4KAAA

Crystal structure of the halotag2 protein at the resolution 2.3a, northeast structural genomics consortium (nesg) target or150
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
294
structure length
294
Chain Sequence
SEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPMGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLFLLQEDNPDLIGSEIARWLPGLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR150
rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 92
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kaaA00
4E46A 4DNPA 2YASA 3DYVA 3H1BA 4QNNA 3SK0A 1R9NA 5CTAA 4XVCA 4BAZA 1KEZA 2DHEA 2V97A 1YASA 4UFNA 1CRLA 2GYUA 3R3UA 5AOCA 1TQHA 1GGVA 4CG3A 2VAVA 3O0DA 3UMJA 2ZJ7A 3LCRA 5ALFA 1LPNA 1TK3A 5ALDA 2B20A 4M0FA 3B3QA 5E4JA 3DKKA 1CUVA 3W04A 3B5EA 5AM0A 1CUZA 1UFOA 3NOXA 3DS8A 3BF8A 4IH4A 1QIJA 3OM8A 3C43A 4P08A 3QBJA 3F9CA 1XRRA 1YS1X 5AI5A 3FVRA 1CUCA 3E0XA 4H7KA 2Y1KA 3GUUA 3OPMA 2VATA 1H2ZA 5ALNA 4ZXFA 5LKAA 2EDCA 3G0GA 3WI7A 4P9NA 4X92A 3FSGD 3K9BA 4AO6A 4PSCA 3DKRA 2O2GA 4FKBA 1EI9A 1AMNA 2AXEA 2RGUA 5JARA 2OXEA 3MGAA 4ITVA 1R9MA 3VJKA 3R41A 2DFPA 5DNWA 4DMCA 5BOVA 3CCCA 3U0VA 4WY5A 4X7BA 3MUNA 2JEZA 5DWDA 1EVEA 1LPAB 1U8EA 1WOMA 3FAKA 1CUUA 1QIHA 1QFSA 5HFAA 3STXA 3BE8A 1YAHA 3FLBA 1IZ8A 3DJYA 2Z8ZA 4X71A 2Z5GA 3LP5A 4XJVA 2QVBA 3GZJA 3TGLA 2XUDA 4FLMA 1C4XA 2CEKA 2QXUA 4TVKA 2CBGA 3AFIA 3JW8A 3QITA 2XUFA 3G02A 4UBJA 3Q0TA 5HKAA 1CUEA 4NZZA 2RONA 3PF9A 5LLSA 4QLOA 4H7EA 3KDAA 3ZI7A 2HA7A 2WUGA 1DX4A 3H2JA 3FWHA 5E4TA 1XRPA 1SCIA 4HXEB 4EB0A 5DJ5A 2CUTA 1H2XA 5AK6A 3WLAA 4AB1A 3DCNA 1LPBB 2XMQA 5BWCA 1H2WA 2RHTA 4RE5A 5FLKA 4DMKA 1AGYA 4HXGA 5ALUA 4AO7A 5HK9A 5HF5A 3WWEA 2H1IA 2K2QB 2WTNA 4H35A 1MX1A 3B12A 3WKEA 1W76A 4UHFA 2CKMA 5ALMA 5C8VA 5D6OA 1IUOA 1XQVA 2VJAA 2D5LA 1BN6A 1C7JA 1UZAA 3AIKA 7YASA 2HA6A 4BZWA 1UKCA 1MNAA 1R3DA 4MYSA 1ZD4A 4NS4A 1JMYA 3ANSA 1ISPA 3BJMA 2XUKA 4J7AA 3U1TA 4B0OA 5FRDA 3IIIA 4UBLA 3N0TA 3OC0A 2H9YA 1FFBA 3UUFA 1CUIA 1XFDA 3C5WP 5LZ7A 5AM1A 4UBIA 1W75A 5EIEA 1YSCA 3RLIA 1MX5A 4BCCA 3I6ZA 3STWA 1MJ5A 4QWMA 4IHAA 3BF7A 2QJWA 4MYDA 4QDTA 4AXBA 3I1YA 4BE9A 4FHZA 3A6ZA 4J0GA 1CFJA 4HVTA 4CCWA 1CUWA 5LZ2A 1LBSA 4JEIA 2XB6A 2PVSA 1ORWA 2WSLA 3WJ2A 1LGYA 5JZSA 1HDEA 4ZI5A 3EQ8A 5AKHA 2WU4A 4KE9A 5LZ8A 4PO3X 1BROA 2E3JA 3IVMA 2GZSA 1T2NA 3FYUA 4EUSA 3S2ZA 2BGRA 4MEAA 2VA9A 3PUIA 1QIKA 4BATA 1JT2A 1QIEA 4Y2QA 4TGLA 4DSZA 1CUJA 2WFLB 1DTEA 2VT7A 1E8MA 4DLNA 3TRDA 2VJDA 1L7RA 3GBSA 1TIBA 3IUQA 3G9UA 4H77A 3DOIA 2QRUA 1AC5A 3MVEA 4MQMA 3D4LA 2OGZA 1ZI9A 3M83A 2O2IA 5DLPA 1N1MA 1TCAA 3T4UA 2C0QA 3WZMA 3G0BA 2QMQA 5AO9A 1QONA 3HC7A 2HADA 1X70A 1KU0A 4J0DA 1PJAA 2RI6A 2VSQA 2V98A 5AK5A 2J4FA 1C7IA 1GPNA 4I19A 4M0EA 3PE6A 1XQYA 4X95A 4G4GA 2R11A 5ALTA 3KD2A 3K2IA 4BTLA 1XRQA 3FLEA 1EXWA 2WUEA 1ZI8A 5JADA 5C7YA 3BDIA 5FPPA 2Z3WA 3LIIA 2ORYA 4B84A 4ZV7A 2IX9A 4V2IA 2QOEA 4BDSA 5AICA 3HJUA 2JGKA 4GEGA 4P93A 1XZKA 4PF1A 2Y2VA 5CT6A 5K3CA 1F6WA 5ALIA 5BWBA 1XZIA 4OU5A 1YCDA 3ICVA 5AM4A 2JGMA 4U2FA 3OTQA 1DT5A 4EHBA 1HQDA 3FCYA 3HXKA 2J3QA 3OURA 5ESRA 2JF0A 4EY4A 2HA4A 2EDAA 3G7NA 5HCUA 1K8QA 1NX9A 2PM8A 4EY8A 5HKBA 3W2TA 5SYMA 4XWGA 1B41A 5BV7A 1VA4A 1DT3A 2PKYX 5K3BA 2OAEA 5J3JA 3PUHA 4X93A 2QZPA 1UK9A 1USWA 4QEKA 3I28A 1F8UA 2VJCA 4A23A 3H2HA 3BXPA 4FFWA 5AKEA 3V1MA 5KBYA 2XMDA 2WG2A 3LLCA 3RKSA 1DINA 4LXGA 1Q83A 1CLEA 4PSDA 2O2HA 5ALPA 2D0DA 1ODSA 1SCQA 1XZCA 4LKOA 4FNGA 3M81A 2PUJA 4CCYA 2WILA 2WUFA 1DWPA 4G8BA 4GW3A 5DYYA 3WWOA 3DDUA 1P0MA 4H0CA 4I3FA 4KRXA 4Y2YA 2DR0A 2WIGA 1IMJA 2Y6VA 3FYUC 2PSFA 4BDTA 1VA5A 2C5GA 3N2ZB 3NUZA 4QDXA 1XZHA 2GZRA 4F60A 5SYNA 1J07A 3ICWA 3C8DA 3S8YA 2C58A 2VJBA 1WPXA 3H0CA 5AKIA 2HU8A 1LNSA 1MO2A 4Y9SA 2HRQA 5FXMA 1MPXA 3H2IA 1PV1A 2Z8XA 3R3YA 5JIBA 2PBLA 3C6YA 5HF9A 2X5XA 1QIGA 4HRXA 5EHQA 1N5RA 3O4IA 1ZICA 5ISMA 1J2EA 3C45A 1OILA 4GECA 4K5QA 2AJBA 2QR5A 5JANA 1XLUA 1UKAA 1RYYA 4Q05A 1JU4A 3ESDA 3DLTA 1HPLA 3C87A 4GWLA 4U2GA 4YPVA 3G9ZA 1BEEA 1R50A 3H04A 4AQDA 5D7BA 5C8ZA 3ESBA 1DWOA 3YASA 3FSGA 1ZI6A 2ZJFA 4BYMA 1XZFA 4KAAA 4ETWA 1ACJA 5I8PA 5T4FA 4JYPA 3STTA 3QH4A 1AX9A 1QIDA 3I2HA 4N8DA 3PDCA 1EVQA 3I6YA 1BE0A 5FDFA 5IVHA 1QO9A 3I2JA 1Q84A 5AI0A 4GHWA 3BJRA 3A2MA 3IUNA 2R8BA 4ROTA 3L1IA 1XZMA 3NGMA 1WM1A 2FUKA 4FLEA 3EQ7A 4QLAA 4W63A 3E1GA 2HL6A 2QXTA 4WJLA 4X97A 4EZIA 4YASA 3IURA 4UHHA 3V1LA 2XUQA 5KWJA 4MJ3A 2QKYA 2PU7A 3SWWA 2OLEA 3AJAA 1BCRA 3D2CA 3GA7A 5IVKA 5CBKA 4RGYA 2PSEA 4DYHA 3IBTA 1H23A 3SX4A 1THGA 1ZD5A 5ALSA 3WK5A 3H2GA 1HLGA 1LPPA 2W6CX 1FFCA 4U2CA 1UOQA 1YS2X 5JALA 2ONCA 4K6GA 1Y7IA 4CIAA 4X6YA 1E8NA 3TEJA 1U65A 5I7UA 1JI3A 1WB5A 2PSHA 5JZBA 3WL8A 3G9TA 3WIBA 4XIIA 1HBJA 4OPMA 2GYWA 2YXPX 3AIOA 2X76A 4W1SA 3HACA 4DMHA 3WA7A 5KREA 2HA2A 1EH5A 1A7UA 1HKHA 1P0IA 1ZD3A 4Q82A 2XUHA 3HZOA 4H7DA 1E5TA 4QDOA 3QPAA 5CT8A 4MQLA 3C8HA 3FOBA 2CJPA 4BB0A 4U2DA 1LBTA 2XUGA 2OCGA 3ESAA 4N8EA 1DU4A 3BDVA 2I3DA 2Y6UA 2AJCA 5YASA 1ZIXA 4BRSA 3CCBA 4X90A 4CCYB 1ZJ4A 4BVJA 1UWCA 1BEZA 4B9EA 3D0KA 4H7JA 5AOBA 3KSRA 1P0PA 2CMFA 4ARBA 3WKAA 5A6VA 5IVIA 2VAXA 5CT5A 5FKJA 1Q0ZA 2B9VA 3R40A 4M0MA 4Y2UA 1K63A 4FDMA 2YYSA 4PV7A 4AZ3A 4EY7A 1XQWA 1CUBA 1G4HA 4WFKA 4NVRA 5F4ZA 1QJ4A 3I2KA 3CXUA 1AZWA 3HSSA 3QYJA 1L7QA 1BCSA 2HDWA 5K3FB 1QIIA 4Y2XA 2ECFA 3VVLA 1Z68A 3ED1A 2JIDA 2OGTA 1YA4A 1R1DA 3IUMA 1EK1A 2DHCA 2PUHA 4BP9A 3SC2A 5HZGA 1BS9A 1XZDA 2ACEA 2PU5A 4H7HA 4ARAA 1GKKA 1JJBA 3HYSA 3O4GA 4FBLA 4BRZA 2CZQA 1XZGA 4UHBA 2HHAA 2YH2A 4G9EA 1GQSA 1WPRA 2QJRA 2C7BA 2QS9A 1B6GA 2PPLA 5AKYA 1MT3A 2XMBA 2H7XA 5AOAA 3WJ1A 5AKZA 4J0IA 2FJPA 2BCEA 3AZQA 5JAUA 4HRYA 5LKRA 4UHDA 5HFNA 3QM1A 4B82A 4CG2A 4IQ4A 4AO8A 2XMRA 4QDUA 3WA6A 2HU7A 3H1AA 1QZ3A 4KYVA 1K6EA 1LPSA 4O08A 2QUBA 3IA2A 5AKLA 1E89A 3I2IA 3KOOA 2ACKA 2B4KA 4B7ZA 4Y2PA 3DNMA 4GI1A 3WK6A 4P92A 3PI6A 1EB9A 1EX9A 3D59A 5AI8A 4H18A 4C87A 3OG9A 4U2BA 2OPHA 4LIPD 5CXUA 4EBBA 1EDDA 4H7IA 5FOQA 1EDEA 3G9XA 5H3HA 4Q34A 1XROA 2XQKA 4LYEA 1LZLA 5DTIA 3ZLTA 3W05A 1XRLA 3EQ9A 3STVA 5LYYA 2XUPA 5HQ3A 1CQWA 2AJDA 1HL7A 3VJMA 5EHXA 5JASA 1A8QA 1BRTA 4K6KA 4QDZA 1ODTC 2XLCA 2C4HA 2ZSHA 2WJ3A 1CEXA 4PW0A 3H19A 4UBKA 3A70A 4BP8A 5CT4A 3PFCA 2Y2UA 4J0CA 4FWBA 3C6XA 4QZVA 2B61A 3GROA 2QTBA 3HEAA 3L1JA 5CURA 5EGNA 2ROQA 4G1FA 3PFBA 5ALJA 4DGQA 2BGNA 1SCKA 1NU6A 3C70A 4HS9A 2HRRA 1OCEA 1E8DA 2OQIA 1NU8A 1TCBA 3C6ZA 5K3DA 4BAGA 1VXRA 2G4LA 4JNCA 5LZ5A 5ALYA 1F0NA 4J0JA 5FPQA 1IUPA 1TKRA 3WK9A 3O9VA 2HA3A 2OCLA 2XMCA 1BU8A 5CH8A 1A8UA 4GLBA 5JZ9A 4G9GA 1VE6A 1AUOA 4K6HA 1CUGA 1MAHA 3EIOA 4AX4A 4Y2VA 4C01A 4U2EA 2BUCA 4C88A 1IZ7A 3H2KA 2BJHA 2VF2A 4QE3A 4Y2TA 2JGJA 1CIJA 2BFNA 1W4LA 4FMPA 3WK7A 4PNZA 4KAJA 3QZUA 1WCYA 5A7FA 4E11A 3R3ZA 5IVDA 2DQZA 2WFMA 5JAOA 3O4JA 3WK4A 4BZZA 1J06A 1N8SA 4X6XA 4INZA 3WIOA 5AH0A 2C5FA 5JD5A 5EI5A 2CB9A 4AMYA 1SOMA 3DL7A 4OB6A 5AKKA 2ZSIA 1A88A 3W9BA 2XUJA 2XLBA 4KE7A 4J0HA 4UHCA 5IH7A 1FJ2A 1ZJ5A 1H22A 5ALHA 1CUYA 4WCVA 3WL7A 1AQLA 3F96A 2WTMA 5HQ3B 1WHSA 1EA5A 1XKTA 3A2LA 2WG1A 1YB6A 2OGSA 1ZGCA 5T4BA 4DSAA 2O7RA 1A8SA 1VXOA 1TRHA 4DMFA 2WM2A 2ZYSA 2XQGA 1QTIA 4WFIA 2XUIA 3I2GA 1CQZA 3X3HA 4B6GA 1O6FA 1DQZA 5E4YA 2WU3A 2EEPA 1FSSA 1CUXA 4B85A 2ZVDA 4D9JA 5JD4A 4RPCA 1XZBA 4Y2JA 2O7VA 1UKBA 1YAJA 5C8XA 2XUOA 2OQVA 3IDAA 5AIBA 3NWOA 1G66A 3QMWA 2WHPB 1LLFA 2JEYA 3RM3A 4Y2RA 1LZKA 4Y7DA 2QM0A 1TAHA 3D7RA 3WYNA 3VISA 2WUDA 1SC9A 5FUMA 1KU6A 4N5IX 4UBMA 4DNQA 3O9MA 3I2FA 3WQHA 3AIMA 4J03A 4W1PA 4UPDA 2JBWA 2GYVA 1YA8A 1GT6A 3FLAA 4B0PA 4E15A 3ZLUA 4GDMA 3FBWA 4AN1A 1G5FA 1JJFA 1XRMA 3LS2A 4IH9A 2C0PA 2JGIA 4AZ0A 5HF6A 2ZYHA 4E14A 3BWXA 2WIKA 3WL6A 5ALXA 1MTZA 5LIPA 1CV2A 3H17A 2OG1A 3G8YA 2GBCA 3AZOA 4G5XA 4Y2SA 3ZWQA 2FX5A 4OYYA 4G8CA 5D3ZA 3IUJA 4FTWA 4Q3LA 3DOHA 2AJ8A 5AM5A 3QVMA 2HA5A 2WHQA 1GPLA 3G0IA 4ZREA 2WLSA 4X6UA 5JAHA 4W1RA 3IB3A 1K5PA 3DEAA 2J4CA 4LHEA 1N5MA 1ODCA 4BC0A 3I6MA 3WL5A 4F21A 1DQYA 5EHNA 4ZGBA 1ACLA 2ZYRA 5ALEA 4X91A 5A7HA 2XDWA 2BUAA 4UBNA 1T4MA 2PL5A 3GFFA 5E2IA 3O4HA 1JU3A 2WKWA 1QIMA 1DX6A 4OYLA 3STUA 5JAPA 1XQXA 4Z49A 3ANTA 5K3FA 4KAFA 1CR6A 4WDRA 2BUBA 5JD6A 4UBOA 4UUQA 2DSNA 4KEAA 2XUAA 1UT6A 4OU4A 3F67A 2PSDA 2ES4A 4JYMA 4OUKX 1ZD2P 1ORVA 5JATA 5A71A 5I9IA 5FV4A 4GBGA 3HI4A 5AM2A 5T4EA 1M33A 1MNQA 3WK8A 4QA9A 4N8SA 5CMLA 1U2EA 1QTRA 1CVLA 3QMMA 5AKXA 5AI4A 1QO7A 3QMVA 3V9AA 4LXHA 1CPYA 3WKDA 1R4ZA 1XKLA 2G5TA 5DNUA 2PX6A 5AI9A 5KWIA 2ZJ6A 2XMSA 4K2AA 4LXIA 3AZPA 3EBLA 4FOLA 5CXXA 5FP0A 3WMRA 4W9RA 3RK4A 1MU0A 3ILSA 4DM7A 4OCZA 5K3AA 2DCMA 1Q0RA 3HABA 2HM7A 1GPKA 2G5PA 2PSJA 4G4JA 4X3CA 3D5EA 4HTAA 3G0CA 1QGED 2VEOA 4DTCA 3CN9A 4A5SA 2WG0A 1ZOIA 2RAUA 5HF8A 1THTA 1IVYA 4WY8A 5AK3A 1VZ3A 1XRNA 1QOZA 1RP1A 3AUKA 3R0VA 3G0DA 1GQRA 5LZ4A 1LPOA 3DQZA 1IUNA 1XZAA 1XZEA 3KWFA 2HA0A 1QFMA 3QPDA 2BAGA 3M3DA 2WHRA 4DNOA 1E66A 5CT9A 3WKCA 2X8BA 1BN7A 2XE4A 3D2BA 1CUSA 1R88A 4GXNA 5AIAA 5AKGA 5ALOA 1UK6A 2DQYA 1GKLA 5K5EA 1WHTA 1ZGBA 3QPCA 4C6HA 3BL8A 3WKBA 3WWDA 1RWQA 2NW6A 3RARA 1CUDA 2WHPA 1F0PA 4UHEA 5DNVA 4XX1A 2XT0A 4Q1VA 4L72A 1W1IA 2GBGA 4L9AA 4OB8A 2JGEA 5ALWA 1AURA 1W6RA 4C4ZA 1E3QA 2WFZA 4MWSA 2WFLA 1LPMA 1JKMA 2H7YA 3MUOA 2RIPA 1J1IA 4UFOA 2WQZA 5AM3A 5A62A 4BVKA 1FFDA 3P2MA 3ESCA 4ZV9A 5EIHA 3Q8WA 4OB7A 3FYTA 3BIWA 3ZPXA 4S0XA 2XMZA 4PSUA 4WDQA 1TCCA 3FCXA 1QLWA 3WWCA 4BTVA 1VE7A 1EDBA 3IULA 4L3WA 6YASA 2WJ4A 4C4XA 1Y7HA 4RE6A 2JGFA 3A2NA 5K3EA 4X85A 2BKLA 4KR0A 3V1KA 2RHWA 2VTVA 4X94A 2P8SA 2G63A 1MX9A 1VKHA 1XLVA 4KE8A 1H2YA 1W52X 4MWTA 4AN0A 3D3NA 3VVMA 4QWWA 3C5VA 4YK7A 4ZRDA 5A2GA 2HFJA 1MAAA 1UOPA 1QE3A 2AJLI 2XQJA 3H18A 5JYCA 4I4CA 5DTJA 3ZLVA 2XQFA 3JYHA 5AJHA 4KJXA 1XZJA 4F5ZA 3FNBA 3R3VA 5IKXA 4NMWA 2V96A 5AI6A 2VQ6A 4AMZA 4PQEA 3DD5A 4IO0A 3KXPA 4EY6A 4J3JA 1K4YA 3V1NA 4JH0A 4HXFB 2WIJA 5CRIA 5DYTA 2HFKA 5EFZA 2V9ZA 5T4HA 1GXSA 2H7CA 2I3ZA 1SFRA 5ALLA 3I1IA 5A7GA 3DYIA 4CI9A 4MEBA 3V48A 4ZWNA 3DL4A 3L1HA 5ALQA 4DNFA 1UXOA 1UOOA 2J3DA 5HK8A 4EA6A 4TPKA 4CG1A 1I6WA 1ZIYA 3E3AA 3PICA 5LP1A 3CN7A 5AP9A 3VXKA 3VKFA 1UK7A 3WYDA 4A16A 3M82A 4HAIA 2QT9A 1L7AA 1D07A 3E4DA 4G8DA 2HIHA 4DIUA 1JMKC 4B81A 1VZ2A 1WB6A 4CFSA 3FVTA 3PF8A 3OOSA 4H7FA 3F8SA 3C6BA 4C89A 3HLKA 2XQIA 1VLQA 4Q3OA 1JFRA 1X2BA 1O6GA 1XZLA 1UK8A 4X00A 5ALZA 2W22A 1EINA 4FBMA 3AILA 5AK4A 4L0CA 2OAGA 2WIFA 4FLFA 4BBZA 4FNMA 1CUHA 3F98A 2OCIA 3HRHA 2FJ0A 2XI4A 3WZLA 3O95A 2DHDA 4BC1A 3FYUB 4YX9A 4UFPA 5ALKA 4BE4A 5ALRA 3BIXA 2QUAA 1YB7A 1FFAA 3ZV7A 1X2EA 2I03A 3F97A 3T52A 3STYA 1PFQA 3GELA 1JJIA 4C4YA 2WIDA 1VOTA 1DWQA 2IITA 5D3KA 1CUAA 4G4IA 1CUFA 2LIPA 3TJMA 4OSEA 5CH5A 4N5HX 2UZ0A 3JWEA 5AKJA 1GZ7A 2OCKA 4OD0A 1S8OA 2Q0XA 1AKNA 4B80A 3VJLA 2JGLA 1FFEA 1U4NA 3R3XA 5AHXA 4BCDA 4BCBA 5LZ9A 4W1QA 4F0JA 1XLWA 3KWJA 1P0QA 1WB4A 4MXDA 3D2AA 4Q3KA 1ETHA 3EF3A 3R3WA 2XMGA 4B83A 3WWPA 1EHYA 1G42A 4JUIA 5ALVA 4BAUA 1VJ5A 2IIVA 4B9AA 4KRYA 1YR2A 2ZYIA 2Z3ZA 4KE6A 3UUEA 4EY5A 3LIPA 4WFJA 5DYWA 5C81A 1OXMA 1EB8A 5ALGA 2VT6A 2GBFA 3K6KA 2WJ6A 4IH1A 4LYDA 3W06A 4HZGA 2I78A 5EIAA 4KACA 1QIFA 3AINA 2GBIA 5CH3A 3W9UA 1MN6A 5EHZA 4CIBA 4FFVA 4BVLA 4J0KA 1Y37A 1EK2A 2HU5A 5CW2A 3VDXA 4RNCA
chains in the Genus database with same CATH superfamily
5KQRA 1B4DA 4NMHA 4AF6A 4HN2A 4EL5A 1O97C 1MHPA 2GJAA 3T4PA 2ZJ0A 2Q29A 2W0SA 4D81A 3QI7A 4XUGB 2BL4A 5BVHA 1VL5A 2QRMA 3DWEX 3FJOA 3DV0B 2QAGA 3MB8A 4JEMA 2YY7A 4WPGA 1R9NA 4K1XA 3PC6A 3CW2A 5CTAA 3OKCA 1KAOA 3SE7A 1SUIA 4A6PA 5K05A 3MT0A 4GSLA 1K3TA 1T2VA 1WZUA 1Z0IA 3K53A 2V97A 3T1YB 2I3AA 3FUUA 4FYIA 2YX1A 3E70C 3ENWA 4GXQA 4REMA 4UD6A 1SQ6A 2Z58A 3WLMA 4D0GA 5IT0A 1YZYA 1FNMA 4HFNA 2NU8A 1BDMA 1JPVA 5L3RA 3ZW7A 4Y2HA 1GGVA 3O0DA 2Q4RA 1N6RA 3OA0A 2X42A 2O0JA 1J97A 2HNAA 3LCRA 4R2XA 2GM9A 3H4VA 4YLEA 1LLCA 4JENA 5FNZA 4B71A 4DTIA 3FPEA 5KVSA 4LDQA 4NU5A 1LPNA 1QDLB 2P5UA 3MJFA 5HX7A 1IQRA 5KYXA 1NATA 3LYUA 1JQEA 3GP3A 1PT5A 3HFJA 3HL0A 4ZICA 2VK8A 1COWD 1QH8B 4TYPA 4IINA 1HEIA 3CX6A 5EKXA 1QU2A 5LBIA 4TSFD 5DM4A 3W78A 5CDTA 3EXG1 1YFLA 1CUVA 3WQBA 1A98A 3RQIA 3G5LA 3ZDAA 1FA9A 1MQ9A 1ZCZA 1BXRB 1J09A 2CLOB 3NBKA 4LMRA 5AM0A 3OEED 2VJMA 1LQTA 1X3SA 2Y67A 1U3GA 4U2KA 3M6UA 4KPGA 1E2LA 2DY0A 3C43A 5BV1A 1JHUA 5BOSB 1Q7TA 2XOKD 4H3SA 2X0FA 1U28C 4K6CA 3EVEA 4CN8A 4KWCA 1ZBDA 3D4NA 3L1VA 1QVRA 3D7NA 5IVPA 2V6JA 1UPAA 3ZD6A 1ZITA 2IYVA 1YBAA 3FVRA 1E2MA 1LV8A 2CMHA 2G4CA 4NDAA 4BU1A 4EQ6A 1LWOA 1N3LA 1GNQA 2LR0A 3FWNA 4H7KA 3WOVA 5AVTA 2Y1KA 1PVDA 1U7DA 4WV3A 4RNDB 1Y1SA 4P53A 3PGKA 2EYQA 4HGOA 6PFKA 1U8YA 1JDBB 4JB3A 4ZXFA 1GAJA 2EDCA 4KUHA 4LMPA 1LJ8A 3TZ6A 4QYIA 2IWRA 3AUTA 3QFHA 4LG1A 1CB7A 3KG2A 4AO6A 4JYAB 3DLPX 1IN4A 4PSCA 2H1HA 4MGIR 1NQTA 2H1OA 3CZQA 3ESRA 1C3VA 2J3HA 5B7NA 5JSHA 1AMNA 1V5IA 3I64A 3MJDA 2GN9A 3FOWA 2GZ3A 1FLVA 1HLPA 2ACWA 2R1VA 1OXXK 2O8VA 1GEEA 3U17A 4GYJA 1W4BA 1LDBA 4MQBA 5ICSA 1F7UA 4PXSA 2ZB2A 4IJ6A 3A4LA 2X13A 3M5WA 1VPLA 1J2TA 5DNWA 1IPHA 2G17A 4J29A 1JHMA 1HE4A 3RKUA 4ZOCA 1ADFA 1MP0A 5CDFA 5BOVA 4DMCA 4ZI7F 2X6QA 3IO3A 1TF5A 2GPAA 3ZU5A 5M3BA 5DF1A 3HCEA 3GLGB 1H8ED 1ZC4A 3DOCA 3NI2A 1W1WA 3TTWA 2P2SA 4R4JA 5FEMA 3LK7A 4JA2A 5CPFA 3U0VA 4ZU1X 3RVBA 3ENQA 2B98A 4PLPA 3WYCA 1X42A 1V8DA 3DQPA 5MGNA 1GFWA 3GPBA 3RT1A 1IY8A 1J1UA 1M66A 4MA5A 1U8XX 1PJBA 1Z4QA 3MUNA 2GJSA 2GJ4A 2EX4A 5DWDA 3SVTA 2Q4TA 2GAFA 2OL4A 2P11A 2VYVA 3AG5A 4XEHA 3RASA 2ZAYA 3K9HA 3WRVA 2UU9B 3FNQA 3STXA 2IRWA 4E22A 3IE0A 1Q2XA 4JBNA 3G82C 1GCIA 4LYGA 5EVCA 1USUA 1AK1A 1ND5A 2MSNA 1DDGA 1KYQA 1YVRA 2VP6A 1YCFA 3LP5A 2VP4A 2J5XA 4LNHA 2PS9A 1JQLB 4HL6A 1NY5A 3AEQA 4Q00A 5HFJA 5TR9A 4B74A 1CULC 2TMDA 3GZJA 4TQAA 4RV4A 1OWPA 1T8UA 2OD9A 3P2IA 5T7BA 3DAPA 2AE1A 4CBVA 5C5DA 4M1OA 1EBUA 2J5QA 3FDXA 4F9TA 3FZNA 1R8YA 4BFUA 2FN9A 3TNFA 3F46A 1NY6A 4UBJA 3NO4A 2H2HA 2Z2KA 3CVYA 1GPYA 1ULSA 4TLAA 1EFVA 4B3JA 5BP7A 2BJWA 1CUEA 1V3TA 4NZZA 1SVNA 3P71T 4LJ4A 3VYRB 4BHTA 2PJDA 1BVHA 4YAOA 3UG6A 3IV9A 4QLOA 3RC8A 1KXZA 2NO1A 1ZVMA 2WP0A 4FZJA 4EGSA 4KQEA 3ZI7A 5A4KA 1MORA 1JAHA 3T9BA 2HA7A 3C5CA 3U9SA 3M5PA 1GRNA 3I12A 3FPFA 3S2GA 1PG0A 5HRCA 3H2JA 4HDSA 1TUIA 1TZBA 4HQRA 2VTBA 5JO0A 3FWHA 4OXIA 3K32A 5E4TA 2UYOA 3WWYA 1W88A 3Q72A 4P82A 3ZDQA 5BQXA 3BS4A 1XO1A 4MDFA 2IQ5A 4JCOA 3QVSA 4RTKA 2AMJA 4G0PA 2BI8A 1MRNA 1P7PA 1RAHA 3IDSA 3EHEA 3DTVD 2CFIA 4HEA1 4MMYB 5HBGA 3WXMA 1YFJA 1J5EB 1MZPA 1Z3IX 1H2XA 3NHBA 1YHZA 3WLAA 1A9RA 5ICFA 4RVFA 3UT5B 1XVAA 3EYAA 3Q3EA 1Z6ZA 3DCNA 4Y18A 2CFOA 4R2LA 3JSXA 5CA0A 3AEZA 1DRKA 1SEVA 2WHEA 1KDTA 2OHFA 4JLOA 4O2BB 2OHJA 4LSMA 3TNDA 5I7SA 2FMIA 3LPAA 2G9QA 2O1EA 3JWJA 4UM8B 3VKUA 1FYFA 3L8YA 1KYVA 2JFVA 1UJMA 4PG4A 4HXGA 1L5HB 4IIJF 3VPDA 1M9NA 4E2WA 2JIPA 4IIUA 3UFBA 1NM5A 3DOFA 3PC8A 1QHIA 4V0RA 1T2EA 1H93A 4QBIA 3GLIE 2YWGA 4KLRA 1V1JA 4H59A 3BGVA 4WOPA 4KWHA 2GA9A 1KAMA 4U7JA 4X7PA 5DT2A 5EUCA 4HNTA 2ZUFA 4F96A 5GJBA 4ICIA 2NO5A 1NRWA 4DCSA 3KZXA 2GRUA 2ZRMA 4IQ0A 1NDHA 4MW1A 1W76A 4ZT5A 4BX3A 4NNJA 2GEJA 2XXAB 4QC2A 3OPXA 3IUEA 4CV3A 3ZDEA 5C8VA 5LMNB 1PFWA 4BLWA 3U3RA 1RJWA 3MELA 5LQUA 2ODAA 3V5NA 5IWAB 4KTVE 2B3DA 2OD7A 3T7RA 5A9RA 2I3BA 1A2BA 2D5LA 3MINB 2BGIA 2VQDA 5DT9A 2IZ1A 4KXFB 4TLDA 5SY9A 1IIRA 2WYWA 5I8WA 5AVSA 5J43A 1MNAA 1R3DA 5GPBA 4TOIA 4MYSA 3JRXA 2BBSA 1WS6A 2WTEA 1IIBA 3ESZA 3D4OA 4TWIA 5JNTA 1KZ4A 4MS1A 2Y8EA 3WIEA 1V1MB 4HDCA 4UOEA 3C0KA 4L0DA 4MI9A 1ISPA 1SUWA 2Z3VA 1SBHA 4KV9A 1KJNA 3A31A 4O33A 2G72A 4XD7D 2ZBVA 1RJFA 4G1VA 1TDJA 3FRJA 1BHSA 1T1IA 3SHFA 4D6XA 4E30A 5FRDA 2NSDA 3P9RA 4UBLA 2DYKA 4YREA 2V7BA 1S4MA 5HHTA 1SIOA 4JUFA 3MMZA 3N75A 1NNUA 2ODPA 3RD5A 5I4CA 3A37A 3Q7PA 3OFJA 1IZYA 4RORA 3RRZA 3UUFA 1LJLA 4KMOA 1XFDA 1LF0A 1GL9B 3WNQA 2HDOA 4IX1A 1I3CA 1OGYA 3V4PB 4EMTA 3AR5A 1NE7A 4MR8B 4YP1A 1XTSA 1E2FA 4KYUA 5FI0B 5AM1A 5DBGA 4UBIA 3I32A 5F21A 2C98A 2WSBA 2YRXA 5ELLA 1E2UA 3V4OA 5LQMA 3HCBA 3PKZA 1YSCA 4U3JB 4BCCA 1M5UA 1C7FA 1ZSVA 4XW2A 3MG9A 4A15A 4FIDA 1PFGA 3DBRA 3PEVA 3RNLA 1HGXA 3OKAA 4RQAA 3EOZA 1ECBA 2C1ZA 2VCYA 2FA9A 4IHAA 4Z86A 1OYYA 3EPLA 1USIA 3WGQA 4AXBA 3SEFA 4KDEA 1V8BA 3AETA 3I1YA 3INRA 2QVZX 1A8HA 3EAFA 3L6EA 5KYWB 4QEZA 4JYZA 3KXDA 2NVOA 1LD3A 4FHZA 5IWCA 5ILOA 4J0GA 4R1LA 2LTAA 3GJXC 2R96A 5A4DA 1DG3A 1RCFA 4HVTA 3CZ4A 3T99A 5LLDA 2ANCA 4PR0A 4CCWA 1QTQA 1LJUA 1R0RE 3QE9Y 2XB6A 1F17A 3DC7A 5BURA 5AVQA 4DJ5X 1W581 3K9QO 4XSGA 5ERGB 4UUOA 2AR0A 2AFRA 4ND5A 1R8JA 1RWMA 4RO0A 3RGGA 2EKLA 4LTMA 1CJVC 2W2VA 4BJ3A 4YDHB 4P31A 3VSAA 4DBLE 1Z0FA 2WTAA 1LGYA 1HDEA 2OKCA 1PDVA 4IZOA 4NBSA 2HLDD 4R8KA 5DXAA 4PPNA 4ZI5A 2WU4A 1PBTA 4KE9A 4ZARA 3D81A 4IGAA 4EZEA 1Z38A 4C3UA 2Q21A 4BO2A 4PO3X 1P3JA 2E3JA 1PZGA 1QR6A 3H9GA 3WP0A 5EZSA 1JQ3A 1T2NA 2XNDD 3FYUA 3FTEA 3M2PA 2IUYA 3I0ZA 4BOYA 1E3EA 4E0BA 1GN9A 1YS9A 5BR8B 1WDTA 1NLUA 2BGRA 2ZRDA 2ECPA 1P4JA 2VZ8A 3QFSA 2I7CA 4KW7A 2QQGA 4LW8A 1G8PA 3OJOA 2XZTA 1HFJA 1SKYE 1FW8A 2A4KA 2P2YA 3PR2B 5AW0A 1QH9A 4ZO8A 2IGTA 4ZO9A 1G19A 1V1RA 1TZMA 3WNDA 4Y2QA 7GPBA 3NWPA 3ADOA 5IT9A 1WMDA 3JD2A 3O4RA 2C78A 3AWIA 3W5DA 4HOYA 1SBTA 1U4SA 4NMXB 1E8MA 1YDGA 2AC7A 2X6TA 3GJ0A 3NANA 4H15A 4KQ9A 4L51A 4LBZA 5K8UA 2J6CA 1ORDA 3DHWC 1JPUA 5HPYB 3ZHSA 5L53A 3PE3A 1D2RA 1R12A 3L8ZA 1AMUA 3OHSX 3FYHA 4J7CA 1YRBA 4NH0A 1QYWA 5EZQA 4KMRA 1I2DA 3MRSA 4MW9A 1NVKA 3F5QA 1KZHA 4DR6B 4AS1A 2EJCA 4L4YA 1GLVA 2VRCD 1NQWA 5GZ6A 5A0TA 2FEKA 1LDEA 1QMPA 3DOIA 3FTDA 2W2MA 5K6TA 5EMMA 4R84A 3HHEA 3ZNNA 1ZI9A 2LE0A 1YKFA 2R6CA 3NC0C 4ZYXA 2VXYA 1VB5A 3PEWA 2VPTA 3OQOA 2VSOA 3BREA 1EWVA 3PX3A 1P4HA 4GL4A 1QYVA 4JJIA 3OLYA 3HCAA 4A82A 4WCFA 2ESRA 3HS3A 3G0BA 2Q4BA 2QMQA 4MARA 4DIDA 1S7CA 2GS9A 2I34A 4N0PA 1RRVA 2HADA 5FWYB 5FTWA 1FJXA 3A1UA 1PJAA 1KBZA 4ITRC 3RABA 1K6IA 2DTEA 2GA8A 2AG8A 2V98A 4GMFA 2YCBA 4EGFA 3F7NA 3HPRA 4NYJR 4FHDA 2QUHA 5GADl 4DNXA 1DIRA 2O8CB 1C7IA 4FOSA 4I19A 1X7WB 1VPVA 3GLTA 2I6XA 1X7GA 3VNSA 3ZI4A 3WLIA 1BZYA 1Z17A 5BMVA 5ITZA 3OH8A 4Q7QA 3NTLA 3PE6A 1BXZA 4YUVA 4DV0B 3II6X 3L7YA 1R4NA 1ZRHA 3ND8A 4URUR 3PEUA 1FP1D 4V39A 1D1TA 4KNYA 4KN6A 2EFGA 2ZT7A 4BLPA 4G4GA 4GFDA 1Q0SA 3RVKA 1LFAA 1NR5A 1R0YA 2CNBA 4ZVMA 2WTUA 2AIRA 4TQUS 2XGSA 5ALTA 4Q4DA 4FFBB 4G81A 6CHYA 2ZAGA 3A1EA 3H4IA 4RS4A 5B2FA 3FLEA 1ULUA 5K3OA 3CX4A 3PT9A 4DE5A 4Y8VA 2QLTA 2PIAA 4FJ1A 3R7WA 1NKTA 4YRCA 4TXLA 5DN9A 4E13A 3DZ8A 3JARB 3KZMA 3EIHA 1KTVA 1MRZA 1W2WB 2JVIA 5C4IA 5AYVA 4DCGA 2QOEA 4J4TA 4BDSA 1DBRA 3DDSA 3HSKA 3BTSA 3L0BA 3PEFA 5A3VA 3E9QA 1N2ZA 3TFWA 4YHBA 5FADA 4DN6A 4M1QA 4EVIA 2QTFA 5BV0A 1OH6A 1XZKA 2R48A 4PLYA 2PHZA 3KZOA 3P2JA 4RTPA 2G80A 5CT6A 4MB2A 4RD2A 5FYDA 1F6WA 1IHXA 1X92A 4MX8A 5K3CA 4F1JA 4GDFA 2VSYA 2IBMA 2YWDA 3ENKA 4ZVLA 1JPJA 2FF7A 4D02A 4EZBA 5CYGA 4QBFA 1YCDA 5D7NA 2JIZA 2ZANA 3L7BA 1U4OA 1ZM3A 4N41A 1EM8A 2AZTA 3X1KA 1H1LA 3O91A 1P6XA 3I6IA 5K09A 2V9PA 4EEXA 2MSEB 5CDSA 1DC3A 2A9PA 2FVXA 2MU1A 3CRQA 3KT0A 3OTQA 2WD7A 1HQDA 4EG0A 1RU3A 1SBNE 2XAAA 4X44A 3HXKA 3ML1A 5JV5A 1CR0A 2B1GA 4OMCA 2JF0A 5LBTA 3SX0A 3AV0B 3GGPA 3TW8B 3X2EA 4EY4A 2E18A 4MKXA 3REQB 4IRUB 1WXFA 2EDAA 3RCBA 3RH0A 3VQTA 1K8QA 1ECPA 3MWLA 5J4LA 2VAWA 3DXYA 1A9QA 3DB2A 4O0MA 4KL8S 5HKBA 5JPDA 4F3YA 3G6KA 1C9DB 3N7AA 4RIIA 4ZCQA 4XWGA 3RVSA 5DKFA 5BT8A 1U0NA 2OLJA 2VUUA 2K6GA 3OKFA 1BW9A 5I9NA 1G7SA 3V4ZA 1KERA 5K3BA 1JG7A 2ILTA 4FDUA 4J1NA 2O07A 1T2AA 1DEKA 2Q41A 2MTBA 5AWFC 4NEHB 1HX7A 2QZPA 1OQAA 3R5SA 4HNAA 1SC4A 1LW7A 5EEHA 2F2TA 3WLEA 2ZCJA 1WCIB 2R44A 4G0UA 2PZFA 4C4SA 4N12A 1FRZA 4DWOA 3TSWA 4FSXA 4YCNA 2CL7X 2OHXA 1F8UA 3B1VA 4WESB 3H2HA 1J5PA 1TI7A 3PVZA 4FFWA 4A23A 5FH9A 4XPIA 2WG2A 3LLCA 3EA0A 4YJGA 1WA5A 1YGPA 1DINA 5LXTB 1WUHS 2PVCA 1QQ6A 2XYHA 1SO8A 3RNOA 1C8VB 1SZJG 1W5SA 4PSDA 1N7GA 4NZPA 5J5VA 3RBXA 2VDWA 3PGXA 5ALPA 1QCZA 3ZH9B 4D1YA 3BL6A 4PM4A 2PBRA 5GY7A 2FHSA 3RYCA 5L4SA 4A2WA 4LKOA 3U3OA 2WEKA 4DPMA 3VNVA 3FTQA 1GWNA 5BMVF 3B6KA 2WFAA 2CUNA 1WF3A 5JMTA 3D0QA 1C41A 4MR7A 5DXJA 3FDZA 2IYFA 3CEHA 4AW9A 4DIBA 2WILA 3KKPA 3VO9A 4B7CA 2Y0PA 3ZHVA 4EHBA 1DWPA 3LWDA 4HN9A 4JBLA 3UHAA 1V4VA 1RQRA 4LCEA 2XYVA 3DDUA 3LOPA 4MIYA 2EF1A 5IDWA 2JA1A 1BE1A 1JHXA 4RZIA 4W7HA 2ZR8A 2Z2XA 1JIVA 6ABPA 2DR0A 1R0XA 1NVWQ 3FMVA 3JQ6A 1QHFA 4HPWA 1M5TA 4JX9A 3T7CA 2HH9A 1RC0A 4FT2A 1AKRA 3OTGA 4JY7A 4PINA 4PYKA 3A14A 2PS1A 4KO1S 4TN1A 4MK4A 1ULTA 1GQFA 1VKZA 2Y6VA 3CKLA 1UDWA 2YJ6A 1J21A 2X22A 3AR3A 4NEGA 4U39A 2PD3A 5BSGA 5CDHA 1ZMBA 3SBEA 2XKBA 4YJFA 3P5SA 1GPH1 2GZRA 3DE0X 4R40A 4CIWA 1NVMB 4A91A 4MAAA 1OGJA 1P62B 2IU4A 4MR9B 5EY5B 3GLQA 1NV9A 1ONOA 3GMIA 3RSSA 3ICWA 2G5CA 2IYLD 1IDOA 3PHIA 2W6NA 5B1YA 3P27A 1UCFA 2AW3A 2OVBA 3VOAA 1HDYA 2HU8A 4FFSA 5AKIA 5EWMB 1U1CA 2AE2A 2WZDA 1BG6A 3I9LA 3KPJA 2IV3A 4D42A 4ZCIA 2WMDA 3H0KA 1OA1A 3K73O 3PQEA 2H1CA 1G6KA 5FXMA 4DC0A 2KQUA 1X7ZB 3N2GA 4N0EA 4RU1A 2CCKA 1LRJA 1KH1A 2WD8A 4RY8A 2VDVE 4IS2A 3ZJ4A 4ZYYA 3N5CA 3AQ4A 1R2QA 2X0KA 1HNNA 3C3DA 2ZYTX 1MB4A 2Z8XA 3U3ZA 1IM2A 1JV2B 3ZUGA 5ITWA 2JHAA 5JO9A 1PR5A 3R3HA 1A82A 4AROA 4BUJA 4G0NA 4ZHQA 2QR3A 2BSXA 1OLXA 2H5JA 4WKOA 1LS1A 1PZNA 2GF9A 3COYA 3DP9A 5FBVB 1KTIA 4TZ6A 5HF9A 1FX0B 1M7GA 3AG6A 2AFIE 3FN4A 3AUYA 3U13A 1EUCA 2NXWA 3AHEA 4TWZA 1NI4A 3GFGA 1ZICA 3O4IA 3JCZA 2DPMA 4O59O 2BFPA 1OILA 3QTBA 5DEIA 4AVYA 4GECA 1JA0A 2CNWD 5JANA 5HGXA 1UKAA 2Q5JA 2LDXA 1SOWA 3QVKA 5LNK1 2AMVA 2QG9A 1XX6A 3BSSA 2GAIA 3PVSA 3GY0A 4Y3UA 4XOUA 3WRYC 1KJ9A 4LHZA 5F77A 2IY8A 3HBFA 1DKMA 1XCBA 4GPTA 3NKLA 4MYHA 4ZQFA 2FPKA 4XR4A 1JIXA 3R5XA 1R50A 5I8ZA 4AG6A 1T9BA 4OM8A 1U0BB 1MO6A 5FA8A 4C05A 2Q27A 5ER6A 1LDNA 2VK4A 4HDNB 5C8ZA 1P33A 3HBAA 2YDXA 4ZODA 1PBNA 3GCDA 4BEVA 2B4QA 1F5NA 3IV6A 1TA4A 2IP1A 3PQ5A 1EP3B 1K66A 1NVVR 4MV3A 1TKCA 1ZO8A 3AHJA 4TM7A 5E38A 2QHXA 3PTLA 4DADA 4N47A 4FCTA 1JG6A 4MYRA 3HO8A 3LUPA 3WHLA 4OM7A 3KSDO 3OICA 3HBMA 1OAOC 4CMGA 1XVUA 2D5IA 1QF7A 2FWAA 4GIBA 4X63A 2HQ1A 1JN0A 3DFMA 1PLJA 1VECA 3DMFA 3QH4A 4Q02A 3OT5A 3E2IA 5IN4A 1G6OA 4EUFA 1QIDA 1RHQA 1ZG3A 2I66A 3IPXA 4CUJA 4CKZA 2CB0A 3A32A 3QF4A 4XQ0A 3FNRA 4RTJA 1I1QB 1ZOOA 3HCRA 3KJNA 1RI4A 3LT5A 3ZK9A 5JXWA 3O1HB 2O57A 4YAJA 1BXKA 1G63A 5IVHA 4Q7KA 1IG3A 3W5CA 3B53X 3FPHA 1CRZA 2XE8A 1ORIA 1BGVA 1OT5A 2IU6A 2RHGB 2XF8A 1AKUA 1JIIA 1H2EA 2IXFA 2YXBA 4M46A 5AI0A 1JXOA 2WJPA 4A8JA 4LOHA 2XB2A 3L43A 1I6LA 4P7KA 3MMNA 5DTEA 4ZYVA 1KYXA 1B73A 2R8BA 3UMSA 4HNRA 4ROTA 1T1JA 1M67A 3G1WA 3GXOA 4IIHA 2M32A 4HDNA 3IUYA 1AKTA 3RJZA 3ETNA 4WCDA 3UV6A 4K1LA 1WM1A 2FUKA 3PXCX 3IILA 3V9PA 4FLEA 2AH5A 2IZ0A 3UXYA 5AUNB 3N39C 4DRZA 4E5SA 3LP6A 3E05A 4V24A 3E1GA 1DAHA 5BMOA 4ARIA 1NULA 3BIJA 3GRFA 1BHQ1 2FW7A 3QWAA 4F4FA 1QCCA 1HDZA 4Q3EA 3GEDA 1HH4A 4EZIA 3K20A 1GTVA 2GGSA 1IL0A 2ID8A 3BMNA 2QMZA 2D2VA 5KTRA 1ZUNA 5ANRB 1OTYA 2XRFA 1NAHA 5KWJA 2ECQA 1WE2A 2I7TA 4XI9A 3WLHA 1RLJA 1X0VA 3HZZA 4MV8A 4KVZA 2PU7A 3PSAA 1JLLA 2PRYA 3GQVA 3HY3A 3NYQA 4H4CA 3WL4A 1NDQA 2VYQA 2ZIGA 2CKDA 3DHYA 4C0HA 2X14A 5HIKA 3NH6A 2P3SA 3ZWNA 5B12A 3R7DA 3SWWA 1TM1E 3LLUA 2P1DA 3D8RA 1HC7A 1QLHA 3GCGA 4DYHA 1FQWA 1WLSA 1Y1TA 2F4NA 5J59A 1QV9A 3PEEA 2AA3A 1SOUA 5C4MA 1KJIA 1UMBB 2C3UA 1M2VA 1EUCB 3LI2A 3VPBA 3WK5A 3H2GA 5G1PA 5MGBA 3NWBA 2VHWA 1LPPA 2EC5A 3D5QA 4GPD1 4W7SA 2IV7A 1BGWA 3ONDA 2W6CX 1WXEA 3ITNA 4M9RA 5FOXA 3R8CA 1PZMA 3TD2A 1E2KA 2EERA 1N78A 4ZCTA 1NLMA 1HE3A 4OFXA 4B2PA 1YZVA 2BGJA 2GD1O 3BSWA 1MC1A 4K6FA 4EPXA 4X6YA 3H6HA 3T7EA 3ZOZA 1W34A 4C6RA 4CIAA 3SKXA 1MENA 3SEAA 1DGQA 3ZU3A 3IPLA 3SYTA 1ZUNB 4HMOA 1D6SA 1W6UA 4HD8A 1GGFA 2NQTA 2NU7A 2A7QA 3R0ZA 4M53A 5HCNA 1Q1AA 5MF6A 5B4TA 5JZBA 4OA8A 1NBMD 2A1UB 2AVNA 1M83A 1OBCA 3RODA 2IPLA 2C29D 3NHRA 5H59A 2GHQA 4B31A 4XIJA 2OC4A 3CYFA 1FSFA 2YXPX 3KQTA 3EUFA 5AFSA 5FPHA 4MCIA 3ZHUA 3D3WB 3HACA 4W1SA 2D2IA 4ZMBA 3WA7A 2VJOA 2Y68A 3A6GA 3W5UA 5F5XA 4TVSA 4G0QA 4JKIA 4OXYA 1N8TA 1NSFA 3GD5A 1HKHA 2C5BA 1RVV1 2EGUA 5EVJA 4DQXA 4FGZA 1CX9B 4HNSA 2PY6A 4DW8A 1IHYA 3CVWA 3TTVA 3WYGA 1ZD3A 3MRTA 4LZLA 3GBPA 4JJ8A 4O5AA 4BO4A 5JWHA 5I7EA 2ZI4A 3ZE7A 3EZLA 2H2IA 4LZPA 3OZIA 1HQYE 5CIWA 9LDTA 5J1SB 2YQ5A 1E6UA 2AUTA 2OHIA 4EQ6B 4D26A 3UANA 1NP7A 2O3RA 1XWWA 1S4QA 3AUSA 2ZWAA 5CFPA 2YOFA 3IL2A 1JLKA 1ELOA 3D02A 3Q88A 2OFOA 3R6DA 1N8KA 1TADA 3R4CA 1E2PA 1KS9A 4IIDA 4LJ9A 5H83A 2YINC 4QQFA 1EWKA 4IPTA 1N6LA 2R1UA 2YOHA 1EZZA 1R00A 4JP5A 1NTOA 4K9KA 4FFNA 4ZAZA 2IODA 1Q12A 2OCGA 4NV1A 4BVFA 4FDAA 2YDYA 3NBUA 1H2RS 2F00A 4TMYA 4Y6GB 1PQWA 3GC6A 1TM7E 3G2HA 3IQDB 4KB5A 2CV0A 4I55B 2I3DA 2Y6UA 5AW8A 2AEMA 3KTDA 1XA3A 3C2QA 3QA3E 1XJWA 3UGQA 1B0UA 3HLYA 4QUJA 1JR3E 4W5NA 5JRZA 1JYSA 3KQOA 5GWXA 1VLZA 2WE8A 3UCXA 2QLMA 3E5NA 3BMNB 1VGVA 3K94A 4CMAA 1W4CA 3ZWCA 1AHIA 1OBVA 1G4AE 1DPFA 4JQSA 4XVRA 3H1EA 2XVYA 4BVJA 4JC0A 2OORA 1ZXXA 2NTVA 4B9EA 1VM6A 2VNSA 4X62B 1I3LA 2ISSD 4PCVA 3VR4H 3D0KA 2OMEA 2BFEA 4CTJA 3O8RA 1P0PA 1T5DX 3CSUA 4QRHA 4ARBA 1IN5A 2JVKA 1U1IA 1IQPA 5FTKA 1RPJA 2WAMA 3I5MA 5A6VA 2ZB7A 1WTAA 3HGTA 4XB2A 4LVNA 4CLRA 5FKJA 1G60A 4C78A 2JZNA 4YJKA 3JASA 3SDBA 2B9VA 1G3IA 3TMYA 3N8NA 1DBWA 3VYTB 1D9XA 5JPIA 1Z4OA 2J3IA 3CZAA 3EZFA 2JAOA 1E6KA 1WIWA 2XAUA 4FDMA 2IVZA 2YYSA 2C9CA 3GQBA 3K0HA 1YRAA 1B42A 3DC2A 1HT1E 4UDOA 3G7UA 3S2YA 5C5CA 3MC1A 5K03A 1XQWA 3JQ9A 4LDPA 3F71A 3WG9A 1KJWA 1T25A 4FEYA 1DRUA 4ZOEA 3GLFB 3A6KA 1VMIA 4H31A 4L5BA 4RJ2A 1CG6A 5DTQA 4D97A 1DJOA 2IOQA 4J90A 1FRQA 1KJ8A 3ZV3A 2I9PA 2RI0A 1F6BA 2VYVD 4D4JA 3DGEC 5J4YA 3HKBB 2HDNB 4R2KA 1A77A 2HK8A 4KIJA 3T9FA 2WSYB 3KR9A 4M8NE 1E92A 5T8KC 5AW7A 3DVAB 2ZI3A 4LAFA 2ECFA 4TS9A 5BSKA 2PT7A 2OGWA 4ZTBA 1JSZA 3CURA 4BZXA 1OFUX 4JX8A 1HEYA 4F8EA 1XAHA 5HJ5A 5L3ZA 1L7OA 4MUYA 3HCOA 2YHIB 3DZGA 3IUMA 4NU6A 4FI3C 4XH9B 2PUHA 2DHCA 2DUMA 3BH6A 3GRUA 1BS9A 4XIGS 3SC2A 4QPZA 2R5NA 2ACEA 4DA0A 1CY8A 1HQCA 2O3TA 2R6GA 3OECA 3NV7A 3P0HA 4GZ3A 4BBAA 4D9IA 4RD1A 3SI7A 1NR1A 5JBNA 1W25A 4XA8A 3QKSB 3FPGA 3H5VA 3EDQA 3IBSA 2C57A 2P9QA 2JGDB 1US8A 1C5KA 1G5IA 2CZQA 3D0OA 5EIBD 3NM4A 2C8VA 2YH2A 1ZL2A 2F64A 4G9EA 1K0UA 4Q9LA 3ZUPA 1N0VC 1U2GC 1ST2A 3S28A 1B8OA 4XB6B 1TVKA 1T4CA 3KBOA 3DAGA 4PLFA 3ZN2A 1VG9B 4MV0A 2HPHA 2BFBA 2E5LB 3ND5A 3QLJA 5FL7D 5IC4A 5AKYA 2Q9CA 1X1BA 4H08A 3JARA 3VKGA 1MPTA 2H7XA 1JDVA 4KN5A 1ZH4A 4NBUA 4P3OA 5AKZA 4UAJA 3N0RA 1A9SA 4FDTA 2DKOA 2ZDHA 3SX2A 2J85A 1DC4A 1UBMS 2FJPA 1ZFNA 4G5HA 2A9KA 4TWAA 1GFZA 3I9V1 4S24A 1OASA 2BFCB 4HRYA 3K0FB 3NRCA 3DVRX 4LPKA 3JU3A 5HFNA 2J9RA 1YOVA 1FSGA 2CXHA 2GZAA 4B82A 1O8CA 1OMOA 3USCS 4NPCA 5PGMA 1X77A 3TDNA 2Q4DA 2XMRA 5JARA 1N2CE 4JWTA 2VNIA 2VUIB 3DCJA 4FX2A 2EU8A 4QTYA 2VK1A 2H48A 1WMBA 5E1BA 5DYGA 4ZEWA 3WGGA 1NMZA 4B3IA 1AZSC 3ZDFA 3DAFA 3H1AA 1XGKA 3BK1A 3EYWA 2G1UA 3B2NA 4O8CA 1VE1A 1FTWA 5EMKA 3RVOA 1PSWA 1P1BA 3BX1A 3SXJA 3WGHA 4DIMA 1A9OA 5IHPA 3I2IA 1Z45A 1YULA 2BP7B 3P1JA 5AJUA 3A2KA 2ACKA 2HIGA 1GSIA 2QV0A 3DNMA 3MWFA 4JJ6A 1L5KA 4C30A 2OR3A 1EK0A 4IDPA 2XGMA 1XAIA 4IM7A 4J0EA 4YT4A 1WUJS 5CDGA 3REQA 1TXGA 5IAAA 4ZOQI 1EB9A 4RFSB 1NVGA 2J5BA 1QNLA 3E2MA 3KYCA 3PQFA 4ALLA 5BSWA 1TK9A 2LRHA 3VC7A 3WYAA 2NXNA 2XEDA 3PLNA 1Z35A 1EX9A 3ERCA 3E61A 2AFIB 2ZUBA 2XT6A 1TM2A 1IRXA 3M5CA 2W4QA 4QBGB 4L6CA 1HFKA 1Q1QA 4H7IA 5FOQA 1WXIA 3LECA 3OM1A 2PRJA 4IW3B 3WISA 1YD7A 1KXJA 2E5FA 3WBFA 4DREA 2XBMA 1W5EA 1PZHA 1T0IA 2HJRA 5JC1A 1UBFA 1CDEA 3OM0A 1LZLA 3D6MA 4JAVC 5AJVB 4Q1BA 1B1AA 2DR3A 2X7XA 3WO1A 3ZLTA 3N2EA 3RU9A 3W05A 3EQ9A 4FFOA 5C1BA 3CH7A 1VJRA 3BXGA 3JD0A 3QOWA 2O7SA 1Q1BA 1T9ZA 1KSFX 2QSZA 4PHCA 2W2QA 4AWXA 3NCTA 1Y42X 1PJ2A 2XUPA 4UEQA 5B58C 5BSVA 3VR6A 5AW2A 5DNAA 5AW4A 4PZEA 3SJBA 3T1NA 3LF2A 1HL7A 1BOOA 3VJMA 4HUQB 3SC2B 1NWHA 2VEDA 1DKNA 3NMUF 4CQNA 2QTWB 1Y8AA 3PQ4A 1EJBA 5CW1A 3H0EA 3S6JA 4AMUA 3LGAA 2DZDA 1BRTA 3ZIDA 3U61B 3NDBB 4DLVA 2QY9A 1E2GA 2FFRA 3F7TA 5IJAA 2W2LA 1CDDA 1AZTA 3V3KA 1KIMA 1NXSA 3KC2A 1C7ZA 4C2TA 3V7UA 5BN4A 3KWMA 1MH9A 3KJFA 4P2GA 4XFKA 5ICCA 3N6XA 4N49A 4UBKA 3ZY2A 1N92A 1XMJA 5CT4A 1A4RA 3PA8A 3CQ9A 2Y2UA 2BD0A 4PCUA 4WNAB 3WMFA 1BTOA 1Z12A 2YWCA 3C6XA 4PTZA 4Q6BA 3VBCA 2JAHA 4AXXA 5KNBA 2CDBA 4US0R 1V25A 5LJLA 5HG0A 1FU7A 2L42A 2X4GA 4Q7EA 3AHIA 4RAOA 2QTBA 2YJNA 3ZCSA 2R8OA 3JVUA 3UAGA 4ENPA 1LBQA 2QU8A 3TQFA 3G2IA 3A11A 2XCIA 5DW3A 5CURA 1GUYA 5EGNA 5IYZB 2ROQA 5CVDA 5FULA 1AM4D 3PFBA 3EXIB 1UP7A 3PENA 1SBQA 4DGQA 2BGNA 1PX0A 2Y05A 3FUTA 1HDCA 3PEYA 1T5OA 3LT1A 1C9JA 1T9KA 2PQ2A 3PIRA 5TJ9A 3U7IA 3EH1A 2DHQA 4ME6A 1OCEA 2OQIA 1NU8A 1B0ZA 1NRIA 1Q92A 3QU2A 4BNJA 2VSFA 4F12A 4G5YA 1K1EA 4XUEA 3C6ZA 6LDHA 4BAGA 3RS0A 1F2UA 1X7HA 1UPTA 1VBKA 5L8VA 2FWJA 2G4LA 3SE0A 1KETA 2Q2OA 2PX5A 2PEYA 6REQA 5FPQA 3AF5A 2GPBA 1A1VA 3SBOA 1NP3A 2EP8A 2VP0A 3S1AB 4D74A 1FB5A 1BHO1 5E3JA 5IASA 4FJ0A 4AJ9A 2KB0A 1TKRA 4CRWB 2C9YA 1GTG1 2J7PD 3L6CA 4C7OB 1FRVA 1OX6A 4B3SB 2V0GA 3O9VA 2JC3A 3L79A 3PWZA 4WNYA 1YTLA 4U4AA 2CVPA 2XJ4A 1VC2A 3ICOA 2XMCA 3O3NB 3OEEA 3SSNA 3TQTA 4WOKA 5CEFA 5CR9A 4HNHA 4Z99A 3A3OA 2GVZC 4Q18A 5EQTA 1CVRA 3LDFA 4OHFA 1DI0A 1JXAA 1R4AA 3QKTA 1A8UA 1EK5A 1W35A 5GTDA 2A9RA 4AUKA 1XOIA 4G9GA 1E4EA 2UZ3A 4QG7A 2WV7A 2B2NA 1HNXB 1ST3A 4RIGA 1CP3A 2F59A 1XKQA 3FB4A 4L95C 4O4JA 4TLCA 2FTKE 3X1WA 1W46A 2GYYA 4AX4A 2DTDA 1UAGA 3T1OA 3GDWA 1L5ZA 1TEXA 3CGGA 4BRWA 1CEEA 3IPAA 1TEZA 4C88A 1IZ7A 2OSVA 4IV0A 4EHFA 4BNMA 1CIJA 3D4PA 4G01B 4LGVA 5FYQA 1W4LA 5IXYA 5K8LA 4KQJA 2Q2QA 3GJ7A 4M76B 4OMUA 1AKVA 3PQ7A 3WXBA 4D99A 2H85A 4PNZA 3EWIA 1N6PA 3KPWA 2JLBA 3QZUA 5A7FA 4MW0A 5HOEA 4TLLB 1G7RA 3ON5A 3EBOA 1T0BA 3RSOA 4P4TA 3L4BC 4FYVA 4CM4A 1KK3A 1I4OA 5ECWA 3NTRA 2IT1A 3WK4A 1NSYA 3OTWA 5AVWA 1HDGO 3AYZB 3GRZA 1U0TA 2XZDA 3IT2A 4JJ4A 1BQEA 2QUZA 1LNZA 1L8AA 4WUTA 1GR1A 5C1PA 2J45A 2EFEB 4HB4A 1W73A 1W87A 2BEUB 4JKYA 5EI5A 3GLIB 5A2QA 4PAWA 3C4QA 1CBUA 3GXBA 4BKMA 5JYEA 1VBNA 4OGFA 3B6EA 1YVPA 1A88A 1U5BA 3OFVA 4TSKA 4OQFA 1GPMA 2XLBA 1SZCA 3IP3A 4GWGA 2VXBA 3IRVA 3EGIA 1XCOA 1ZOSA 5IH7A 4YP9A 4L5IA 3ORSA 1P5HA 1XEWX 1U90A 1V0JA 3N7UA 4IHKA 1ZJ5A 2RAVA 4E6PA 1H22A 1JB1A 4QBHA 5ALHA 2IYAA 3RANA 3FX2A 3R3JA 4WCVA 4BO5A 1PL0A 3A1WA 5K0TA 1L0BA 1T6YA 1PEKE 1QVAA 3PJGA 4RZQA 1MAVA 3TX2A 1E2QA 1WDMA 2MIIA 2G36A 3BORA 2Y1WA 3D3QA 4A5OA 3PWSA 2VT3A 4W8HA 3TBHA 4BZPA 2H06A 2IS6A 4J91A 3GOHA 3Q2IA 3R7SA 2CF5A 5G02A 3VZQA 2I8CA 4QVIA 2QBYA 3VSEA 1GZ3A 1KHHA 3AW8A 1YB6A 4QRIA 3X2FA 5BSFA 1S8FA 4OEHA 2XOEA 4XIYA 1JR2A 3EOBI 5HKLA 1XCGB 1YI1A 3FVVA 5KHAA 1Q0LA 3E03A 3R7BA 2IFTA 2HCTA 4HWPA 3UAZA 4FN5A 4N40A 5JCZA 1Y8RB 5ARCA 5C1DA 5JDIA 2B1JA 4PQFA 2XDQA 1OB2A 1GTSA 5FWXA 3Q5DA 2XNHA 3RS3A 2B7CA 3CXRA 1TRHA 5JJLA 2AFHB 1TQ8A 4BNNA 3GHHA 1ZMTA 1GHTA 1IHUA 1Z5NA 1QTIA 1XF1A 1HK7A 4NAHA 4YT2A 4MDEA 4XRGA 5TS2A 1VJ0A 4BS9A 2XUIA 3KV1A 1TPZA 2RGXA 3H1TA 3NTVA 3KLPX 5JNWA 3LKVA 4ZEXA 3OZVA 3C1TA 3PUXA 1U2QA 2WOOA 1IULA 1O6FA 2L2QA 1W44A 3DONA 3LKDA 4UCXA 5BYAA 2VQEB 3K92A 3FSEA 2WU3A 3M1YA 3ORHA 4P4LA 2BDUA 4NZMA 1UJ2A 1WBBA 2PL1A 4PHTA 3QG5A 4AU1A 1JIQA 2XH8A 1P7VA 3QPWA 2FR8A 4QIHA 4F4HA 2WF8A 3AXSA 2Q7XA 2J3KA 4OHCA 1JG4A 1J8QA 2NU8B 1YRWA 3QKRA 1UKBA 5C8XA 3NB0A 1HYBA 2XUOA 2ZT8A 3O3MB 5DYNA 3RFXA 4B7UA 4C5AA 2JFGA 4F6LA 5BXYA 3KKZA 1YL7A 2ZQZA 1EGQA 2O54A 2IE0A 3KVOA 1YONA 5DP2A 4EG4A 5HRUA 1SUAA 4KQ6A 2C2GA 3SYNA 3A6PC 5IDYA 3VPHA 4RABA 1AGXA 2BEWA 3HEBA 4KO8A 2QT1A 5DK4A 2ZE5A 4JLWA 5FBKA 2AR9A 1QH8A 2R3SA 1QUFA 3M70A 4DXAA 1F60A 2BGUA 3D7RA 1NVXQ 2XITA 1KI8A 3PGLA 4ATNA 2O20A 3PPYA 1W0KA 1C4OA 3SM9A 3VNAA 4GOOD 3UA4A 2K2WA 4JD5A 3R6LA 4ZEOA 2CLMB 2IY7A 2WM9B 3BAZA 3F6EX 4WKCA 5JI3E 4L9SA 1QGAA 1RI3A 3IDFA 3DFIA 3MJEA 4HPXB 4QXAA 1WY7A 3V6LA 4J03A 1Q16A 3L82B 5BW8A 1H4VB 2IGBA 1H6DA 4YRFA 1AHPA 1MMFB 3K8ZA 1Z28A 3OOYA 1U0SY 2JBWA 2XTZA 2WJHA 4WVFA 1YO6A 4RSGA 1GT6A 1U7OA 5CIQA 4C20A 5LD2B 4IR7A 3FBWA 4FCCA 3REOA 3TMKA 4PN3A 1D5WA 2BONA 2AS0A 2QI9C 2Z04A 1SVMA 3UK7A 5A5EA 2ZWPA 3LHIA 2IZ5A 2L18A 5F3WB 2M9MA 2UVPA 4Q3AA 3BGOS 1YZGA 4FC7A 3RTEA 3P9YA 1ZOPA 4GKVA 2JLYA 4TKUA 3LAWA 1OBFO 3HU3A 1AA6A 2H5EA 1QVWA 2GEFA 4MWOA 4BO7A 3N53A 4AZ0A 3EG9B 1C2YA 3LUHA 1QF9A 5HIIA 1EYZA 3AR9A 4DUPA 4ED9A 5JH7A 1HF3A 3ADDA 1UINA 1ZMOA 5GONA 3I5YA 3LXRA 1OSNA 2V58A 1ENYA 1GKYA 5I7OA 4OYRA 1RWPA 1M8PA 4A1FA 2OT3B 3O93A 3H17A 2GBCA 1C0LA 1RE1A 3LPLA 4CKXA 1QH1A 3FVQA 2DJ5A 4TLBA 1OC2A 1BDBA 2FX5A 2ZQYA 3DVLA 1N0UA 1XNHA 1YS6A 1S02A 3G5UA 4Q3LA 5D87A 1JG1A 1AQYA 3F7OA 3I2YX 3VNQA 5IU6A 2QX8A 3IODA 3NJRA 1SBZA 1Z5VA 4CCSA 1GPLA 5JFOA 3G0IA 5FR2A 4R2WA 4ZREA 4J94A 4NOJA 1ZSYA 3CE9A 4UTOA 1BMFA 2WICA 1ECCA 3QLUC 3PL5A 4Q19A 2QVLA 1X38A 3JZDA 5FQNA 4F3CA 1C8LA 1P9NA 5JAHA 2UKDA 4OHKA 1QCYA 2QMEA 4GZLA 3WBJA 3CZMA 3CNBA 3V4FA 1N5MA 1ODCA 1UL1X 2GVNA 4NF2A 4WWHA 5G4KB 3Q4GA 3I6MA 4NPAA 4B3RB 1RLUA 5THKA 5L7WA 3RVJA 5EMNA 5LDHA 2FWNA 4K6MA 5K0NA 1N5KA 4ZGBA 2VUSA 5J4KA 4X1YB 4EPYA 1JEAA 3TD6A 2DOKA 4TKZA 4BNDA 2QTTA 4DRYA 2XGJA 4FZ3A 1J25A 5GP1A 1K6MA 3OWXA 1WSBA 4QAQA 5SICE 1KI6B 3M6LA 2B82A 1T36B 1T4MA 3CONA 1DE0A 2M98A 1H1DA 2PL5A 3OVMA 5KNDH 1IZZA 3E6AA 4YJHB 2XE7A 3HLTA 2OZPA 1EU1A 3BCUA 1WCWA 3ILYA 4PNEA 2FNAA 1JU3A 1DCFA 1S2NA 1P4GA 3H5NA 3OQIA 4TXMA 4NXMB 4YROA 1DX6A 2IXGA 5E6SB 3EBPA 4BNGA 4PWYA 2ZJ2A 3IEXA 2OEPA 4WN9A 3UMVA 3WV5A 1RQ7A 3VTFA 1CNMA 4RKFA 2YZGA 5JAPA 1JF8A 4GICA 2HQRA 4Z49A 1QAOA 2VXOA 3L8CA 4JKOA 3SN6A 5K3FA 4KAFA 4GLFA 1AHHA 3WGTA 3T3EA 2C59A 5A03A 5ECGC 3GRVA 2B4YA 2IBSA 1YZHA 1QKJA 1FYDA 4D9EA 3NHWA 3PCTA 2WVHA 4AWAA 4XWAA 1EHCA 2JFXA 4RULA 3QX7A 3OQVA 3SAJA 5EJ4A 3BPSA 3UTDA 2VNHA 1WW8A 3KQHA 5F73A 4UBOA 4LQ4A 3S40A 3VI4B 4EGCB 2HAEA 4U7PB 2D8AA 3W1EA 3OOEA 2NPFA 3OTOB 4CVNA 3NBZC 1F0YA 4KEAA 2HHJA 3K8YA 1UT6A 3MHTA 2CFCA 3EXFA 4LC1A 3F67A 4BPRA 4EUKA 5IZCA 4I99A 4UXHA 2PVPA 1U2DA 3OCXA 1W29A 4Q21A 1RXIA 4NJMB 1RI2A 2ES4A 5DBHX 4WESA 4TLEA 4OV6B 3SC4A 1IC6A 4PLGA 3IO5A 3UCFA 3HXQA 2FSFA 1S5PA 3IQXA 2J31A 2J0SA 4BXOA 3AM1A 5LYJA 4ESVA 1E1DA 1MJGM 4N6GA 1JDZA 3PDUA 3CLHA 1HYHA 3HI4A 2RMKA 2NO4A 2MMCA 3FMPB 4G0YA 4MPJA 3J81A 2MSLA 4MVJG 1Y3DE 4NZNA 3DUWA 5H7XA 3CU5A 3WK8A 4QA9A 3HDVA 4N8SA 1BWRA 4O3FA 4JITA 2HK7A 3NAMA 5CMLA 2J9FB 4IMRA 2SCUB 3SMVA 3IBCA 4DQDA 1MJFA 5HDQA 5LQAA 2XRMA 1CVLA 4B6OA 5AKXA 3K9GA 4DWJA 2QZ4A 5C3MA 5HNKA 2P7HA 4MUIA 4PYMA 2WSMA 3TI9A 2FSVC 3LQYA 4CF5A 5E9WA 3R7NA 3RAPR 4RD0A 1PGJA 4HADA 1UT8A 1XKLA 2G5TA 2P6UA 3CNEA 4WBXC 5LP6C 5FNVB 1VE9A 4ZZ2A 4ID9A 5DNUA 1B8VA 1SD5A 2GF0A 2I7VA 4MQEA 4Q4AB 3KKMA 5JBIA 5AI9A 3MA0A 1DJMA 3A6JA 1HDRA 2QVCA 3WNBA 3EVCA 2IUFA 4XYMA 3WIDA 2DPYA 2WT4A 5DK6A 2RCYA 3AZPA 2JAWA 4ZDWA 4K3UA 3EBLA 1RLTA 1YKGA 3AVOA 1NZFA 3O8OA 5CXXA 3A10A 4UU0A 1UPFA 3B2QA 4BMVA 1JH9A 3WRXC 1MU0A 5CA1B 3NVDA 2PKRA 3I01M 2YNMC 2X8JA 2RHBA 3JAKA 5TQ2B 1CQJB 5JCOA 1PW5A 1G9XA 3TE6A 3ME5A 2VTDA 2W6JD 4EB8A 2JJQA 2VNKA 2YV3A 4BV8A 3NBAA 4AECA 2O2ZA 2A0FA 5DH9A 2JS7A 4N7JA 1B23P 5KYYB 4IMIB 1BMDA 3DFKA 1WAMA 4WXYB 2CMGA 2EFDB 5A0FA 1PT9A 4FGJA 3T5AA 2IYQA 4MIEA 1DEOA 4X3CA 3ZBUA 2FQ1A 2Z30A 4DLWA 1O96B 4EH1A 2YWRA 2JLXA 4L02A 1Y1KE 2J48A 4KC0A 3P5BA 2DPGA 5E3IA 3H8SA 4MI3A 1ZS9A 1XAJA 3CNQS 4R41A 3RE1A 3WYBA 4PONA 2YYAA 1BXRA 1ZOIA 5HF8A 1G8JA 1IVYA 2QORA 4KFUA 5AK3A 4HAXA 1H0KA 4LSGA 3G2JA 4IDNA 5K6AC 1G21E 3ETCA 4HB0A 3HADA 1G5PA 4I50F 4RACA 5BR1A 5CAEB 2FQQA 2AOUA 3BZBA 3D8TA 3EZ9A 1D9ZA 3G0DA 3GHYA 3R0VA 3ETDA 2OD2A 3UHJA 4KGVA 1LPOA 1COWA 1V6AA 2YZNA 4D7AA 5CAEA 1E2JA 1KFEB 5CPBA 3KWFA 1EX6A 4JC8A 2QGZA 1RYMA 3UT0A 3PZBA 2AF4C 2AOVA 2PRSA 4AJ4A 2BAGA 4ROSA 4LJYA 4UVGA 1HKUA 4RJLA 3RDPA 1EGHA 3WGOA 3RAEC 1P61B 5DB4A 3FPCA 2FSIA 2VFAA 1IB0A 1CJSA 2FH5B 3W6OA 1DDOA 4WZBB 4GXNA 4C3VA 1UK6A 1P9LA 4QATA 2QRKA 1GKLA 3UFXA 3CR7A 4KQ1A 3ZKWB 1E3WB 4G56A 2XHZA 2PH5A 2ZUUA 3E9MA 4UATA 4C6HA 5IBCA 1TYZA 2PGXA 5A3QA 2D8MA 2NW6A 3BXHA 3EXEB 1YUNA 4Y6LA 5I7HA 4CEHA 4YACA 5EJGA 3O2JA 5SY6A 5DCUA 5AOVA 4LJLA 1MV8A 1Y5MA 2BKUA 2E21A 4YGXB 2ZM5A 2V6GA 1C7RA 3NCHA 3QHQA 4F5EA 3O92A 4XX1A 5LBUA 1F51E 5E2AA 3ZS9A 3MTIA 1BW9B 2ZRJA 4L72A 4H6PA 5EE1A 2OP0A 2IU3A 1XQ1A 5LD2C 4FDLA 3WIVA 1UJ6A 1ECFA 2M1XA 2ZRLA 3EF1A 5ALWA 4DDMA 1AURA 4IXDA 3T6KA 4Z2AA 3GUYA 2GM4A 4D57A 1U7UA 4F11A 4DZTA 1H05A 4F9EA 2F7SA 2NM0A 1W30A 1O2DA 3FCOA 4EG1A 1D04A 1GSAA 2W70A 2J7PA 2WFZA 1X8JA 4PLHA 1LPMA 3CEAA 2BFDA 5B7PA 3BD8A 1FDUA 1JKMA 2HF7A 3OPYI 1G1MA 5DGXA 5ENZA 4D3FA 4RY2A 1A95A 4AKSA 1F2UB 2Y0EA 5HCIA 4AQYB 1DIGA 1BEUB 1XTUA 2X5OA 2CLKB 1FFDA 5DHRA 3P2MA 2H52A 2QRGA 2X0EA 3AVWA 2D06A 1SUSA 2WWVD 2JANA 4IJMA 1MEOA 1NV8A 3EZ7A 1P29A 4Q47A 2W2XA 1JHZA 5JS6A 2VF5X 4ZK2A 1E1KA 1E4OA 1RZ3A 3BIWA 4GMHA 4UMDA 1NIJA 2ZBEA 3TH5A 1A2OA 4B6SA 4K05A 1IOVA 1W7AA 1RQXA 2OAP1 2ONZA 3OE7A 1QU3A 4WDQA 3HB0A 3LCJA 2P65A 2YFHA 3T5TA 3PLAE 3ED5A 3ZH2A 2QX7A 1H8HA 4HHEA 4MHSA 2NYVA 5BW6B 1H4QA 5TQ0B 6YASA 1Y7HA 4RE6A 1E58A 5JTUA 3A2NA 3TKLA 4KITB 1XL0A 5T41A 4RF3A 3TL6A 5K3EA 5CEEA 2BKLA 1AMOA 1I2ZA 4DVJA 1G8GA 1ONPA 3CUTA 4TT8A 3O8DA 1Z6XA 4R9VA 5CVJA 2VTVA 3V1KA 1D4ZA 3BYZA 1G16A 1WZNA 2Y1LA 4J1TC 3QJYA 4H17A 4WACA 4LXXA 4XVHA 2LWIA 5KNCH 5MFZA 5BSUA 1QDUA 1A71A 1U7PA 3SJUA 1F06A 1V16B 1X1CA 3ZR4B 4AN0A 4WBNA 1RYFA 3D3NA 2OHOA 1F2DA 2CJXA 1B93A 3BHNA 3KQPA 4ZRDA 4AY4A 2HFJA 2QK4A 3GFQA 4BNWA 3C3XA 1PIWA 4RHEA 1UBNA 1Z88A 3LFHA 1G8AA 1UOPA 2H5LA 2XQJA 2FZLA 2FRDA 4NFSA 5JYCA 3KTAB 1SQGA 3WHIA 2UZ4A 3U3XA 1UKVY 3VU1A 5AK0A 3O4VA 3ZE6A 4M0UA 3JQFC 1OJLA 4F5ZA 2J4DA 4PYQA 5CLGA 1RZRA 3H3JA 5FLEX 1OH5A 2PMKA 2QDKA 3R3VA 1RRGA 4OAPA 1BDIA 3FWKA 4QNMA 4XB1A 3AF2A 2GEDA 4GOKA 1HE1C 4EPVA 2VNAA 3U7QB 2ASEA 1NQVA 3TOCA 3OKPA 4QELA 3JWGA 3EDMA 4D4LA 4ZYUA 4OHUA 4F7DA 4UE3S 4BUZA 4URFA 2HXGA 1S1CA 2N47A 2I33A 2Q5FA 1T4CB 1MJGA 5ADHA 3L07A 2I6QA 1XEWY 4J3JA 4FGKA 3MCZA 4Q15A 2OMKA 7REQB 3VTZA 3EZXA 1MDBA 1YIOA 4UZEA 2FOLA 5C4GB 1FK8A 1AU9A 3OE4A 3AVPA 4XQGA 3AJ8A 1E2IA 3TPCA 3MLAA 4MULA 2VNJA 1Y3AA 3NHSA 1TLFA 4WECA 4DLPA 1KDRA 2X1MA 1GXSA 2ETVA 3D9QX 2JD2A 1C4KA 3HZRA 1F2TA 5ITVA 4Z1MD 2P4QA 1TRKA 5FPTA 3BGIA 3IMEA 3ELBA 4RCVA 1K86A 3DYIA 5B1IA 2DHRA 4IJ5A 4CI9A 4L16A 2E89A 3NKFA 4UJ5A 3VR3D 4MEBA 3RK0A 3V48A 4ZWNA 3LCMA 2HZBA 5E0OA 4LF6B 1CR2A 5G0TA 4EG3A 3L1HA 4WFQA 4MI6A 4OP3A 1KI1A 4D9MA 5IEBA 3SIRA 3DE4X 1JEEA 3H9BA 1SG9A 1CFZA 3U7QA 4WZBE 4TTPA 1SBIA 2OO3A 1E4VA 1LDYA 1LU9A 2OV3A 3ASZA 1Y5NA 5IJ9B 4EA7A 1OZAA 3BJZA 2AYZA 3DEKA 1V2GA 5CJPA 3C7AA 2J0QA 2Z2ZA 1TVMA 4PZAA 4F86A 4JJFA 3Q3VA 3PICA 5GZ3A 1NT2A 3CN7A 1G17A 2DFTA 2PO7A 3WAGA 3GFTA 3OZWA 5FIUA 4DA4A 1K7YA 1G20A 5CDYA 2NVBA 1JR3D 2QTHA 1E7SA 3JS5A 4QFMA 5HJ2A 1J42A 1CE8A 1N6NA 1C1XB 1XJ5A 3LRXA 4L8VA 2Z6AA 3FI9A 4LBWA 3DCYA 3GB9A 5DCLA 1XC7A 5LXTF 1TU4A 4MRPA 3TGWA 4BGIA 2POQX 3A1DA 4DIUA 1H5UA 4I0WB 2VDQB 5HIMA 3V8QA 4XCXA 3ZGOA 4B6PA 4I9HA 1HURA 5C37A 2XT9A 2OZEA 4UEOA 1RJ9A 3OOSA 3ZJUA 4QT0A 4H7FA 4PR3A 4ARUA 4YV1A 3NEYA 4F3RA 1LVUA 1W93A 3C6BA 1NLZA 4XQCA 1SXPA 3ANNA 3Q10A 3AH8A 3M4YA 5JLAA 1F7VA 4I8DA 1QC5B 1NVFA 4NAUA 3VRHA 3K70C 1NUUA 3H11B 2IU0A 3A7EA 3VUFA 3X2SA 1Y3HA 2E4XA 5F98A 1X1QA 1IPEA 1O6GA 4MLZA 3H8VA 3MBIA 3Q7QA 1HY3A 3DAOA 5E95A 5IP5A 2D4HA 2YXLA 2A5LA 3AM3A 4PZLA 1DNPA 2JVJA 4UNRA 1KZ7B 3ZTYA 2W22A 2VAMA 4Q5IA 4CN9A 3G2OA 4L0CA 4TS3A 4ZVQA 3QE4A 5BRNA 3DBVO 3FDIA 4I1IA 1C81A 1BA3A 1CIPA 3EMKA 3PQ2A 3L4EA 2WMYA 4BBZA 3LP8A 2GAOA 4IJKA 4CFYA 5I6DA 4QXQA 1J0EA 1CUHA 1C0KA 2X5NA 3F7MA 2A5GA 4TUYA 5AVOA 2F1KA 2VH2A 3F98A 2BGTA 3FGPA 3HRHA 3Q3CA 3V34A 2XI4A 3WZLA 4EG7A 4F6CA 3JQQA 1G9TA 2DHDA 4DQVA 1CHDA 1T29A 2MSWA 4J16A 4O4IB 1E3TA 2CWDA 3RUAA 1R15A 1Z7GA 3LX8A 2A0WA 5MHTA 4C6TA 3K9LA 3KHSA 4DCUA 4UFPA 4MW7A 3UKOA 2JLQA 1I2AA 3I92A 2L17A 5TPZA 4BE4A 1EFAA 3FTFA 2OFWA 1BH2A 2KLBA 2TMYA 3EGDB 2WP8J 3OPYA 4QEDA 1OAAA 4HWSA 2A9FA 3KUKA 1GSOA 1FFAA 1XXHE 1Y6RA 2ET6A 2IDMA 2R6DA 3NV9A 1RWBA 1QCDA 1HZZC 2P2GA 3QPUA 4B40A 4BLVA 4NTZA 4M6WB 3UJPA 5CFOA 4FXPA 2ST1A 1KZ9A 2I03A 2XVAA 1MG0A 3F97A 1E79D 3NPMA 4V0ME 1JSCA 1PFQA 1Y8CA 4MROA 1JJIA 5DWVA 4CE6A 1G8YA 4C4YA 4XWWA 1GQQA 4CKEA 2EKDA 2Y0CA 1K9SA 3SSAA 3TVDA 4BX0A 5KSOA 1ML3A 2D1TA 4FEAA 4G4IA 5A4IS 1QHYA 1SKUA 1XLTA 2GZ1A 1E5XA 1WHTB 1PJLA 3JWEA 4EUNA 4IUDS 4QHTA 1K4MA 5HRAA 2OCKA 3O82A 4XGKA 2WYUA 4ZCMA 4P54A 5KI6A 5GJVC 1DKOA 1YBFA 3ABRB 5GINE 3LQ2A 2O6LA 4UXJA 1D8TA 3CCFA 5HSGA 3L49A 5KU1A 4BL5A 1SCUB 2Q0XA 2R1ZA 1RHMA 1R27A 2Z2YA 3ECAA 3GNQA 3C24A 3KCNA 3HH8A 4WJKB 3S5JA 3EGVA 1AOXA 5DIFA 5KAPA 1WX1A 4ZEMA 2ZU6A 3GJZA 5AHXA 1J22A 1LB1B 5J5AA 1ESCA 1MRSA 1SXHA 5KO2A 4YRAA 4NCIA 4BCDA 3KOYA 5D00A 4BCBA 5LZ9A 4MP6A 1SXJD 1JHQA 4A2QA 3Q9UA 4W1QA 2PLFA 3VR2A 4F0JA 4KU4A 4UEWA 1LC3A 3EN0A 2UAGA 3RS5A 5DV9A 2IYSA 3GA5A 2A9VA 3PSHA 3W3AA 3PBKA 3R7AA 4P84A 3SOZA 5FI1B 3FBTA 1UJBA 1ETHA 5CCXA 2B1IA 7AT1A 1Z7WA 3JVVA 2ZS9A 4TMZA 3KR0A 1AF4A 1C3OB 2EJWA 4D8VA 5JDCA 1JEQB 2PT6A 3EF3A 1AIPA 3WWPA 4J4BA 1EHYA 3OZEA 4ZK6A 1G42A 2RH5A 3HJTA 4E2XA 5LFAA 4C4OA 5SY4A 1QYIA 3FGZA 4Q9KA 3MTJA 2ZLBA 1XF9A 2OM2A 4EDFA 4IXNA 4B9AA 5A5VA 5EZYB 2BJVA 2ZIVB 1C8BA 1G21B 4KDFA 5JSKA 3MXTA 2ZYIA 5AR1A 3NDRA 2ZSKA 3PNVA 1RKQA 2Z3ZA 1RZVA 3MWGA 3PV0A 4TLMB 2LPMA 4EY5A 4K86A 1L4UA 2BISA 1HNZB 3SP1A 3AF1A 1IY2A 5C81A 3HYRA 2JFHA 5TVKA 5ALGA 3THSA 2VT6A 4B4VA 5IFLA 1L4BA 3WAKA 4OLJA 2EWMA 2DSTA 3ACBA 1GNSA 3KEMA 4LYDA 4A4DA 4BV9A 1GQYA