4K9SA

Peptidoglycan o-acetylesterase in action, setmet
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
total genus 110
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k9sA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k9sA01
3MILA 4JKOA 3BZWA 1ESDA 3PT5A 4NRDA 3DCIA 5JD3A 1BWPA 2WABA 3DT8A 2Q0SA 1DEXA 1U8UA 1VJGA 4RW0A 4S1PA 3P94A 4I8IA 4JJ4A 1ES9A 1VYHA 5HOEA 1J00A 4K40A 1ZMBA 3DT6A 2APJA 2WAOA 1IVNA 1ESCA 2WAAA 2HSJA 1K7CA 1ESEA 2Q0QA 3RJTA 2VPTA 4HF7A 4JHLA 3HP4A 3U37A 5A4AA 5BN1A 1Z8HA 1JRLA 4IYJA 4RSHA 1BWRA 4K7JA 4Q9AA 1BWQA 1DEOA 3C1UA 4LHSA 1FXWA 4H08A 4TX1A 1PP4A 4PPYA 4K9SA 3KVNA 4JGGA 4XVHA 3SKVA 1V2GA 3DC7A 4OAPA 3W7VA 4DEVA 5B5SA 4JJ6A 3DT9A 4HYQA 4M8KA 4Q7QA 3SLRA 5CD9A 2W9XA 4OAOA 4K3UA 1FXWF 2O14A 1YZFA 1WABA
chains in the Genus database with same CATH superfamily
2G63A 3FX2A 2QTZA 1HJGA 4AJOA 5IVCA 4TTVA 5JMWA 4ZARA 3JALB 2ZR0A 2MHCA 3DOEA 1AUYA 5CFOA 1IATA 3M1AA 1WMEA 3EHEA 4ARIA 2XUEA 4BRUA 3UV7A 2G9GA 2NYAA 3FNGA 2C59A 4QU1A 1JLHA 4R3UC 4TTPA 3B5LB 3PEYA 4MYRA 3RJTA 1NCQA 4OSEA 4JI3B 1SU8A 4CQNA 1IZZA 3OI7A 3N9MA 1DC6A 1W04A 4NU5A 1SM4A 4Z7OB 3A21A 1C8BA 1Z0DA 4WPGA 4KJXA 2L9LA 4DDKA 4KW7A 3FI9A 4AVBA 2PUFA 3STTA 4E22A 2JLUA 5LZ8A 2Z5GA 3U13A 3HUEA 2PKCA 3U1XA 3RTGA 1OX4A 2OA2A 4I6EA 3K4QA 3K1TA 2GHTA 3G5MA 2J6CA 4KR2A 4CDQA 1ZAYA 3E0QA 5FBLB 5EZWA 3VNRA 4WVFA 3NMBA 2OZLA 5BV7A 2WILA 5G41A 3MT7A 3DW1X 4JLMA 4X62B 4FGLA 1FXWF 3MFQA 4EW6A 3VR2A 2RGCA 3T08A 2JG9C 1T1IA 3KLPX 1LPNA 4LYDA 4HRVA 2JG9B 2E4WA 4GRAA 4ZCSA 2X0DA 4OI4A 4L0QA 3HR4A 1NBME 5JCJA 3Q9NA 2RJLA 4D8WA 5AUOB 2M98A 5G05L 4Y3OA 3E7FA 3STWA 4DO0A 4M7WA 3R05A 3PQ3A 4B3IA 1LHOA 3C7DB 4PLCA 3S7EA 4HOYA 2GBCA 4A27A 3LRTA 3NYIA 3Q3VA 1L6IA 4IXWA 3H8VA 4LC1A 4RPIA 1AQIA 5EKUA 4XJZA 1RABA 1TME3 1M2JA 4CRWB 3GT0A 4JR1A 1DXYA 3NSTA 4O9GA 2VF8A 1ULBA 1SRQA 1K5MC 2A1TR 1BTOA 4EY4A 5LJLA 3WSOA 1K5MB 3H8UA 1JSZA 1C7RA 3M9LA 2ZRGA 2VDKB 1JF8A 3LXRA 3I3BA 5J09A 3RYRA 4OP3A 4M0HA 2PZKA 1LJ8A 1Q3TA 2HU2A 3ZQJA 5A3MA 4UVGA 3K3OA 2I2FA 2VAMA 2AR7A 1I2BA 2IGBA 4K8FA 2PUJA 4JQSA 2PKXA 1CUJA 3WYNA 4I14A 1JHNA 1ZHHA 1GZCA 2AMJA 4JOQA 3SC2B 2J07A 1K8YB 2FX5A 1DEXA 5ANQA 5DH9A 2Q3FA 2WYUA 4BQ5A 4KAFA 3G13A 4UTRA 3UAVA 3M2MA 1V4BA 1QY4A 3BEOA 4JQTA 2GNAA 3DOJA 1PEDA 2OP0A 4JX8A 2XMCA 2LKCA 4YCDA 5CAZA 1PWHA 5AM5A 4CUGA 3MB8A 2G9NA 4GNRA 4XSGA 1GP4A 3NHSA 3CCFA 3GCZA 3S5AA 4Q21A 3UK6A 3KALA 4ARAA 3PQ2A 3HKDB 3PB3A 3M3CA 2BSAA 5DX8A 2CLIB 1ODCA 4B6PA 3V4SA 3AOEC 4GPIB 4F92B 4DA4A 1W2GA 3GXBA 4LDQA 4MRSA 4CE8A 3FN9A 1V35A 3UJ6A 2Q1UA 5I9SA 1HRKA 1RHI3 5JZGA 2IUFA 5JPMB 4L7QA 1FW8A 2EGUA 4O29A 121PA 2QX7A 4CDUC 2J6HA 4CDUB 2ZYUX 3T9DA 2UVDA 3FNQA 2FJ0A 3ZIAA 5ERXA 2UYOA 1C9KA 1E3TA 2ILMA 3AL2A 4G89A 1RUC3 3H1GA 4N76A 1REQB 1C1XB 4MHSA 4LO6B 1SXJD 3LD8A 3KLSA 4FYWA 1KYVA 1SDDB 5CAEA 2ERFA 1SKYE 2V3VA 3CU5A 4K9DA 3L8HA 1SCUA 2JKVA 3FSGD 2B2XA 4I8XA 3QFRA 1ZM7A 2V8OA 5LDDC 3TVYA 5LZ6A 1LI4A 3AU9A 2XXJA 3L40A 2OCYC 1AHIA 3QVWA 5ES4B 3J81A 5JWRA 3L01A 1PZXA 4HAOA 3BMOA 1S0BA 5CW1A 1HGXA 3S8YA 3FSJX 4K05A 1VJDA 2GD6A 2IHBA 1Z9BA 5E6UB 4QU2A 5I7HA 2Z8YM 4H6PA 1IHOA 4F38A 1LK7A 3NNJA 1M34B 3BXHA 1J8VA 1W9TA 2NU8B 3RMXA 4YEDA 1JQ3A 2ARKA 5I01A 5EP4A 1S7GA 3HRHA 5GZDA 4F4JA 1H2BA 4B7ZA 4O4LA 4FOVA 4HG2A 4WJLA 3DYBA 4KO8A 3IUNA 4BNXA 4GWGA 1UMCB 4HZGA 3C3DA 1JHZA 1YQTA 4MOWA 1YR6A 4X1IB 2GOYA 4LBKA 1T5LA 1GEGA 2BPA2 4BP9A 2ZXFA 1G3RA 4M49A 3ZWWA 5JSQA 4RS4A 3V8PA 4YG0A 1KH2A 4OLLA 4ZQIA 2AN5A 1ZGJA 4PS0A 2O8BB 4EOGA 1Q8SA 1QFYA 4DM3A 2QRLA 3BXFA 1Z4JA 4BV3A 3MW4A 3KQLA 4JP1A 3AP1A 3QIAA 4BMYA 3R0ZA 4YZ2A 1DDIA 5E9WA 4P4SB 1REEA 3E9DA 1JECA 1X7ZB 4I4IA 4IP0A 3WV6A 1PGOA 4Z4CA 2J9XB 2AYHA 4TUYA 2YBKA 1PGNA 1OWOA 2ZBPA 5FOUA 2QG6A 3EQZA 4RV9A 4DC1A 4TRRA 4ZOEA 1QANA 1N0VC 5HCNA 1MF7A 2JIDA 5K3EA 2RBEA 4BKUA 5JSHA 2IZOA 1PK6A 5L73A 2DTYA 1G9DA 4M55A 1AXZA 2X7HA 3GA7A 3MAGA 2HCRA 4P7FA 3IMKA 3N0VA 3FHTA 2G4VA 2XRZA 4INAA 1W94A 1ZRNA 3O8OA 4G0PA 2XB9A 4WNCA 5AW7A 2NSLA 4C14A 4E2WA 3W5MA 3BBPA 1JR2A 1R37A 1IMOA 2VOTA 4O4IF 5DGCA 3IDOA 4CKXA 4XE9A 5EIXA 5JI7A 5FL3A 1G3QA 2D4AA 3C6MA 4R4ZA 4N6NA 2ZRJA 3QM1A 4PTLA 2BFFA 4LE4A 1KFKB 4YC7A 1W47A 1QRUA 1L8XA 2CXHA 3RT7A 4CN8A 3MG9A 4FSDA 3G2MA 2JHCA 3SQNA 2ZI6A 2WL1A 4UHBA 3FVWA 3ACCA 4PQYA 2DMRA 3U7GA 3GJRA 1K9VF 4RY2A 1GYQA 3ANLA 3P2OA 3R44A 1P8AA 3HNPA 3E05A 1YB6A 2HF8A 5C8VA 1WBJB 2R87A 4S3MA 2WYFA 2BQPA 1MH1A 3NXSA 4YT8A 2V09A 4MVJA 1S9DA 2XH6A 1RUJ1 4ND6A 3QYFA 2WK1A 4MKGA 4GSYA 2AT1A 4MKXA 5JTUA 4Y9TA 1NCQC 1F8GA 4Q4X3 3TG8A 1C1DA 1PTJA 2DWOA 3C98A 1NCQB 1C41A 2W1UA 2FV8A 1YL5A 1N34B 2G83A 3VSBA 3MSXA 3E3AA 5B1EA 5MGBA 4F4CA 1FB5A 4QKQA 3N2IA 2EHDA 2B4YA 4QX2A 4FYHA 2QA5A 1GWLA 3QLEA 1J9EA 2VQUA 4FSJA 3NOVA 1OX4B 4EYSA 1P1KA 2N42A 4Z6KA 3G6JB 2VYND 4CDQC 4R9NA 4CDQB 1IWOA 3AR9A 4U7FA 2OZLB 1BK1A 1WBDA 3KKEA 3D3JA 3HEAA 2JLQA 3WX0A 4E5MA 5AICA 4OL0A 3UGJA 2XTMA 2A5DA 3V8BA 2GEKA 4FYVA 1O6BA 1YU6A 2RDSA 4BZ4A 1LPMA 1TM4E 3K30A 3GLFA 1JMYA 5C8CA 3HCEA 3NALA 3NVKI 2FZLA 2P0AA 3RBXA 3P2YA 3VISA 4FYXA 5GZ6A 1TE2A 1C7QA 4Q01A 4JYCA 3MUEA 3ZV4A 5LQKA 4AS2A 2KB0A 2VF7A 2YN0A 2XOKA 3OURA 3HE3A 3BMQA 1HQYE 2PELA 4C9BA 1SULA 2WDBA 1SBHA 4WEQA 1QV9A 4RXMA 1QM5A 4R2MA 2OYCA 4DDMA 4DMHA 1LOBA 4HQ0A 4CM1A 4R0MA 2AGVA 4E12A 5CB8A 2NQ8A 1NBEA 3UV6A 1K75A 5KC8A 4NLLA 2FWRA 1FMD3 3E3MA 3U7EB 3IBSA 3JQ9A 3TOSA 1JZ6A 1KOLA 2XKBA 5EJZB 4MGZR 1GPWB 2X41A 3WLMA 4QLOA 2WG1A 3SS8A 3A4NA 1E2KA 3ZBQA 2PLFA 1W36C 4CCLA 4O1MA 2QD2A 4OHKA 5E8AA 2AX4A 2GJKA 1AUOA 2CJWA 1W36B 3CT6A 1G6NA 2DPHA 4DSTA 2C5LA 4XMAA 4JP2A 1EVLA 3K53A 2ALJA 1ZZ8A 3KFXA 1FIUA 2VDQB 2VQAA 2R1ZA 2ZYGA 5I7UA 3U3RA 1RXVA 3OQMA 4L28A 4G3YC 1BXHA 1P4HA 1PR3A 3ET5A 1T9BA 2G8NA 4A2WA 2QNIA 4RAOA 3VO8A 1RPJA 3TTXA 1BVUA 3HBNA 4JJKA 1TCCA 4DC9A 1AR62 3D5TA 3ANSA 1ZYUA 1GSIA 4N47A 5HTKA 3UJBA 4LZWA 3BSSA 1N1GA 4LO4B 4YRZA 1UZUA 1U3DA 4UREA 1XTPA 3NTLA 3UQZA 3JYPA 1TAHA 4EPRA 4XW3A 3ETHA 4Q4CA 5MHTA 4E7OA 5JCZA 4UMFA 3OAAA 1XSEA 1II8B 2M9MA 1EBUA 3VBHC 3SYRA 3BGDA 4OL9A 2F00A 3WLHA 1F4PA 2QX8A 1PUJA 3TEJA 5JZGC 1Z62A 1K66A 1EDDA 5JZGB 2QTVA 4UHJA 1K45A 3NWBA 5DSXA 1GKYA 2VZLA 4FK8A 2LD4A 2XX3A 2VPPA 2TS1A 4HFNA 2IBTA 4ONUA 1LV7A 5C52B 4ZV9A 3N9IA 2LXNA 4ABYA 5LNK6 3SU8A 1Z15A 4GU5A 1YRYE 1JLRA 2YOHA 4D4HA 4IIUA 1MV5A 1GLGA 3INYA 1V6JA 1PZ9A 3RAFC 4XDYA 2FMUA 1Q15A 1CAXA 2J3LA 5CAEB 1SCUB 3K5PA 4WBXC 4DT1B 3HUUA 3LEGA 4HDOB 3VD3A 3LGXA 2V5YA 4QHSA 2WG0A 2YHAA 4OD0A 3QD6A 4RIGA 4YAJA 1ODTC 4UNPA 3V8NA 3SX4A 1ZOOA 3BMOB 4R9CA 1KI3A 2MT9A 5FPPA 4K6KA 5DF1A 4G4SP 1O8PA 1JZ8A 5KS2A 4HR7A 4YDRA 4X61A 4NMWA 1ZISA 4YPJA 4JC4A 3VVLA 4JGGA 3Q88A 4R1QA 4XTMA 2BFUS 4K9RA 4MLCA 1KFCB 1XDDA 2CXNA 5C7IO 1WMAA 2WYOA 4AKEA 3AHDA 4X6RB 3PU3A 1N5OX 4N65A 3SEZA 3KT6A 1NKSA 5AK3A 4C7OA 4LT5A 4O4LB 5ALGA 3KQ4B 1LESA 1MAWA 1TQ2A 1MS5A 2DSNA 3BK1A 3B9PA 1NT4A 2HWD1 2C6SA 3KGZA 4O5AA 1M2KA 2DM6A 4C4RA 1I6MA 1RMTA 4ZCRA 3VOAA 2VCCA 2MIIA 2VNSA 3TIFA 4I4TF 3WVNA 4N7IA 1JZ5A 2O3RA 1U0LA 4NBTA 2QP4A 1W34A 3KTDA 4FYYA 3T1QA 3P4XA 1T0BA 4BNKA 1E9EA 1QP7A 3RS2A 3K6SA 1KH3A 4Z8XA 4Q4JB 4XUPA 4YGBA 3OQIA 1T1SA 2W2NA 5C8WA 4OHXA 2AG5A 3VPHA 4TUYB 5SZIA 5DZFA 5FYYA 5KYWA 3G8YA 4NR1A 1Y3CE 2PMKA 2I80A 1KKMA 4FT8A 3C24A 3OCCA 4XYGA 1GA1A 5AXCA 1E3LA 4P2BA 1PK6C 1EAH2 2Z3VA 1M7GA 3DEFA 4TT3D 1PK6B 1YMUA 4IGQA 3EIXA 1FAYA 3L7KA 5HIMA 3F8WA 5EZYF 3T5BA 3HB5X 4BVKA 5LK7B 1RWKA 2DQSA 4AFMA 5DE3A 1EUUA 1RINA 4GFDA 4FPJA 3VZPA 3PXCX 4RX1A 2WIAA 1IXRC 3H3UA 4ZZ1A 2V5AA 3N28A 2WSYB 4YB8A 3LIPA 3FKJA 1MTZA 2JI8A 1W3XA 2EXHA 5IMSA 5C4GB 2W6JA 2BFFB 1DQ0A 5JR3A 3IVGA 5L9VA 1AX2A 1WA4A 2EIEA 4GM1A 1KVUA 1FYFA 3Q0TA 1NJ1A 2CXPA 2WF9A 5E89A 1QGAA 3KV4A 1YNOA 2DURA 3QBEA 4ZVPA 5DU2A 2JHAA 5EPOA 2QGNA 2UYGA 2P2KA 3JVVA 1ZOSA 3VC7A 4X1YB 3BRWA 2RS51 5L53A 3TXYA 4DMGA 1RUD3 2IP4A 1YVRA 1CQPA 1XKTA 5J5AA 3VLBB 5ITWA 3N0RA 1PVC3 3PPIA 2R072 3RSGA 2RS31 1CR6A 3Q7QA 3A2LA 1SRRA 1PTJC 3B9CA 1C1DB 3LPDA 4U7HA 2ZGOA 1H1TA 2C2WA 4UUQA 1JSLA 1VL8A 5SICE 3W7BA 3PNSA 5AM3A 2HQSA 4JP5A 3WGVA 1MOZA 2P1ZA 2FMDA 4XDGA 2WI8A 1FUYB 4I7EA 4LHWA 4OQMA 2VO1A 4GPTA 1E2PA 3R0QA 2CMHA 1HYBA 2FMYA 2OHJA 3Q0IA 4ZXKA 1V8PA 1XTRA 1PEKE 3OTIA 3LQRA 4BQ2A 4HD8A 4D41A 4QG3A 5IT9A 1ST2A 3ZC3A 1AHSA 1J23A 5IC6A 4DSNA 1JL3A 3CEPB 3H9JA 1P5RA 5JNSA 4DWJA 3JQGA 2CU5A 5CDTA 4KFSA 5E4YA 3WZ2A 1C8NA 5L4SA 4Y1UA 3C6QA 5G4KA 1O6CA 16PKA 5C8CC 4WADA 3GLFB 1S3FA 5CVTA 1OZ0A 5C8CB 5FR3A 4FI3C 4KPYA 1CR0A 4LOIA 2C5BA 4XM1A 3RYFA 1LENA 5GONA 4M4RA 1U4SA 3VR5A 4YFWA 3TLMA 4OJMX 1O7FA 4PLWA 3VOBA 5KEIA 5IXSA 4BQ4A 4ISCA 2G4IA 2QP3A 2EXJA 5KOIA 3T5AA 3BMQB 1UOOA 4K6OA 3GN2A 1OBFO 3LHIA 3PFKA 5FNVA 1NY72 1X1SA 5LA6A 4BPRA 2I6XA 3NW4A 2PZ8A 1RUI1 3KFVA 3RV4A 3GELA 1KJ9A 4GWLA 4GX5A 1I5ZA 4HGOA 2RHRA 1VPTA 1YK1A 4WZAE 4F93B 1ZUHA 4MVJI 4QO8A 3RZHA 2FSFA 2BNMA 5TS2A 2DX7A 3IEKA 3FHJA 1QGLA 2JEYA 4O4HF 3V4FA 4LK6A 2CJWB 2LM3A 2ZPAA 5IT0A 2HFKA 5EC8A 1MVQA 4B3FX 3TB0A 1A5TA 4MUNA 4G5QA 3ENKA 1V70A 4RLHA 1SUDA 2YNMD 2BBWA 2FQ1A 5MDHA 3G79A 3UMRA 2NO4A 4LWOA 4DIQA 1IN5A 5HZKA 2YL2A 5DHUA 3R4DB 2OV2A 4R2WA 5HCFA 1TEXA 3U3ZA 3H8OA 4XA8A 2Z30A 4IPTA 4I9HA 3H5OA 3I6BA 5CNMA 3BG5A 3JQQA 3TL3A 4FNAA 1LSJA 3RS7A 4D6XA 3IJEB 2NUTA 4QDKA 5LUAA 1FRZA 1V00A 5TPZA 2XV1A 1ZO8A 2ZOSA 1M76A 4YGEA 3MIHA 5HS4A 3Q3EA 4UOZA 2VHJA 1Z3IX 5D5PA 3IP5A 1G8KA 3IP3A 3JWHA 3RW9A 5LMZA 1OXBB 4GZ5A 3I2GA 3DXUA 2CDRA 1ENSA 1NVAA 2XUIA 4IDZA 5TQVA 1L4GA 5BQXA 4HXFB 1PO21 4FFIA 2QTVB 1DDLA 3T30A 2JF0A 4NMMA 3NHKA 4UFLA 2DF7A 3HNRA 3OEAA 4W5QA 1MHPA 4J43A 1WDLA 1XRQA 4LJ7A 1GDDA 3ZY2A 1ISMA 1ORTA 2DT5A 3FMPB 4XB1A 5L40A 4IIDA 3L4KA 2O0OA 2FPGA 4FPGA 1Q6ZA 4NI5A 2QLBA 1HRI1 4YVSA 3HG7A 4GPBA 2ZK7A 3U4HA 5HF8A 4YZ1A 1H2EA 4WM7A 4EY7A 1IJBA 4XFDA 2ZE5A 3A1NA 1CAXB 1G8WA 4HWPA 4U8HA 4QDXA 3G7NA 1V43A 2VOJA 1S0GA 3DMPA 1LTQA 4UU1A 1KI1A 3A0RB 3BXXA 2IV7A 3GT4A 5CH3A 3ZOZA 1ZINA 2PJDA 3I9JA 3ENNA 1VFPA 2O52A 3HZZA 3BVCA 5KDOA 2BKAA 1DQNA 3OE7D 4RO0A 4Q4AA 2EBWA 1JYXA 3EBRA 4DUGD 4L3VA 3ZYRA 1VALA 3T9EA 2HYDA 4EB6A 5BSTA 1ZK0A 2KBEA 5FOQA 2H9IA 4I6JA 2OSVA 2IPMA 4OA8A 3OTFA 3M33A 2JK1A 2ZM6B 3CNNA 3L7IA 1RTKA 5FI0B 5F1YA 3F0TA 2J5QA 3WRXC 2RG1A 4GLLA 4CTNA 3WL5A 3NIDB 4C7OB 5FYIA 1J33A 4UM7A 4DYHA 5KVCA 1D8AA 1Y5IA 1LQUA 4MDFA 1W25A 1OIWA 3JQCA 4PNZA 4HH4A 5ALPA 1OCEA 2FSGA 5LZ9A 4L99A 1B23P 1KJYA 1WXFA 1DEKA 2VYCA 2VA9A 3Q8BA 1VE7A 1A4IA 2R85A 3VMFA 2I99A 1G21A 3EMRA 1WP9A 1YFYA 2PRJA 1Z4MA 3ZVMA 1AKVA 1RC0A 1U8UA 4G2NA 2NZ2A 2P4EA 2V0NA 3K6SB 2CYBA 5ENVA 1EFHA 3WCSA 1NUQA 1OH3A 1Q5PA 3OQIB 4Z0TA 2B8TA 5KYWB 3IBGA 4REMA 4XKJA 3F97A 1JQAA 2H0BA 2LCIA 1GZHB 1RI4A 1OH4A 3LB9A 5BSGA 5FZGA 3I3SR 1A9ZA 1J2YA 4BQSA 3TGWA 1ORHA 1X8MA 4J49A 1IUKA 4LCBA 1NTOA 1QHDA 4DRXA 5F5CA 2ZHNA 4ZU3A 1U3FA 4YR7A 4LNHA 4FPXA 5EWSA 4FPOB 1F1BA 4B79A 5AP9A 3K2BA 1OB2A 4NICA 1FNDA 1HLDA 4PR3A 2JCXA 1XZAA 4JKLA 1G5IA 1NLZA 2D3RA 1O5UA 2IIVA 4H55A 1OTHA 3MEPA 4KU4A 2RHTA 1SVLA 5JALA 3PVSA 1BLZA 1REDA 3IBTA 5C7GA 1ZI9A 2DLDA 4KOAA 1V2HE 3A1CA 1YCDA 1FU4A 4RD2A 2HDWA 1RHQA 4CN9A 1FFYA 2BI7A 2BGGA 4DSUA 2H9YA 1ZUNA 1JQBA 4YK7A 3HGTA 5B1DA 2VNIA 3V4ZA 3L41A 2TEPA 4GP7A 4GRIA 4C4SA 1ELOA 1E59A 1T1EA 4FJ2A 4XDPA 4XJUA 5IKXA 2GCIA 1N2JA 3DFMA 1SY7A 3QYAA 3VVCA 3RSOA 1RWVA 3U17A 1KDTA 1QHGA 4BNTA 1R5NA 2GAOA 2OFPA 1WDTA 2WNIA 1J8MF 1JDVA 2W39A 4BLQA 2UXCB 1ZNPA 2CWDA 3UXMA 1EEXB 3I0MA 1KS2A 5C7OO 1Z22A 2A9OA 4BC0A 3PC2A 2IEDA 5BNWA 2BFDA 3LLVA 2GXUA 3RFTA 5L7OA 3UM9A 3LDGA 5FUNA 3GLHA 5LQNA 2QFEA 3KKMA 1OPXA 3KJIA 2XW6A 2O05A 4XDOA 1D09A 2JIZD 4TLGA 1WTCA 2PRIA 4WN3A 5G4KB 3VNBA 4FFRA 2BY4A 1GPKA 1Y6GA 4DQ0A 3A6FA 3SVLA 1GGHA 2F17A 3EH1A 1KO8A 1SCAA 2B82A 3OPYA 3RRZA 3RYFB 3HBZA 1IBKB 2QQPA 5GONB 5TLSA 5EYPA 5LB2A 2FPKA 2ZCJA 2QRJA 2IWGB 1IY8A 4IXTA 1GKUB 3TG2A 1V7ZA 4KLCA 4RA0A 1D4OA 2IU0A 2PQ2A 1IWBB 3DGEC 3P71T 1MX1A 1JEQA 4MLDA 4U9UA 2BUBA 3HKBA 5FNVB 5IATA 5JNVA 3GLSA 4UXJA 5LA6B 4EHFA 2Z3WA 5JFGA 4CCNA 1GPMA 4IV5A 1KSJA 1HRV3 3FOEC 1NJ2A 1SN7A 2J9YB 5FZMA 3QJGA 3VDCA 4U2AA 4MZUA 2YFQA 2QL6A 3NDIA 2BDUA 1VHDA 2FA9A 3A3KA 4XIFA 2XTAA 1KBZA 2HA0A 4KN8A 5GALA 1ESNA 3TRHA 5J36A 1VP3A 3RBVA 4IVPA 1GQQA 4I81A 2KLBA 4OHWA 2W00A 1L4EA 4ES6A 1PJSA 5IABA 4YYEA 2CJPA 1UMKA 3P2EA 4NY1A 3K2QA 1JJFA 1JQKA 3LQ4A 5F1PA 2BNNA 3ZIUA 4J1NA 4XX1A 1GOTA 3TBFA 3OEEA 1X7YB 4QOHA 3PHLA 2C8KA 1ZIOA 2GMWA 2P37A 1T3HA 6Q21A 2HLDA 3WDWA 4P38A 2B99A 3RVRA 2XVLA 1US3A 4WCVA 4FZRA 2NUTB 2WPDD 3Q7RA 2E53A 5AVPA 4M38A 1VPHA 3IXQA 4K9MA 3VDQA 2H08A 2NU6A 5FP4A 5TNXA 1NM5A 5A6VA 4NDZA 1A4RA 3VPFA 3CVWA 3OX3A 4EW2A 1V11A 2EL7A 5BW4A 4C2UA 3ZJTA 1PJ2A 3LAWA 4URHA 2K2QB 1GSHA 4UBJA 5G0UA 3F2VA 3SJBA 4P3XA 3L7NA 2VRNA 4ZRNA 3H1YA 5IAKA 1JB1A 4MEJA 3VPDA 2HSJA 4UDOA 3SEAA 3RS5A 3DE5X 1CJSA 2YUIA 3T5TA 4AK3A 1NUSA 2J1TA 5AHKA 4Q03A 3WKAA 2GFQA 2ZUCA 3ASUA 4P00B 4YVSC 4CTMA 2FPGB 2Q1XA 2WFF2 2NSJA 4UJ5A 1OB5A 4YVSB 1NW3A 1YE8A 2ZSFA 1AK1A 1XE3A 3BJZA 3MUNA 1BSVA 3AFMA 2JLZA 1G19A 5HGXA 4WM7B 4X8PA 1ZC3A 1PNQA 2ZBEA 3O3CA 2G25A 4YNIA 1I24A 1IK4A 3VB9A 3DWIA 5CT4A 1DOAA 4MKHA 4CV2A 2AQHA 3LUBA 5J37A 2VL4A 3SC6A 3HZRA 3B7GA 2PAMA 1USIA 2X9NA 1LECA 4WVZA 3Q8FA 1OREA 1J09A 2ZJFA 2IFRA 1BS1A 3T7IA 4J4TA 3I12A 4Q4AB 2HIGA 3R6TA 1C0IA 2C31A 5DEOA 3EH2A 3N8KA 1QONA 3BD7A 1UKZA 3ESZA 5FLXA 3GYGA 4EB6B 2DKOA 1E61A 1HT1E 5J2TA 1ZUD1 1OI7A 3TFWA 2CXXA 3GFBA 3PQ7A 5HIAA 2ZGUA 1MFPA 2GXQA 1CX4A 2FAXA 3ZFGA 2EAAA 5HDQA 3T3PB 1J42A 4D6PA 1WNTA 4DUXA 2GAFA 2IUEA 3K8YA 2J9ZB 4QB2A 4HJRA 4RMNA 4P84A 3W3ZB 1SOVA 5JJIA 5EUBA 3I1JA 2VKTA 1V6CA 3PFGA 5JI2E 1QXRA 3W59A 4Q7MB 2YY7A 4MVJF 2NU7A 5FLYA 2QRGA 3AI3A 5HBRA 5DW3A 2J09A 4HH0A 3W9SA 4ISRA 3B1YA 1MZEA 2LTNA 3KYBA 2OZKA 3GR6A 3I0NA 4K9NA 1G21B 1DKNA 4OSOA 2AUTA 2O3TA 1R0KA 5A3RA 4OFBA 3EK2A 3RABA 4BV8A 1EWVA 4P7JA 2GASA 3O2QB 2AMVA 3BA6A 1UBCA 2CLCX 4PZZA 2WQZA 3HQRA 5FO0A 1QYXA 3IPRA 2JG9A 2WG2A 3O8RA 2D0IA 3VOTA 1QUEA 3L4EA 3M7AA 3RNSA 1N6NA 4R98A 3V7YA 2IHUA 4L27A 1W8DA 3ZXEA 1QLWA 3BHNA 1CPYA 1I3LA 3M6AA 1IG3A 3KKOA 1M1YA 2PRZA 3EF3A 3ZPXA 5BV8A 3MIZA 3IP6A 2FZWA 1NBIA 2ZR8A 1YFUA 3SDZA 2VYFA 4TMTA 4DRXB 2ZYDA 2AVNA 3EAFA 2QXYA 2VJPA 4LE3A 2VNKA 2Z43A 1XZJA 2M1XA 3ESCA 3PC8A 2V7EA 5IC5A 4F06A 5JWPA 3E9ZA 1OROA 2H16A 3I54A 1QO0D 2HKXA 3QVVA 2E82A 4HG6B 4ITUA 2ODBA 4EVIA 3ND7A 3FJYA 2YYSA 4A92A 1NQAO 1I1QB 5LM3A 3D8RA 2IXHA 2ODQA 1R6DA 4R83A 1FP6A 3PQ5A 4FE4A 3S4YA 5JANA 3UCXA 2R79A 1A9TA 4W8HA 3MHPA 5G02A 5COBA 4XF9A 1H6AA 4HNVA 5LCXA 2FN7A 4F9FA 3Q15C 1ZUNB 1D0SA 3EZNA 3VPBA 3HUDA 4V0MA 1UK8A 5C0OE 3D7MA 4BFLA 4FQZA 2QUJA 4MDYA 3HI6A 1UC4B 1CX9B 3B78A 2FGKA 1NKGA 3CX3A 2PWZA 4FDTA 1EFCA 5K45A 3EPJA 4XWAA 2JRCA 1PR2A 1E9SA 3ENQA 4P5PA 1TTQB 1JHUA 1XHFA 1Y3BE 3UCFA 1Z2CA 3JYOA 1A9SA 3WKDA 5ESRA 2ZGRA 5CXXA 5EKDA 4QRIA 1USWA 3SIWA 4BA6A 1T9ZA 1QUFA 4L08A 1Y1PA 2C2ZA 3ONVA 4TZ0A 5HUQA 5LQSA 2BFDB 8ADHA 4QUHA 4H4EA 4IZHA 5IWAB 1RXCA 2IH4A 1PD0A 1A3CA 3GLHB 1OBVA 4EV0A 1C80A 3D43A 2X3UA 2FKAA 3P0JA 1XNKA 1YHZA 4G0YA 1QOOA 4ZVQA 4IZOA 4EB0A 4QQOA 3DCIA 4G6ZA 3WF0A 4NOJA 2RK6A 1EPUA 1EXWA 3HABA 3KSBC 1EUQA 3JU3A 1GUZA 1Q83A 5CDGA 3OPYB 5CLHA 2CHGA 4YRKA 3L8EA 5DJ5A 3WX5A 2P34A 3L0OA 4KXUA 4Y30A 3POFA 3GCDA 1AUVA 1IFXA 3PF8A 3HKBB 2ZRLA 3DEZA 2WZR2 1C2TA 5A4DA 4Q39A 1BFDA 5T4FA 3RODA 3TECE 3S1LA 4EA9A 4P3NA 3HDGA 4G5SA 1Q17A 4QODA 3SMVA 1E69A 2O23A 4OGLA 3ONWA 2ZHMA 1XRPA 2O2SA 3BHIA 3SQWA 4G23A 3HU1A 3U60B 1QYIA 1W4ZA 1ULTA 2YYOA 2AXPA 2G0NA 3OT1A 4EI9A 3AERA 1ULUA 2IWHA 2VR1A 1W93A 3DTYA 4DNYA 2V55B 2UAGA 2OK7A 4B4WA 2FDIA 3O1OA 2CDNA 3NBQA 1SEFA 1YKSA 2VDPB 5EVCA 4TV8A 1JE1A 2ZE7A 3E9RA 5TQ0A 1O8SA 1WVMA 3BS4A 3IR5A 4N5MA 3TX6A 1YTLA 3HLTA 3CE9A 2HU5A 5A5DA 4UUOA 3A04A 2OD2A 3K8OE 5U1PA 3M70A 2QI9C 2HBTA 4HI0E 4E2QA 2HK8A 3E84A 3WF3A 1Z0ZA 1GPAA 1IY2A 5H3HA 2O0KA 3TOVA 4Y1EA 5A6SB 4NBLA 1VAMA 1L5ZA 2WZEA 4QDUA 3MC1A 3LKJA 3WK7A 4Q00A 1W29A 1AL21 4A6PA 1Q3HA 4EEKA 4IEQA 5FWNA 1F4LA 3IT8A 2DT8A 2YXLA 3PUQA 1SMKA 3TE7A 2NU6B 2AE1A 4GKBA 3NWOA 2A2ZA 2PAKA 3QEMA 3OPYI 3HXPA 4XIKA 2VTVA 4M89A 1F1JA 4G84A 1V11B 1J84A 5KREA 1ODJA 2P11A 2FMXA 3CH7A 4LKDA 5FORA 5FP8A 2XYPA 3WSWA 3KQVA 4FP3A 5KCZA 3LZZA 1WCUA 4CPBA 1HW5A 1TUBA 1OWPA 2JIJA 3EIFA 4KVGA 1YQCA 1QTQA 4AGRA 1GYPA 5A3OA 3PHJA 3RSLA 2VWHA 2J41A 1T1GA 1W2HA 5EOVA 4HH1A 1VDZA 1QOPB 5LA0A 2BHTA 4MUGA 4N9HA 4EVQA 3OZUA 4IKEA 4KX5A 2A5LA 5IM4A 5LMUB 1JWBB 5C9ZA 2JCYA 3H5VA 5HJ5A 1Z17A 3O1RA 1ZUWA 2V73A 5CA0F 1XXHE 3TM4A 3UMFA 3C16C 5DWQA 2Z69A 2OHHA 1KARA 1ATIA 3LIGA 2I3GA 1HKHA 2BI4A 1KQOA 1QFZA 3FF1A 2XGGA 5JRZA 4G1FA 2Q3MA 2YPDA 2BGCA 2OSBA 2AENA 5AW8A 1S0CA 5J2TB 1ENYA 5FIUA 3ZFGC 2VUDA 4XM2A 5LW9A 2YMZA 3ZFGB 3AL3A 4OQEA 4WOJA 1YR8A 1SHZA 4OGKA 1N3LA 1KSFX 5T54A 2EKDA 1NLMA 4BAUA 4JLPA 2QR3A 4YCCA 3DLAA 1HNZB 2UZIR 3U4MA 2IPNA 2NU7B 4YQFA 3TSZA 3WLEA 3STXA 1D4VB 2PQMA 3L79A 4BMVA 3DBLA 2EZ8A 5FYZA 4KXWA 4W8JA 3NNNA 4HYYA 4C78A 2XMQA 2GZDA 5DZSA 2SKEA 4YH1A 2HPZA 2FFQA 2F3SA 4C4YA 2FZGA 4HDRA 3U3DA 2R5NA 2BEUA 2JH8A 4ASUD 2W0MA 4JBGA 1A2QA 1BMQA 4IRUB 5LBBA 2OORA 5A7QA 1O4WA 1YO6A 2ZX0A 1BWQA 1R1A2 3DCYA 3D8HA 2WQZC 1BA2A 1TJPB 3Q3CA 3EIHA 4ZO6A 3KR1A 2O8NA 3WLQA 3D54D 1N57A 3NONA 4PLGA 4BM8A 1I5RA 1BDHA 4AEKA 1UU6A 7YASA 3KSAC 2KYRA 5FY5A 4XUGB 2XB4A 5ALFA 1DWUA 3UBTA 2PS9A 2P9QA 3CZRA 5DIFA 2FUCA 4B4RA 1Y9JA 1M1YB 1JYVA 2V7UA 1GQPA 4X8NA 1MAHA 4DOUA 5TF0A 3R8XA 5HSGA 2JI4A 4QX3A 2CHHA 3G23A 2Q30A 1WXGA 4RHEA 3CO5A 3TZCA 4QTXA 1GCGA 4F6CA 1E57A 4RCZA 3N59A 3PC8C 3A36A 2HEGA 2AJLI 3BE5A 2E4XA 3W5UA 3SJCA 2MWMA 4BO3A 3UO8B 1PFQA 4UW6A 2Y1KA 1DU3D 1M83A 4MWTA 2ZOEB 4G01B 4LX8A 4OCZA 1Y4SA 1IPEA 3AR8A 3DF0A 1TL7C 3DMNA 5LA6F 4DLPA 5TMEA 1P7YA 4WLNA 3TKLA 3H3FA 1VAVA 4NTZA 3KUKA 2BFAA 3KQQA 3SM3A 2CMGA 2JDUA 1U4NA 2A5YB 5T6MA 4AX8A 4Q9JA 1KDZA 1X0VA 3MGBA 2E49A 3LBHA 4KC0A 4FUQA 4ID3A 4KQCA 1KJ8A 3F7NA 1R66A 3BK7A 4BHPA 1YULA 5C9AA 4EY5A 5M2QA 3E48A 3WZLA 1UX7A 4Z92B 3HFRA 4LMFA 4MVJH 5EHQA 1QRRA 2XSZA 1KJJA 1V5EA 2GUWA 2ORIA 4MVCA 1QJZA 5YASA 4XFCA 4MV7A 5LLTA 1VE1A 1P72A 4NR0A 4FS8A 3V6LA 2OGUA 2REQA 2XQFA 1FU7A 2H18A 1FJ2A 5A3NA 2W2IA 1CQ9A 1XRNA 1ULDA 2G7MC 4BLOA 1II8A 4V2VA 4EWLA 3BCRA 4GI2A 2QQIA 3ZR6A 3NGMA 5BWMA 3VBHA 1MGOA 4KBBA 4BO6A 4YZ4A 2I2BA 1Y6ZA 4Q4Y1 1XJWA 3GJ4A 1OIVA 5C3RA 2O6HA 4LA2A 3SE7A 5DZGA 1FLAA 4LGCA 1W35A 3WR0A 1W8TA 3WLOA 1RP7A 1UJ2A 4XB2A 3OBTA 3LA7A 2XMRA 4OUEA 4B43A 2VTDA 1UBFA 3IMMA 3GRAA 1D2CA 2RE9A 2J87A 1Y9ZA 1MUUA 1PL0A 1OHFA 3HUFA 3FPKA 4UZSA 1FFHA 4DT1A 3C3CA 1WA6X 3WIOA 4LRSB 7MDHA 3OCYA 3KR2A 5DXDA 2YU2A 1M6EX 1CG6A 3E7DA 4HGZA 4DS0A 2CCKA 1KZHA 5DGDA 2RHGB 3JUUA 4RGGA 2DTWA 3HCCA 5D3KA 5EJAA 3F49S 3OT1B 5JE8A 3AERB 1CUDA 3BFJA 3L5KA 3B53X 4Q15A 2W6ID 1U5IA 3E0XA 4YMGA 3Q72A 4NCBA 4ZCPA 4A8HA 4JCOA 2VSQA 1N0WA 3KV5A 5H81A 4EF4A 2C24A 4Q1CA 4TV8B 3LBFA 3AP7A 2I3DA 2JDID 2JI9A 5TQ0B 3BB1A 2J1EA 1G5HA 3PC7A 1RRGA 4YMIA 2JE7A 3W6NA 1YQ2A 1H3FA 4FQ4A 5CPFA 3D64A 3ZCUA 4WUVA 3C2QA 2Z8YA 3GLGB 4R0NA 1R0YA 2WQ8A 5JHGB 3RTCA 4URWR 2QD4A 4V0KA 3PPYA 3T54A 4JEHA 1SCBA 3D1LA 3LCVB 1W8HA 3M5DA 4GKXA 2XNCA 2JZOA 1B43A 2XT9A 3MINA 4V3BA 1XNQB 1DC3A 1NZDA 3CQ9A 3T1NA 1QJEA 1D1PA 3NASA 1XE8A 1VHTA 3U4CA 4AF9A 2CL5A 2UV8A 5AD1A 3IE1A 1O4YA 2F4NA 4Q4JA 4IHQA 1ODFA 1RXUA 5A6ZA 1TMF1 1W8ZA 3L2HA 3QEMB 4U9HS 5M34A 4IDBA 3QOWA 1KD7A 1SVKA 2XKPA 3K77A 1ZZGA 3AWDA 3CB2A 4FFMA 2RIPA 3KE8A 4FWIB 2P69A 1W59A 3A1DA 2XMSA 1I5PA 3JTEA 4GKAA 4DXRA 2SHKA 1NF9A 1XO1A 3QWHA 3A9CA 3IHKA 3V6MA 2FWMX 3S0MA 1AR63 3S44A 1TUBB 4Q8LA 3I64A 1Q5OA 2N75A 5DT9A 4NX2A 4CR8A 1I8TA 3OBZA 5LP1A 1L7PA 4WY5A 3VAZA 1NG9A 1ESZA 3SH5A 1MEC2 5IZCC 3JQAA 1FK8A 3V80A 4AN4A 1ZVFA 2Y1XA 3ZHVA 1WW6A 1NMZA 3A9WA 3PDQA 1ZN2A 1GWMA 4L4UA 2CV2A 5K2MA 2HREA 1SG6A 1THTA 1TKBA 2QR2A 1LGBA 1TCBA 4A36A 1CXZA 4H1UA 4JH0A 4ROSA 1N3BA 3A6HA 3FPJA 2A9PA 2EF0A 3TCNA 1SCDA 3PCRB 3B20A 4KAXA 1TZMA 1KYYA 1WLYA 2GN6A 3EVFA 4R8RA 1T24A 2I76A 2X5IC 2FDHA 4IFTA 2DVGA 3ZHRA 4X1YA 3WJ2A 4R3NA 2DU1A 3DDNA 3H1TA 5F5XA 1O7JA 1JGTA 5BWCA 1BBT1 2R6FA 4QFDA 3DXFA 5GZ3A 5KJ1A 3LV8A 1OHHA 2YINC 3FAZA 3CB4A 1G7RA 4XHBA 4QQFA 3IZOA 1JG6A 1H0SA 2EIHA 1M7BA 3Q8LA 1LEDA 5D85A 1CP3A 1NXTA 2G9FA 3O92A 4D3DA 3HK2A 4KQGA 2FP3A 3EZFA 3VDAA 3L8MA 4UPVA 2A71A 5IAVA 3DBLB 1KGYA 3A25A 1WXEA 1X39A 4ZS3A 3HYLA 2D98A 3N7LA 3ZVXA 5HXAA 4HDRB 2ZUTA 4KXFB 2OORC 2BEUB 2RE8A 4MO9A 4URFA 2WIKA 5A3VA 2GPTA 2H5LA 1DHKB 2A7QA 2QQGA 3HA7A 3AM1A 4W8OA 2Y68A 3BERA 3SD7A 2Z42A 4LYEA 4PXSA 3K0SA 1VL6A 3ZCQA 1XJAA 1U1IA 4BQFA 1J58A 1OURA 3P5BA 2ABWA 4QXBA 4KE9A 1XN1A 3QFTA 4RF5A 1W4CA 4OMDA 1NJGA 1N7HA 4ND1A 3V42A 1VYVA 2XGXA 3AJRA 3BH6A 3F7MA 3UXYA 1UAIA 1QH1B 1O4ZA 3JR3A 1W30A 2FW9A 3I45A 3CJRA 3H97A 4X7MA 2RK4A 3BGOS 3PJRA 2G06A 3UT5A 4HVAA 2R5FA 3OUHA 4MA0A 4CHGA 4YRBA 1UOGA 1ACCA 3T5GA 1BVRA 2XLBA 4ZT2A 8ATCA 2ZYSA 4RMGA 4P9XA 1TO2E 3ROPA 1V5FA 2A5FA 3FCXA 2V7VA 2BFPA 2BW0A 4OUSA 1RE1A 1P61B 4Q1DA 4EDHA 3NJ4A 4GMGA 1MO6A 3TDMA 2RK3A 1F2TA 4AJEA 3K20A 1FUEA 3VZCA 4CCAA 2FRDA 2E63A 2DFPA 4OQFA 4AJ4A 4XYBA 3FPHA 1IM8A 1L5KA 1RQGA 5KHAA 2Q9UA 4QM9A 4NBRA 5ILOA 1QZZA 2B92A 1X14A 2XBO1 4H1TA 2J7KA 1SWVA 1U3CA 4H3SA 1XPWA 3UNXA 1DLLA 4E46A 1T15A 1RIRA 4BV2A 3AVRA 4DNQA 4FLEA 1QXPA 5C9AC 1P1BA 3ZWDA 4YUYA 2D40A 4H2AA 5C9AB 3MA0A 5KSOA 1CQXA 4XPZA 3C8XA 1GPDG 5CG1A 1Z2AA 1X1DA 1V6MA 4GP9A 1KBQA 4XACA 3H86A 4EYKA 5DLDA 2REQB 2Y0DA 3G2JA 2G9UA 2ISQA 1MB4A 4IGIA 3W5SA 4F4FA 4JLUA 3FMVA 3ZWAA 2GN8A 2MU1A 2QIOA 4NSNA 1S3IA 2PZMA 1B1AA 1YSCA 3IM0A 1DAPA 3OO1A 5DBEX 4OXXA 2Q62A 2XCSB 1WETA 4R2XA 5BSUA 1XJCA 3VBHB 2HT1A 2IYQA 5A9TA 5FWDA 1K8RA 1RBYA 4KXQA 1J0EA 2HHLA 1JWAB 4YALA 2NU9B 2P77A 5K4AA 2AZDA 4XQ9A 1DJMA 2FCRA 4QWMA 4GKYA 4L76A 1PFYA 1OA0A 2XYQA 1SHKA 5F6LB 4YCBA 1H2WA 3IDQA 2HEYF 2XYVA 2DFBA 5BNPA 4DMIA 1XE7A 4J7XA 3BL5A 3GOQA 3ROMA 1Z29A 4AF6A 5ADWA 4KR3A 3QU2A 2RG4A 2NVUB 4YAOA 2DUMA 1F6DA 1SHUX 4DBZA 4R8LA 3UAZA 4AP9A 5DMHA 4DQVA 4QPDA 4NIHA 4PEVA 2WJVA 1P9WA 3NW9A 5A5EA 3AOGA 2JBAA 1SOWA 5CBPA 2YS6A 3UMYA 3X2SA 3FDXA 2XNDA 4E13A 4FDLA 3KV3O 3BIOA 4CKWB 1FYUA 5ARDA 3P9XA 1UOPA 4LK2A 3PEVA 2XVKA 2WSSD 2WUVA 2WUHA 3SX2A 5U4QA 4DUZB 2WMOB 2Y0BA 2E32A 3FRJA 3DPRC 5FNZA 3ZE1B 2XMLA 1E5SA 2UUOA 4O5OA 2VUAA 1GU1A 3WW3A 4Q1PA 1QOQB 3QG5A 5CGZA 1X77A 4NIIA 4QKNA 2KHZA 4E4YA 3C1UA 3LHDA 4IX9A 1DTWA 1N6IA 3GRUA 3WRXA 3UETA 5FPXA 5J2TF 3VJRA 3FNHA 1DJNA 3EBPA 2I4MA 3X29B 3FGOA 4JUBA 4Z4FA 4CA9A 4DINB 4GVLA 3KQUA 1C4WA 1HQNA 2AH5A 4PI2A 1PGW2 1OWNA 2JWPA 4NFHA 3PHMA 5T4BA 4JBWA 3AM4A 1YDEA 2ZRNA 1QPGA 1HURA 1TUEA 3A27A 4P36A 3MINB 2CVFA 3O4FA 1U0NA 1UOBA 5EXSA 5GZEA 3L6OO 1S96A 3IEXA 3B60A 3Q9UA 2OWEA 4JCKA 3ADBA 1RI3A 1UPCA 1CK4A 1PJLA 4GOOD 2UU8A 2R96A 2IXDA 2WWGA 3BEDA 3BRCA 4JYPA 3FDFA 1N5JA 3Q7SA 1FPN2 4YRPA 2DB3A 5HUJA 4BFVA 5LP6A 2GX6A 4I30A 1OFVA 2PCJA 4AN0A 2XIJA 2JDHA 1YDMA 1G5FA 1C0EA 4BDSA 2IXEA 1CRWG 4XRGA 3LTEA 5CUQA 4AQSA 1GN8A 5EEGA 5HFAA 2OL4A 5DBHX 2G80A 3NT4A 4W5RA 4NULA 2JVJA 4FOSA 5FYQA 4LCJA 2DUOA 2HF9A 3U10A 2ZJ3A 3JQAB 4J8PA 1C9NA 1XLTA 5IT6A 2CDOA 2IYWA 5I8WA 1N5MA 4HFRA 1ND5A 1UYYA 5J3JA 1QIHA 5BPHA 1PWYE 1UL9A 4XLTA 1WSAA 3ORQA 2DRIA 2AC7A 1W2OA 3UGGA 4MV4A 4AKHA 4TLAA 4DR4B 5JJBA 3O47A 3ZCSA 3ZVRA 2ZAAA 5CM8B 4MV8A 2N1BA 1QPBA 1Y4ZA 3UMGA 3H2JA 4HNTA 1Z6XA 1KOFA 4DMCA 1PKEA 1DNPA 2A9QA 1BKDR 1DGLA 3GHNA 4B4UA 2J48A 2JFPA 5AOAA 1CHNA 4AHZA 1DI0A 4QMAA 3UG6A 1L7VC 2X5KO 2P67A 2NO7A 3H13A 4CEWC 1KETA 1VZ2A 2I45A 4QAWA 4CEWB 5AM2A 2HV9A 4ZO4A 1DJQA 2FEAA 1TG7A 4YP0A 3PU6A 1HNXB 1TB4A 1IULA 1IVSA 3KJQA 3TX2A 4QPNA 4CFZA 3IPLA 1UJMA 4ZYXA 4BIFA 1DBPA 4EF6A 3DGTA 1KTIA 3S55A 5LOVA 4WY8A 2CFIA 4Z82A 3D6MA 3J4UH 4WKBA 4LTAA 2X7XA 4EBFA 4F4HA 2R0HA 1XD2A 2R4UA 1ZNYA 4TXMA 1VE9A 1IOAA 3UXHA 4FAGA 3AXEA 4QXQA 3L1UA 4ZXFA 3AM3A 3IEUA 4WACA 4FFNA 3ME5A 3LL4A 4W6XA 3ZWVA 1JTFA 1F8FA 2EW1A 1J3QA 5M0TA 1CJCA 1SG3A 1PGL2 3PNPA 4I4CA 5BUSA 2DKNA 4F56A 3QBVA 3INTA 4UQLA 1GNRA 1KXJA 4KUGA 5JAXA 2ZUSA 1IKQA 4MZDA 3FN4A 1MX3A 5TEVA 4B3JA 4PINA 2HBUA 3GT3A 3UT5B 1POV3 4YW4A 5HCHA 3OCZA 4LRWA 3ZK7A 2XZTA 5BQ5A 5CVJA 2HWF2 4J9UE 1RD4A 421PA 3IT3A 1IOWA 1Y4DE 2VMFA 2I34A 5AM1A 1TPZA 1TZKA 1RYNA 1ZH4A 5EMLA 2ZTHA 2BHNA 4HK9A 4MB0A 2AWNA 2D00A 1WUJS 1QQP2 5IZ4A 3A11A 3WF2A 4O63O 3TR5A 2P2LA 4BJ0A 1GTRA 1Z16A 2XJPA 1PJ4A 1F2TB 2FRDC 4UAPA 3MWDA 5CURA 2OC4A 3LE8A 4X65B 3CF6E 3D8NA 4JKYA 1XYYA 4WQMA 1E2GA 2OCXA 2OKCA 4YM1A 5H1YA 1WV1A 5ISLA 4BVBA 3QUSA 4OXYA 4IDDA 5H3LA 2WN3A 4GIBA 2V7QD 4IGPA 1J06A 1SURA 2X1HA 2HRCA 5F1KA 2HMWA 3ZYCA 2Z2XA 4Y5SA 2QT1A 5IKEA 1O59A 2P41A 4L8LA 4ZQHA 2WVHA 1MB9A 1ORVA 2QVXX 1D0VA 1FOD2 1X7YA 3LDAA 4FFGA 3AR7A 3VZMA 5FOSA 4JBXA 1AYM3 2CYCA 3D4NA 4YCLA 4RL4A 2NMOA 4MZXA 3C7FA 1KFEB 4TKLA 1CUXA 2AFVA 2ZRQA 1FOEB 3TBKA 3E70C 4QIHA 3WADA 1ZOLA 3ADOA 2PWPA 4JT9A 5T5QA 1PZEA 1E79D 1TQ4A 1UAGA 1I32A 2J1SA 3IUMA 2ENWA 1KP9A 2AUNA 4UASA 5KYYA 3OZSA 3LFMA 1GT6A 4KQMA 1CUFA 2JJ8A 4Z9FA 3PUIA 3T3EA 4MUAA 5BORA 4CEHA 5IVBA 3P19A 2IBSA 4GH5A 3WGIA 3PITA 4PLOA 1JE0A 3ANTA 3ILXA 5TC4A 4YV2A 1H0HA 4MKZA 4EGAA 3W34A 2XWPA 2C07A 3ZN6A 4NHKA 3JZIA 4LBLA 1KI4A 2W71A 3B1WA 3NAQA 4QM8A 5BNPC 1HQWA 2P3SA 5BNPB 4MAFA 2OHVA 3HYRA 1V9U1 2QMQA 3FPSA 3PDWA 2I2CA 5IRCD 2ZZJA 3D7LA 5FO7B 1ONNA 4ZOCA 3RWKX 2IYNA 4EUNA 4G0WA 3NG1A 3DUFA 4JI1B 4ENWA 2ZCUA 1O8CA 4MICA 1X6VA 1G55A 1ML3A 3CEAA 4F2PA 3SIPA 4HB2A 3Q8MA 1SUEA 3MLKA 5BW6B 2VZEA 3HQ4O 3EFHA 1QNFA 5K3OA 2I66A 3FZYA 2JBAB 4RSRA 5CBPB 3PVNA 2H1CA 3LPLA 1YZFA 2XEXA 4RQPA 4PYOA 5EQJB 3R76A 2IXLA 1FY2A 3IQIX 3MMPA 5A62A 3RI8A 5IM4F 3LPFA 3FTNA 3L82B 1VMHA 1WUKS 3PBKA 3R4VA 5EE0A 3OQOA 3KYDA 4ZZ2A 4TRJA 3P20A 3PX3A 3QNMA 1OGIA 3BN3A 4H18A 1E1NA 1IBMB 3EDCA 3DZIA 2WJZB 3CRMA 5KIAA 1VCIA 1EY2A 3REOA 3TUZC 4BO1A 3QE2A 1DTWB 1XQ9A 4P5DA 3HYCA 2RM23 4EGFA 1ND6A 4Y0AA 2Y3IA 3CS3A 3II6X 5HR5A 2O1SA 3OIVA 2ONCA 3P8ZA 3EO6A 1P2SA 3DE0X 1QJY3 5A71A 1KRWA 5K0UC 1C8LA 4QD3A 1WBBA 1AR82 3BTAA 3WMWA 4DZTA 2IC1A 5J4HA 1YWGO 5ICFA 1E0AA 5LUBA 4N18A 3BWYA 1YR3A 5E1DA 2VZ9A 1N7JA 1I4TD 4KR9A 3FCOA 4TS1A 1JN0A 1GWKA 1KDOA 5B57C 1CJKC 3NJYA 4QRDA 2VUHB 3EHDA 5JC1A 1QKIA 2C2KA 3RROA 2RHOA 4GOXA 4NFSA 5LP6C 3BCWA 2UZ3A 5LP6B 1HM5A 4DHWA 3LQYA 3L8CA 3EZLA 4PZUA 1QQTA 4HN2A 3AW9A 2YVUA 3TPZA 3DCNA 1RXGA 3WE7A 2OZEA 4X63A 3C1AA 4QPGA 4KIFA 4BPZA 2HWC1 3L4BA 3EWIA 3N2KA 1IQRA 4A6XA 5G0WA 3H2KA 4U7WA 1HFJA 3RGGA 4A0HA 5FZAA 2WV7A 3PLQA 4JBNA 4IYRA 4NHEA 1XLTC 2A0WA 4F71A 1PO12 4QNRA 3NAGA 5D86A 5HIKA 4Q0UA 3T7JA 3JRXA 3K51A 4JIGA 1VRH2 2I67A 1O0CA 3PHBE 1VKRA 1DQ6A 4AXOA 3FWZA 1KOGA 5HXVA 1YUMA 5ALYA 1Y1SA 3LMKA 2XEDA 3MOIA 2CGPA 1Q1ZA 3SKXA 1EZZA 4RGQA 4KXMA 3U48A 3WNOA 2NVBA 1XA0A 3KUUA 3UK9A 3KDSE 3MQFA 4K0RA 1ZXBA 3TW4A 2QJVA 4AKSA 3L7AA 1OKKA 2ZR9A 3ZV5A 4MYSA 3MJCA 2B8MA 4JT2A 1XB9A 3PNKA 3IOEA 3GNQA 1ZC4A 4KODA 2AN9A 4MB6A 2ADDA 4MWSA 1IPSA 1L4FA 5L6MB 1EVYA 1LPSA 1BU5A 2I8LA 1QH9A 3HWX1 2RHPA 3QX9A 5AI6A 3JRNA 2R8BA 4J0IA 4XQEA 4MGYE 2DFKB 1OXSC 1SXIA 4KXLA 4QTYA 3K4ZA 3I9KA 2X76A 5FAKA 3RC3A 1UC9A 5LOVB 4JXKA 5A2QA 3Q3IA 5B5SA 2Y34A 3K05A 5GM1A 4U0JA 4LIVA 3WFIA 3NXKA 3L07A 5DM70 4UW9A 4Y8VA 1XD2B 2B7BA 1CEXA 4E2XA 4D0GA 3G8DA 2PT7A 5B4NA 4AVVA 3KNZA 1FFSA 2C04A 4GQBA 4Z07A 4NMLA 1C0PA 1Z33A 2IA5A 1ZI8A 4YT2A 1JHPA 2HQBA 1N25A 3GPIA 4L02A 1OYWA 1NI4A 4B46A 4Q4DA 4YJHA 4G5RA 4P4TA 4W9RA 4Q1FA 4HAIA 5CIRA 1N6HA 3THWA 3COJA 2W2MA 3CPSA 3SSOA 2G9QA 3Q5EA 4B3GA 1WJGA 3ROKA 4GPD1 4BBPA 5FY4A 1ZJZA 3JSXA 2IITA 2LGJA 4MHTA 3H7AA 3I83A 1PF7E 2PJRA 5CYFA 5IAEA 3F4LA 4R7TA 5A3PA 1D6MA 3DYOA 2Q4DA 4QZVA 4QDRA 3W5CA 3JBG1 2BZ1A 4KO3S 3HB7A 2YH2A 5EMKA 2WU0A 3ROGA 5JCOA 3I6MA 1AYN1 4BMOB 3B3FA 4R9VA 4C3OB 4ZC1A 2JEOA 2ZE6A 3MWDB 2GP5A 3JQWA 4GUDA 1BMFD 4XLLA 3I97A 4KXYA 3QH7A 2WA3A 3GC6A 2O8FA 5MFPA 2WJ4A 1PGJA 2QTMA 4I3HA 2IHJA 5ABPA 1D4M2 1CUVA 1ZW6A 2NMNA 4E03A 1MO2A 2OO3A 4XBNA 2B8EA 1S0DA 2GH1A 4HFMA 5D3ZA 4FDVA 1WD7A 1ZMBA 2J32A 3G0GA 4FX2A 3TLEA 5FK8A 4YAIA 2IQ5A 4IE7A 1TU0A 1PYDA 3E18A 3VDDA 4N4AA 4FC6A 1PT7A 4K46A 2D8MA 2R7NA 4HXYA 1YHFA 3ZBPA 2C88A 3GHMA 4PN3A 3KELA 2XOXA 5F77A 5A6SA 2YU1A 4O4LF 4YRQA 1L1RA 3OUZA 3C14C 5I47A 3C8DA 5F64A 1RXWA 3Q7IA 2C5DA 1ZBA2 4TX1A 4FX5A 2I5PO 1NV8A 2ZIVB 4PSUA 1S8NA 3UJAA 2VTFA 2ECOA 2VRBA 3W4IA 5EJGA 4BS9A 3K09A 5KYYB 1IBSA 5ALMA 5EZ5A 1WUVA 2BJHA 3VI4B 3VZLA 4YRAA 1U0RA 4K3UA 1Q50A 5LA2A 4C0XA 3RLFA 4CEHB 3RARA 3ORHA 1CYEA 2Y1WA 1G7TA 5KQRA 4KNWA 4OQQA 4LTDA 4L3OA 1VP9A 4XTCS 1ECBA 5HHTA 1PX3A 2P4SA 1GP5A 2GC0A 4M2LA 4PG7A 1TLFA 4TUYF 4ZPJA 3KSCA 1Q0SA 1TLLA 2EQAA 3ZN6B 5ICGA 1SQ0A 2WM9B 1RAGA 4YP1A 3DNFA 3LGRA 1BYHA 1R091 1PWZA 2RKOA 2YCLA 1EUDA 5KJCA 2EBHX 4KYVA 2ZSEA 4L9AA 4YDSA 2AOTA 2GQ0A 3MXTA 1NMSA 4DJ5X 1Y48E 4HEA6 2XLAA 5IH7A 1CEQA 3DUFB 3PSAA 1QZUA 2JDMA 1MS3A 4K88A 4MI6A 2R8YA 2Q1MA 3MBWA 2D2IA 3ITDA 4RL6A 4IHAA 3MIGA 4RQPC 1Z0FA 1PFKA 4RQPB 4LZNA 3MD9A 4CFSA 4EJ0A 4XW2A 1H69A 3T34A 3AR4A 1VPVA 3QVSA 5KSYA 3JVEA 3L6BA 2XITA 1GN9A 4G81A 4A0QA 4DDUA 3ULKA 1Q3KA 5IWCA 2JI6A 4F4IA 3KYDB 2GVDC 2IC5A 3ISJA 1SLCA 4O7XA 4JTNA 1TEHA 2B45X 5IAOA 2HRBA 5CX4A 3HYTA 4RCVA 4CM4A 1R081 1E6CA 3KZKA 2D2VA 3COYA 5K8SA 1IZ7A 4JEIA 2QF7A 4M1WA 1NVKA 3WW2A 1R12A 5KQLA 4S1OA 1QGUA 2J4CA 4DV2B 5BNQA 3BDAA 3P2KA 4UTOA 2P75A 3AETA 3BXGA 5J40A 2W91A 3RKSA 3VVBA 3W1VA 1ZRRA 5CFQA 4HUQA 1G5RA 1PZMA 1D2GA 2R1VA 4HRYA 4BNDB 3B2NA 1MO3A 4XAAA 4F2DA 2VHEA 2NO5A 5EJIA 3HCAA 2Q6KA 5HJ2A 5E1MA 1W06A 3IEVA 4Z1MA 1RUNA 3RUIA 2EWMA 4QYIA 1XRMA 4TM8A 5BRJA 2DJIA 3UJDA 3A6KA 2PUVA 2EZ9A 1KEWA 4FQ8A 1EEHA 1QR6A 2PNFA 3E27A 4QKDA 3IAUA 3J7TA 3NRJA 3GHHA 1M5RA 1JH5A 4A6SA 1MMFB 2Z4RA 2FOXA 5JECA 3POBA 1RZ3A 1TQ8A 9LDBA 3UUEA 2BFMA 3MGAA 1XBFA 4D5GA 3D3WA 5FBZA 4OFZA 2TMDA 1S4CA 4IIHA 4QPGC 1KPGA 2RS13 2WOOA 4MITA 3L4BC 2B6NA 4LRYA 4RTLA 4QPGB 3IV6A 1QS0A 1FUKA 4JLAA 4DCNA 2CDCA 3N2KB 3T2TA 1ZZ6A 3T9CA 5AVZA 3WNCA 3D1JA 4FI3F 4F84A 2PSJA 1VRVA 3PFFA 1XXLA 4QUBA 4D9BA 2VPIA 1JR3E 3X43A 3LK6A 3HB9A 4CEIA 3RZLA 1GFZA 3D6AA 4GDFA 1UIKA 1C8VB 3DE6X 3RQIA 2NLRA 2RMU3 1WHTA 1BCRA 1T1RA 3KVAA 2WWRA 4AI0A 1R3DA 4H59A 4MKRA 4OXRA 3AVWA 4B8YA 3QELA 4M37A 2WT8A 5DGXA 4BZPA 4S04A 1KQFA 4NBNA 5DAPA 3PX2A 1FFDA 1FVHA 3KQOA 4H7IA 1TW3A 1LY1A 4V2IA 4O08A 1H8EA 5BSEA 1DG6A 2ORVA 2PVCA 2XJTA 3UF0A 1X9PA 2X8JA 2WC2A 4B6FA 4AUKA 4CT5A 4FNGA 3QEKA 2ZJ6A 1S2MA 1NBMA 5G1PA 4PZPA 5L51A 3ACIA 4TYMA 1EYZA 4K6HA 1BVYF 4QEZA 2YW9A 5CR9A 1UMBA 5FWEA 5DXAA 2DAPA 1XF9A 1O95D 4OXKA 5KHLB 2UUAB 1EM6A 3LW8A 2YZ4A 1AK2A 4Q4W1 3H0KA 3MWLA 1RR6A 4CMEA 4M53A 2DGDA 1IEWA 2BMEA 3H7IA 3C48A 2B8WA 2P9BA 5CFPA 4UAUA 1JOJA 2C7BA 4CV0A 3RYHA 3D7KA 4NS1A 5ALXA 3I9OA 1W6NA 4Y4YA 1TIKA 4L4SA 3QWIA 1BXGA 1UMDA 1AHHA 3OBIA 2P2ZA 4Q7EA 2ZJBA 2XY4A 1IG0A 4PR0A 5BXQC 2YKGA 3QXXA 3HXQA 4UFJA 1V4NA 3C41J 1FVXA 3LT5A 4JB2A 4Z99A 4MGIE 4YRIA 1VB4A 4PHGA 2AG1A 2PN1A 2ZI4A 2EJTA 4OBXA 3LCUA 4YJGA 4ZVKA 2G9RA 1NI4B 4AQ2A 3TRIA 2GEVA 4AL4A 2GD0A 2Y0OA 4YJHB 1OC2A 1QGOA 3BQMB 3JZFA 3THWB 3ZYPA 4CM7A 2CNBA 1LI7A 3F78A 5HTOA 1QTIA 2NT3A 1PU2A 2BJSA 3M4XA 1CT9A 3IE2A 1RT9A 4RA6A 4M4PA 4KQ2A 4MPDA 5EESA 3OIFA 1LQ2A 3M3OA 1Q0UA 4XGNA 2GF0A 2Y60A 4EKGA 5JCOC 1GNZA 2HW8A 5HV0A 4CIVA 1NQWA 2OC9A 3PNVA 2W6CX 1Z5OA 2YV8A 4RQBA 3REFA 2AE2A 3GGSA 2WB2A 1GADO 2R062 3ZE9A 2HHJA 3F6CA 1S2OA 1GLVA 1W3VA 1CY8A 4BUCA 5FY7A 1BZYA 4M1TA 3NM4A 2O8FB 4E4TA 4M01A 2ORWA 3AHJA 3FCSB 2V3CC 4RK7A 4KDCA 2LE0A 2P3KA 4NYIQ 1WB5A 4L9BA 3A2MA 1NGSA 4KSBA 1JEYA 1UBMS 2GPWA 4RH1A 5CTJA 1FLDA 1A27A 2WKRA 4KBYA 1VB5A 2C4NA 5FKCA 1T8UA 4US1R 3W2TA 1Z68A 3GLGA 3VDDC 3NV4A 1G7CA 5TX7A 1L4BA 1G20E 3T0IA 3VDDB 3CWCA 2J4FA 1N9GA 4GMP0 1CD5A 4BX0A 5EIEA 3E8SA 4YRDA 3KD3A 4M1EA 2FZ1A 3ILHA 3FHQA 1WY7A 2WZQA 3Q12A 4U3JA 5B4VA 2AEJA 4JXZA 3MBKA 1R27A 4P4NA 3GRVA 3ZSJA 1XPJA 5P21A 2IKQA 5FZOA 4Q9NA 4D9EA 4HVOA 1OFGA 4HK4A 3V32A 1OGYA 5FYUA 3RNLA 4D7YA 2X0KA 1ISSA 3K09C 2QM8A 3IUYA 3W7AA 2DWRA 4X8OA 2YX1A 3C8MA 4KACA 9MHTA 4UXHA 4JWTA 5TXGA 2RR12 3FDIA 1V1RA 3MZ0A 1XZNA 4KPUB 5FL7D 4R1PA 3SSNA 4SBVA 1OIXA 5A3LA 2R1BA 2YN4A 3M4YA 1FTYA 1X70A 3DMFA 5JATA 2GT1A 3WG3A 1KMMA 5INTA 5L9AA 3NIGB 4LISA 2WS91 3M3EA 4TZKA 1NZIA 3T0FA 3PNAA 1UEIA 2UZ1A 2GU9A 1EUDB 5IZCA 1J2EA 3F1LA 1NE7A 2CFCA 5K4HA 4RK1A 2AOTB 1PLLA 2Y0PA 1EK5A 4QOIA 4UEWA 2EIBA 1WCYA 3N9PA 4WLOA 2ON6A 2H0RA 4RF3A 2PLAA 1V6LA 4X00A 4EB8A 2XNSA 4TZ6A 4OJNA 2ACVA 4GZMA 4W8GA 2X5IA 3ZN4A 2WU8A 4D6RA 2H4YA 3L1KA 1S1CA 5HWSA 2FTKE 3WJ7A 1RQ2A 1QIMA 3QPCA 1MZFA 4UULA 5ED4A 3HR9A 4MV9A 1N2HA 2ENRA 3F6PA 4CM4B 1NASA 5JD4A 1GA4A 3IKWA 1Y1RA 4E4RA 5K51A 1CUGA 4AFBA 1RQXA 3NV7A 1WPQA 5F2OA 4K1LA 3DOFA 2I8CA 3S29A 1HDKA 1QGUB 3X1XA 1C3OA 3ZTWA 3C5WP 4F3NA 3AETB 4U6QA 2ZXEA 4HLCA 3K5IA 3O03A 1JG4A 2C5FA 3LDRA 4LG1A 1AURA 4HUQB 4EHAA 3MIIA 5F37A 1CR2A 2JEMA 3DW3X 2R1VB 1DBIA 4AX4A 3ZJ5A 4YO7A 4Q5IA 4M9QA 3NEAA 2JD4A 2K0GA 2CFSA 2F6RA 4ZCMA 3FRIA 1NKVA 2YJZA 1ZXXA 1OI4A 2OBBA 4BQQA 1Z45A 3NTXA 4QYIB 1Y5NA 2WWHA 4OJTA 1WM1A 3CY6A 1R8YA 1GPJA 1J97A 5DDJ2 3ZR4B 4U7JA 1H4TA 3DPUA 3DP7A 3NTQA 3MF9A 3AZYA 4MS3A 3DMYA 1P29A 4BX9A 1GOHA 3OJXA 1NOJA 3TS1A 1NAIA 4Q4V1 1O96B 1EJ0A 1PS8A 3LRXA 1MVNA 3P6BA 4XVRA 2FSUA 4DRYA 1MHTA 1ID1A 2YZMA 3RYCA 3VZSA 3I6IA 2JG3A 3KO8A 2PVPA 3D3WB 1QH1A 4MCJA 5KNBD 1SK9A 4F2HA 5AFSA 2XECA 4J7CA 3I9MA 2AF4C 2AW5A 2RGUA 4J4BA 4I2OA 1B15A 5E6HA 1QS0B 2YVLA 1U5AA 4NCIA 4ZN6A 4R54A 1JKJA 3MAJA 4PU0A 5GONF 4ND8A 1JEOA 2G1UA 4DLYA 5JD3A 4ILEA 4CEIB 3F5QA 3P0EA 4DIKA 3COVA 1H0RA 4RGYA 3O1MA 4D25A 4UM9D 4J6GA 1M5TA 1C8M1 1WHTB 5A7PA 1JU9A 4WUTA 3LXUX 3G2HA 1DXQA 3MYRA 3HU2A 3EUWA 4GWJA 5FNVF 1BCRB 2WTEA 1K5DA 2PNJA 1PJQA 5FUYA 1KERA 1U7WA 5JD6A 3QELB 3TAUA 4QD2A 1U5XA 3ZLVA 2BBAA 2HJSA 1VCHA 1ZK4A 1JJ7A 4Q6WA 4KMSA 3WRYC 3K9GA 3HACA 3PIGA 4MR8A 3ZNOA 4KAAA 2WF7A 1W9SA 2XKKA 2X8JB 5IVEA 5C51B 3C7AA 1US8A 4BN4A 1XZIA 4YZ5A 3W7VA 1ZH2A 3LLMA 2IEGA 3LPMA 4G1MB 4JX9A 3OGVA 4PRLA 3BU0A 4ZMRA 4LY9A 2Z2KA 1UMBB 4POOA 2RGAA 1DL5A 2C84A 2VJAA 2FPLA 4BIIA 4CMEC 3RC7A 2P5BA 5EIBD 2OGTA 1S2IA 2NM1A 2X1VA 2P1DA 2AK3A 3WIEA 1G8SA 2POCA 5JO9A 3AINA 1A8PA 1WLSA 3EOBI 3RYHB 4FYKA 4DV7B 4JJ4A 4Q9KA 5A9RA 1W6NB 1BXGB 1UMDB 1P2UA 2HYXA 1ZL2A 1ZMRA 4GBJA 3KOOA 3NAMA 4EEZA 3NNFA 4LZAA 3UUWA 5A7OA 1PNRA 2DULA 4MUVA 2W37A 3RK4A 3DV8A 4RZIA 3IO3A 2NU9A 2ZI5A 2FUG6 2NO9A 1NLRA 4F7WA 2UY8A 4PG5A 5D84A 2AEEA 4IDQA 1OVSA 5I8ZA 2AJDA 4YJGB 1HB3A 4XD7D 4Y2SA 1PJRA 2QRKA 5JUWA 4HNHA 1YH3A 1HDCA 4NOMA 4HO1X 4JT8A 1AGPA 3BH0A 3VNSA 2R47A 1LXCA 2NVUA 1DIBA 2GZRA 3C74A 1J5PA 3OQPA 1GCIA 4RA6B 1PV1A 3BIWA 4H6VA 4FOYA 4OI0A 2XJSA 1FFBA 4XDQA 1WB9A 1VLNA 1R8XA 5IG2A 1TA9A 4GXRA 1GZDA 4Q19A 3C1OA 3LLSA 2OV4A 4CKWA 3HDHA 3QZUA 1PGQA 5JU6A 3F95A 5JAIA 4U2GA 3MV01 3IL2A 2O3QA 5HVNA 1JU3A 4LEJA 2J3IA 3LL7A 1KZ1A 1EV12 3JCZA 4LYHA 3QVUA 2IY7A 3DPRA 3LOQA 3TQQA 3PDUA 5JY1A 4M8NE 1XNJA 2I6QA 1BYIA 3BALA 1W39A 1HT2E 2XRMA 4F45A 2XUDA 4ER0A 1TOAA 2X4LA 1JEYB 3ASIA 1M8GA 5DYYA 4QRHA 4YGYA 4F4UA 3WKCA 3WYGA 1U7TA 1PR4A 2NTJA 4YUAA 2PH1A 3L7BA 1EVIA 2EDAA 3A0KA 2KMLA 3GALA 4KWJA 1N9GB 3SLRA 3O0WA 1EGMB 3GA5A 4DXZA 3UB3A 2VBCA 2IYEA 2EFGA 1W8WA 4ND3A 1JA1A 1WW3A 1OYVA 4U3JB 1XV5A 1PDWA 5HX7A 3DTTA 3GG2A 1SKYB 2ZIGA 2IEAA 2PPVA 4NBVA 5FZ0A 4GECA 5FZOB 4D0QA 1C7FA 2YR0A 3F90A 2FEWB 4LC9A 1I2ZA 4J4HA 5DUWA 2VQ6A 2IZ6A 4E8DA 4WKNA 4I1VA 3ZIDA 4IJVA 4M3CA 3IPCA 5HK8A 1U7UA 1XSRA 2F55A 1BE6A 1J0CA 1H4SA 2H51A 3O4GA 5JRJA 3AYCA 5GKAC 2AGSA 1V1RB 1KAOA 3W6OA 1WSWA 5BT9A 2YXSA 3ORFA 1YZHA 3TH5A 1U3VA 4OJYA 3SVZA 2HJ9A 4TVOA 3QPAA 4RTOA 1Z0SA 5H9PA 3CLUC 2V0CA 2WWJA 5FMDA 2PGXA 3RYIA 2VZTA 1I7NA 3NOOA 4YJKA 2CT8A 3D2LA 3HEMA 4DZRA 3P5SA 1CQJA 5JJCA 2CB0A 1KRIA 1OYOA 2YPJA 5THXA 4NUBA 4O61A 2UZ1B 1RUH2 3F4KA 3RNOA 2CDBA 1W9YA 4META 4CDWA 4R31A 4O8CA 2RCNA 4KTVE 4PCRA 2C9DA 2EKPA 1QB7A 5K0ZA 3NEYA 4JY7A 1EXDA 1QX3A 3FH0A 4RU1A 2NOAA 4R1OA 1MOPA 3K32A 1J24A 4LO7A 1RM5A 2WEKA 1RJFA 3NTUA 4E33A 4NROA 3RDPA 2X5IB 2IVZA 4O59O 1C1HA 5BYAA 5BSRA 3RC9A 3U44A 3KD2A 2HA4A 1Y1TA 4AS3A 2HSDA 3KFLA 2ZTUA 1QF6A 1J0AA 5BV0A 1RZUA 3W2FA 4XOUA 2AL7A 3UPTA 1ZDMA 5E1OA 4Q9AA 3IEPA 3ANYB 4FYIA 5ALKA 3IUPA 2X0FA 2VDOB 4YX9A 4CEWA 2CV0A 3OBRA 5EUCA 4KGDA 5AJHA 1GUDA 1JLSA 1Z2EA 4JD5A 4DA8A 5BN4A 1C3OB 2DVFA 3I62A 1T8SA 2FHSA 3OGGA 1RYYA 2VULA 3WGMA 5AKXA 1XP5A 2OUKA 5FXZA 4YECA 1DIWA 2OZJA 2HGZA 1GTMA 3RIYA 3ABSB 3BULA 3TN91 1HYQA 3QU7A 3KTAA 2HDOA 5LA9A 4B7XA 5FZ9A 4Z9AA 1N3PA 1MXHA 1U9JA 3NQ41 2MPFA 3ZCRA 1ZW1A 3N86A 4BVEA 1T8TA 4MS3B 4P0QB 4BNZA 4LCEA 1DELA 5CA1A 3FZ3A 1JUDA 4FPLA 2FDXA 3DXYA 2G9VA 4XABA 3RYCB 4S2GA 1GAWA 2R4TA 2Q4SA 4LQRA 2J46A 3KBBA 3NHAA 1BS9A 2B5HA 1SBFA 3L7MA 2DCUA 1E3SA 1BVVA 1C5HA 1Y3DE 3O3NB 2EZTA 2XJVA 1IEXA 4HB0A 5K05A 2WJGA 3F3YA 1A4UA 1DP4A 2CHVA 13PKA 5A7FA 5JTTA 1QP4A 1SHTX 2QX9A 1DAOA 2Q21A 1JKJB 3BDIA 3GRZA 1E2LA 3NR2A 1QJU1 4BGVA 4ND8B 2G04A 2IRWA 3K70D 4LKFA 1TXGA 1YEWA 3BWCA 3UBMA 4CP1A 3C6XA 3HN2A 3IESA 1OJLA 3KR9A 2JENA 4Z9BA 1WCIA 2CJYA 4NZNA 4JQRA 1F5NA 2ET7A 5BW8A 1WZXA 1UYPA 2GFHA 5BSWA 4TTTS 4EHKA 2IZWA 1R6BX 4GPEA 4G1CA 3S68A 2ZTLA 2OCAA 1CS4C 1P77A 3HADA 3OTWA 1GCOA 1BZWA 3BOPA 1QV6A 1QE5A 4FDMA 1DUIA 1EAH3 4QYXA 1KZ6A 3LBAA 2FSHA 3VKOA 3BSYA 1LW6E 1ZP6A 4Z4HA 2GMEA 4LKOA 2GHRA 4MR8B 2JLSA 2JJYA 3R5KA 5ITZA 4YG6A 4RPHA 2DUQA 1L7NA 4GH4A 4OQ4A 1B16A 2OGWA 1VBB2 1US8B 4MCAA 2RJ2A 1TJNA 1UP4A 3IKVA 3ZCPA 1JWLA 2HFJA 2R042 3ZE2B 5FUBA 4LK3A 4M9UA 3RU3A 1ZJ5A 3OJBA 5FPAA 4EVSA 2IEIA 5EHDA 4GWMA 3T0DA 4IEIA 1Z7S2 3V48A 4HONA 3DT9A 3VU3A 3H1EA 2O57A 1L5LA 5LDGA 1UT6A 2QI9F 6PFKA 1W90A 2AQKA 4WAUA 3GGGA 4WV8A 4CM9D 5LZ2A 4RWEA 1DBRA 5K0BA 3SC4A 4PYKA 4BXFA 5THQA 3GBWA 3M3DA 4AZSA 2R073 3GUZA 2P6RA 3WMEA 2WTXA 2OFXA 4ZOLA 2BGIA 4HBZA 2AR6A 2FLWA 3H1MA 3PSHA 1ZJYA 2WJIA 2WD8A 1KU0A 1K7CA 2LBPA 1HDRA 3GLQA 3F2ZA 3DLBA 1QAOA 4KQWA 4M6WA 4M0LA 2VK2A 3RCBA 1F51E 2I22A 3CUSA 2ZXUA 4GMFA 1KJZA 2YVQA 3VR5H 4XIJA 4TN7A 4NJ4A 2PX6A 2ZABA 4HMQA 4IUDS 3G7SA 5K8VA 3PMSA 1PLJA 3CKLA 1NULA 2GYUA 3LF2A 1UXKA 2Z9BA 5E1BA 5DRTA 2AXQA 1ZGHA 3TKYA 5IK2A 3A6GA 1O08A 1SCIA 1UDAA 3J81k 2D06A 1DGWA 4HATA 2OXTA 1FLVA 1M7HA 3HB0A 2YRXA 1RCTE 4KEAA 3RANA 5JPIA 3RG2A 2OE2A 1TKAA 3IQHX 3ZNQA 4PTZA 2Q6VA 5IHPA 3DPRB 2ATVA 3IRVA 4Q0MA 1ZAKA 1CDDA 2FPUA 3KM5A 3KC2A 3QLUA 4Y4RA 3CJXA 3T9BA 1K3FA 3W20A 3OIUA 1IDOA 1C3HA 2OMEA 4BY9E 2CSXA 3M89A 4I9NA 3D3NA 4MAMA 3ON7A 3J8F2 1IQ0A 4LE0A 5DCWA 1ACMA 1JXQA 1NKTA 3LUFA 3OEHD 1XU9A 3VYVA 3PFWO 1PFUA 5K7PA 2B20A 3T41A 2ZEZA 2WA2A 3EULA 3AV0B 1RRFA 4AI9A 4XUNA 4XEHA 1N75A 1V3UA 4TMKA 5JHHB 2I7TA 5A6XA 5K0UA 4D9HA 2IXFA 2AKEA 4N1AA 3AEXA 4FZ3A 2ZB8A 5HKOA 2W11A 2WRZA 5F2NA 1CWPA 3UKOA 1CR7A 1T91A 4DZGA 3AR5A 4TN5A 2NPFA 5IWFA 2FN3A 2X8LA 2GLUA 4PNPA 3AEZA 1GUBA 4D4KA 3K0BA 5A5VA 1YQEA 1PYGA 3CVXA 4M3CB 1DWOA 2PT5A 3EDRA 3N76A 3SQOA 4BL5A 3KUCA 5C8XA 3F47A 5CD1A 1OFTA 4MR9A 3OP1A 3T0GA 2A0KA 1WZIA 2KWIA 4A2QA 1VOTA 2Z8XA 1IB0A 1SC9A 4B32A 5FZLA 3FVVA 1UDRA 2A9KA 2ZUWA 3P9SA 4U2DA 1DGQA 4P35A 4H7DA 1AR91 3RYIB 1TT7A 3OB8A 1CIJA 1S5PA 1TD1A 1CQJB 3TI7A 2O8VA 3RTAA 2P6OA 4G0QA 4PYQA 3U80A 2OUIA 1EFPA 1JIJA 2REXB 4RTNA 3WVJA 2ZRDA 2XCUA 3B7WA 3P3NA 4B8EA 4HDAA 4E2ZA 4CDWC 2GCGA 5FYTA 1TKRA 3G2OA 4QOEA 3JAKB 3QPUA 1NIJA 3W79A 4D9FA 1KAQA 4CDWB 1O3SA 4JC5A 2GPJA 5BOVA 2PL3A 3HN3A 4DQLA 3INNA 3L2OB 1DCTA 1K08A 5LLSA 1WZUA 4PC1A 2GAUA 1HXS1 4K0KB 1CUSA 3UKJA 3AP4A 3UWMA 3LUCA 3F6RA 1E5IA 2RB5A 3UHAA 1A04A 3LFHA 3PTRB 1WPRA 3TGPA 2QZ3A 3DKPA 3GNLA 4R71A 2B5WA 2RAFA 2RGXA 3U44B 3U78A 4B3HA 4COUA 2PZAA 1URPA 1R9GA 4Y2JA 4BBZA 1W5FA 1AKRA 3GEHA 2P62A 5DOZA 1H9WA 3B6ZA 3S2FA 3QMWA 5K99A 1LBEA 2OPHA 1GYRA 5DTEA 5T57A 4RPGA 2F7SA 3O4RA 3ET4A 5EFUA 4LUMA 3G1UA 1SLAA 1ZJWA 5D1IA 5JOYA 2FZ2A 1PIV2 4Z4QA 2F1KA 4FOPA 2CVPA 1T8WA 5BN4B 1CZOA 1ZU4A 2DCMA 2YZ2A 4DOMA 1MQSA 4LF5B 3LHKA 1W0PA 5AW4A 4CKCA 2MCFA 1UY2A 4DXTA 2TUNA 1JKFA 4UUMA 1P2BA 4CCKA 2FB9A 4PZ9A 5LNK1 2I7DA 2XVAA 1P3JA 4JOSA 2A14A 2HA6A 4DSOA 4I2NA 3HTXA 1X19A 1QORA 1IB6A 1AL0G 2VH1A 1NL3A 3V0AA 2VMDA 4ZAGA 4YMVA 2PHUA 3KTAB 3L6CA 3MWFA 4AAXA 3V8RA 1EVQA 4J1SA 3X0DA 4KLRA 4BO7A 1GZSA 5C3QA 3MOSA 3JD1A 3N39C 1CY2A 3ZN5A 2YMLA 3PXAA 3PJDA 1C9EA 1RC8A 3RS9A 2XZOA 5CA1B 4AAPA 5AO9A 1W8FA 4FVTA 5E4JA 1ENRA 4IHKA 5EJ6A 4ZS2A 4TWZA 1XI2A 3I2FA 1OUXA 2BN4A 5ALEA 5EA2A 3B3GA 2ZJ2A 1KU6A 4Y2UA 2CZQA 2ZU6A 4MVJP 4XJXA 1HLCA 2XHZA 4RORA 1DQPA 4LYGA 5FA6A 1TIPA 4XFGA 1FTSA 5ALHA 1MRZA 1E6EA 4W6ZA 5AVWA 2BBSA 2QY9A 3R23A 2QLTA 2WO2A 3RREA 1JDJA 3NC4A 5AJVB 1BEEA 3HJAA 3KHBA 3LIHA 1O03A 1YKFA 4IEOA 5HZHA 2P2NA 4LE1A 1WCIB 1DG1G 4EG6A 3DZHA 1GCAA 4NHMA 1GQFA 1LRLA 3NOQA 2O1QA 2HCTA 3G17A 3L8FA 2Q7OE 4ABTA 2V6MA 5CH8A 2JA2A 2PX0A 4KZKA 3GWGA 3EPHA