4K9SA

Peptidoglycan o-acetylesterase in action, setmet
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
LLTDYGNASASPWMKKLQSVAQGSGETFRILQIGDSHTAGDFFTDSLRKRLQKTWGDGGIGWVYPANVKGQRMAAVRHNGNWQSLTSRNNTGDFPLGGILAHTGSGGSMTLTASDGIASKQRVSLFAKPLLAEQTLTVNGNTVSANGGGWQVLDTGAALPLTIHTEMPWDIGFINIENPAGGITVSAMGINGAQLTQWSKWRADRMNDLAQTGADLVILSYGTNEAFNNNIDIADTEQKWLDTVRQIRDSLPAAGILIIGAPESLKNTLGVCGTRPVRLTEVQQMQRRVARQGQTMFWSWQNAMGGICSMKNWLNQGWAAKDGVHFSAKGYRRAAEMLADSLEELVRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualization of a substrate-induced productive conformation of the catalytic triad of the Neisseria meningitidis peptidoglycan O-acetylesterase reveals mechanistic conservation in SGNH esterase family members.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Hydrolase
molecule keywords GDSL-like Lipase/Acylhydrolase family protein
total genus 110
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1360 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4k9sA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4k9sA01
4K7JA 2VPTA 4Q9AA 4RSHA 5JD3A 4DEVA 5B5SA 4JKOA 1ZMBA 5HOEA 4JJ6A 2APJA 4K40A 4TX1A 4LHSA 4RW0A 1YZFA 4HF7A 5BN1A 1ES9A 4IYJA 1J00A 1VJGA 3DC7A 3HP4A 3DT6A 1BWPA 4S1PA 2WAOA 3RJTA 2WABA 2Q0QA 1DEXA 4K3UA 2O14A 4OAOA 1WABA 4JJ4A 2HSJA 1BWRA 1PP4A 3P94A 4Q7QA 3PT5A 3BZWA 1ESCA 1FXWA 4K9SA 1FXWF 1VYHA 2W9XA 1BWQA 3U37A 4NRDA 1IVNA 1JRLA 1U8UA 2WAAA 4JHLA 4PPYA 4OAPA 1ESDA 4XVHA 4H08A 4HYQA 1Z8HA 3DT9A 4JGGA 3KVNA 1ESEA 2Q0SA 4I8IA 1K7CA 3SLRA 3SKVA 5A4AA 1DEOA 3W7VA 4M8KA 5CD9A 3MILA 1V2GA 3DT8A 3C1UA 3DCIA
chains in the Genus database with same CATH superfamily
3IE0A 1WSDA 3QP9A 3OH8A 2OBNA 2AV6A 3BXHA 2R7KA 1UDWA 2ZEXA 3EQZA 3DZFA 3KT8A 1LVGA 2P30A 5TF4A 4DJEC 4FPEA 3QWHA 1UOOA 3GFOA 3AHEA 4ZVKA 3B9QA 3LYAA 5H9RA 2CCGA 3K16A 4DR6B 4UBLA 3N4MA 5AHKA 4XBNA 1ASJ1 4CIAA 5H16A 1K6JA 3I23A 3IDAA 5HQ3B 5H7XA 3IOMA 4GMP3 1C9MA 3CGWA 1E6LA 5DTJA 2VZ3A 2ZX2A 4MG2A 2ORED 5FTKA 1KL7A 4MDHA 1ZIYA 3T38A 4IUGA 5J40A 3WGVA 4Y9SA 4Q2FA 2IHZA 1MXFA 4WCFC 3LMKA 3R24A 3ZEIA 1Z5ZA 1RXFA 4D3XA 4DSOA 2WMOB 1N7GA 1RI4A 4AJ2A 3CZCA 4M9SA 5MDHA 1VE5A 4X24A 4OB7A 4YG6A 2FP4B 3O8OB 3SJCA 3X1DA 1YB1A 1RUF1 4V24A 3N7AA 1VIVA 5L7OB 1E2PA 2FPSA 4Q1VA 4HUJA 1E4OA 3V9PA 3AKTA 2QJTA 3ITNA 4C0AC 4DZZA 2P4UA 3H1EA 3TQSA 1PE0A 5DX8A 3N53A 4J4TA 1XDDA 3U1TA 3AZQA 421PA 4GVLA 1OSNA 1KDMA 1AKVA 1EVKA 3IR7A 1AKTA 3VBRB 3VV2A 1AXGA 5JQGA 3LEKA 3BE4A 1XE7A 2CVQA 5TJHA 3DPRC 4F4HA 4UVDA 4ZIRA 4GP6A 4JTOA 3HI4A 4XJAA 4I4TF 1GRNA 4UFNA 1P7CA 4DMRA 1SQGA 5CG8A 3GX1A 1VL2A 3HO8A 1BA3A 1N2OA 1P44A 1W2NA 3VBRC 1KZ4A 1EUZA 5F2OA 1G9CA 1L8OA 2OQIA 3NEPX 4BK5A 5A7NA 2Q8PA 2X9NA 3GLHB 4J2TA 5FKCA 4M3NA 3CVWA 1ENSA 3OWHA 1L7LA 2HNKA 2ZZNA 2EHJA 4YFWA 1AQIA 5HIKA 3PSAA 3F0TA 4FZJA 4MGHA 5HXVA 4I50B 1SJ9A 5DUWA 3F46A 4IDHA 2HUNA 3PNSA 4YAKA 4ZEVA 4GMP0 3ZFEC 3LGSA 3N9MA 5AHOA 3T54A 2QTAA 2P34A 4PLWA 4BEWA 3TEMA 2X8KA 4AU1A 4IJQA 4B9EA 3KD2A 2Q3JA 2V9CA 4ARAA 2GZHA 1ZXXA 4R40A 5JO9A 3MCAA 4PG7A 3VR6H 1P4GA 2SHKA 1LW6E 1PG0A 1QF6A 3PQ5A 1N5LA 3AMMA 4TMVA 4UU1A 2PUBA 1WOYA 4TVKA 2W08A 2ECKA 3C5CA 4P53A 4F4FA 5JAIA 3ZXLA 5A7QA 1SGWA 1L4BA 5A9SB 3OZXA 3OPQA 1XSRA 2CW5A 2Y92A 2VVTA 2P9TA 3UA4A 1DC4A 4WA7A 3ZN5A 3DT9A 4BAGA 1OA0A 1PK6B 2XGXA 1YIPA 4MV7A 2REBA 5F12A 2DSNA 1F6WA 5IT6A 2AFVA 4HXGA 1RWQA 1IPKA 2FI1A 3KQMA 1Y1QA 3FC0A 4DR7B 4UM7A 2VZLA 5DISB 2QROA 4DAEA 4CPBD 1OTHA 1N2IA 4PPGA 4YO7A 3K46A 3UETA 4M22A 1MX9A 3TQHA 1QWSA 4Y22A 4GKBA 1GGJA 1R0CA 3C0KA 2B8MA 1F3OA 1M2WA 4TX1A 5H9PA 4D3YA 2ANCA 1K1EA 3FJOA 1RXUA 5AXBA 4ZMSA 4URTA 4XVUA 1O9GA 3C2QA 1ND2A 3KZMA 4Y7DA 2IUFA 2GH8A 3HNOA 3BD7A 1G8FA 2GZSA 4P81A 1CG6A 4YP7A 1QJY2 3EAGA 3JZFA 5HK8A 4ZIRB 3EXHB 1S2LA 1BQEA 1JR3A 1F4AA 3WRWA 1W7AA 3EN0A 1WAMA 4BLRA 2XUAA 2YWGA 1AJKA 3VBRA 1E89A 3PD1A 3SQMA 3K72B 3VHRA 2R8EA 2X1HA 1L1FA 3D6TB 5JSUA 1FDSA 3JPYA 2H0RA 1N92A 1Q0LA 4FCCA 2FZEA 4ZCPA 5LB2A 4QHTA 1W6PB 3COWA 1ZYUA 3EWIA 4CZ2A 3V32A 1ZVFA 2GNBA 1IULA 2YHAA 4Q21A 3PIGA 2D06A 4N49A 2WJIA 4RY2A 1SUPA 1FX5A 1Y82A 4J4BA 2IGTA 1OUXA 2J7KA 1USVA 3NT5A 5H02A 1KZ7B 1N3BA 1VG8A 5DMYA 4WNIA 1Q20A 4CCJA 4KGGA 4O8ZA 3EZ6A 2WQ8A 3JSXA 2Q07A 3ZDRA 2F4LA 1E3MA 1XEXB 3M9LA 4IS3A 1LS1A 4OJYA 2IOFA 4BKUA 2GD6A 4CE6A 3O7MA 3ENQA 1WPXA 1VSUA 2Q6TA 5K3FB 3KALA 1SK9A 2JENA 1BWRA 2IYSA 1ZM7A 1NQWA 1L6IA 3NV7A 4NBTA 3IPYA 2C0ZA 1ZGCA 3VPXA 6NULA 5AI9A 4BFCA 1E58A 4C91A 4FINA 1MEOA 1C3HA 4RJJA 4JZRA 1QH1B 1HR0B 3EQ6A 3T9CA 1VHQA 9LDTA 2G88A 3Q12A 1NBOA 4XX1A 3VTZA 5CFPA 3BFXA 4LNHA 1LGBA 4FYKA 1EFPB 3HXLA 4BISA 3L6OO 4EI7A 1IXRC 1ZZEA 3H1BA 1BJKA 4MO2A 4HQ6A 2VHYA 1QJX2 1S8AA 3CJRA 3QPVA 1UBTS 4AD8A 2P6CA 1UCXA 1VBB2 2BBAA 1NBHA 3B52X 3E9QA 1ORTA 3NM5A 2VSQA 1V11B 2F1IA 3D3KA 4PI2A 5JNTA 5DM0A 1J56A 2VGDA 3W8RA 4D8TA 1NI3A 3AESB 1ATZA 1WKBA 3EVGA 1KY2A 1HI9A 4R1OA 1JXNA 1EFRA 1EY2A 1S0IA 1NQUA 2P6UA 4KL1A 1AU9A 1BS9A 2QTMA 2IYPA 4JYMA 1J23A 4URYR 2H8GA 5K03A 1HE8B 4B2YA 1R1A1 4RIIA 5EXXA 3AB0A 1HZZC 1OFNA 4QJ3A 2XT9A 2QE7A 1D03A 2HWKA 4HDMB 1SBCA 1HDIA 3H5VA 1ZN7A 3VAAA 1KGYA 4A8HA 2VAXA 3DMTC 2IJGX 2FKAA 4TT8A 3HJFA 1XDWA 3L04A 2BD0A 1G6NA 3WKCA 1I5RA 1ULFA 4AZTA 3U7GA 3AEUA 1I4TD 3P2MA 4P93A 1GAWA 5C1OA 1YQDA 2DM6A 1NIPA 2QRQA 4OUSA 4J76A 1Q1QA 3N2ZB 4FCVA 3SFZA 4F2PA 4MROA 5BMOA 5DXAA 3D4PA 1C7IA 2CNWD 1SIWA 1U2DA 1KVRA 1JJFA 3KJHA 4KXNA 1N4DA 1H2BA 2GZ2A 2Z4FA 4LO5B 1ZXLA 1QONA 3VMFA 5H3CA 4UF0B 3PJYA 2OA0A 4AF6A 3C1AA 1RLMA 4O2AF 2JGKA 2YVKA 3TMYA 1E3JA 2JLQA 4K46A 1C8LA 4LBKA 5C5CA 2D7DA 3MYXA 1LI5A 3T1LA 1KAEA 2QYTA 3I2OA 1U6IA 1PJRA 3ANSA 1QRAA 5K0UA 4CDQA 4OLLA 2ZYUX 2C5AA 4Y6RA 4NNOA 2IXAA 5AM4A 2XKKA 4Y2JA 2QTCA 5F9MA 1Q8SA 1BE8A 1RWNA 1OFSA 3O84A 3IT8A 4E94A 2WBKA 5MGBA 1IB6A 1WUYA 4L11A 4G5OA 5FFNA 4JLWA 1FFYA 2R6GA 1NR5A 4A0SA 1E6KA 4IZHA 3ROZA 5FBKA 2N3ZA 2XT0A 2OV1A 1MQTA 4KPYA 4LXYA 2CLHB 4DUGA 3K2BA 5C46F 3IWZA 4QX6A 1HYHA 2WE8A 4NCKA 1H0HA 1Z22A 2NP7A 1EJ0A 4FKBA 4KQWA 4ASUA 3CINA 3GRKA 3GJAA 3K1ZA 3Q6IA 2JHGA 4FFNA 3U7JA 4KWKA 4QFBA 1FW8A 3GFFA 4I02A 4N8SA 3RMXA 4UREA 2ZHKA 1PGJA 3RUHA 2GVZC 2H57A 4JQRA 1PTJC 4TL9A 1WU8A 2NT3A 4NAVA 1DX6A 5B7GA 3D6NB 2XZLA 2IYZA 5J2UF 3QU2A 3EGVA 2OEPA 1RXWA 4W63A 1RUE2 2GMPA 1LDBA 3WHIA 4ZDWA 3U6KA 5I5GA 1NFQA 1YRHA 1IXYA 3IEUA 3T6KA 1H6BA 1Y0BA 3DLPX 5IBQA 5E9WA 4KR6A 1WXWA 3KT7A 4NOLA 3ZZTA 1VB5A 2EFCB 4HDRA 1Z6TA 3PGLA 5SICE 5ED0A 5A1JA 1W3XA 5FUMA 2PVCA 3AH8A 3T7SA 4B09A 3O8QA 5E9QA 1QYIA 3FWNA 1O5LA 1I4DD 3U0VA 4YQYA 4V2WA 4UU8A 1UMCA 1QGYA 1QQAA 1H8HD 3PLNA 3H4MA 1M2FA 3AKDA 2HK8A 4WVLA 5B58C 1VZ2A 4QG7A 3GLIA 2HO4A 2AOVA 4U2FA 5DGTA 1ZGAA 2JDIA 1GP4A 3AUFA 1QKJA 4NBNA 1KO8A 3W0LB 1QHGA 4BVJA 4GX0A 1AQLA 3AEQB 3VU9B 4LZAA 5JVVA 4MX3A 1VBB3 4IHAA 1M2OB 3B60A 2AJCA 2PYTA 2VT7A 4GC5A 2YOFA 4P3OA 4OFZA 2VZ1A 1TADA 4TLLB 1W88B 1JFFA 4LITA 3AUAA 3HCBA 3R77A 2AWOA 4LS3A 2Q3BA 5EV7A 3G2KA 1W44A 1U63A 2P6RA 4CEYA 4UW9A 1Z4IA 4JLOA 1W30A 4R83A 5KTRA 1BJTA 4GT1A 4WFQA 2XOXA 4ZTZB 3HN6A 4ZU6X 2JX9A 1E2NA 3K9WA 4ES6A 3KKMA 1R0YA 2PVSA 1F31A 2VYFA 1XNJA 2HJ9A 3P4UA 4GPD1 4QRIA 3IEXA 1HE2A 1QZXA 4YS6A 4C21A 4IDZA 1YZFA 3QX3A 1U3FA 2QR3A 3GYGA 4HDCA 4HLUC 3PKZA 4H4DA 3NW9A 4D02A 2XONA 1THGA 4II2A 4IESA 1JJBA 5CB4B 5IYZB 2AN1A 5J2TB 1GXSB 3HYCA 2WT4A 1XRLA 1Y9EA 3HL0A 4DCGA 4HLQB 1V39A 2AHOA 3SZ3A 5HKKD 2Y4OA 3L6BA 4TZ6A 1O7JA 3DZCA 3OLZA 5EOVA 5TLSA 3MMSA 2WJHA 4N5IX 2YRFA 3W8NA 3CNAA 3IHLA 1P74A 4DOMA 1EINA 3RKUA 4B3HA 5HRCA 2E89A 4KPGA 2J7PA 4L9RA 1Y8QB 4RJTA 5AIBA 2B6NA 4JBLA 3LDFA 1NVDA 2VXCA 3PR3A 2A1XA 3CJIC 2XE7A 1QQTA 4UNQA 2VATA 3CH6A 2CWMA 1T1JA 1H65A 3FYUA 3NH6A 2BEWB 1BW9A 4KE8A 3IVGA 3A21A 3D1JA 3DBOB 1RQ2A 1G2IA 1MABA 1SBQA 3MGKA 3KEQA 4X45A 4QATA 4M76B 1XE8A 1L7AA 3ZU5A 2NU6B 5FZDA 4DDUA 4CGZA 1I1QB 3TCXB 4PC1A 4ME6A 4PFQA 3AETA 3ZXYA 4M0DA 3F9RA 4KWJA 2X5OA 1XWWA 4LDJA 1XC6A 1JSXA 3S81A 3BIXA 2BH9A 4TXMA 2DVGA 4MGKE 1ZA4A 3D02A 3D0QA 1ULOA 2J0EA 4JXXA 4M37A 4BB9A 1DIHA 3PZBA 4CKCB 1P4AA 1N1VA 4C7MA 3HKCB 5F1PA 1LA2A 5T5LA 3GGSA 1HO3A 1L5RA 3VZJA 3ESRA 3SXPA 1L8AA 2XHNA 3A28A 3EDMA 4UFJA 3ND8A 2YWJA 4IQPA 2HMYB 5JNUA 4FBGA 4W5HA 1UKVY 1M6HA 2NP6A 2FSHA 1ZCJA 1SCDA 3B20A 4JGBA 3WIEA 5JVDB 1ASJ3 3ZFEB 4V0KA 4BQ4A 3A6PC 3AK0A 4YVSC 4AJEA 1T2XA 1QIQA 3TSOA 3AFIA 1W6MB 1H4HA 4EYSA 4US1R 3IUMA 2GESA 3OTIA 4URZR 5CYFA 5H5JA 4FM9A 1E92A 3DAYA 3BGOS 3RU7A 2JIJA 3QIVA 4Y1FA 2C26A 4XCVA 2UDPA 3ONVA 1QHDA 4EKGA 3SVLA 4G8CA 3T7DA 3A7QA 3FGOA 2QSJA 2X0JA 3IBMA 1XKXA 3IBSA 2NO5A 2VKQA 2VSFA 4QBKA 3AKCA 2X4LA 2Z4SA 2ORIA 2DMRA 2G0AA 4XX0B 1J21A 1OFTA 3EVBA 2WNVA 4FOYA 1JDJA 4OI4A 4AMYA 3PYXA 1QNYA 4ZYWA 2PSHA 2VHTA 3WK7A 1OKKD 5C3PA 1OKQA 5KMGB 3LVRE 2WA1A 2AFRA 4D7AA 3W58A 4G1VA 7AT1A 1QXJA 2XIQA 3DVQX 2ZHMA 1G86A 4LJLA 3D0KA 2LRPA 2EATA 1COV3 3HCOA 2G82A 4BNLA 1CV2A 4CUCA 5LZ4A 2CNWA 2CFRA 1NW3A 1TQ2A 2XNCA 5JXIA 1E5SA 1D7PM 2PS1A 3FZYA 2BR5A 1TEXA 4RVOA 4X20A 3VPAA 4WZ6A 3PUSA 4I6EA 3KE8A 3F3KA 3PHCA 5A1FA 4WN9B 4ZJPA 521PA 2B42B 3TNLA 2ZYDA 5ESDA 3GNSA 2RS32 2Y6VA 3HR4A 1CB7A 1EFUA 5CJ2A 3B12A 2DUPA 5LKRA 2WMNB 3NC4A 2BP6A 2D40A 5DU2A 1K75A 3ZJVA 1QJX1 1PWEA 3A4NA 1VDMA 4BGVA 1K6XA 1TME3 4RZQA 5GIOE 3T0IA 3IUEA 2R042 4E2YA 4U6SA 3RB8A 3ZQ4A 3NCTA 2BNMA 3UJPA 4X64B 2C9KA 1YZLA 1REEA 3RC2A 3SQOA 5I93A 4OJNA 1R093 2ZJ8A 2NUAB 2IXTA 3Q40A 3G2JA 2HLDD 4XFBA 5CEJA 4P35A 1I1OA 4NMXB 4Z0TA 4U7HA 4WKBA 1X7GA 4YAJA 4Y1RA 3IP6A 3D8NA 2G36A 2C4XA 2GCNA 4TV8F 2VG9A 2NMNA 2JFBA 3RUCA 1GGHA 3QE2A 4YP9A 1TJPB 1ZMRA 4D2IA 1XMQB 4LKDA 1DX4A 1VLZA 1L3IA 5CJPA 3R4DB 1OH7A 4RQPC 3W4JA 4B7UA 1F8FA 5H1YA 2GHIA 3UPDA 1T3TA 3Q72A 5AJUA 3OGJA 5FY9A 1K5MB 1EVQA 5K3AA 2VH5R 1HNNA 2J1VA 1ENRA 5FBQB 3U9LA 1KPIA 3B6ZA 3UJ7A 1WWKA 4EMUA 4G5XA 1RCFA 3EMVA 1AT1A 4R2HA 3RI8A 3QE4A 3NTLA 2XQRA 3DPIA 4DLBA 4GKKB 3IKMB 4N0EA 5L40A 4GOND 1U4NA 4H16A 1RXIA 2DLNA 2FW7A 4GI7A 3OPMA 4NEGA 5GINE 3HVUA 1TAGA 3GLUA 1H1DA 1DBVO 1D4ZA 5FI0B 4DC9A 1FS6A 1JDNA 4B6PA 4BRWA 4HN1A 1RQGA 4EUNA 3N1UA 4JYBA 3SZOA 1IWPB 5E4JA 2IZ7A 5J47A 5FYQA 4UTRA 3QKRB 3BRCA 4P9NA 5JMTA 3FPEA 2EYQA 2QXUA 5HCAA 4FR2A 3HHPA 3EXEB 4WBNF 4DG9A 3N5CA 1G1AA 3PTYA 4Q0QA 4N4AA 3P3PA 1WBJB 5DLPA 5AOAA 3TMAA 1M34A 4SLIA 2GLUA 3R5TA 3ESXA 5LXTF 1TXGA 2XD4A 1ODNA 1FDUA 4OB8A 4M9CA 4S04A 3T0DA 2ALJA 5IEJA 3JAWB 4KXWA 3EXG2 2AI2A 1VGQA 3RPEA 2OSVA 3OF5A 2I3AA 5AKEA 2X22A 1ZL2A 2HWB1 4P3KA 1NUSA 4GJZA 3GR6A 2QLLA 3JTMA 3T52A 2ROQA 1EB8A 2DT5A 3SC7X 3GWGA 1SQ5A 3IOBA 4YAGA 4NBRA 2A9PA 2QQLA 2CBGA 3LFHA 5GONF 2WO3A 2WS92 3H1TA 4LHZA 2YVUA 1NQXA 1WCWA 4ALKA 5DPNA 3R4SA 1YDMA 3QPDA 2NYRA 4YDSA 1NQTA 2JHPA 2WSBA 4Q47A 4IH9A 2AEEA 2D5LA 1EP1B 1ZGJA 4OSEA 1URXA 4DLUA 5TQ2B 3FUQA 4FOLA 1FJHA 2IKSA 3OIFA 3S6JA 2ZGSA 1MHTA 1SXHA 3W6UA 1E77A 2FYTA 1Q57A 4HGQA 4HWRA 3ZWQA 4U2GA 2VNVA 1V70A 3ENVA 1IN7A 2FSIA 3AYZB 1RQNA 1EUUA 3UIEA 4LF8B 4P38A 4Q4DA 3KG2A 5D86A 3CW8X 1K88A 2DR0A 2JGEA 3LX5A 1R4NA 5ARCA 3JZVA 1XYOA 5TB5A 4C0BA 1N7IA 3LPAA 2ES4A 3PXBA 2J5XA 1Z08A 1RQRA 3PJDA 4JBYA 3WF3A 1CWPA 3GA0A 2ZAGA 4D6RA 4RZIA 4H6WA 3S2EA 1W94A 3VZPA 2P2KA 5AVJA 2ZSUA 4FPXA 4QJIA 2L18A 4QUAA 2B82A 2V6IA 2Q4EA 3AG6A 2W2IA 1Q43A 4ZOQI 3GJYA 1W8NA 3MILA 4I2VA 1Q1BA 4YRFA 5D51S 3FHLA 4OHPA 4CEWB 4L27A 5CCBA 5KSPA 1OJLA 1MO2A 5LYJF 2OAP1 4IRMA 4IZIA 4OHUA 3WQ7A 1U5CA 5LBUA 2X8JA 4H7JA 1MEJA 1L4FA 4PDWA 3MRVA 2VZSA 4IE0A 2V9ZA 2C5DA 1T1GA 3SFTA 3RYPA 2JHFA 1DL5A 1BVRA 1RIIA 1J1TA 5A1AA 4OZXA 3TN93 2C1XA 2SECE 4YACA 3UJ6A 4P4SB 3WLQA 4LYAA 4GH4A 4UE2A 4P0TA 3GC6A 4R9VA 1KEUA 5IARA 1OCEA 3H0CA 2YJZA 3X1ZA 1CGPA 3RJZA 3HQ4O 2GARA 2OECA 2Y1KA 3VPDA 4YDQA 2X19A 5I51A 4JU9A 2AZ4A 1CDZA 2RGNA 4UNIA 2WJSA 3RFTA 1E60A 1RJ9A 3WP3A 4EDHA 3PT9A 2R66A 1U7WA 1O5OA 2QE6A 2PSEA 4E4DX 2ZXFA 2EWWA 3W5MA 4L22A 3COVA 1DUSA 3PFIA 4I9HA 3HDTA 4WCDA 4U7FA 1QDEA 3OHPA 4F3JA 1YFKA 2PKXA 4LBQB 4RGQA 4DQKA 1XAHA 5DWDA 1QG2A 2H9AA 3O4FA 1NTRA 4X8PA 2EF6A 3FPLA 5AVTA 1RWBA 3AM4A 4QT4A 4MSVA 4P54A 3M6IA 1LJ7A 2HK9A 1CXZA 2VBCA 4MW7A 5JOQA 1JFTA 3FPAA 2ACKA 3KHKA 4BGEA 4E2XA 5ALFA 3IDBB 2HHAA 2GPBA 1YB6A 2IU0A 4YZ4A 2RHMA 4UNSA 1K4MA 2XAUA 5IT5A 3A06A 1QPGA 3NRJA 5FZ1A 4EVIA 3TOXA 2MPFA 2AEMA 2OO3A 2HA5A 3Q7RA 2WK1A 4NCHA 5A03A 3BIWA 1LK5A 4BNNA 5E9JA 1MDFA 2FOLA 2XCLA 2GP5A 4RR3C 2OYZA 1PJQA 5F9TA 2R8YA 3F9CA 3T1VA 1UCFA 2I1WA 4UAJA 3N35A 1WV0A 5LBTA 1DZRA 3ZY6A 2LPMA 2EHDA 1P39A 3O8NA 3F71A 4SBVA 2X8AA 2JECA 3M6MD 1QGZA 4EW1A 3ZFGC 3VZRA 5GOTA 1ZNYA 3R7DA 3WDYA 4D6YA 5KQMA 1ZM2A 3LBAA 3PA8A 2GC3A 1QKIA 1LUAA 1JAXA 1UYZA 4TYSA 1Q8OA 4QICA 3TR0A 3LCRA 3ETLA 1Q3EA 2HU7A 4QTXA 3OCVA 4RD7A 1P7YA 2VK4A 2D2IA 1FFXB 3FPGA 4GOMD 3AR8A 2BIFA 1OBOA 5E1OA 2B94A 3RYTC 2AFIA 4XF1A 2ZMNA 4DS3A 2VMEA 3ZH2A 1CERA 1B76A 1BGWA 1FFBA 2PXAA 1E0SA 2VJBA 2PSJA 2D2FA 1DC7A 2GUGA 4UDNA 1T5HX 4BPZA 3CEHA 4BP3A 4UD2A 2HHHB 2I65A 1PFGA 1J8YF 4AF8A 2AXPA 3V1MA 1WWYA 4YHBA 3C7TA 5I7HA 3ACBA 4L2IA 3EB7A 4LJRA 1QGDA 1Q22A 4CKEA 1M0TA 1NYRA 1RKXA 1P33A 5EXOA 3D5EA 3NXKA 2PWBA 1RRGA 1OA3A 2OD2A 1ZCFA 2F67A 2P4QA 1F15A 1RYFA 1L7OA 4Y1ZA 2PAEA 2GEFA 2WLSA 4N5NA 4HNHA 2JG9B 4D0NA 3OU6A 4XPZA 3V5NA 1OHHA 2VECA 1W19A 4IJMA 2B37A 4R6WA 3AYCA 2HXGA 4G9SB 3BBLA 4G3XA 1U3VA 1OH6A 1KSGA 2C6SA 3VVCA 3FSRA 4K86A 3E0QA 4OFGA 2AZMA 1TO1E 4BCUA 1ZJ6A 1IN4A 1FI2A 1TZJA 2CXPA 2EJTA 2BGPA 2IVFA 2HRZA 1VRVA 4A15A 5IVFA 2IQIA 1QUEA 5CLHA 1WKVA 4MUAA 1E7QA 2VHXA 4CDUB 5JAHA 4XJUA 5CFNA 1L9KA 1F0YA 4DY3A 2QZPA 1ZW1A 4RM3A 3I3EA 1UDAA 1VBB1 4D0SA 4IS2A 1PGW2 1RUC1 2HC9A 2JJ1A 2WNUA 3IOCA 1ZJZA 4EKEA 3M7AA 4O0MA 3SLGA 1CS4C 4YZ1A 4OQ9A 3OTOB 2B8TA 4R2IA 3FHOA 3KFXA 2CL6X 3K6KA 3IBCA 3ZS8A 2VXRA 1ZU5A 3C14C 4Q26A 4BNGA 1IQAA 4HDKB 3UCXA 1CJTC 1HYGA 3F74A 3UPUA 4AHXA 4JWKA 2JJ2A 3NFYA 2A9FA 4FDLA 4FUQA 5BSWA 4GJYA 2JB8A 1RLOA 1FC0A 4OEHA 4ID9A 1QWOA 3VSCA 2CWSA 1YMUA 1OXSC 2DWOA 4O4IA 1BDJA 1DCKA 2OT7A 4CL3A 2BE7A 3P9RA 5H80A 1A7UA 3W9UA 4GDMA 2QPAA 3H8UA 2QLNA 1W4CA 4Z8BA 2ET7A 2HMTA 3BB1A 3Q98A 4P92A 4O4LB 2CLLB 3LPLA 2GTPA 2CHFA 1K7XB 1Y8AA 4GZMA 1N5DA 2CNDA 2VSNA 3T1HB 1EK0A 1O2DA 2GN7A 1ZKMA 4EG0A 4M4RA 4WZZA 4YCNA 3UAWA 4HQKA 2V4ZA 5DXFA 4LX0A 2DCJA 1GTG1 1SLCA 1CF9A 1J25A 3M4NA 2R041 1MJNA 1A98A 1SXJC 4MJ7A 4Q3OA 3P32A 2H0AA 3D8RA 2AFHE 3IAFA 4ZCTA 3SDBA 2PRZA 1ZD8A 4CEYB 3S7IA 3PD7A 3VBSA 5FXMA 4NZYA 1WPRA 5T7BA 1Q0SA 2WIGA 4E2GA 1LEMA 2A9OA 3O0WA 3W6OA 4E31A 3SYMA 4C76A 2NTVA 2XWBB 4D3DA 4DOUA 4Q4HB 5CLLA 4IV3C 2X15A 4ROSA 1EFHA 4PYKA 4RVCA 2II6A 2H3EA 1JDZA 2D00A 3GB9A 4IIGA 1YVDA 2H7VA 1XMSA 2QDNA 4M1MA 1Y48E 5FWJA 3O1PA 5EZQA 1UQRA 5GVRA 4YR7A 1YBFA 4J7AA 4YXWD 4K81B 3NWPA 4BO6A 2WFF3 4KXVA 1N6KA 4P83A 2PUTA 1NOKA 4JKLA 2BRUA 2WNUC 1PD0A 1DJLA 1VG1A 3L8DA 4YN3A 4PLOA 3JQQA 1NURA 3OFKA 1II8B 1HQLA 1U8AA 2W58A 3P9KA 2ETXA 4MI3A 3SJZA 1WEHA 1LBIA 1WBFA 2AR7A 3BAZA 2WSIA 4DLLA 1FLAA 2B3DA 5AVUA 1JXMA 1G3QA 1FY2A 2WZQA 3SJBA 2Q2WA 3CZ9A 4CBVA 3CUUA 3B38A 3EEFA 1DZ3A 4W4TA 3GRCA 3KD3A 1QTIA 5CNAA 1K6EA 3D8SA 4M9ZA 5AM5A 5I47A 3FRIA 3CEWA 1KRHA 3DDOA 5KOHB 3TTYA 2GBFA 1EA7A 2IUSA 5CEEA 1IATA 1MP0A 3DDNA 1CQIA 4DXSA 2PV7A 4DUWA 2OBMA 4NU5A 4AFBA 1YK0A 2GSWA 2C4WA 4Q9DA 5AW9A 4KQ9A 4RELA 1HZZA 3ZIAD 4EGFA 4MPRA 2QZJA 4Y24A 5DNDA 2YBPA 2AX3A 5HI0A 3TGLA 3PT5A 1P0CA 3Q3HA 2ZIFA 1JI0A 4FDVA 5ALVA 821PA 3V3TA 1YVPA 3KKLA 2CYCA 2CLKB 2KQUA 2FMUA 5CFDB 2QTNA 4MV8A 1ESDA 4ZGWA 3POBA 3VTAA 1T8SA 1RIRA 1Y5LA 1A9YA 3TQCA 3LWCA 3QE3A 2XUKA 1CX1A 3RSOA 3PJEA 1U7HA 4PICA 3Q2IA 3OSDA 1WB5A 4KLNA 3JWIA 2ZQZA 1MAWA 1WHSB 3F67A 2VW1A 1YZNA 1GPJA 2X29A 3BIJA 4ZYLA 5C5UA 4A0FA 2PUVA 3K4QA 1M7GA 4FPKA 2XKAA 1UJNA 2P2LA 3U4SA 4DN6A 2FA9A 3EXFA 4ND5A 4AWBA 2AEYA 3M6FA 2VJXA 4IEYA 3VYSB 4RF4A 3A26A 3AKEA 1B41A 2D4AA 5EPEA 2I2FA 1X42A 5AW2A 1B73A 1RHQA 4FWBA 2C82A 4IHJF 4M83A 2O6LA 3V4SA 1NG9A 4HN0A 3G8CA 2PX5A 2PU7A 1D2CA 4J0GA 1I3LA 5IJ0A 1HRI2 4ND6A 4IG9A 2NUTB 3HYRA 1WR8A 1AVTA 3R5HA 2J41A 4EGQA 1HDCA 5BNFA 5CK4A 2IY8A 4QDZA 2XEXA 2B1IA 1EXWA 3RROA 2JFZA 3R7BA 1V1MB 1JV2B 2QPOA 4QT6A 5DHQA 4YM0A 4TV8A 4OD0A 4D92A 3HDHA 2MEV3 1VJCA 3AJAA 2IS2A 4BCCA 3MAAC 4XR4A 1XYPA 4UOJA 4DYHA 2BPOA 3QXGA 3M3OA 3JALB 4PYLA 3QWAA 2A5ZA 3R9XB 5FJJA 2WZCA 3SIWA 1MAAA 2QT1A 4DLZA 3LGAA 1VI2A 4S2UA 2NMOA 6GPBA 1XQNA 3OBTA 4ARSA 1GTRA 4LWZA 2WRZA 4QXHA 4DYDA 3AESA 1DFGA 2XCRB 5A7SA 1LPAB 1U8UA 1V11A 1FFAA 4LRWA 2W2QA 4GKVA 4FKZA 4FE4A 4OGKA 4UE3S 3H1MA 5IHRA 4IV5A 3MUY1 5KSWB 2O7RA 5G0VA 2BGJA 5DHTA 4GOKA 1AR71 2J9XB 5TARA 2DFNA 2QG6A 4WHMA 2IITA 1CDOA 5TT0A 3DLBA 5F2KA 2HMWA 3AEKB 2PBFA 4EG3A 1HMPA 5CHEA 3T7IA 1OHHD 4CTOA 4I3HA 4ZYXA 5LBEA 4OCTA 4DCVA 2QK4A 2R44A 2FDHA 3SEPA 1NOJA 4YPVA 4HRAA 5AUQA 2R061 1OLXA 5GV7A 4AGRA 1O4YA 2E85A 2WTEA 4BJ5A 2MEV1 2QQPA 3ETPA 5I01A 1KQOA 4Q7KA 5KYWA 2VTXA 4BJ1A 3MERA 3AMHA 4C7JA 1ZVMA 1Z36A 4BMSA 2JDNA 2QN1A 1KY4A 3WIVA 4RD6A 1U9IC 3W7AA 4D9JA 2XWQA 5FLYA 3WGLA 1Z3CA 1H4GA 1GYQA 3CJIA 2CLEB 2FCUA 5FT9A 2C7OA 2JE9A 5I0TA 4DCNA 2WTUA 2QRGA 2YY5A 2VP6A 4QX3A 1ZI8A 3EIHA 2BPA2 3CWQA 1FSZA 1YMVA 4XB6B 3CM0A 1VP3A 4FHGA 3MIEA 2J59A 4NARA 2PH7A 3OCCA 1RUJ3 1ZM3A 4L6CA 3JBG2 2VOKA 1ORVA 2HFJA 3HFGA 1AF7A 7REQB 3NV2A 4PZEA 5HCUA 4BQEA 3P0EA 1ENPA 1QTRA 2XPJA 3T5MA 2BDTA 5ILOA 5LLTA 1MPXA 1I4OA 3E6CC 3IXMA 2BFFA 3KB1A 4A8PA 1C8M1 3TTXA 2FDRA 1W6MA 4ZMBA 4D41A 4ZVOA 5IKEA 3GAZA 1QV6A 1TAHA 5D6OA 2X6RA 2Q3CA 2AMVA 2VPVA 3RS6A 2XHEA 3H2GA 3IDCB 2C03A 3S8EA 1VSBA 4LI3X 5KSZA 5FPAA 3NDJA 5CIQA 5BNIA 2DY0A 1L5HA 1CR2A 3ICWA 3JYHA 3O1LA 4RMHA 3FKSA 2HWXA 4U2BA 1UEIA 4AEDC 5I7FA 2CL0X 4AHWA 1UC4B 4ZV7A 3D2BA 2ORZA 4JKIA 3W8EA 3TUZC 3GDGA 4DIBA 5B6IA 3MOGA 1SXGA 1QZTA 1K8YB 2X1MA 4LXUA 3U26A 4DWVA 2UKDA 4J0DA 1ONBA 1YQUA 3VGIA 4HNVA 4MQFA 1GUIA 3H6GA 1BN6A 5AI5A 4R8LA 1Q12A 3TXYA 4O2BF 1CUHA 1ZS9A 2WUDA 3H99A 3S70A 5CGQB 4FWIB 1J9ZA 1Q56A 2RFLA 4GXQA 2J6BA 3F5MA 4NYMR 4NOKA 3SYRA 4W8OA 2VAWA 3FMOB 2VT3A 2YS6A 1HT0A 1X7XA 3I2DA 3ABIA 3EQ8A 3ZH9B 1KYQA 1D6NA 3EDOA 2FMYA 5ESXA 1HJGA 4BY9E 1NY6A 1SPPA 4J07A 3PWKA 4JR0A 1L4NA 1C2YA 3Q8LA 4HWGA 2ZT5A 1ISIA 1CCWA 3WK9A 3O0DA 4B7AA 4K9MA 1T2FA 3T7RA 1ADYA 1VKNA 2GMEA 3IBFA 4IMRA 3VMMA 3ZIWA 1BN7A 3FVWA 4AHZA 2UWBA 2WHEA 1IHMA 1XXHA 2P91A 4IJKA 4L4UA 3QCWA 1WLYA 4BKOA 3GJ6A 2GS9A 3ANNA 1QIEA 1B6TA 4RS5A 1PD1A 5GPBA 1MVLA 3ZOZA 3KQUA 2DFTA 2OCPA 1ZCBA 3NIDB 5KOIA 3FFBA 4F9FA 1H8TC 5JQGB 3ADPA 3IQXA 1G21E 1ZYBA 5HR5A 4C4SA 4BJ6A 4HN2A 2PUWA 3RR2A 4AVCA 3K70C 3OMXA 1FMLA 2UYBA 2E21A 5F7OA 2ZAHA 1L7QA 1AF4A 3HA3A 5HPYB 3B78A 3TCKA 3B70A 3UWKA 1EDDA 2O8VA 4W7SA 2V1UA 3FLRA 1LHWA 1GZSA 2ZAYA 4XM1A 3KSAC 4AJLA 3ENRA 1SHKA 3NYRA 4XJ8A 3DLTA 3T12A 3LPGA 3PR2B 3I3OA 4RE5A 3S2FA 1XNTA 2FDXA 4IX9A 4QVKA 3EXAA 3N9OA 1NMSA 3PNLA 5LBIA 4BQPA 4RPGA 2BISA 3K31A 2ZHLA 4Y2VA 4IY1A 4NL4H 3H3ZA 3QV1A 4BGIA 1WQ1R 3GRZA 5LWBA 4MWOA 1GKKA 4B17A 3SJUA 2PGIA 1LPNA 4DMUB 1S9HA 3O8QB 4LCJA 3IKVA 3POYA 1F6DA 1XLWA 4N8DA 2FQYA 3KWFA 4DQ0A 2QPLA 3B3GA 1N4AA 1KBOA 2Q1XA 1CZTA 3IMMA 3QGMA 2HWD1 4EN9B 4G4FA 1UU4A 1V8OA 2YYSA 4YWHA 2AG5A 2HRCA 4XTRA 1AL21 1YWGO 3C3BA 2IXCA 2OV8A 1POXA 2O2ZA 5LP6A 4LO6B 3HO1A 3P9IA 5JH7B 2PJDA 4DRZA 1C0IA 4TS9A 1VLQA 4ITCA 3KGLA 1AR72 1DQRA 1UYYA 3QBTA 2RS13 4U2KA 3U4HA 4I19A 1S1MA 4P58A 3N3HA 2QRNA 3L49A 2QF7A 2X2EA 4XCQA 1Z33A 4C7OB 1JIIA 4IHJB 3DFIA 2QYSA 1V9U3 3QW4B 4BLTA 1SFYA 5DM1A 5FI1B 1PCXA 1OBCA 3CONA 3PSHA 4LSGA 3S2GA 4G56A 3KPYA 5A7PA 4EJ2A 3A1VA 2CDOA 1Z2NX 2M9MA 5H4HA 5FLHA 4M3CF 3UT5A 3DOFA 3DCQA 2I6UA 1LS6A 5AO9A 1LRHA 4F8YA 2KM2A 4E27A 3F4LA 3K0AB 3R6GA 1PZEA 3FCOA 4KO2S 3HADA 1NKVA 1ENOA 3GQVA 1H30A 2JZOA 5HKKA 3PURA 4Y2GA 1DBSA 2IZ5A 1JI6A 2AEJA 1N3YA 2AUNA 2AC4A 1ZM4A 3W5HA 1SCNE 3EPJA 1V7PC 2Q2VA 3ZK7A 4CKZA 3LWNA 1HL3A 2VCHA 4JX0A 4HFMA 1QG4A 1QS0A 1S89A 3O4IA 1CQXA 1E2LA 4BE9A 3I9FA 4I9GA 2VC2B 2ARXA 2PWPA 4ZEXA 3V8MA 4BO9A 5DW0A 1I10A 1SU6A 1L5SA 3I9V6 3NDBB 3BJZA 1E9AA 5CFCA 2QDXA 4RVFA 2O0LA 4E12A 1DS6A 4C01A 2YZ4A 2ZCVA 2CVPA 1DIWA 4FFLA 4WBSA 4RVSA 2QS9A 2G19A 2EEZA 4MOAA 1IXZA 4LVNA 5A3PA 4M0UA 4MS1B 1N5KA 5DHFA 5HKAA 2BM0A 4RD0A 5DTIA 3OLCX 5BXXA 4TTRA 4WWHA 3FLTA 1UODA 4BXFA 2NN8A 4AYTA 1EA5A 1NXQA 3LLVA 4HLNA 1X38A 4BTLA 3I45A 4I1IA 2RIRA 3R05A 5BSUA 5FZAA 1G3RA 2C5HA 2QW0X 2WVGA 4B0OA 2ZIZA 3AUJB 4U8GA 4KE7A 2QBYA 1ZL0A 3EZYA 5B1YA 1E1QA 2ZS9A 3UKTA 1VAVA 2WZR2 1JNXX 1P3JA 3TWOA 2DZDA 4MR8A 3GEHA 1XCOA 4Z2WA 2H1HA 4BFWA 3GROA 1RVDA 2RS33 2HBYA 4P9IA 2UZIR 4IRUB 3GPDG 1OOPA 4JU8A 4QKNA 1KGDA 2XA2A 2JG3A 1SKYB 1GWNA 2HNAA 1HTTA 4F97A 3ZDSA 1R37A 5K0TA 1JG6A 2XGJA 2H5EA 2IUTA 1C8M2 5KC5A 3FUTA 3KZCA 3RRFA 3GLRA 2Y05A 1GQPA 4HWSA 3IR5A 4CM9A 5FL7A 4R54A 2Q29A 1CIJA 2ZJYA 2LALA 3PIJA 2YWBA 4A5OA 3N5KA 3P19A 1QFYA 1BBT1 2O8CA 2O0OA 1YDHA 2G9GA 3V8QA 1P6UA 1G8YA 3BD8A 1PIV1 1Y9JA 1LPOA 4EJSC 2D3WA 3AX4A 4HZUB 3TTSA 3RG2A 2FU5C 1GUFA 1HRV1 1W1IA 4U0JA 4ZQGA 3FHTA 4B44A 3WNKA 1Y6GA 2EW8A 1T5OA 3HLYA 5AI8A 3MB8A 3H5AA 4NV3A 1KFEB 3T9EA 4RAQA 1UYXA 2QUOA 4LQDA 2GNMA 2VQTA 2BKLA 3SCHA 4F3TA 5IJXA 4QO7A 1M1UA 4G8BA 2XKPA 3ZK9A 4L16A 3AQIA 3DFKA 4X1YB 3V6LA 3KKPA 1PLLA 5EQFA 5LWQA 3JV7A 2DPYA 2CFTA 2MYTA 4P1ZA 5ECDA 4PJYA 1NOIA 4MWTA 1NW6A 1IQPA 2VP9A 2W6CX 3WDKA 5AH0A 1W6QB 1A6CA 2L82A 1DAFA 3LIIA 1C3JA 3OQJA 3SD7A 2R8RA 5ES4B 1E4VA 4RHXA 4J16A 3BRQA 3GLGE 2P7IA 3C98A 4LT5A 2ATXA 1DC5A 3MOSA 3H1AA 3TF5A 2WO1A 1RPNA 5L6MB 2JFGA 2CK3A 3ZYHA 3CG0A 4IICA 2R1DA 1OVMA 4L7QA 4L8VA 3LX4A 4L4YA 4M7OA 3KLSA 2WJGA 1X92A 3ZFFC 1XQWA 4GL2A 2B30A 5JSHA 3V80A 4GB31 2NPIA 1XWIA 2HDNB 3K77A 1QFJA 4AZSA 5JIUA 2C7RA 1PR9A 2GYWA 4XYGA 4TVSA 5IDVA 1XHLA 1UBGA 4MGTA 1CRLA 4MP3A 2W2NA 3ON5A 5E16A 1ULTA 2ZAMA 1NR1A 3IH5A 2XXZA 2ODEA 3W20A 4MV3A 1H4TA 3RF7A 4J7XA 4JGYA 3QNWA 2V0NA 4PRLA 4HJRA 1KE1A 1KAMA 1CZLA 2JFUA 2R2GA 3BWVA 1QC5A 3KTDA 1SZDA 1T2VA 5DHSA 4QDTA 2AYYA 3OEBA 5LDHA 2AR6A 2VD7A 2C4TA 3DEFA 1EPUA 3ER6A 1YTUA 1JYIA 4N18A 2VUUA 4HMOA 5FMOS 1QHHB 2GGSA 1YGPA 3DZHA 1N2CA 4OUKX 4S2DA 3G89A 3GJRA 4NI5A 5LATA 3NYIA 3VRHA 2J31A 4LNVA 2E6KA 4I66A 3ISJA 4Q1DA 4QPYA 1GV9A 3NHBA 5IULC 1VIWB 4KFUA 5BMVB 2X77A 2GF9A 3EGXB 5D1NA 3DHEA 3TQFA 5B6JA 4LFCB 2BOJA 4LNUB 3OEHD 2BZGA 2ZTVA 1Y4DE 1V25A 3BSFA 2ZROA 5E0OA 1YZVA 1W36D 1EYZA 4MGZE 3FHJA 3UGHA 1NSFA 3A1UA 4HWTA 4BLQA 3MRTA 4TMWA 5LA6A 1TEIA 4OXQA 1I0LA 3ORQA 3COPA 3I49A 2G9QA 2E6UX 3M8LA 1X7DA 3QHPA 2EL9A 5CLFA 4B4VA 3U62A 5EMHA 2NVUA 1J5XA 5ALUA 1HH4A 4CPDA 1NWHA 5FP9A 1EFDN 1Y9MA 3F5DA 3ZXDA 3A70A 4UW6A 1K3FA 2W39A 2Y1EA 4E5SA 3G2QA 5KJEA 2GXAA 1RADA 1UMBB 3TSCA 1GN8A 1PUIA 2XADA 3RS8A 2P5BA 5FPPA 3SVZA 2XWPA 5JSZB 1PL7A 2J3MA 4X66B 5B3JA 2IPAB 5C3OA 1R7RA 1X94A 1U7XA 4KG8A 4IDOA 3RYKA 5ADHA 3T0AA 2A6PA 5TV2A 2PG3A 3I9V1 2BBSA 1QP7A 2OO7A 3TQIA 4EG4A 2FWRA 1OH5A 4WV3A 2PZFA 4PYIA 2HJHA 5ADVA 3VKNA 2RKOA 3KV5A 5D6NA 1JKJA 4NHLA 5TT1A 3M4XA 3VKUA 2Q8NA 1ZK4A 3QYJA 3EDRA 1P1JA 1HV8A 3NJ8A 4DJDC 3V1UA 1BAPA 2CJXA 3OCXA 2WU0A 1BMFA 2HGZA 1Z4OA 1G4AE 3HLKA 1AGPA 2ADDA 2ATIA 2H1WA 4K6BA 3BX1A 2CLFB 3TSZA 1V6CA 1APBA 2GHRA 3MHPA 3WGZA 1WUHS 3L8FA 5T5PA 4D3SA 4DREA 2ERYA 3WYGA 3FPFA 3ERCA 3ZZ1A 4A6PA 4IIYA 3Q1KA 4MVJE 3OJLA 5LD2C 2VNGA 2JLSA 2CZQA 3O2NA 4JLPA 2IP1A 1IPFA 4QAWA 4KVGA 1D9ZA 1L5KA 4GIBA 2NSYA 2Y4NA 1V2HE 4CCDA 4C2TA 2QTZA 3H9UA 1F3LA 4ND2A 2YN4A 5H9VA 2YG0A 3K4AA 1WW5A 1V96A 3COSA 1N57A 4QNNA 5UKDA 4EMTA 2RS52 2IE8A 3CUKA 5H4GA 3L7MA 1BXRA 2DTDA 4Q3DA 3K53A 3CGGA 1RIFA 4P32A 3DV0B 3QELB 3MB5A 5HCHA 2WWXA 2Q3MA 5A7FA 3WI7A 1K66A 5G0WA 2QLBA 4OHCA 5C32A 2PH5A 3PDHA 4Q5OA 1ORHA 4FOTA 4N9HA 2OV4A 1WP9A 2C2OA 1QOTA 2ECPA 2VI5A 1G6KA 1QGED 1UXXX 1GKBA 4WRRA 3E5XA 3ZYGA 1R083 3A05A 5EIYB 3F8TA 3STVA 4XVQA 2AR9A 4LF4B 4HATA 1FMJA 4AJOA 3S5UA 5JRZA 1OTXA 3FNGA 1C8M3 2YXEA 3NDRA 4A2PA 5K4LA 3A31A 5BNWA 1E1RA 3USUB 1COV2 1P2GA 3QX8A 3C5EA 4L08A 4CEHB 3C39A 1M2JA 1FFGA 1QJX3 2WJ3A 1KVTA 2IZ1A 4Z4EA 2J46A 4FI9A 1QPZA 2IYOA 3ASUA 4RR3A 1QE3A 5BSTA 4LDZA 3JZIA 1Y3FE 1BCSA 5JS6A 3LTEA 3A4LA 4TXHA 2Z58A 5B4VA 1G20B 3NEAA 1DEOA 2UU8A 4RVNA 5BV2P 1YI9A 5ESRA 3HACA 1D7OA 4JVNA 4V3CA 9GPBA 1E5VA 4RMJA 2Y9PB 1RRVA 4U2AA 5GMOA 3LIPA 1J33A 4HAZA 3JVUA 3VPHA 2XDAA 4K9DA 3LUFA 1NJ8A 2ZJ7A 2G77B 1U02A 5JZMA 4DJFC 2AMFA 4HGZA 1DT3A 2Z98A 2G9RA 2P9EA 4QGSA 2PZ8A 2N47A 1T9DA 3B7MA 2G1JA 1DGRA 4BUJA 5BN1A 3PTRB 3TRHA 3EPHA 1T3SA 1V6IA 1XZFA 3ZWCA 5JSKA 3NJ4A 4OLJA 5DWVA 1PQYA 3A32A 4M1EA 2I7CA 4AQSA 1Z4NA 1BFKA 1FRQA 2W6OA 4CT4B 5D8AA 1GTSA 1GVHA 5C5TA 1TVMA 3HVDA 3E05A 4QQKA 3BHMA 4Y9RA 3JW8A 4R1PA 4A5SA 2CB9A 3R6LA 1QOPB 3NAGA 3CT6A 3H0EA 3G9QA 4EZ4A 3KOYA 3WQRA 4CKBA 4RCVA 1YTLA 3MJVA 3QFHA 3DHVA 2O2EA 3QTLA 3IAS1 3RREA 4TMZA 1MR3F 1P0MA 4QDJA 4Q12A 4JHTA 3TLGA 4XDOA 1NXVA 4AJ1A 3PNAA 3KEFA 4LOTA 1TEHA 1KZ9A 4EHHA 1KF0A 4AJ9A 1B15A 3ZWPA 4LKSA 3AJYA 1XKTA 1NSYA 4RWZA 3W5JA 2QY6A 2ZVJA 1DP4A 3ELUA 3ZG6A 1XXHE 3B8HA 3UWPA 4C30A 4CNBA 5D84A 2OFWA 3E7PA 1QBKC 4AC9A 3MGBA 1T0UA 2GTIA 4KV9A 4E8DA 1GDDA 3ENWA 1JLHA 1DQYA 3WISA 4F45A 1GM5A 2BEVB 5HF9A 1I0IA 1IZYA 2V3CC 3JQCA 1XTQA 4IWXA 2VRBA 2MMCA 3E03A 2HU5A 1VMHA 2IY7A 1BMV1 5TPZA 4R51A 4XTMA 3DOUA 4R1NA 4ZPXA 1DAOA 3PKIA 1DPFA 5B4NA 4BMVA 3E53A 3GZTB 1T2UA 1CUDA 3WNDA 5E38A 3C3EA 2OK7A 5FWXA 1KJWA 1VFNA 2VTVA 4JRAA 3LQ2A 3Q6NA 3LPMA 3WOGA 1QHIA 1W49A 2ZIGA 2XIJA 3OC0A 2J9FB 1YOBA 2V96A 3F3MA 1Y3IA 2IUWA 4JROA 4UMEA 4UU0A 1FZTA 3NMBA 1BMFD 4KO4S 3ADDA 1KA9H 4QQ2A 2RG7A 4Q1PA 3ITQA 3PVNA 4QPDA 4Z9XA 5ICGA 4P36A 3RWBA 3RVKA 3ESBA 5JXGA 2EG9A 2ZEYA 4JMPA 1NY5A 5BUSA 4Q4X1 3T1OA 3T1NA 1X7YA 1U2QA 3RUPA 1VIDA 2PTMA 1X8KA 3T9BA 2JJ8A 1CDDA 5EUCA 2R86A 3K8QA 3SE7A 5DUVA 5BN3B 5SY9A 5D8AC 2BZSA 1W5BA 8GPBA 4FFRA 3MIHA 1YRYE 1MRNA 3DCJA 1HQNA 2Z9CA 4MKGA 3NL1A 1ACLA 1RBMA 4EEKA 1PRYA 1Y1KE 1M76A 3AL2A 2B1RA 5BRAA 2ZGUA 1LPBB 2IEAA 3WGKA 2WJWA 4XEHA 4TGLA 3N2NA 3EBLA 2IQ5A 2L42A 2J4DA 3L6EA 1KAGA 4RF2A 1E7MA 1G7TA 3FNFA 2R9VA 5FZCA 4ETNA 2VLBA 3II6X 3ENZA 3M3IA 3V7NA 1DRJA 3LDGA 1QRRA 5LQUA 2G1PA 1ND2C 1UDCA 1PUJA 3OJBA 5HVNA 1SIOA 2JKXA 4KSYA 1KJRA 4RPCA 4L4SA 2WIFA 5E6RB 3S44A 1N3IA 1XTPA 3FMVA 4GI2A 5L51A 3PL0A 3ROKA 5C7GA 2ARBA 3ER9A 3TZ6A 3HFJA 5FUWA 4QQOA 3TI7A 2F17A 1VBA1 3K73O 4FB4A 1OX6A 3A9RA 5INTA 1FATA 2ZRCA 3R3XA 2WT0A 1GZ6A 3V55A 2RE9A 4EECA 1GZHB 2XWSA 1RD4A 1QY4A 4UXIA 4N3BA 3KJZA 3A1CA 4GR4A 4MH0R 2RD2A 5LP1A 3LSTA 3TVYA 2VYNA 3UPTA 3ETEA 3QMMA 2KMLA 4QWMA 3UTDA 1HG1A 1NT2A 2QRLA 1RUI3 4D42A 4M6WA 3L1JA 1BHSA 4E13A 1J8VA 1KP3A 1KDVA 1I2DA 2H1RA 5CXQA 3DQPA 1SHLA 4ZQHA 4F9TA 4O3MA 3OX2A 3PUQA 3E7FA 4FYPA 3ACIA 1U9IA 4GGOA 1XBFA 4FC6A 1P5FA 2OLEA 3EFBA 1RXCA 4FX2A 3WS7A 4BX8A 5FAXA 1DDOA 2QRVA 5L9RA 3H2HA 2YBKA 1K5GA 2C8LA 5CKNA 3OEEA 4OYUA 3AZZA 4XTPA 4CCEA 1MKYA 3FVVA 2VP5A 3U4QA 5I7RA 4RDIA 3RIMA 5CVCA 5KYYA 4LA2A 1LY1A 4ACBA 2HK6A 3GT7A 3SC2B 2YN0A 1R1A3 1EWVA 3FX2A 4P6VF 2BBOA 4C06A 1BTOA 1QFXA 4H3HB 1PR4A 3LUBA 1XMJA 3HIFA 4LHKA 2FCTA 3L0CA 2WYIA 1BXGB 2H1IA 4ZHQB 2E4XA 3FYTA 2TUNA 3VR6A 4DANA 1YRAA 1UBFA 1A95A 4RZXA 5A9RA 3KVOA 1SA0A 1PWZA 1NAIA 3TOZA 1JR2A 1HE4A 4UHBA 1WE2A 2QYHA 1BVP1 1XNQB 3SYNA 3ITKA 2FUEA 1SU4A 3GEBA 4HDSA 1TMF2 5DYNA 3O8CA 2OOSA 3D4OA 1U8CB 4QHYA 3RS5A 2YIDA 3QH4A 4UARA 4YXWA 1J1ZA 1KETA 1HE3A 1VBMA 2JFNA 4WK0B 1DBWA 3GZUC 2B99A 4UHEA 1GQ2A 2OM6A 2YR0A 3VDDB 2ZAOA 3T5GA 1CY1A 1SVUA 3RZHA 4RIEA 3CX3A 1J58A 1Y3HA 4C04A 5CPBA 3HYNA 3EIQA 3JBG3 1CS0A 4R68A 3GZJA 2HL6A 4G86A 1HQWA 4PZ0A 5T8KC 4MJXA 2L19A 5F64A 5FOTA 2J42A 4NNPA 3JVEA 1TI7A 4J1WA 2NXEA 5JS7A 3GHHA 3IV6A 4HXFB 5FNVB 2BMFA 4XRRA 5FYVA 1RQLA 3G7SA 3EPPA 1R081 4KWEA 3O3MB 3ZKYA 4N6GA 3P0HA 4C1BA 3N7KA 1U7TA 5F3DA 3LP5A 3MS4A 1AHHA 1X7YB 2YHUA 4CIYA 4XXAA 2X53S 2FG6C 3DDWA 3KT3A 3EMRA 4M1OA 4UKDA 4KUGA 1G4UR 4LJHA 2P69A 3POIA 1GDHA 1FUYB 2H6CA 3RJ9A 5B1SA 3BQMB 1PG2A 2Z83A 1EUYA 1DKLA 3CKLA 2VZ9A 3LQ1A 4MS3A 2WSSA 2WFMA 3MD0A 4QU5A 4BDVB 1QGAA 3MWYW 4W7IA 1X7WA 4UAGA 4QBGB 5IVYA 1K4KA 4CYDA 2GXQA 4QMAA 4KYTA 4BMPB 4BO5A 3NAZA 3FA2A 1DLLA 3BWCA 4HXEB 1OOPB 1EUCA 4GPIB 2Y27A 1RLJA 3OX4A 2R6AA 4BO1A 2R5FA 4IGEA 3UAGA 1EGHA 4AXXA 1DFHA 3N0VA 3L0DA 1BQ3A 4K1XA 1N75A 3GGGA 4XASA 2NACA 4JITA 1XTTA 3C6YA 5FYTA 4TXNA 2C5LA 1ZM1A 2VHZA 3KO8A 5JOYA 5IMSA 3CSUA 5FWYA 2DLCX 4R2XA 2OQ6A 2C1FA 4XQCA 3JQAA 2X14A 5KXEA 1UX7A 4AF9A 4ERXA 1BYHA 4D99A 1TG7A 4AI3A 4JQZA 4CVUA 2ILMA 2WSVA 1ISHA 5FZKA 5H9QA 3DO5A 3LE0A 5JWOA 5E3JA 3IQHX 2LCFA 2D7JA 5FUQA 4OM7A 3EVTA 3P0IA 3CH7A 4WDQA 3L7DA 4BMXA 4GF5A 1NG0A 2DBRA 1VECA 1PNFA 3O5AA 3K5HA 1HDRA 3ZBTA 4HNQA 1NSTA 3C1TA 4Z99A 2CJWA 4LXIA 4Y6QA 3DFUA 5CR9A 3BMOA 2F00A 1OHFA 4FAHA 1UD1A 3ADBA 4ENRA 3S1SA 5CA1F 1JMYA 2I71A 1IBCA 2ACVA 2ZUUA 4BQWA 3CF2A 3N9NA 1P3Y1 4B5KA 1SBIA 4RGYA 8OHMA 2AF4C 4RACA 4RXTA 1PLJA 2W0SA 3KOOA 4RQBA 5JI2E 5FDBA 5CNMA 4R7ZA 2DBVO 2PO7A 2X6QA 3KLNA 3JRXA 2G17A 4HKOA 4UHDA 3K0BA 5F37A 1XUOA 3LBHA 5AVAA 2LVBA 4R9UC 4MVJP 3OIVA 4JVOA 3U19A 3U14A 1TJ5A 4A03A 1WV1A 3AJDA 3EULA 3UT5B 1M2HA 2IIBA 4E1AA 3OF2A 3O0VA 1AS3A 2OPWA 1RM5A 3BEOA 4FYYA 3WV5A 4O29A 1D0SA 3LLMA 3ZDZB 4F7ZA 3VZMA 4EB3A 3MIFA 4ZGBA 3A6FA 4IG4A 2VMCA 4HPKB 3V4LA 2IXKA 1G16A 3FMPB 2G5TA 1GTZA 3PC2A 1CUCA 1JN0A 4ZCRA 5JECA 1DX9A 3DFFA 3ROXA 1N9KA 1MA0A 3IVXA 3IBTA 5IW0A 2VTXJ 3OM0A 1IC6A 2WM3A 4AFDA 3L0OA 1XN4A 4N7JA 3IUQA 1PJBA 3NNSA 5M2QA 3HJCA 2VUSA 2WJVA 3IX7A 4BB6A 1A9OA 2C00A 2VBBA 5KWSA 1RWWA 4I81A 3IVRA 1JIJA 5CIRA 4B4RA 1RUD1 3T5CA 3I6QA 4U36A 1DB3A 5HW0A 3C7HA 3U16A 4RTKA 2NU8B 2VHJA 3UKJA 3RSZA 2ZG6A 4X0EA 2IXBA 2OL4A 2HBRA 2FOXA 5I4BA 3QWIA 5BWMA 4N76A 5JR7B 1T2NA 3AL0C 3KM5A 1KK1A 4QFCA 2BLNA 4S05A 5IKPA 5FP8A 3W5SA 2P8SA 3KQ4B 2C2GA 1O9HA 1UKBA 2BOIA 3GO4A 3H97A 1MRSA 2EZ9A 4HQOA 1LHNA 2L17A 1ZGBA 4Q4V1 3O0TA 2PHUA 3L7YA 3EBRA 4D8YA 1C0PA 1ZWKA 2FRDC 3CZUA 5CIWA 2GH1A 2ZUEA 5BN5A 1UP6A 4ZAXA 3F6PA 1Z2EA 4G2NA 4UCQA 3L9JT 2VOEA 4U39A 1U31A 3IO3A 1NJSA 3MICA 3R8CA 5DYGA 4LOLA 4QQ8A 1GSIA 2RS53 1TA0A 4ND8A 1J0AA 2O7SA 4XDYA 4LKFA 4A7KA 2K0GA 3VZLA 3M9XA 3UAYA 4IGIA 1RS0A 4P4TA 3K9CA 4S0XA 1ZNQO 1M75A 4I0WB 1PG5A 4GBJA 5CLGA 4TWZA 3FETA 1PWXA 4YGEA 4BNYA 3U40A 1ULUA 3MXOA 1V3TA 4Z7NB 4Q4X3 1MS8A 2DP4E 1XOYA 4X8OA 1A8UA 5F7UA 4A82A 5GADl 4Q19A 1HB4A 4XOIA 2AQHA 4L02A 4FQ5A 2IFWA 3RSLA 3JQPA 4NRDA 1P75A 5BVGA 3LSEA 2AIRA 4ZZIA 4HMZA 3J8F2 2CMDA 3N28A 1DUVG 1GSAA 3MEQA 5I9BA 3I28A 3EXIA 2C04A 5ICFA 4NC9A 4QT0A 2XUIA 2J7MA 3CUTA 3X29B 2HWC3 4BXSV 3SF8B 1GP5A 3PCTA 1QIJA 4D9FA 4GSLA 2QJVA 1MAHA 5AWFC 1XNRB 4NBUA 3EJ6A 1T4DA 5HM6A 1SB9A 1OD6A 2KXLA 4M3CB 4HF7A 1SLLA 5EUBA 3S2UA 1JFVA 1FQWA 2HZ7A 4LOHA 1E6UA 2F3RA 2VCYA 4G01B 4DIFA 1PQUA 1SCUB 2I6TA 1UL1X 3C6ZA 4TUYB 3KS9A 4AAPA 3HJAA 4D79A 2NV2B 3U4CA 3KSBC 4KIUA 3IQFA 4HLUA 3FR7A 2V65A 4JH0A 4MCJA 4O63O 1HFEL 2HFKA 3JQBA 1TCVA 1KAHA 4ECAA 1Y8ZA 1JRLA 4TYYA 2R1BA 4WASA 1X80B 3L7CA 1UPFA 5IVIA 3IPAA 5DBIA 3R20A 4DNPA 1U1CA 3A0NA 4ZPIA 1C1XB 2A0UA 4S2EA 3CKMA 3WL6A 1OPRA 2GCOB 3K1YA 1GYPA 1XR3A 4Q3EA 3HJGA 1U2ZA 3QUSA 3Q87B 5JD4A 2Y1OA 2JGFA 4HAOA 4H1UA 1OYVA 5CUQA 1YCIA 2BHSA 1PZFA 3RZMA 2P1BA 4AJPA 3DSRA 2ZDHA 5HJ7A 3NNDA 4PSKA 4FCAA 1YB7A 4AJHA 4GFDA 3QLVC 3OTWA 4YJFB 4MGEA 1G8KA 2ZBEA 4H1HA 3X44A 1OLQA 1QC5B 4A6EA 3KJNA 2FFRA 4UCFA 3T4XA 2DUOA 2W95A 5KSOA 4X94A 4BLVA 1E1MA 1ZZ8A 3UFBA 3AI7A 2OGSA 5AJHA 4KN8A 3NVMB 1G5TA 3FLMA 1G5QA 5J4LA 4IJVA 2VP2A 3ALQA 1BDMA 5CCXA 3ILRA 3H2IA 3IVCA 2JLVA 4UMDA 4XGIA 1M8PA 2IE0A 4PSVA 7MHTA 2PYIA 4N0QA 4YMVA 2W37A 3T1YB 3MF6A 4QSMA 2EDAA 1Q14A 3T1TA 3P9NA 2D97A 1CD3G 4JLDA 3VV3A 3VD4A 1BEV3 5AK6A 1I2ZA 3CT4A 4RY0A 5KDOA 3OX1A 3EGEA 4KQ7A 2IHJA 3T9DA 5A6SA 3D3AA 1E3WB 3AUXA 4A41A 3BB6A 2H1CA 1YQGA 3KHCA 4YW2A 1LD3A 2X4GA 5JOWA 1JZTA 5FBLB 1FOD1 2J9RA 1RHI3 4YRAA 4BO2A 3ZGZA 1A77A 4Q66C 5FO1A 4MW1A 3I72A 4NPCA 1DQ2A 1YNOA 4ALJA 2ZM6B 1EK5A 4ZO8A 4AI2A 4LTDA 5KOJA 4FJ1A 4O6VA 1GL7A 1IHOA 5IVDA 1MX1A 4QB1A 4JK3A 1R0WA 4M46A 1BD4A 4V39A 5ANRB 1W8ZA 4PS0A 1MAUA 1RMU3 5A2GA 1P8JA 3PGA1 3QA9A 3W1WA 3USZA 3UEOA 1W0OA 1T2CA 5DAQA 2VWGA 3THYB 1SDWA 1OBVA 3WK5A 1LNQA 1PJCA 4YUWA 5K3SA 1VBC3 4HNUA 4YWAA 3LV8A 4QXMA 3H6HA 1D09A 1WCUA 5ALIA 1JTEA 5DDJ1 3WLOA 3IA7A 2DCMA 1HRI3 4TXWA 5EZYA 4L6AA 2A3NA 1ZC3A 3FOZA 1YC61 2NYVA 4GZ6A 1W8DA 3KQNA 5FYMA 1O6ZA 2DFDA 5EXTA 4PFKA 3MUOA 5CX4A 3ETNA 1YRLA 2WC1A 3U7EB 1DI0A 2FLVA 1WB4A 3QEOA 1IONA 2R97A 1SNYA 5DNWA 4LJ5A 1EH5A 2X05A 4ENQA 1J5EB 2SKDA 1CUWA 4GBGA 2D2EA 4BO4A 4QUHA 4K3UA 4D9EA 1XFDA 1Z73A 1UY0A 1V7CA 2LGJA 3R9XA 3RGWS 2WF8A 5K0SA 2A6VA 5A62A 3L1KA 3C24A 4R16A 3E5MA 1RC8A 1Y9ZA 4B85A 3ZBPA 2G28A 3TDMA 5FQ0B 4A45A 1ISMA 3ZFFA 1X15A 2PH3A 5BURA 4P02B 1YS7A 2HWF3 5BXQC 4EJRA 4BC0A 3EZ2A 2HOQA 2DTWA 4GQ7A 3DTVA 2H4HA 2V74B 4ZI7B 4JUCA 4RH1A 3I2JA 2JASA 3O9MA 2Z2KA 4X84A 2HQ1A 1Z2CA 5DBFA 4KSCA 1LDGA 1W96A 4L9SA 3MEPA 4L8YA 5FDFA 3TJRA 1GUBA 5JFOA 1MB2A 4ZYVA 1QJU3 3ORHA 3FFTA 2DPHA 2BEUA 1OC1A 4YVWB 3UJAA 4PHHA 5F7XA 1FV2A 1VBE3 4J7CA 2VW0A 1X36A 2HPVA 4QLBA 1Q16A 4QGHA 2GJ8A 2VF4X 5AM1A 4DA7A 2AXNA 5J5CA 4BNXA 3OUUA 4YAOA 3BJIC 1DINA 1F5SA 4WEOA 3PZRA 3HEIA 3W5VA 1VB3A 1T15A 1WA4A 1JALA 3JX9A 4Q0PA 1CAXA 1B74A 5EJAA 2X0FA 3NTUA 2Q7DA 5JXJA 1QB7A 5IC6A 4Z8YA 3K96A 2QQMA 4LX8A 5DBOA 3STWA 4X00A 5KDDA 3HNYM 4WI1A 4IV1B 2XZTA 4LF5B 1X70A 3WVJA 3VD7A 1RLTA 3D8HA 3DEIA 3G1UA 5EJ3A 5FO7B 2X8BA 3N87A 5C4WC 5EUMA 4KUEA 2Z0MA 4KU8A 2NXJA 3P1IA 1XTKA 1NQAO 3E82A 1CY7A 1ZD2P 1UZYA 5AR1A 5I9LA 2IUUA 2FF7A 2R6DA 2VJMB 3HQXA 1ADCA 2PU5A 3A6JA 1GYKA 2I8CA 1CEXA 2E9SA 4L5JA 2QI9C 2ID7A 3DAHA 4KYIB 4I2NA 2HF7A 2YIMA 2OLKA 1USUA 1W52X 4JX9A 1YVRA 2PKQP 4BWGA 3OBZA 2B4AA 4D8WA 4L8LA 4OXXA 4F06A 3L05A 4PU0A 5IF3A 1R9GA 4CP0A 2X10A 1CQIB 5GOZA 5FR2A 3C8XA 1KHHA 3T41A 3DD5A 2F2TA 2XJQA 4H1TA 5JWHA 4HRXA 5EMKA 2D1RA 3RO7A 2JGAA 4OQXA 1MGOA 2YOHA 1DZIA 3EEQA 6REQA 5K05A 1T2AA 1VBNA 2EX4A 2V45A 1D1TA 5FUBA 4C0QC 1ODKA 2GM5A 4C4RA 2WIJA 3OUTA 1CQZA 3DW1X 5KYKA 2DJ5A 2VNSA 3LUPA 4IIXA 2FCAA 4L1KA 2VYVA 1UMZA 1U0JA 1EVLA 3S99A 3IUNA 3WLJA 4BE4A 2CVHA 3R9IA 5K0FA 5J1SB 1FFHA 2EJCA 3P2OA 4QD3A 1ST3A 3PXXA 4UPDA 1YIAA 1GZ3A 1V0AA 1FXZA 2DVFA 3GUUA 3QLQA 5TNXA 1LAJA 2ZITA 1CYDA 2W6QA 4H59A 4OJTA 3HVRA 1RAHA 4WJLA 3JD0A 1AKRA 4D9HA 1NXPA 4FTBA 1E2JA 4QECA 2FX5A 5B2EA 5C3UA 2GEKA 1OH4A 4EL0A 3TZCA 3CE6A 2EICA 3TE7A 4FHEA 2XITA 4JLBA 3SCGA 4TTQA 1ZI9A 1PZXA 2HZBA 1YJLA 4M0FA 2HA2A 3AKRA 1XMXA 2XMRA 1Q95A 4JVMA 4COKA 2QMEA 3ETGA 2HN9A 2PA3A 1ZSVA 2XQKA 2EF0A 1JHZA 4W4ZA 5CK5A 3KKKA 2BJSA 5JOXA 3NUZA 3ZDXB 2XT6A 1JH5A 2MINB 2WWGA 4CMBA 1RVF3 3UHOA 4CCWA 1W47A 4NH4A 3BICA 2ZI9A 1MHPA 3JQFA 2YFUA 3VQTA 1BEUB 3H1GA 3E4DA 1OLME 1DHTA 2W2LD 2VJMA 4GMFA 3AFHA 1XCJA 3WXMA 5FO9B 1RFLA 3AUTA 1AZDA 2QVBA 5B1HA 1U2GA 3TRJA 1EWRA 3V7UA 5L7TA 4PFSA 4JA2A 2RV9A 3R3SA 2HV8A 4PLYA 2PZKA 4POAA 3LZDA 4YI3A 4WL0A 2PNJA 2B78A 2FMKA 1GKIA 4WNAA 4CMGA 4HKLA 2WAYA 1NONA 2Q1MA 4KBGA 4PPNA 5CD1A 4DR2B 4XDPA 4IEWA 1KKUA 1O96B 2CV2A 4WGFA 5ABJB 2BY4A 4D82A 4BBPA 4KODA 2OVFA 3FZ3A 2C97A 5K3BA 2QD5A 5FZBA 4EPYA 4Q3NA 2F8TA 4JDOA 5FKJA 1EMDA 1DKNA 3R1IA 4MP6A 1TE1B 4XIJA 3KZXA 3G7NA 3UJBA 4AX8A 4OREX 1QOQB 5EJMA 4JJGA 1YR2A 5AFEA 1J0EA 1JHAA 3K6SA 4DB4A 4QU8A 2QRZA 3KJFA 4UDOA 5LD2B 1WJGA 3SKYA 3ZO0B 3ILVA 1JIVA 1XQ6A 2VS1A 1AKYA 3TTVA 2QRMA 1XE3A 2JH3A 1KEZA 4YVWA 1MV5A 1UZ0A 1Q50A 5HX7A 5G41A 4DQAA 3ZX4A 1SWWA 3REOA 1TW2A 4OUEA 3ZYCA 1F8VA 4P7FA 3DOJA 1M5RA 3ZN6B 1U3DA 4P84A 4L95C 3ELNA 1XLVA 4F1KA 4MYHA 3BH7A 2B4YA 2FWPA 3LOQA 4DR3B 1MDBA 4Y20B 3U1VA 3VYWA 1G41A 3HZRA 2VNKA 2GJ4A 3K4PA 2NSJA 4DA0A 1H8EA 3C45A 5ALTA 3WXPA 2YGMA 4UEWA 4BQOA 1FTSA 1TM4E 3FF4A 2ZBDA 3QPCA 4AWXA 4YO8A 3ZDVA 1N1MA 2XZOA 2UYQA 2GJKA 5D00A 4AVSA 4QGLA 4DLNA 3FYDA 1EYBA 1CY6A 2OCAA 1W2HA 2PGLA 3QHAA 2HU2A 5HF5A 1L5HB 3C16C 5FUYA 3MS7A 2FRVA 5GJCA 4PG8A 1S3SA 4AN0A 2FWBA 1DTWB 4N0PA 4WVZA 2JIZD 1QOZA 6ABPA 2PFKA 1BDIA 1HN0A 1VALA 3EGIA 1E9BA 1U0NA 3EWNA 2FETA 5EMJA 2GEBA 5H9WA 3EG9B 3EMDA 5EJ6A 2RE8A 1J8FA 3ZHBA 5EIWA 5A4DA 2Y6LA 2RS11 3RK1A 1XRQA 3MQ2A 5MN6A 2QLFA 2XOKD 1GNRA 4GZ9A 1VXOA 4UVIA 3QMPA 3EGCA 4I99A 5GP1A 4PSCA 2Y1CA 3A11A 2BGRA 2PMKA 4K8OA 5IH7A 4MPPA 1HXHA 4P5DA 2QZ4A 4JY7A 3HWWA 1XYGA 4LMFA 2GI4A 1KFJB 4AP9A 3GI1A 4QYIB 2ZM5A 1LTEA 3GF4A 1DWPA 1NR7A 1ESCA 3IPVB 2IYXA 4CM3A 1W9WA 2HWE1 2Y6FA 5J5VA 4XAQA 5F2SA 5IDYA 2YFKA 1HYEA 2PQ0A 2WT2A 5HFNA 1SFNA 2UVPB 1KI6A 2XMBA 1RHRA 4GVXA 1ODFA 3UAVA 2O2SA 4DXAA 1O97D 5FMBA 3IEPA 2ICAA 4JVSB 4OU4A 5HYVA 4E22A 4CMIB 1OMIA 3MQFA 4OGLA 4Q9NA 5JQWA 3ICQB 4F3NA 3QZUA 3C3MA 4YVWC 1RHKA 3KC2A 1XCBA 1GL3A 4DG8A 3WGYA 4MVJM 5EL0A 3QLUA 1JT2A 4NWWA 5CT9A 4ODIA 5A6SB 3O5SA 3UJ8A 3H50A 2V03A 4LC9A 4ACAA 2WWJA 1CUIA 2HIMA 4QPGA 1Q3TA 2UXCB 3MVEA 4OA8A 1KI1A 4R52A 1NBWB 2M32A 5JSPA 2FHRA 4O7XA 1Q44A 1N9GA 1ZHOA 5IJAA 3OPZA 3PNKA 4CTEA 4Y98A 5ACA2 3UWDA 3N9QA 1WSAA 1AUYA 3U37A 1KK0A 1AR83 1H1AA 1AY0A 4PSAA 1NXMA 1HF3A 5U4QA 2W42A 1NL3A 1JZ6A 1E69A 4QX0A 2WUEA 5B64A 1N2EA 3TRDA 4HVTA 2X2PA 4J0QA 3U6BA 2AVDA 4IDGA 4YPOA 1KI3A 4P14A 3ZXEA 2JK1A 1W1WA 3POEA 4WZCA 3UC9A 3IJPA 3W78A 1ZHFA 2V0CA 4Z07A 5T5JA 2BJWA 4M54A 2OQVA 4CDXB 1E9VA 3BM5A 1F8XA 4K6CA 2NU7A 3MGUA 3ULKA 1JDSA 4MYCA 3ZLBA 3HUTA 3UO8B 1N3QA 1KY5A 4ABTA 5IVCA 4J6FA 4W8GA 1TF7A 1WW4A 2VUJA 2GCOA 2RH5A 4ASUD 2A1UB 4GQAA 3STUA 3TAHA 3B1XA 2O1XA 3LSYA 4G85A 2ZBUA 5E8AA 3LF2A 3KYBA 3RZGA 5EFZA 2JW5A 3QFCA 3OBAA 1UADA 4J25A 3IAQA 4LHWA 1A76A 1PO13 2ZCJA 1M1XB 4WKCA 1UT5A 1H1MA 4XARA 4XM2A 4O61A 2ZVDA 3WD5A 3EJWA 4DCJA 3BPSA 2C9CA 3H1FA 2AOXA 5GLZA 4Z3OA 1Z6ZA 2PRJA 3VR3D 2ZRGA 5ILGA 5F5CA 3LK6A 2PMWB 3U07A 4ENSA 2JLBA 1XG5A 3LUCA 4WMLA 3IELA 1YS2X 3BTAA 1AURA 2ADMA 1TQ4A 1T26A 5DAWA 3M2PA 4EVSA 4WERA 2H0QA 4IOLA 2RKWA 2DWQA 4QU9A 2P75A 5BT8A 1M54A 4IQFA 2OD9A 3P9XA 3VTKA 2V7TA 4CFYA 5KHHA 1UJBA 1AGRA 2W2KB 3I5UA 3OLWA 3PPIA 3RSSA 2I78A 3NPMA 4ZCIA 3WHKA 4CDWC 4BNJA 5J09A 1PQPA 5AVQA 5EJEA 1ZZGA 4G24A 4PXSA 3AHGA 2EQ5A 2AJDA 2PVPA 2GJSA 1PGNA 4Q15A 3WL7A 1EWKA 2DSTA 2NO4A 1L4EA 4TTSA 3GDFA 5J3JA 5CFDA 2QN9A 3DBRA 1N6OA 4DIMA 1UKCA 1GPBA 1KSJA 1OPOA 1MFPA 1N32B 1N5IA 4DL9A 2YS7A 3E8XA 1NFFA 2D5BA 4P98A 1JT9A 3I52A 2R1VA 4CIDA 2C8VA 3ELYA 1DRWA 2DR3A 2VSYA 3VA7A 3O14A 4FN5A 1E3SA 3O03A 5BR4A 4F4JA 2Y64A 4MULA 5APAA 5AICA 1LQ2A 3D3EA 2FUKA 4YW1A 1X7ZA 3EZ7A 3NAQA 3K9BA 3NG1A 4MHTA 3O1RA 2X5XA 4J3FA 3WWPA 3T3GA 5EPUA 4BZZA 2HRBA 1JE0A 2R1ZA 2HYKA 2FOIA 5CITA 4G63A 1J6UA 1V8PA 4XEZA 5AOVA 5DN9A 4ZDJA 3KR2A 4OAQA 5HZHA 5BNNA 1II8A 2ZUCA 2QNIA 4RJLA 4YRSA 4IDEA 3BXZA 5EPAA 2MTBA 1VBKA 5G4KB 5IDQA 1RM0A 1IIRA 4IX1A 1NFRA 1QV7A 3OTFA 5FWDA 3EH2A 2V4VA 1Q6YA 3RFFA 4B6EA 3HZOA 3OG2A 4N40A 1Y33E 1W1UA 4MZXA 4XLTA 1VIYA 3PC4A 3UWOA 2E18A 3F8SA 4DEYA 4B6OA 3THYA 2PNFA 1N5MA 5HM8A 4D5GA 1YQ6A 1ZNWA 3M5WA 2BELA 1MQTC 2X4IA 4REQA 4QD2A 2X86A 2A5DA 1A9TA 4AWDA 5IBPA 3IN9A 1RYEA 4HH3C 3IIMA 2DWUA 4G4SP 1XD2A 3P94A 2PE5A 2ODNA 3DTNA 3NMUF 2F1HA 2WHQA 4WOKA 4BEVA 1TGVA 4CM4B 3GLGB 3B13B 4LXXA 4Y0NA 2C1ZA 3DL3A 2GN3A 2X0NA 3WNPA 4X54A 5DJ5A 1P7VA 2ZUBA 4E9KA 1OLSA 1K5MA 4I36A 5IKOA 2Q9BA 1R5BA 2XLGA 1W0JD 3IAM1 3UW3A 1JG7A 1F7UA 3F4KA 4I4CA 2V7BA 4E03A 5DF1A 2DU8A 1M7BA 3DBHA 3PL1A 1FBNA 4KNYA 1KXJA 4QEZA 5DSZA 1GQQA 4EG8A 4ARCA 4XD2A 3W2FA 3RVNA 1TC1A 1R082 3VKMA 1HNXB 2VK2A 1C4XA 1YXMA 2RC6A 4HNAB 4QKQA 2ENWA 3UV3A 4L75A 2D1QA 1KXGA 3THXB 1Y7HA 4Q0MA 3AU9A 3M89A 1Q5PA 3F4BA 3T34A 4P9XA 1F2VA 2J1LA 1LCIA 4HSGA 3O2QB 1R0BA 3TKAA 4ITVA 5K45A 4DIDA 5ALHA 4GI1A 1Q17A 3K1AB 3DF9A 5IVEA 2CJWB 2C7BA 2QI9F 3R3HA 3LQYA 4ZQEA 2WU1A 2NTEA 5A6QA 3GD7A 1NOVA 4JYPA 3R0ZA 4IEQA 4PCLA 1S0JA 4DJTA 3FPHA 1QO0A 3SNKA 4Y26A 1I3MA 1E5IA 2GETA 3C4JA 4NVPA 1S1AA 3GJ5A 1Q3HA 2BM9A 2J32A 2ZSDA 2A3WA 4BLJA 5H68A 5JU6A 2PHTA 2WWIA 3DQQA 4RD2A 2VH2A 1D2QA 1ILWA 2AOUB 3G5UA 2E4UA 1KVQA 1U7DA 1OLMA 4EPRA 5E7MA 3W04A 3ZJUA 3ZCTA 3EEIA 4D4MA 3VR2D 2GJAA 3FFZA 3CZAA 1UWWA 4NU6A 2JI6A 1AM4D 2WFAA 3I7DA 4UM5A 3BIEA 3I3MA 4RL4A 5JYEA 4RETA 1R27A 4JR2A 1KR5A 3KOWA 2A1TR 2AT1A 1IJBA 4MUGA 2FG7C 4KLCA 1OLUA 4EY7A 1C0LA 4DNXA 1DMSA 3ZV7A 2C9BA 1ND3A 3FB1A 3F9IA 3E5NA 1JHYA 2WHXA 1PGW1 1RUC2 4TUYA 3RSHA 3PRJA 2WZEA 4DSZA 5A5GA 1Z0DA 3OI7A 1G2QA 1E2MA 2BZDA 4D8UA 3L9XA 3FX3A 2FZLA 3SCFA 4MVXA 2ID4A 1PFUA 3PQ8A 1FMTA 2E7TA 4XXHA 3LT2A 2YVAA 3TFOA 4QXBA 1SUAA 4GBMA 5DLQC 4I8XA 5DM70 1NU8A 1GTMA 2YNMA 4BGDA 3PU8A 2OORC 4HFNA 1K2VN 3OZUA 1RU3A 5K4AA 5AKXA 1RVF2 5ALOA 2Q1FA 1WP4A 3ENKA 3U4GA 2PZMA 1U0EA 4ZT4A 1CUAA 2C59A 4II3A 4JUIA 2J07A 2IWRA 1RRFA 1E5LA 2WFF1 3UG7A 1TAQA 3T5PA 1H23A 5BVGB 1G9TA 1BE1A 1VB2A 2NZXA 3SN6A 1FRVA 1SC1A 1V9LA 2QENA 3JD73 4N8MA 5HF6A 2R7AA 1OYYA 3KXDA 3JPWA 2VIIA 4KWLA 3QIAA 4CE8A 4HDOB 1PFYA 1IDN1 1BD3A 3OO1A 1EE2A 4JJIA 2PFWA 2XTJA 2ZGMA 1M6VA 4GBED 2HUPA 3AK4A 4A8TA 3WAKA 1RQ7A 4YRQA 4J2OA 3C3YA 3UJNA 1I6WA 3Q88A 2P35A 2F8LA 3NETA 5B12A 1IS4A 4DBVO 1BRMA 2VQDA 2B35A 5CW2A 2B8JA 4NV1A 2R48A 2HDOA 5KC9A 3GJ0A 4HAVA 2Q8OA 1F5NA 3ZLVA 3M2TA 2FR0A 3GEEA 4BN5A 1LSJA 5GZFA 2RR11 4L85A 4HRVA 4Q4W1 4MLZA 2R043 1D8AA 2Y77A 1HSZA 1GCIA 3WY9A 2J3EA 2FFQA 4TKLA 3IAAA 1NZIA 4A7YA 4YGBA 3GT3A 2M1ZA 1T1EA 1X1SA 3BFKA 2VHVA 4DE5A 3VD9A 4Q1FA 4MGYE 3JD72 3OM9A 2W47A 3CH5A 3AF4A 2BFEB 1I33A 1HEYA 2FEKA 4NIGA 4H60A 4U6QA 1H2ZA 3ZHUA 1QVRA 4IGAA 1E62A 1A4RA 3ML1A 1EGAA 2UYHA 1MS3A 1YC5A 4NULA 2VZEA 4JLUA 3QLEA 2I07B 4NPMA 3SC2A 3V7FA 5A0VA 2J4FA 4GD3Q 3UC5A 4CCYB 3KV9A 3D64A 4DTIA 5L4LA 5F5AA 1AR63 1W46A 3HK2A 1GG9A 1NW7A 4UMFA 2H5LA 4DMMA 1GPUA 5FY1A 3HJRA 3K5PA 2JG8C 4PYMA 3L01A 3I3QA 5A3WA 1N3OA 2IYQA 1P1KA 1OFIA 1NZCA 2QWXA 4MB6A 3PQ6A 3BPZA 1GCUA 4K0RA 2BP7B 2YW9A 3EUAA 1IZ8A 1AZWA