MGTA 1NI3A 1G3UA 3A4MA 1MHTA 1YA6A 5CYOA 4TQUS 1Z56C 4H1VA 3FTCA 4LDAA 2VPWA 5FY4A 2ZEYA 2NXJA 1W73A 3OHMA 5F78A 2NPFA 4B5KA 2AJLI 5KQGA 5C1BA 1CNMA 4XYBA 4DNFA 1O8BA 5JT1A 5AWFC 3QIVA 4HNUA 3PD0A 1ZD5A 4JVSB 5DNDA 4B6JA 4DA9A 3BTZA 5KXCA 1OLME 1RHKA 3HN3A 2H2WA 1DAPA 3ZJUA 3CWCA 1OILA 5FYCA 2Q5QA 1SUFA 2IPMA 3ESCA 2XE6A 1T8SA 3LIPA 4EPVA 4XTMA 2FCVA 2D5BA 5G2OA 3W4KA 4YQEA 3HSKA 4W1PA 4ZKDA 3N35A 2VNHA 3HZOA 1VALA 3QE3A 3C4VA 1XD8A 1BMQA 3B3QA 4GB31 2BYVE 1GR0A 4U7TB 5CG2A 1OIWA 1XZKA 2I71A 4KE9A 3CF6E 4FSXA 5IEJA 2ZDHA 5HV4A 1TMGE 1ITZA 3TAUA 3SNMA 4ENSA 2IYPA 2IYZA 2GPJA 5JOYA 1U2GC 2H31A 4AKSA 4U0JA 2CK3D 5TPZA 1XKXA 2ZX3A 3Q5EA 4NYMR 5JPMB 5HCBA 5I8TA 3F4BA 3E7WA 5FPYA 1YK1A 2WHEA 5FLYA 3DVLA 3QBDA 1SPXA 3D0SA 1Z35A 4GH4A 3SISA 2C5BA 4MO9A 1M8FA 5AJXA 4LMBA 1XZIA 3RVOA 3I1FA 1DHRA 3OC6A 5JDCA 4I1PA 4OAOA 2OXTA 3IT8A 2XDYA 3NG1A 2IGBA 4PNPA 3W77A 1LPAB 1AR91 1RTTA 3WQQA 4WSOA 3C4JA 2ZPXA 2X5IB 2G0TA 3OTIA 4QJBA 4Y6SA 3AZXA 1W6UA 2ZUVA 3NATA 4YSFA 4CDMA 2AJBA 2HK6A 2KPOA 3IPRA 1K6MA 4I0BA 2HWC2 5JLAA 4ZXEA 1U8FO 4UOEA 3KEGA 5KQLA 3UO8B 1IY0A 5DP2A 3PD1A 3DMYA 3NGLA 3MT9A 5A7SA 2R68A 4IINA 4JA2A 2CNAA 4DBVO 5G41A 3HR4A 3J7TA 1CB0A 2D5LA 3JRXA 1C7IA 2NM1A 1RPNA 2RJLA 3A04A 3T7EA 2O0HA 4I6JA 2NV2B 4KDCA 4KQ9A 5CEFA 3TN91 2GCEA 1D4OA 1RJWA 3GEGA 1J0CA 2BMVA 3LAWA 4KVZA 1CAUA 1A27A 4L5IA 2XHZA 1DO8A 2FZGA 4CU9A 3I9NA 4DZZA 1Y4SA 2AYXA 2ZUBA 1RUH3 4V0LA 4P32A 1YZGA 4CUBA 1KVUA 3PX7A 3KVOA 621PA 3GFBA 1UBJS 2XWJI 2YBEA 1LSJA 3VC3A 4DPLA 3MMPA 4MIEA 4FOWA 5EYXA 1KY5A 3F5FA 4CIYA 3PVNA 1RI3A 2O7RA 4AY4A 5FP0A 2ZJFA 3WG9A 2C7GA 4CLRA 3N5KA 2ZIWB 2ZA9A 2RMKA 1B74A 5IXYA 1C3VA 4QJ3A 1FYXA 2WSSD 3W8DA 4FCVA 3TZ6A 1KO1A 5ALTA 1NBWB 3RGGA 2B83A 4NRPA 4E21A 3W3AD 4U7JA 2LNDA 1I3HA 3OEED 2QAGC 4N43B 1U7UA 4BLTA 2X0RA 3VA7A 3RVRA 4AJ2A 4HV4A 1Q0HA 3HH8A 1E4EB 2V5VA 5ICEA 5ENZA 1IVNA 4E2SA 2G5TA 1OI2A 4PBOA 1JHZA 4BASA 1ZVFA 1A96A 4OI4A 1PMIA 5KWVA 4Y4RA 2BELA 1AKMA 4INPA 3THXA 1ZLXA 4MARA 4X66B 3KGLA 4R84A 2PMFA 4TSRA 3FD8A 4A82A 4DY3A 3W79A 4KYIB 3VZQA 3ZBUA 5C8CA 2NTVA 4CQMB 4HVOA 3JPYA 1H6CA 3CRMA 3JV7A 3LGRA 4MVJP 3RK4A 2JANA 3YASA 1MS9A 3GD7A 2OBNA 4CJXA 3ZDQA 5LQAA 1X87A 5KWJA 3C5EA 2BFBA 4R3WA 1UBCA 3C15C 2AEYA 1ETUA 2HREA 3NALA 2Z5FA 5LJIA 1WZUA 3DKKA 4LMRA 1F6WA 2D6KA 3HDGA 3BD8A 3GMSA 1P0PA 3FWNA 4AHXA 3HHPA 2PX8A 2R041 1KETA 1H5NA 3MB5A 4GQBA 3OPWA 5LZ7A 4H2AA 1T4GA 5A3RA 5K0LA 3E05A 2Y92A 4FEYA 4OPMA 1GLVA 3G8DA 1ODLA 1LBTA 3T0AA 5JY6A 1LBIA 2AQHA 5AXBA 2Q45A 3NNSA 3R6LA 4JKLA 3PJQA 4XZUG 2IXAA 4JUBA 5FDFA 4UTPA 1BNCA 3I45A 4RD0A 2OZPA 2F4LA 2VH2A 4G8JA 2XKPA 4JJ8A 2G82A 3OLYA 5AJTA 4MUGA 1G6NA 3GEMA 3OYWB 4Y6RA 2JG3A 3U11A 3K5HA 4HDRA 4IMRA 221PA 2RFLA 2GUGA 2IV7A 4NLLA 4IV3C 5K3BA 1JYTA 1Z75A 4K1LA 5C8VA 3RRJA 4BP1A 1YAJA 2PYIA 5ECWA 1FK8A 1M8KA 4QX2A 4TYWA 3KQPA 4DSZA 2WD7A 3G2NA 3BDIA 4D25A 1E1YA 4Z4HA 1GT91 4XQDA 5EMKA 4ZOCA 3R6SA 5ICMA 5FXWA 2O8BA 3WNMA 4X71A 2PN1A 4MV7A 5BR7A 1V6CA 3CQ9A 4N82A 1UQTA 3FLBA 2HU2A 4QSHA 2V6JA 3GA7A 1GWMA 4BXOB 5A7FA 3GCXA 3LVBA 4E9KA 4MQEB 5FBWB 2D4HA 1K5JA 5TSWA 2WA4A 4EF5A 1UCFA 2ONCA 1S2BA 4V0NA 2WU1A 5GONB 3R6GA 1X9IA 4XPVA 3II6X 3BWDD 3Q1KA 4L4ZA 3GGSA 1U80A 4MADA 3IN9A 2WO3A 1EWRA 3IEUA 3K5WA 2IYFA 2Y76A 4JX8A 1KYXA 1Z4PX 3UMBA 3WF1A 5I9IA 3LC0A 2R84A 1KI6B 2WJHA 1V3VA 1PJLA 1ZZEA 4A23A 3PYMA 4Y2SA 4ZVOA 2AMLA 3EYPA 1OFGA 1A1VA 2PZFA 1Y6RA 2HYDA 2FE1A 4KXNA 4HGQA 3RU7A 3PKZA 1TF5A 2IPOA 1T0HB 5HR5A 3I23A 1RKUA 1KERA 1U04A 3SHQA 4B71A 1RRFA 1WVGA 2AWNA 3T5GA 1WB6A 1YD7A 3VR4D 4CKYA 4MW5A 1ZVQA 1XP5A 1RUOA 2APJA 1PO22 1E1CB 4PC3A 2YYYA 3N2KB 2PH5A 4EHNA 1TQ5A 3L04A 3RSZA 4XF1A 1G6Q1 1LTEA 3CUEF 1LLDA 4C3VA 3L92A 3PLNA 2JG8C 4PICA 1ECBA 5JOQA 1P6QA 4F12A 4MVYA 3EB7A 1F4HA 3NFRA 4QFDA 2VTBB 4ZU6X 2QNBA 2VXBA 1JKXA 2OB1A 1O7JA 5K3CA 4GC5A 2B7LA 5JFOA 5K0FA 2ATIA 3DDUA 2ZJCA 3UJCA 4GLLA 1UBNA 2DHEA 1M7HA 4OQPA 2Z5LA 1ZBE1 4AI8A 4D8VA 2PX5A 3ZYGA 3EMVA 1OYWA 1QZXA 2YWBA 2QW8A 2I80A 4N18A 4POAA 2E89A 1XKQA 5BRAA 4DXHA 5TNXA 3P5BA 2C9OA 1T0JB 4CEHA 1QIGA 1UKAA 1AYM3 5KNCH 2C4TA 2B1IA 5JI7A 5HXAA 2IHTA 1AUYA 2EXIA 1ND6A 3FTEA 4XBQA 1EFTA 2H4WA 1SUAA 1JB1A 5D8AB 4DV0B 2VQ0A 3JW8A 1N1TA 2VDMB 5FLJA 4DL9A 4LS3A 4Y2HA 2BEWB 5E4FA 1IEVA 3IMCA 2X2FA 1UOJA 5AW5A 2JLAA 3FLAA 2WZPP 5A7GA 3D6NB 4XDHA 4LYYA 4MCHA 1D2EA 3NJYA 3LXMA 4CE8A 4KPUA 1UBUS 4F0JA 1P7CA 1OPOA 3QEBZ 2DVGA 2QTCA 3N9NA 4DLPA 2B4YA 3V1LA 1XXHE 4P4TA 4Z9BA 4YI5A 2VJAA 2OWEA 1VMAA 3TVYA 5AKEA 3DYOA 1WD3A 2PMKA 5D84A 1F8GA 1U0AA 5E2IA 4YW1A 4ZPJA 1CYDA 1WOMA 3BWEA 4N40A 3B85A 4D94A 3F6CA 3WDYA 1Y6FA 4MMYB 2BU9A 2PX3A 3L7YA 1SY7A 4G5HA 1QO9A 1RHI2 2P0AA 1D07A 1XBTA 2AKEA 4BRUA 1BEUB 1HQYE 1NIJA 2WSLA 2J7PA 3GZNA 2CEKA 1RM4A 3VRHA 5C71A 1D7OA 3EXFB 1AKRA 4PLZA 4UD2A 2FR0A 1M2VA 1Z2PX 3SKVA 4I0AA 3G2LA 3D6AA 1SBCA 3AJAA 4Y6QA 1OB2A 5IDWA 5JQGB 4D6PA 3KV5A 2I78A 1E1RD 3OM0A 1OR8A 3KTOA 2FQPA 1PO21 3FBYA 1EK5A 1ES9A 4GO1A 3REQB 2NV0A 3W9SA 1DWOA 1Y1RA 1WZNA 3CZCA 4F71A 2BJWA 2UAGA 4BLQA 4K6CA 3H8RA 3OOSA 2ZSHA 5I48A 4XFHA 4NE7A 4P3PA 3HAGA 2W2VA 4C1WA 4BYMA 1NXOA 2VPQA 1LESA 4LPKA 3R3WA 2Q8EA 4W5QA 4PZEA 4WZAA 1NYWA 3VZJA 1A5SB 2B4QA 2EIXA 1K5PA 2AG6A 2J3DA 3R05A 4YUAA 3QH7A 2OOSA 1NJ8A 4ZVMA 3RPEA 3IEXA 1PVXA 4PE5B 3SHOA 1R9GA 2H1VA 2VNGA 3LDRA 3VVLA 1RUF1 3WJ1A 1KU0A 2O8EB 3HR9A 1A9PA 4M49A 4JIMA 3CZUA 1JPUA 4RTKA 3AL6A 5CKQA 3K1ZA 2QM0A 4CMIA 5FY5A 5FAKA 2UYCA 2BZSA 2R4UA 1MGPA 2IDKA 4LXIA 1ZBA2 3DEZA 4C05A 5HZGA 1EV13 3IUSA 4UE3S 4KIFA 2DBNA 3OTFA 2G06A 4ALKA 3Q4GA 5IYYA 1QH6A 2AD5A 2PLV3 2P11A 4D97A 3I49A 3F4KA 2C78A 4URUR 3U4MA 1W0OA 4R54A 1GPJA 1T36A 3T4PA 3FFXA 1YS2X 1LTKA 5DK4A 1H05A 3INGA 3OQMA 2ON6A 2BONA 2Q3CA 2BCGY 4D6RA 1W0PA 3UW1A 2ZB8A 1RHJA 3K09A 2R043 3B82A 4PSKA 4LRSB 4JJ6A 3E3MA 1G9DA 4Z86A 1V95A 1ZC3A 3V0BB 3A1EA 3LOPA 3HVUA 3TMAA 1UY2A 1CNFA 4RKFA 4AD8A 1JTEA 3SBEA 2FG7C 4XWAA 1IBSA 1OV4A 5C53B 2FU5C 1W2UA 2WQ8A 4HLQB 3S55A 3K4AA 4CKWB 2INGX 1Q91A 5THXA 3T2TA 2EBHX 3K9LA 4JBNA 4YUWA 2AOTA 2ZRDA 3O8DA 3VHXB 2E4ZA 3QUQA 4HVTA 3H0EA 4MV4A 3URKA 4DGSA 4IJWA 1RMQA 4GRAA 2R6JA 3X43A 2QZ2A 3OJBA 1JQDA 3F5SA 1OHHD 2RG7A 5F21A 1P1CA 1LQ2A 5FULA 3ZZMA 4JI7B 2RDQA 1JUIA 1MZ6A 3FLEA 4NIHA 2Q1WA 4BB6A 2P79A 1WMBA 3KQMA 1TVGA 2B21A 5DMHA 4R2KA 1CZTA 1W46A 1P2GA 5DNAA 4IEWA 3S68A 4QTXA 2OBYA 2ZB7A 3QCWA 3E4CA 3DF0A 2Z9CA 3SJAA 3TW0A 2E63A 2F67A 3E5HA 1DC5A 3HWSA 4ZAGA 1CUBA 1NTOA 2QJTA 3PHBE 1DS6A 1OLRA 3PUHA 5CW1A 2P5UA 3DCIA 2J07A 3MT8A 3WINE 4XJXA 1V45E 5DZEA 4M0CA 2E85A 2O8BB 1HLPA 4MWOA 2YINC 4ZT4A 4HKWA 4RX1A 1JEQA 1VLMA 4QQNA 3FTQA 2ZE8A 3DMTC 1MX1A 1BS2A 5BV8A 3TOCA 5A6VA 2WYWA 4RK0A 2AACA 1P19A 1ODMA 1YJBA 3D81A 2WSIA 3JYNA 5JVDA 1IONA 5A7PA 1JG2A 2C5FA 3DLAA 4MW0A 5CW2A 4FGWA 3NMUF 3VSCA 2HWF2 1F20A 2DM6A 1RL3A 4LZJA 4JTOA 4I5DA 1U8ZA 4RE6A 5A3VA 5CT5A 3O38A 3IXLA 1AO0A 3MCVA 4BVFA 2G07A 1AVBA 1TME1 3L46A 1Z2DA 1DQSA 4W5OA 4BQXA 1NNSA 1HRKA 1GL7A 3SBXA 1GQSA 3FOZA 1II0A 1DX4A 3U0ZA 3HB0A 4RKWA 4OVKA 3ZW8A 3O4IA 3E8MA 4OM8A 8LDHA 4DNOA 3VC1A 1V7QA 4NY1A 1M6YA 3OSDA 3EXHB 3RBAA 2NSDA 5KWSA 3I5XA 2QD5A 5AVXA 5LZ5A 1YFZA 5A7QA 1LPMA 4PAOA 4DA4A 3BWYA 1WUYA 2FQXA 3QLTA 3BSYA 3B52X 1PZGA 3B94A 2QNIA 2YBSA 5DX0A 4EPYA 4B3NA 3RS7A 2YQZA 3DE1X 4UAJA 1H6XA 4N76A