4KAJA

X-ray structure of the complex of haloalkane dehalogenase halotag7 with halts, northeast structural genomics consortium (nesg) target or151
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
304
structure length
300
Chain Sequence
HHHHHEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAETHYLENE GLYCOL
publication title Northeast Structural Genomics Consortium Target OR151
rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
total genus 95
structure length 300
sequence length 304
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kajA00
5ALKA 2PL5A 4J0IA 1M33A 2XUGA 3PDCA 4MQMA 4LXHA 1AURA 1CLEA 4HXFB 3A2NA 3I1IA 4AMYA 4FFWA 3PI6A 3WL5A 1WHSA 1DINA 2O2GA 4DNFA 3WWOA 3ZLUA 5FUMA 3O9MA 3OTQA 4UHEA 2VJDA 4UBLA 1QTRA 1CUIA 2C0QA 3WYNA 5K5EA 3F67A 2LIPA 3IA2A 3MVEA 4UHHA 1K4YA 2Y6UA 1WB6A 3S2ZA 3IDAA 5I8PA 4G5XA 4NVRA 2XUFA 4BRZA 2QOEA 4RE6A 3WKEA 4ARBA 3K2IA 3QMWA 3I1YA 5EIHA 4WY8A 2H9YA 5JZ9A 4HS9A 1K5PA 1WB5A 1XLUA 3HABA 4B9EA 4BZZA 1WPXA 3SX4A 3E1GA 1YS2X 2VJCA 2WILA 4B0PA 1H2ZA 3AJAA 3E3AA 3ZV7A 6YASA 1QIHA 1L7QA 2QTBA 5EGNA 1W52X 1E3QA 1XZCA 3STXA 5CW2A 1HLGA 4J3JA 3STTA 2QUBA 5HZGA 2RAUA 2DQZA 3I28A 4G8CA 3G9TA 1UK7A 2HA5A 3C43A 4LHEA 5I7UA 4EUSA 1XLVA 3I2KA 4B9AA 2QRUA 4GLBA 5AKYA 3QPAA 4X94A 3PUHA 1UT6A 5K3BA 4ARAA 3AILA 4AO6A 4W1SA 3FWHA 4IQ4A 1CUHA 1EVQA 3BJMA 1R1DA 2IIVA 4Q82A 1SCQA 1TQHA 1XZGA 3G0CA 4QDOA 5SYNA 5ALLA 1N8SA 4PQEA 4JNCA 2IX9A 4BCBA 1LPBB 1UKAA 5CT4A 2HA6A 5AM2A 5IVIA 3UUFA 3V1KA 1RYYA 2JGJA 4Q3LA 1YR2A 3O4IA 4FHZA 4G4JA 2J4CA 1VKHA 2I3ZA 2XMZA 4BRSA 3V9AA 1F6WA 3D5EA 2RIPA 2IITA 1BS9A 4J7AA 4M0FA 3C5WP 4FFVA 2CBGA 4L3WA 2FJ0A 2PX6A 3PE6A 1HKHA 5ALEA 4KRYA 4KRXA 4J0KA 1XZEA 1UZAA 2JGKA 5CBKA 4RE5A 3ZLTA 2PPLA 3V1MA 1E8MA 5AI5A 4BP8A 4H7DA 1ZJ5A 5JD5A 1C7JA 4H35A 4CCYB 5DTJA 4LIPD 3G02A 4XVCA 1FFDA 1IMJA 1EDEA 5K3AA 4Y2YA 3IULA 3NWOA 4DMHA 2ZJFA 1CEXA 3KWJA 2CEKA 4KE7A 5K3EA 4WJLA 5EIEA 1MN6A 2DHDA 1W75A 2XUJA 3EQ9A 2RHWA 2XUPA 5ALZA 1YB6A 2BGNA 3AINA 4NZZA 5ALJA 5FOQA 3I2IA 1MJ5A 4DSAA 4P9NA 1ORVA 1YASA 4CG2A 1BN7A 4MYDA 4Y2UA 1A8UA 3BF8A 5AKGA 3O4HA 3CXUA 5JD4A 2H7CA 1K6EA 3WL6A 3ZI7A 2G63A 3QPCA 4J0GA 4J0CA 4QDXA 1LPAB 3WA6A 4I4CA 3H18A 3LP5A 1XKLA 3R3VA 5KREA 1MPXA 2DR0A 4M0EA 2O2IA 1VLQA 5ALDA 1H22A 3F8SA 2WU4A 1QIGA 4FMPA 3D2AA 1W1IA 1IUNA 3IUMA 3VVLA 4UBNA 2OG1A 2BCEA 1ZJ4A 2XQKA 3R40A 4OCZA 3KXPA 4NS4A 2B61A 3DLTA 4BAGA 3OURA 2ZSHA 4N5IX 3JWEA 3K9BA 4ZXFA 2XMGA 1DT5A 2QS9A 5LZ2A 3UMJA 4BCCA 1JU3A 2JIDA 3IURA 2XUOA 4B6GA 3M83A 4BC0A 4I19A 3D7RA 4U2EA 2VA9A 4KAFA 1CRLA 3Q0TA 2OCIA 1KU0A 4DTCA 4GW3A 4QDZA 2ACEA 4IO0A 1LPMA 3EQ8A 2QT9A 4QNNA 5AK3A 2YYSA 3R3WA 5E4TA 4ZV7A 4G9EA 1W6RA 3CCBA 4HZGA 3C6YA 3GROA 1RP1A 5EHQA 1GPLA 1Q0RA 3A70A 5LKAA 1CUZA 2J4FA 3OPMA 4X91A 1ODCA 2HA3A 2WU3A 4IH4A 3DD5A 1HDEA 2XB6A 3OC0A 3WJ2A 1GXSA 1YS1X 4AZ3A 4BAUA 1QIMA 3RM3A 1IVYA 3ESCA 2X76A 4X7BA 1VA4A 2WQZA 3FYUC 1GPKA 1MX5A 4N5HX 1MX9A 5C8VA 5IVKA 2ECFA 3SK0A 5CTAA 2ROQA 3FVRA 5DTIA 3C8HA 5KWJA 1BU8A 2VJBA 3K6KA 1JJFA 4EY5A 2ZJ6A 1CUWA 4YX9A 5AK5A 1UFOA 2ACKA 2WUFA 4WY5A 1DTEA 1RWQA 1XRNA 5LZ9A 5ALMA 4UBMA 5C7YA 4ZV9A 1K63A 4QLAA 1X70A 1FFCA 5AKZA 2C0PA 3H17A 4UFNA 4EY4A 2WHPB 3WQHA 5FV4A 3M81A 2GYVA 4HRYA 5AKEA 1CUXA 4B80A 1GPNA 3JW8A 1XZHA 1UOQA 2XQJA 1SCIA 1XRRA 3BIWA 3IUNA 5JALA 3IBTA 1E66A 3ESAA 5AHXA 2B9VA 4Z49A 1O6GA 4C89A 3O4GA 5FXMA 4C6HA 1UKCA 1X2BA 1LNSA 3IB3A 1CUJA 3GBSA 5K3FB 3ED1A 3RLIA 4QWMA 4FLMA 2BKLA 3KSRA 4IHAA 3LIIA 4KAAA 4OU5A 1J06A 5AM4A 1UK6A 2R8BA 4PW0A 4Q3OA 3RARA 4KE8A 2C7BA 2JEYA 1C4XA 4LXGA 1XQVA 4CIAA 4WFIA 3VXKA 1JKMA 1CUVA 1Y7IA 2QJWA 1SFRA 3SC2A 3NUZA 3QYJA 1LZKA 1BEEA 2QXUA 2OGZA 1QJ4A 2I78A 4E14A 5ALGA 3D3NA 4GHWA 3ZLVA 3CN9A 1XZMA 2QXTA 2WIGA 4Q3KA 4TPKA 2O7VA 1JI3A 1P0QA 1HBJA 4CG3A 5A7FA 1EVEA 4MJ3A 4CI9A 3DEAA 4OB8A 1VE6A 1Y7HA 3GA7A 2H1IA 4BVKA 4IH1A 1QIDA 1BROA 4BB0A 1IZ7A 3DL7A 3IVMA 1BEZA 5AK6A 2XMRA 5ALQA 1F8UA 3FNBA 2AJ8A 2WHQA 1LBTA 5T4HA 1P0MA 3TRDA 1KEZA 4UUQA 1R4ZA 4PSUA 3C6ZA 2BAGA 4RGYA 4DLNA 4C4YA 2C5GA 2OPHA 2V9ZA 2PSDA 3I2HA 2EDAA 3ANTA 1K8QA 1Q84A 1LBSA 4OB6A 4DGQA 1XZJA 1FSSA 2CB9A 2WUGA 4A23A 4QEKA 5HQ3A 4B85A 1W4LA 2RI6A 2H7XA 4FTWA 1QIFA 3G8YA 4X90A 1LPSA 3TGLA 1DQZA 1T4MA 2Y2VA 4W1PA 4XWGA 1E8NA 4G4GA 4BAZA 3WK9A 3FLEA 4G8BA 1L7RA 4UFPA 1F0NA 1TCAA 3DKRA 1TRHA 4KE9A 1UOOA 4W9RA 3HXKA 5AI8A 3T52A 3FBWA 1ZOIA 1ODSA 5AIAA 3C6XA 4BE9A 1XZFA 4MXDA 2AJBA 1GKKA 4GI1A 3F96A 2VT6A 2G5TA 1UK9A 3VVMA 3FSGA 2HFJA 3HLKA 3WIOA 2XQGA 1S8OA 1H2XA 1DWOA 1ZD3A 5HF5A 3ZWQA 4HVTA 1HQDA 2G4LA 4ZWNA 3MUOA 2XUAA 2WG1A 2D5LA 4Q05A 1Y37A 3G0BA 3STVA 1YA8A 1ZIYA 3OG9A 3OM8A 4B81A 1CIJA 4DMCA 4CIBA 1XKTA 2PVSA 4E46A 1CPYA 1CUYA 5EHNA 1CUCA 5A7GA 2HDWA 3I2JA 2JEZA 3D2CA 5JAPA 4GDMA 2WSLA 1UOPA 3DYIA 2ORYA 1THTA 2XMSA 3T4UA 3AFIA 1Q83A 3HYSA 3IUJA 1A8SA 1CUUA 3WZLA 3HEAA 3VJMA 4ITVA 1GQSA 5CH8A 2JGMA 2XMDA 2Z3ZA 5LLSA 5AKKA 4EB0A 1XRMA 3RKSA 2WJ4A 3WIBA 1FFAA 2QMQA 7YASA 1R88A 4E15A 4P92A 5JZSA 2PKYX 4P08A 3FYUB 1TIBA 4MYSA 3QZUA 2HA4A 3G9ZA 2XUDA 1QFMA 5ALRA 1UWCA 1AMNA 3HRHA 5BOVA 4AB1A 2HA2A 4FKBA 2JGIA 4B7ZA 4BYMA 5J3JA 5AK4A 2AJLI 2EDCA 4HTAA 5ALSA 4OB7A 1BE0A 4X71A 3W05A 4KEAA 3H04A 2G5PA 4BZWA 2ZYSA 3QPDA 4X6UA 2OXEA 1QGED 1BRTA 2K2QB 5ALIA 4A16A 5IH7A 3FOBA 3L1HA 1BCRA 4G4IA 4X6XA 1SC9A 4L0CA 4J0HA 3G7NA 2H7YA 4LKOA 2WIFA 4X3CA 3D2BA 1ZGBA 2V96A 3I6YA 4UBKA 4DYHA 5EI5A 5HK8A 2XUQA 3H1AA 2CMFA 5E2IA 1OXMA 4K5QA 2QZPA 1EI9A 1GT6A 3WI7A 4H7EA 3QH4A 5ALOA 1UKBA 4XJVA 1VZ2A 2E3JA 1SOMA 3O4JA 3N0TA 3PFCA 3WK5A 4E11A 1QZ3A 1EXWA 4K6GA 2WIJA 5JASA 3Q8WA 2GBFA 2GZRA 4F60A 1XQYA 3OOSA 5AKIA 1A88A 1TCBA 3G0IA 1QONA 4PF1A 1MU0A 1MAAA 1QIKA 5DYTA 1EK2A 5D7BA 2FUKA 4QA9A 5AJHA 4U2BA 1P0IA 5CH5A 2XUKA 4DIUA 4OU4A 3JYHA 1A8QA 4K2AA 3IIIA 3BL8A 4WCVA 1U65A 2Y2UA 3P2MA 1GGVA 4XX1A 2WFLB 2PSJA 4CCYA 3GELA 3D59A 2WHRA 2PUJA 3H2IA 3DYVA 4HXEB 2Z5GA 5DYWA 1WHTA 4EA6A 1R50A 2PM8A 4QDTA 2ZYIA 3ZPXA 2VAVA 1DWQA 2HM7A 3BF7A 5CT8A 4H77A 1DQYA 3AZOA 2HIHA 3MUNA 4AXBA 1LPOA 3HACA 1QIIA 3IUQA 3W04A 4L72A 2Y6VA 4GWLA 4JYPA 2I03A 3O0DA 1R9NA 4EY7A 2XE4A 2YASA 4KE6A 3B12A 3I6ZA 2JGFA 4LYEA 2OCGA 2DSNA 3BDIA 3WYDA 4RPCA 3WL7A 2WG0A 1XZDA 1EDDA 1LPPA 4QWWA 3C6BA 3N2ZB 2ZVDA 3VJLA 1ZIXA 2OCKA 4MEAA 1OILA 1QIEA 2UZ0A 1KU6A 4C87A 2CZQA 2XLCA 4JEIA 1AGYA 3AIKA 3WK7A 4AO8A 2HU8A 4HXGA 2HU5A 4QZVA 4Y2XA 4DM7A 1FJ2A 3H19A 4Y7DA 1EH5A 3STWA 4AO7A 1R3DA 1XQXA 2HL6A 3QM1A 5HF6A 5FPQA 2WLSA 4YK7A 5D3ZA 1ACLA 1TCCA 3V1NA 2AJDA 4WDQA 3PFBA 4UBJA 5JAOA 3TEJA 5AP9A 4KAJA 3GFFA 2I3DA 5HQ3B 4O08A 4BE4A 5D3KA 5JZBA 2WFMA 4PO3X 1CUSA 3PF9A 4PSDA 4BDTA 4Y2SA 4W63A 2WKWA 5AKLA 3PICA 4KJXA 5AH0A 4BVLA 3DQZA 3DOIA 5BV7A 5DYYA 4GBGA 5FRDA 1JU4A 2VEOA 2XUHA 1PV1A 2X5XA 2PSFA 3FLAA 1J1IA 3C45A 5ALWA 4FWBA 4X00A 4CCWA 1D07A 2DHCA 1NU6A 1MNQA 5CRIA 5ALYA 4QLOA 2Y1KA 1MT3A 4J0JA 4G8DA 1VXRA 5H3HA 2GYWA 1AQLA 1FFEA 1Z68A 3C5VA 4BATA 2QJRA 1XZLA 5T4EA 4U2GA 5AI9A 1LZLA 4H7HA 1GQRA 3BE8A 1AX9A 2C5FA 1YAJA 4KACA 3DL4A 2ZJ7A 1F0PA 3E0XA 3DJYA 1J07A 3FLBA 1JJIA 2QR5A 4GECA 1P0PA 5ALFA 1ZICA 3WKCA 5ALPA 3H1BA 3WMRA 1QFSA 1VA5A 2O2HA 5A62A 2W22A 2PU7A 3L1IA 5AOAA 1E5TA 3R3ZA 3M3DA 3VISA 2O7RA 4QE3A 3H2KA 2HRRA 3AIMA 1VOTA 2XDWA 3PF8A 2Z3WA 2DHEA 3ESBA 5AKHA 4JYMA 3V1LA 3VKFA 5ALTA 3WZMA 1EDBA 1YCDA 2XMBA 1A7UA 3BXPA 1PJAA 2WHPA 3R3UA 1NU8A 1T2NA 5AI6A 2YH2A 3DDUA 4J03A 4OYLA 3BIXA 4U2CA 5DNUA 3E4DA 1JMKC 4WFKA 3WWDA 4FBMA 4MQLA 3B5EA 1O6FA 1L7AA 1USWA 1BCSA 4C4ZA 3R0VA 4I3FA 4KYVA 1QTIA 2VF2A 4AN0A 1ISPA 1N5RA 4MWTA 5CT9A 5E4YA 2FX5A 1EHYA 1VJ5A 1VZ3A 3ILSA 4FLFA 3WK4A 4WDRA 1XZBA 3WKDA 1CUEA 4F0JA 1XZKA 2RGUA 5K3FA 5A71A 2BGRA 1MX1A 3EBLA 1XRPA 4U2FA 4H7FA 5C8XA 1XZIA 2BUCA 1TK3A 3C87A 1THGA 2DQYA 2X8BA 5HK9A 4Q1VA 4BDSA 4UBIA 1QOZA 3QMMA 5KWIA 5HFNA 4B84A 1W76A 3M82A 5ALHA 5CT6A 3LLCA 2HHAA 4AN1A 2D0DA 3VJKA 1EB8A 4XIIA 5LZ7A 1EA5A 5CXXA 3TJMA 4OSEA 1DX6A 5ALVA 4C88A 3O9VA 5CXUA 4N8DA 1UXOA 3RK4A 1DWPA 4OUKX 2JBWA 3CCCA 1Q0ZA 2WJ3A 4UHFA 3AIOA 5FKJA 2WUDA 2BUAA 5DWDA 4S0XA 2R11A 4Q34A 1XFDA 3FCXA 4FLEA 3SWWA 2ES4A 3WKBA 4F21A 4D9JA 4EBBA 4B0OA 3GZJA 4F5ZA 1WB4A 2QUAA 5BWBA 3F97A 4X97A 5LIPA 4C01A 3WK8A 4X93A 3W06A 1C7IA 4H7IA 4TVKA 5LZ4A 5AO9A 1UK8A 1ORWA 3FCYA 2PU5A 1CR6A 3GUUA 5C81A 1H2WA 3WKAA 1QE3A 4ETWA 1GKLA 5JANA 4A5SA 4UHCA 4EHBA 1QO7A 4H0CA 5DLPA 2GBIA 1ZI9A 1MTZA 5EIAA 3R3XA 1XRQA 4X92A 3WJ1A 3FYTA 5HFAA 2QM0A 3LCRA 5SYMA 3EIOA 2AXEA 5CH3A 3WWPA 5F4ZA 4ZI5A 2GZSA 5A7HA 1WPRA 1B6GA 2WTMA 4K6KA 1ZD5A 4BCDA 1LPNA 4Y2PA 3DS8A 3PUIA 1EB9A 1ODTC 2AJCA 5AI0A 1XRLA 5ALUA 3HJUA 4NMWA 4INZA 5K3DA 5JD6A 3A2MA 4PSCA 1AUOA 2HADA 4JH0A 5AM0A 1XQWA 3G9UA 1CQZA 1MAHA 2HU7A 4EY6A 4G1FA 3H2HA 5HF8A 1X2EA 1U8EA 2XI4A 4BTLA 5FLKA 1LLFA 2WG2A 2Z8XA 2BFNA 1HPLA 3X3HA 4UPDA 5FDFA 5DJ5A 2V98A 2XT0A 2VJAA 2V97A 3H2GA 5HCUA 4Y2TA 4YPVA 4JUIA 2Q0XA 2WIDA 1ZGCA 2GYUA 1ZI6A 3W9BA 1JJBA 2OLEA 2WIKA 5AM1A 1U2EA 1WM1A 3WA7A 4BP9A 3I6MA 1EK1A 3U0VA 4ZGBA 5LP1A 3DKKA 2GBCA 2Z8ZA 3C8DA 4DNPA 3UUEA 2DCMA 1WOMA 3VDXA 4IH9A 5ALNA 3KD2A 1SCKA 4Y2RA 3L1JA 1EINA 5I9IA 2OAGA 3BDVA 5T4FA 3D0KA 2WJ6A 1YB7A 4N8EA 4K6HA 4B82A 4BVJA 1NX9A 5CT5A 4EY8A 3QBJA 4Y9SA 4DSZA 1QO9A 3KOOA 4MWSA 1LGYA 3NGMA 2ZSIA 5T4BA 1DU4A 4X95A 5K3CA 2BUBA 3ICVA 4N8SA 5JIBA 4GXNA 5IVHA 5JATA 3C70A 5AM5A 1QIJA 1R9MA 1VE7A 2ZYHA 5EHZA 3QVMA 4LXIA 3WK6A 2J3DA 5AI4A 5HF9A 2GBGA 5LZ5A 4AQDA 5AIBA 4B83A 4C4XA 5EFZA 2W6CX 3DCNA 1JMYA 3DNMA 1GZ7A 4OPMA 4UFOA 1XLWA 3FAKA 3KWFA 4FNGA 1OCEA 1ACJA 2FJPA 3FYUA 2RHTA 2HRQA 5A6VA 1EX9A 2J3QA 1I6WA 5HKAA 2XMQA 1CQWA 4DMKA 1ETHA 4GEGA 2PSEA 1CUDA 2HA0A 1TKRA 2XMCA 5A2GA 4FBLA 4BBZA 2B4KA 5JAHA 4DNQA 4YASA 3H0CA 4ZRDA 2OCLA 5D6OA 3BJRA 3ESDA 5JARA 4Y2QA 4AZ0A 2C58A 1B41A 4H18A 1DX4A 5ALXA 3DOHA 2JGEA 4KR0A 5LYYA 4V2IA 1DT3A 3S8YA 1ZD2P 4UBOA 1AC5A 1CFJA 1FFBA 2DFPA 2VAXA 5YASA 3A2LA 2HFKA 4Y2VA 4BC1A 2VQ6A 1IUOA 3ICWA 1CVLA 1JFRA 3HI4A 2JGLA 1IUPA 5AOCA 4LYDA 2BJHA 3HZOA 3CN7A 3I2GA 4FOLA 4PNZA 2XUIA 1H23A 2WM2A 3HSSA 2OQIA 3G0DA 1CUFA 4Y2JA 4DNOA 3FVTA 5E4JA 5IVDA 5HKBA 5AKJA 4ROTA 2WFZA 5EHXA 3W2TA 3MGAA 4X85A 4FNMA 2CKMA 4FDMA 5C8ZA 1J2EA 3WWEA 1YA4A 1G5FA 5AKXA 5AICA 2CUTA 3G0GA 2OGTA 1CUGA 4CFSA 4OYYA 5LZ8A 2WTNA 5AOBA 1IZ8A 4L9AA 3LIPA 3KDAA 3QMVA 3STYA 2C4HA 3D4LA 2WUEA 3QITA 3WL8A 5CMLA 1G4HA 2XQIA 2JF0A 4H7JA 1H2YA 2VATA 4AMZA 1E8DA 4J0DA 2XLBA 1CUAA 1AKNA 4UHBA 1CUBA 5ISMA 4WFJA 1ZD4A 2OGSA 2WFLA 3HC7A 3ANSA 4CG1A 1MNAA 3F98A 5FPPA 3BWXA 3G9XA 4ZREA 4W1RA 5CURA 3STUA 2OAEA 1U4NA 3YASA 4DMFA 4PV7A 2ONCA 1ZI8A 4UHDA 2YXPX 1AZWA 1N1MA 5FP0A 2OQVA 2P8SA 3U1TA 3B3QA 3LS2A 4HAIA 5AM3A 5JYCA 1G66A 4HRXA 2EEPA 3O95A 2QVBA 2PUHA 4P93A 2B20A 4QDUA 4BTVA 2PBLA 2RONA 4EZIA 4OD0A 3FSGD 1XZAA 1JT2A 1TAHA 3W9UA 2ZYRA 4RNCA 2QKYA 3H2JA 3NOXA 3AZQA 3I2FA 4W1QA 1YAHA 1N5MA 1E89A 5DNVA 1PFQA 3AZPA 1G42A 2NW6A 4M0MA 1WCYA 5ESRA 4X6YA 3WWCA 4U2DA 4MEBA 2HA7A 1YSCA 2XQFA 3R3YA 3AUKA 2VTVA 5BWCA 2PSHA 1HL7A 3EQ7A 4H7KA 5JAUA 2VSQA 1MO2A 3EF3A 5IKXA 5DNWA 4AX4A 2CJPA 2VT7A 3WLAA 5KBYA 5LKRA 1BN6A 4G9GA 1QLWA 3A6ZA 4TGLA 3F9CA 1XROA 1CV2A 3R41A 3V48A 1VXOA 5JADA
chains in the Genus database with same CATH superfamily
2C2ZA 5A6SB 2W70A 4ETIA 3ZLJA 2PL5A 1P75A 3OICA 1M33A 4OXRA 5EJ2A 4MQMA 1EP2B 3EISA 4BFSA 5KCZA 1CRWG 2FMUA 1U0SY 4KPUA 3O75A 2OV1A 1CLEA 1B8UA 4R68A 5HJ7A 3L4JA 4Z9YA 5F1OA 4R71A 1GTSA 2I4LA 4B6RA 5ABPA 4R3UC 2I4IA 3I1IA 1E4VA 2CKDA 3ZD7A 1XG5A 2W6OA 1QG0A 3SICE 4DNFA 5D6NA 3LHIA 4XLTA 2ZOSA 3I9V6 4EYGA 4UCXA 2POQX 2NQ8A 2XVAA 1II9A 4UD6A 5JS8A 2WABA 2B5VA 4EVRA 3FDIA 4IMRA 2V5UA 1MHPA 2OKCA 1S2LA 3G3EA 3X2FA 4B6QA 3THYB 3NR2A 4DLUA 2AN9A 1CUIA 2O52A 4Q3EA 3KVNA 4M88A 5P8WA 4CF3A 4Z9AA 3I62A 4A1OA 3HNOA 1JVBA 4FBGA 1I3CA 5K5EA 2F9FA 3EFHA 4KITB 4HTFA 2IC5A 2BM9A 1K97A 4M0PA 2WPDA 1UOEA 3S29A 4TLDA 3COJA 4B4UA 4JWTA 3TSCA 1F51E 2Y6UA 1UDWA 1FYXA 4W7IA 5LP6A 1VHTA 1VM6A 4U6QA 1PYOA 1OX6A 3DP9A 2PA0A 4G37A 4HDQB 1VIVA 3GYGA 4MVJE 5DWQA 3WXBA 4NVRA 2XUFA 4MNTA 5L3SA 3KZNA 1EVIA 2C29D 4R1OA 3ZE8A 1EE2A 4X61A 2XEDA 3MMSA 1WX1A 2ZEJA 3SBOA 5K6TA 2DM6A 3HADA 3L8FA 1QAOA 3QMWA 1NP7A 4AWXA 1DLIA 2PZKA 4NR0A 3FCOA 4WASA 4DQVA 3QWAA 1ORIA 4OA8A 1WP9A 2AZMA 3KJFA 2Q1XA 4PZYA 4WY8A 5EIHA 1Q12A 2HJVA 2ZSFA 3HWSA 4NATA 1ECGA 3BUSA 4NU0A 4UHKA 2WAYA 4BEWA 4YMUA 2BELA 2AOWA 1U28A 4HS9A 3PXEA 1NQAO 5IP5A 3VVBA 1Z34A 1E2LA 1K5PA 2HXYA 1F8YA 2QJOA 2OCBA 3N6VA 1I10A 2QRMA 4FFOA 3RIXA 4DTIA 5J2UF 1FS5A 4B9EA 5CDUA 1WPQA 1ZNZA 4EATA 2OQ2A 3TZKA 1ECPA 1YS2X 4EQ6A 1X7ZB 1KMMA 3W6ZA 2GUGA 4I81A 5LQRA 3TSWA 2Y76A 2JIZA 1W5BA 1QH0A 3GEIA 2JKZA 1DZ3A 3ZZTA 4XWKA 4TMYA 5BR1A 4BWFB 3PQ3A 3HR8A 3ZV7A 6YASA 3QW2A 4QOEA 1VI6A 4DEXA 4C0QC 5JS2A 1RNLA 4YAKA 2WB2A 1V6AA 2PD4A 1JR2A 3INGA 1Q6YA 4BN5A 3IAUA 1V8FA 5B37A 1IVNA 3FKJA 5CW2A 1X0XA 4EZEA 4EHLA 3I30X 1O03A 3STTA 1V0JA 4YP5A 3BD6A 3OQPA 3NHUA 1AO3A 3KWMA 2RGRA 1RBQA 1Q21A 1SUIA 3E4CA 4R5MA 3ZE7A 3JQ8B 4ENQA 2W48A 5I7UA 3CNHA 1DTSA 3H9EO 1P74A 1CDEA 2ZT7A 1W0JD 1PQ4A 3A0UA 2DTDA 4FSHA 4RKFA 4EUSA 4Z0HO 2HF9A 3CEJA 3ZHRA 3RPEA 4X94A 2JARA 3MYYA 4HWOA 1TTHA 2VPPA 5FA8A 2I1LA 5DMHA 1M76A 4Z4CA 3EOBI 2RKOA 5BN1A 2QY9A 3EWNA 2HF2A 4H60A 2H0QA 4QFBA 1GD1O 5IWAB 3Q2KA 3FWHA 1WA5A 1RAFA 4Q9HA 4ENPA 4ZHQB 4AP9A 1VIAA 3G2JA 3LXMA 5L4LA 2JBHA 1XEWX 4EUEA 2WWGA 3PHJA 4WXPA 1FP4A 4YRAA 2NTYC 2FW1A 1NJ2A 2OAQ1 1Y9DA 2Y4NA 1I2DA 3ICQB 1QYCA 4CTNA 2WMDA 3RS7A 4OYHA 4RMHA 3VO8A 1C7RA 3IEKA 3D7LA 5JJ5A 1XZGA 2QTCA 1TKBA 2OZVA 4ZCQA 2IL1A 8LDHA 1X8JA 4UVEA 4DBVO 4FJ1A 4MCHA 2GAIA 1ZRNA 1R10A 1YRWA 2A84A 2VUIB 2W0MA 4PQEA 4R1QA 4EHHA 2FKAA 4KO2S 3GOHA 4M8KA 2D1QA 3HB5X 3VO1A 2IX9A 4R1UA 1WDKA 1SU6A 1UKAA 1NW7A 4LRXA 4YJ2B 4NEGA 4FZ5A 4OHPA 1KYYA 4V2UA 1R8SA 1C81A 1Q92A 3CZCA 1PTJC 5AM2A 1XHEA 2WU0A 4PX3A 5F3RA 3EIHA 3G2KA 3UANA 2OQRA 4LBWA 2QD2A 3CR8A 4JP1A 1D9ZA 2J41A 3I52A 2FR8A 2ZJ4A 4LHSA 4NYJR 4WBSA 2VSYA 3DVQX 4IG9A 4BQSA 1P1KA 3E7PA 3KZVA 2J9YB 4FHZA 2IDJA 3TLGA 4DKXA 2Y1DA 4GOOD 1J24A 1VKHA 1PJBA 3BEDA 2WF5A 3ZNQA 3I4CA 3U3ZA 4CNBA 2GXQA 1NLZA 2RIPA 3CYFA 4JKYA 1Z2CA 5A05A 4C4SA 1HM5A 3KBOA 1BS9A 3RSLA 1N3IA 4A27A 2EFYA 4I9NA 5AW2A 2AKEA 1W25A 2GXSA 3VKVA 4LRQA 2FWIA 4OK5A 4D7AA 1ZIPA 4DCGA 3UTDA 5ARCA 1KS9A 1RTTA 3MXOA 1ZZGA 1PHRA 2BZGA 1Z0FA 3D64A 4MCAA 4ZGGA 2HB6A 3KEOA 1AKEA 2CBGA 2AXQA 1NRJB 2FUG6 2Q62A 3IPYA 4K2HA 5KJEA 3PIDA 4DEYA 4V1CA 3G0HA 3H6GA 4UUOA 4OX9Y 1RCUA 1B26A 3OZVA 1Y81A 1WMSA 3PQEA 4HDMB 1NE7A 5ALEA 1IB0A 3EVTA 4HGQA 4J0KA 4JOBA 1PDVA 3PYLA 5LWHA 1R0ZA 5JSHA 4B87A 4O02B 3TQFA 1YNSA 3OLXA 5ECYA 4QVGA 2IV7A 3UAGA 5FWYB 1TQ8A 4V0ME 4MGZR 3Q11A 3V1MA 4EVSA 5JFOA 2YQ5A 3T3EA 1QHFA 1M0SA 1KYTA 2EG9A 2ST1A 1B6TA 3S2GA 4BP8A 2YN2A 1SKYB 4H7DA 5GZ3A 3P71T 3QKTA 2GLUA 2VK1A 2WA2A 4ID9A 4C7JA 4C22A 5BWMA 5JQGB 1YXMA 1LKZA 1DRWA 3SKYA 3DHEA 3PVSA 5DTJA 6LDHA 4LIPD 5A4FS 3L6BA 3G02A 3IMKA 5KNDD 3K6SA 2FV8A 2IHJA 4E1AA 4XVCA 3WGIA 1IMJA 1NQVA 1L6RA 1LLCA 4ND4A 4R83A 3WBFA 3OLVA 5KQGA 2ZE8A 2ZK7A 4MQEA 1TK2A 3AEQB 4ZOEA 3NM6B 4PGMA 4KYTA 3SGLA 1J25A 2RB5A 5IDWA 2R6JA 3CLTD 1YF3A 1E6CA 3PDHA 3VU9B 2NP6A 2W11A 2IYVA 1QK5A 4M2LA 4ZQHA 1YDHA 2Y4OA 1E6WA 3CH6A 3O3OB 4P82A 1R8XA 3KOZA 1XELA 3KQOA 4K87A 1WHTB 1ORDA 3WY9A 4DLTA 2FGKA 2DXIA 3FIUA 3QFCA 4ID3A 3LPMA 8GPBA 1JTVA 1R6UA 2CN1A 5BSKA 5JY6A 4OP3A 4YCBA 4KIGA 1W75A 4Z86A 1I51A 3FWYA 4RLFA 1SPBS 1UP7A 2DULA 3MWEA 3TFWA 5KINB 1LRLA 2AWNA 4CR7A 5C8YB 3TCXB 2XF2A 4G0UA 3AINA 4JSYA 5JOQA 3T1HB 3AY3A 1XDDA 2PUAA 5CDHA 1WMBA 1XMQB 2QVLA 4C6TB 3AEYA 3HJAA 1YI0A 2J31A 3GJQA 1XDGA 1CVRA 3TJZA 3LUAA 4ZCIA 2NU9B 3V1UA 4WK2B 5KHOC 4ARZA 3MINB 2CFRA 5C53B 4G86A 1Z7YA 2C3MA 1SUDA 4HPJB 2E6KA 2F7SA 1YMVA 3SXJA 2E37A 1DDOA 1T3LA 521PA 3HBAA 3GT4A 1NJ6A 3AL2A 3EGOA 2P91A 4M1OA 4D4GA 4WXEA 4Y2UA 1A8UA 2OK8A 3DBLA 2WV9A 2ZWIA 1AT1A 3O74A 4IVRA 4JN6B 4QU5A 4BKRA 2X2FA 3DZHA 4EKDA 5KSOA 4NMHA 5B1EA 1KWKA 1O95A 4EBFA 4OI1A 1IHYA 4CNQA 3DEHA 4QYSA 2BKVA 2NMVA 1ESCA 4R1TA 3DDZX 3U7IA 1RKQA 2GTHA 1UJNA 2VWQA 1Z35A 4ASUD 1JE0A 1U3WA 1CY1A 1YJAA 2P40A 3ZI7A 4BZQA 1NJGA 1S2GA 3PZRA 4J0GA 2PZAA 4CLHA 1V4VA 1LPAB 4KGVA 2TSYB 5H1YA 3U9SA 3K2BA 1KSHA 1MOQA 3R3VA 5E1MA 1OHHD 2XRFA 1GNVA 3LQ1A 2OLJA 5KREA 2LDXA 4QRIA 1YKFA 5B57C 2DR0A 4M0EA 1U8CB 5DNCA 2O2IA 3M0EA 4DJ5X 1T2FA 5J43A 1AKUA 4GI7A 5ALDA 3RU9A 1TF2A 3H2YA 1C2TA 3LFHA 4EDHA 2VJMA 2ZUDA 2YFKA 4PYKA 3RYCB 3X2EA 1SVOA 1RHUA 2ATIA 4J16A 1IYZA 1E5QA 1U7WA 2P67A 1QBGA 1E7QA 2I4OA 4NBSA 5HDQA 2DSTA 1GNLA 1W1IA 2VUHB 2PGJA 3DYBA 3IILA 1L5HB 1X15A 3LY9A 4P4SB 3W8EA 3KVRA 4HAXA 3IYLW 2EERA 4FMCF 4UBNA 2PL1A 3MRTA 2BCEA 1TYBE 2ZROA 4AIRA 1ZJ4A 3EBPA 2O0LA 3E05A 1QRUA 4A10A 2AOXA 4FP9A 4UE3S 4BX0A 2EATA 4OCZA 4EHFA 3WYEA 3LUDA 1EP9A 3KXPA 4ZYLA 1RM5A 1VB3A 3RAPR 5FFFA 5EWMA 4ARUA 4CTKA 2ZSHA 4NV1A 3I9OA 3K9BA 2R65A 4WNAB 2GCOA 3TM5A 3TR6A 3VNQA 4BTEA 4DYDA 1JXAA 1I6LA 5EJFA 1P7CA 4PHFA 1SG0A 4EUKA 5LZ2A 3WMFA 3HL4A 3T0IA 4EYEA 3TCKA 1VHDA 4BCCA 1G5IA 4PPNA 3BYZA 1FJXA 2FWPA 3JQEA 2AFIA 4OBEA 2ZRFA 2QVYX 2HY7A 3QWBA 1IOLA 3DVAB 1VL0A 1YS4A 4QEZA 2AQHA 1MOZA 3K9WA 4HRVA 4L76A 5B7NA 2X9NA 5A3RA 4B6GA 4CCSA 3MRSA 1G7RA 2IP4A 4JP5A 3PCRB 4AP6A 4BC0A 4YY3B 4OX9B 2FQ1A 2GPWA 3EYAA 4C3ZA 1SG9A 3EDQA 4NYMQ 4U2EA 4DC1A 1A4UA 3Q0TA 5GQSA 3RNLA 3RDPA 4G0VA 3MBOA 1HGXA 4GW3A 5JCOC 1KFJB 3IKVA 4Y6OA 3PC4A 3AM4A 3MWYW 2DLNA 2O6LA 1MABA 2KBFA 3H5IA 5CBPA 2ACEA 5DRTA 1OMOA 3DUWA 3EWIA 3TEMA 5HSGA 3EQ8A 5EWLB 3QMPA 3IBGA 1D2CA 1ZS9A 3EVNA 3JAWA 4RA9A 2ZI4A 4O4JB 2H1RA 3H5TA 4ZZIA 3OE1A 3SHWA 4NBLA 1KTVA 2VPWA 5CDGA 2TECE 4C4OA 4G9EA 1W6RA 2FMIA 1T1GA 3HBMA 3VC2A 5B12A 1W34A 2OC9A 1W35A 3OHSX 4CLOB 1N2OA 4EGFA 1XTIA 2UUPA 1FMCA 4IQFA 3C6YA 3T3IA 3IHWA 4B74A 4PVDA 4HK4A 1HT1E 1Q0RA 3IVXA 1FP6A 4BLPA 2H63A 1RADA 1DC3A 3TSYA 2O20A 1Q14A 4RJTA 2J4FA 2WW8A 2W37A 1UBCA 3IJPA 2AXNA 1AU9A 3OJLA 1GNSA 1E9EA 3TE7A 4FNOA 4TZ0A 5C5EA 1M34B 1LC3A 4FHEA 5FUQA 4DA4A 3JAKB 1AHPA 1DJPA 2X9GA 3N0VA 4FFNA 3NQ41 5EP3A 4QUDA 3WJ2A 3L4KA 4S12A 1Z5WA 4JSRA 3SFZA 4LYYA 3AB7A 2I6SA 1R5BA 4GSKA 4FJ2A 4BAUA 3KOYA 4EA9A 1QWOA 3BWVA 3H86A 3P9XA 5ELLA 2XE7A 3FSRA 3IL2A 1JJ7A 1C4WA 1OIWA 2FZWA 2H08A 2I62A 2V0CA 4KDEA 5DSXA 1BXGA 1JDUA 2IVFA 2C7QA 3A14A 2CV2A 3UO8B 1UT8A 1ID1A 2H8GA 2WQZA 1G8PA 3FYUC 3HUEA 4L3OA 2GVDC 1EX1A 3T15A 2HJWA 1ADBA 1CSEE 1FFXB 1J0AA 1X7YB 2KSQA 2PBFA 3DMNA 4FDAA 3QSYA 1BYIA 1EMDA 3HU3A 2DQKA 1NQUA 2JPDA 2ROQA 4HJXA 1W8IA 5DTIA 4D02A 2CFSA 2A9OA 1VI5A 2JL1A 2VJBA 3RIMA 1NJ5A 4C7VA 4FHCA 5T3YA 4AAYA 3W5UA 4CIDA 4D81A 1CUWA 3GFRA 3JQPA 2B34A 5D84A 5AK5A 5AXBA 4X1YA 3UJ6A 3OFND 4MMXB 3C3JA 3LOPA 1UFOA 1XP5A 1R4NA 1PR9A 1BYUA 1ZRHA 1WXFA 2BLNA 1CETA 2H9IA 3BB4A 1Q50A 5ADWA 5GONA 3DMTA 3SKXA 3MWDB 1IMOA 1T4BA 4YMSA 3WB0A 4ZQCB 1B4DA 3EDYA 3JRNA 4X1IA 3TQOA 1LF5A 2DBRA 3FM9A 3G2QA 3IOBA 1PTKA 1M7HA 1Y8QA 2IDKA 4P0TA 5JNRA 1XRNA 5JJBA 2GM4A 3LHDA 2E4UA 4HAYA 1TM4E 3WV5A 1PS8A 2HQ1A 1TT7A 2J7PD 2XWPA 3KSUA 5BUSA 1XGKA 2H1CA 1B93A 2PZ8A 5AKZA 4HVCA 2A9RA 2IY9A 3KKLA 5EZSA 4B79A 4DVJA 3GMIA 4ZVSA 3AGPA 3HBJA 1V1JA 3JZMA 4PLVA 1M8JA 1PFWA 3ZC3A 5EQTA 4G5GA 3PQ8A 1VFPA 3WV4A 5AKEA 3W5VA 1XEXA 1GPNA 3VSCA 4OHFA 1UPCA 5IJ0B 1MQ9A 1KBOA 3U16A 5EC8A 3R7BA 1T6ZA 5J2TA 3L0DA 1Z75A 4K26A 1G20E 4HDKA 1A82A 4L7QA 3U7EB 1SCIA 1XRRA 2HEIA 3IUNA 2VZLA 4D5GA 5KKNB 3IHTA 1Z6YA 2XOKD 1IY2A 1DO8A 1U1EA 3IBTA 1ENZA 4HGZA 1O6BA 3SR3A 1B16A 3F5FA 4G2NA 1ZFNA 2HZBA 1LLUA 5FEMA 4MPDA 4HDCA 5CVVA 3H9GA 3UB2A 1T0BA 3I92A 4Z53A 3UV3A 1O6GA 2EARA 1R37A 4PZCA 3WIVA 1QHHB 1QDEA 1QYIA 3EGXB 1NMYA 2JLBA 4C1BA 3B1ZA 4XE5A 1LNSA 3Q10A 3N7UA 3AEZA 3RVJA 1YZNA 5FL3A 4DV1B 2P4UA 1Z7WA 1VIMA 3ED1A 3KHUA 3Q40A 3SBXA 1YQXA 4RVHA 3UK0A 4FLMA 2PMBA 1Y8AA 4R31A 3R3SA 2WK1A 4V0KA 2BKLA 3KSRA 4ZYZA 3GJ3A 4MVJI 1H2HA 3DJFA 4FWTA 3PTZA 5ELMA 3E53A 5A04A 3C41J 1J06A 1RTKA 3QFRA 4GX0A 2JJ2A 4TQ9A 3CISA 5FYDA 2ECPA 3RARA 1OLUB 3C5HA 3I4LA 2FSPA 3EB9A 2X42A 3NGXA 4KVGA 2Y1LA 4CEIB 2FWAA 2PS3A 2SICE 3R6WA 3VXKA 4WRRA 4ZV4A 2YXBA 1OB2A 4O5AA 1AV6A 3GLGB 1BU5A 1HY3A 2CHUA 4BNKA 1O9GA 1SFRA 1HE4A 5FYQA 3RVQA 5EYPA 4J0EA 1SHTX 3ZWNA 4GR9A 4EELA 1BH2A 1VBKA 5DV9A 5L3RA 1A4IA 1QUEA 2PRJA 2XOEA 2Y67A 4DUGA 4H9GA 3S2YA 3CWZA 1LZKA 4P31A 2J1LA 3FZQA 3NANA 2OGZA 3UMCA 1WPGA 2Q5LA 1ZEMA 4L4XA 4XDHA 2V7TA 2I78A 3W7VA 4E14A 1D8TA 4MI3A 3QVJA 1P8JA 5K01A 3KQTA 5ALGA 3JAMA 1EVLA 1FUUA 3JALB 4GHWA 4FVTA 4YV7A 2W2VA 2F3SA 1UWLA 1M0WA 2QXTA 3I3OA 3OU7A 4JLBA 4Q3KA 1MA0A 5EHIA 1X1AA 2FNAA 1OSNA 3KALA 1N1EA 4LF5B 1I3MA 3IPXA 3IBCA 4QUGA 5CPBA 3WLQA 2FOIA 4K46A 1HBJA 2FJUA 2IY8A 2VDKB 1IUKA 4HFNA 4G3XA 2X9VA 3HCOA 4MJ3A 2QE6A 1X9IA 5JFGA 5EG5A 1IIRA 1MAVA 5B58C 1ZJJA 4I1RA 2PLFA 3BQMB 4CQMD 4PAMA 3S40A 5THKA 2RHMA 1UAAA 4MO2A 4RCVA 3GA7A 1ZISA 4PU0A 4RENA 1L8AA 4RY8A 3EXG1 1EYZA 1N9KA 3GRYA 3RFFA 3BE5A 1P1HA 3OZ7A 3H8WA 1AUXA 1WSWA 3QYPA 1O0SA 3D4IA 3IBFA 1L1FA 1EX6A 1L5WA 1UP6A 1P72A 4A6EA 2FR1A 2HTFA 2JD1A 2Q5HA 3CEMA 3DL7A 3GEPA 2CZCA 3U9LA 4BB0A 5AK6A 3F2VA 3K8YA 4ESHA 2XMRA 2C8JA 5B30A 2OT3B 2D7JA 1J56A 3G2IA 4PAOA 2Q50A 1TJ3A 4RIHA 5ALQA 4E2FA 1NURA 4RF4A 4BP1A 2WHQA 3DLHA 2HYDA 1W47A 4RTRA 4O63O 1OXBB 2QQEA 3AF5A 1P0MA 3FOWA 2IXBA 4P83A 2ZS7A 1QF7A 3C6ZA 3VO2A 4MQUA 3M8KA 3QXHA 1RRPA 3GO4A 1TJPB 2GASA 1R0KA 1AKVA 3FX2A 1ZINA 3GG2A 3JD3A 4GMGA 4N6GA 3ZBPA 3MB5A 3PDWA 2EDAA 4IRMA 4WNIA 4OSPA 1KEVA 1U0NA 4C06A 1IHPA 1GDHA 3EGVA 3ZXUB 4AF6A 1NKSA 1VPVA 1AQUA 2ZCVA 4JMPA 1RPNA 3BE4A 2TMKA 5DGDA 1P7WA 3T0GA 4AJ4A 1KKLA 2XF8A 3DGEC 3IAAA 3S7TA 3C14C 1IEQA 1FYDA 2O2ZA 4JOSA 3T7EA 4BY9E 4ZAYA 3NT5A 3EZ6A 3LBYA 3QA9A 1S96A 1Y5LA 1FY2A 4DAOA 4QDKA 4R01A 4QGAA 4EH1A 2H29A 2RI0A 4DARA 1WCIB 1PGJA 3QVLA 3FPKA 2GFHA 4WZAE 3OPYI 4E5SA 3DFZA 2I8CA 2J0UA 5DXJA 2Z5FA 2Q28A 3DDWA 3Q9UA 4YAEA 5ICMA 3NM5A 3UPTA 2JIBA 2NSHA 1EJ6A 4A2QA 2OESA 4CM4A 4E2XA 1W96A 2COKA 1BVRA 2D7CA 2ODQA 3HCFA 1JFFA 5D2CA 3K4QA 1IVSA 2FPPA 4TYWA 3A4LA 1H42A 1PG2A 3D6HA 1WU7A 1NI3A 3FPGA 4LTNA 1WAMA 1XQ9A 3QKWA 2EX0A 3I53A 1F4PA 1ONPA 1T4MA 1C41A 1QG4A 2O57A 4L8FA 4W1PA 4XWGA 1GL3A 4MTCA 3SZGA 4DLWA 4IF6A 4F72A 1VYHA 3QEBZ 2BSXA 4KI7A 3NXKA 3DP7A 1AK2A 2I91A 1LI5A 3O47A 3DZBA 5IKEA 3K0KA 4Q00A 1ZMOA 1OI3A 3OFVA 4WT7A 1EBBA 2FZCA 1X7DA 5EEHA 4E3ZA 3FLEA 4G8BA 1FX0B 4JLAA 2F00A 5CLLA 3ESZA 5A5DA 3TB6A 4UFPA 1F0NA 4LHXA 3DKRA 1CYEA 4CDRA 2QL9A 4QEDA 2DY1A 621PA 1XAGA 4M0KA 3AEUA 2PRZA 1Z15A 3FWNA 3OBIA 5A0TA 3W2IA 4V38A 4EEKA 1MO5A 1NWCA 1UBRS 3WLOA 1ZOPA 3IKMB 3LPLA 2O8DB 3FBWA 2B78A 4BO0A 1OXTA 1ZOIA 1BQEA 2C97A 4EPRA 1JDZA 1CEQA 4LY0A 1HK7A 2PG3A 5K51A 4UTZA 2IBSA 4LSZA 1XTKA 5KKAA 4C7OA 3MM4A 1T1RA 1Z5OA 4BE9A 2YNMA 2GD0A 3PKIA 3NV7A 1GKKA 1XKQA 1U3VA 2VYVD 4P0QB 1HTBA 2LUOA 1RYZA 4IUCS 5CFRA 1ZSYA 3GAMA 3D0RA 3PXDA 5EESA 4R2WA 3F96A 3C1AA 5H80A 2OZEA 4OQEA 4RV9A 5DCYA 2G5TA 2IS2A 4RTQA 4PYOA 4LY3A 2YS7A 1I01A 2PR7A 2VBFA 1QDLB 2Y71A 1V16A 5FL7A 4F7WA 3TECE 2AG5A 3GEBA 1QZUA 4HSGA 1PBNA 4DRZA 2HCRA 1FDVA 2HFJA 2J3JA 2YTZA 3RREA 5C3MA 3HDHA 4LN1A 1X7HA 3O3CA 4XRRA 3WS7A 3OY2A 1RRMA 4YQEA 1ODJA 3HXPA 4P53A 3OT5A 3P97A 1UT5A 1YBFA 5TS3A 4YPFA 4AJEA 3P2EA 2E85A 2ODPA 1VJ1A 5DCWA 1KJJA 1G8MA 3ORSA 4RJLA 3EHDA 5TRTA 3VI3B 5LXTA 1HQDA 1RKXA 2YZNA 4KW7A 1IY8A 2HEGA 3LQYA 5SY6A 3VI4B 5C8DA 4QJBA 3UZUA 1IBLB 5GWXA 3ERCA 3MUOA 4BMZA 2B0JA 2K6GA 1JWBB 1VKNA 4HR7A 1GU0A 1V1RA 2CBZA 2D5LA 1Y37A 4YALA 3G0BA 4ND3A 3PB3A 4G5YA 2XKKA 1ZIYA 2JK1A 1D1PA 3OG9A 4GOXA 4G0PA 2O8CA 3F6BX 1O89A 4HATA 5A9TA 3L3BA 3P0EA 2IF2A 1CIJA 4M6WB 2B1IA 4NMLA 2CNNA 5IFLA 1O9BA 1XKTA 2RH5A 5FTKA 2RMKA 1JR4A 3RTGA 3P9SA 5BUZA 1VYUA 3MBKA 4GF5A 3LUCA 4R41A 4KR2A 2JFBA 2QZSA 1G8KA 1JU9A 1IC6A 1GZ5A 1WKVA 2VRCD 3I2JA 2FLVA 1T6YA 1GUDA 4R0MA 4DB2A 3GWZA 2WJHA 3FMPB 3OCVA 4MHSA 1R66A 2H1WA 2ZG6A 4J4TA 3FNEA 4KGXA 4II2A 1NF9A 2CVFA 3AONB 3PITA 5KYWB 1IDOA 1BMFA 3ITKA 3UV7A 4C5BA 2NM0A 1ECLA 1UOPA 5ECDA 2G09A 2ORYA 3S70A 3GQBB 3T4UA 4J6EA 5LL6P 4IHKA 3OCXA 1T24A 3C8UA 1C7ZA 1F12A 3NOOA 4FDTA 1WULS 2C9ZA 1NOJA 3D3EA 1NVDA 1G59A 4Q9JA 2OLKA 4BX3A 3WZLA 2GJ8A 3HEAA 2HSJA 3VJMA 2D3WA 4XVQA 4R51A 5CH8A 1N75A 1DE0A 4QXPA 1D6MA 1WKBA 2A1IA 2Z3ZA 4K7JA 3EXHA 4MS4A 3DBHA 4NONA 4EB0A 1E0SA 1Z5UA 4N82A 1ZXLA 4DDTA 1XNGA 4HBGA 3G8CA 3ADDA 2WWXA 5FTJA 4DM3A 3HLYA 4A0SA 2B5OA 2AD5A 5M7EA 4D74A 5G1NA 2A9KA 1S2DA 5BR4A 1CF9A 1SZCA 3MTGA 2AFHE 1FVOA 2WJ4A 3MA0A 4IOKA 2G25A 3WICA 3WIBA 4OFBA 3WNVA 1D0VA 2QMQA 1IWPB 1T1IA 2LWIA 7YASA 5HA5A 4E15A 2XA9A 4IO1A 4P92A 3V97A 3DWEX 4I8IA 1J97A 1ONOA 1TECE 2X0EA 1JG7A 3U3XA 1KTIA 1O3YA 1U2DA 4ZQIA 1UM9B 4HVLA 4KSCA 5T5QA 5IRCD 5HYVA 3LUKA 1CF4A 3U7JA 1L1RA 2AIRA 4II3A 5A0FA 2HMTA 3QZUA 4E4TA 3G8DA 3G9ZA 3HVJA 2XUDA 2EKDA 3NBUA 4FQ7A 4AY5A 4WUTA 1GDDA 4G1VA 4OY3A 3ORFA 4E13A 1VC2A 2BGJA 1A1VA 4MR8B 3D7NA 2IA5A 4H1WA 3NEJA 3OECA 2QQ5A 3CJTA 4PBTA 3HWX1 2ZBFA 2QUKA 4F45A 4DCJA 3E7XA 1OBOA 5IF9A 5KOYA 3GLFB 3IQFA 6CHYA 2BFMA 4XQ9A 2Q8QA 4B7ZA 1JDJA 1ECBA 4XB2A 4MUYA 3QPWA 5D87A 1AM4D 3LL4A 1NULA 1ZBDA 1AQ6A 2YW2A 3E9EA 5IVPA 1JWLA 4NCBA 1SA0A 3WE7A 2FWNA 4GZ6A 1M10A 1GQOA 2FH5B 2VJPA 5BRNA 1D1QA 3AFOA 1ELOA 3OF3A 4J49A 1E3IA 2A5YB 2QGFA 1SC6A 3RAFC 1FVXA 4QM7A 2QQ0A 2R8EA 4EVIA 3GJXC 3BB1A 3V9PA 1H4VB 1GCUA 1GZHB 1QYVA 3ROTA 2IEZA 3OM1A 4UAJA 2K2QB 4A8PA 1JQKA 2MSLA 5AVWA 2FPLA 1CW2B 4QX6A 1DDGA 4D0NA 1HF3A 1Z4NA 4KVAA 1LW7A 3LY7A 3D8BA 2IBTA 4RIFA 4EJ0A 5E0KB 4F5DA 3E48A 3JWIA 3PQDA 2NUAA 1Y5NA 1ZR2A 3QKIA 1KVQA 2PT9A 3QE0A 1HV8A 1YZHA 1HDOA 1P9RA 1LX6A 2JCSA 3CSUA 2W2QA 5K0NA 4L0CA 5FTLA 1AG9A 3OIUA 3PR3A 2I6UA 1J1ZA 4OGKA 4N54A 1ISIA 3COVA 2AHOA 4KLCA 4LKOA 1Q7BA 2K7FA 5I9MA 2QN6A 4X3CA 1ZUNB 5FFMA 3LXRA 3ANMA 4IEFB 1ZW1A 3R74A 3TCNA 3HHEA 2QAGB 3AF4A 3K20A 3PJFA 5J5AA 1U9ZA 1Y89A 3T9CA 4RDIA 2W4QA 2Y92A 4UBKA 2HSEA 4FT4A 2DECA 3GUVA 4BJ1A 4DYHA 1W0JA 3GLQA 5EUCA 5IMBA 1PI3A 1JHQA 2KPOA 1NWHA 2DGDA 4UOQA 1AHNA 1GCOA 4LNAA 5ANRB 1I1QB 3CVYA 4LQCA 2CMFA 2F3QA 4PLWA 3TTXA 3WAJA 1T10A 4JBHA 4TRJA 4RD0A 3GFGA 3DDSA 3BXGA 3QH4A 2IXTA 4MYTA 4W5OA 3FPEA 4LI0A 4V39A 2JGRA 1WO8A 3WBJA 3DG9A 3T3DA 1ZM3A 4BO9A 2E3JA 3HMKA 1YE3A 1H69A 4HFMA 2IU6A 3PTAA 1TTTA 1WUHS 1Q5PA 3CPEA 3PWKA 1EGVB 1ORHA 3K0CA 2DUWA 3FZGA 3B5IA 4MRPA 1X7XB 2R6R1 3M5DA 1FQWA 2GNPA 5AVQA 2D5AA 3K0FB 1CP3A 1UWVA 2PS1A 3IQEA 4ODIA 1V41E 2J85A 2WIJA 4OKNA 3UW1A 5JAMA 3TPCA 1OX5A 3FZYA 3DDOA 4RTLA 2EQ5A 2Z9CA 2ZBQA 3B1JA 1YNOA 3ZJ5A 4IGEA 4AJ2A 3Q0EA 1Z4LA 4I6JA 3BK2A 4C1NA 4QBHA 4UPVA 1XLTC 1T6NA 1B6RA 3IQGX 1TT5B 3OOSA 1ZJWA 1BHQ1 5AHKA 4J76A 3BH7A 4PX9A 3F3KA 1TCBA 2IXFA 5WRFA 3NNSA 2VCEA 1PQYA 3MJFA 4IJMA 2FHPA 4JLSA 1I7LA 1GPUA 2WDPA 1TQDA 4LISA 1M3SA 1G2QA 4MKHA 1FDTA 1PQWA 1YKGA 4U63A 3K70B 1DTWB 4MUJA 3LBIA 4RM2A 4CKZA 3MMPA 4US0R 5D7BA 1NMEA 5DGIA 3TPFA 3WO1A 5K20A 5G4LA 4L16A 4A0RA 4EYOA 4CFZA 3M1AA 2O0MA 2DCUA 4Q3CA 3E35A 2PWBA 5AJHA 3KKNA 1KRXA 4U2BA 2XNDD 2FN7A 2A7QA 1N0VC 1UUFA 1GM5A 1T26A 4DIUA 3ETEA 3ZE6A 4M0UA 3JYHA 5T8KA 3UA3A 2XCQA 3NAZA 4D5EA 2E4XA 3D0QA 2FQWA 2FSHA 4XX0B 4Y6QA 5JWRA 3AI7A 4MRAA 3P2MA 1PR3A 4XUDA 2GETA 1FFWA 4BNDB 3ABQB 1J8QA 2PSJA 3Q3GE 2HPAA 3Q3VA 2IZ0A 3ZGNA 1Y4AE 3UK6A 4WADA 1GGNA 3GELA 1LVUA 2XUZA 3GY0A 4QBTA 3NHZA 3B3AA 4TYYA 4LGMA 2FWMX 1N4DA 2DFLA 2MMGA 1AN0A 4W5JA 5FUVA 3VYRB 1X77A 1L5YA 2PUJA 3H2IA 3ONVA 3RT9A 2PA3A 1Y8CA 2HXSA 3HFGA 3IVAA 2PYIA 3WLTA 2BGTA 4DLZA 4F04A 1N7HA 3H5WA 4K8OA 1Z56C 4OF4A 3DYVA 4AG5A 1GZDA 1Z33A 4LFAB 4HXEB 2GZDA 2J3KA 2GS9A 4WACA 2Z5GA 3WIEA 3ONFA 1L7PA 3V8PA 5DYWA 4ZEXA 4CM8B 4F5EA 5KNDA 3Q8XB 4PPQA 4FUQA 1EJ2A 2IP1A 4KFRA 3ZPXA 1BA2A 4MICA 3PLNA 4P84A 1S8NA 4GP6A 2JFUA 4MA0A 3Q7RA 4R4JA 4U9HS 4NEHB 5CT8A 1N8NA 4REQB 3LVFO 1U0BB 3THRA 1AQNA 4PZ0A 1L5OA 4NDZA 2M9MA 3HVHA 3RT1A 3CUUA 1QIIA 3PKJA 3GVPA 1UPAA 5E6RB 5ER9A 3WQSB 4CV1A 4AKSA 3KK0A 1ZD8A 1F20A 3NHSA 4M9XA 3W78A 4TL6A 3KZMA 5CFNA 1W36B 1XDUA 4CQNA 1RYMA 4NXMB 2OV6A 3SC2B 3KRTA 2JAPA 3SOZA 1QRSA 3PEYA 4YLYA 2CXSA 2Y1FA 1G8SA 3FHLA 4KE6A 1KK1A 4LJ8A 3SZMA 1TCUA 3OTHA 2KWIA 1N2BA 3HP4A 1B74A 2JANA 2RJNA 5GIPE 4CKEA 1H8ED 4G5OA 4KBFA 4KXFB 4L22A 3WGYA 1D2NA 1NLFA 3P8ZA 5K2MA 3SVTA 2CJWB 2X7XA 5C5IA 2AG0A 2QRVA 3FPCA 4I8DA 2ILVA 3UOAB 2GB4A 5F7XA 1HNXB 4INJA 4PZUA 5IEJA 3JZDA 2WG0A 1GGKA 1VP3A 2VDNB 3NHYA 2PE5A 5DYGA 4BVGA 4OXQA 3EF1A 1B15A 1HETA 3Q3JB 4GR5A 5E6SB 4RPIA 1GSIA 4MYCA 5FTWA 3UFXA 1N5DA 1CJVC 4Q3NA 4IIFA 4JB8A 2P2ZA 1UZLA 2C7VA 3VPCA 1QWSA 1JAYA 5HILA 4QU9A 3A1TA 1U3UA 3C3MA 1Q0TA 2QPOA 2VHQA 1RXIA 3I01A 2KX7A 2QM8A 2R4UA 4NEQA 4PO1A 4R1PA 3RJ5A 2OOKA 2I2WA 3ZDEA 2VJYA 5H5JA 3JRXA 3L9XA 2CZQA 3F1KA 2EF0A 1G20B 2LRHA 3A4TA 3JATB 3TNLA 3U60B 4MWBA 3SQNA 4ASUA 4NH0A 4JEIA 1YE8A 1AGYA 1KKUA 1JIVA 1U4SA 1ZMTA 2GWRA 3WK7A 2PIAA 2QSYA 5F5LA 4M8IA 1Y4SA 3KQWA 2HU8A 3R3JA 3ZWOA 5LQJA 1I4LD 4D57A 1EQAA 1OHHA 3MT7A 4P1ZA 3ZWCA 1GPMA 1VE9A 4JVOA 1KH2A 4GPD1 4KN8A 1XZPA 4R2LA 5EUMA 5I4KA 1RBYA 4CDNA 1LBEA 2B9EA 2R7MA 1I8TA 1P9WA 5EUBA 4AO7A 3I9KA 3IAS6 1XQXA 2HL6A 2P9CA 3A11A 4KLRA 4RXUA 3OQOA 1CQJB 1T36B 3VR4H 4JGBA 4F9GA 4FHGA 1J6UA 4JX8A 1WVMA 2AMJA 5KNLA 4ZAGA 1Z0AA 2C4VA 4AYTA 3PUVA 5IAKA 3UJ8A 1OE0A 2PH5A 3EEQA 4RQTA 3LZCA 4UDNA 1DJLA 2YJ4A 3TEJA 2KLBA 3QLTA 4GVPA 4ZVTA 5LYJA 3U13A 3WFIA 3VOAA 1MA3A 1FLDA 2VHZA 5B3JA 1RYEA 1KI7A 2CEAA 1PWZA 1V96A 2QTVB 4IGAA 3SQLA 1H94A 4BNGA 3VH4A 4D8WA 5F3WB 1F48A 3KAJA 1SB9A 2AC2A 1BE8A 1G5PA 2ZBRA 3PFNA 3IDZA 3LNCA 4NC9A 3MCTA 3Q6MA 3B1XA 4LDRA 2ZYAA 1TQ2A 3PNYA 3PQ5A 2BONA 4LK2A 4UNIA 4CGYA 2O54A 1PR2A 1CUSA 3PHIA 1E2FA 1NQWA 1WW3A 1NVBA 1XPOA 2DFKB 4JNKA 4BDTA 3K6RA 1OTYA 3E70C 4Y2SA 1G5TA 1YU6A 2VSXA 2FEMA 2Z09A 4MITA 5IT9A 3PICA 4FI3F 2DMRA 5IFKA 1OPRA 3LL7A 2P69A 2QTLA 4O2AB 5AH0A 3RSGA 1NNI1 3MGGA 4WERA 2AVNA 2V3VA 4HNTA 1JH9A 3B78A 3HKCA 3L93A 4JEMA 4I3HA 3TRHA 5GY7A 1JU4A 1XJQA 1JXOA 2BFBB 2DPHA 2XUHA 4DPLA 1WB9A 1TZBA 2HSWA 4BMCA 2YUTA 2AN3A 2WUWE 4Z3DA 2SHKA 2WJGA 3ZWMA 2X5XA 1YCGA 5IU6A 1JXQA 5G4KB 1YE5A 3ONNA 1CD5A 4QNMA 1RFGE 2XSZD 5EQFA 4E5VA 4QYIB 1JDVA 5K0SA 4G97A 3P32A 5JVDB 2XGSA 2JI7A 4FWBA 1AQJA 5A5GA 1QXSA 3MUFA 4RGBA 2B25A 4J2HA 2GF0A 2DHCA 3PWZA 1MB4A 3QVSA 3CLUC 5GVRA 1NU6A 1TF5A 3L4SO 2CNKA 2BMDA 3K09C 3SN6A 1MT3A 5NULA 5KX5A 3EIFA 4J0JA 3JY6A 3PR1A 2R5FA 4K6MA 5KYUA 3LP6A 4MV1A 1RAIA 3N07A 1HDCA 1BOFA 4G1MB 1XCPA 5IAOA 4IIBA 4N76A 2VP9A 4YV2A 3CLSC 3TKYA 3BJIC 2AYZA 3SJUA 2JI9A 1GTZA 3OP1A 1BXKA 3WR5A 2O5EA 4U2GA 4X1KA 5LPNA 3MW8A 4UM8B 2NZJA 2GZAA 3B7GA 1OXKB 4IXNA 4F3CA 5AI9A 5A4DA 1LZLA 2DF8A 2DU8A 1NIPA 4U7WA 1DAGA 3LHSA 3TMYA 1N6OA 4RVDA 4V0NA 1E7YA 2ZRHA 1AX9A 2C5FA 1YAJA 2QB5A 2Y1XA 3UCXA 4YJGA 2V9PA 1EP3B 1Z4OA 3BWMA 4BBJA 5BV2P 4IIEA 4UAUA 2VJLA 1J07A 4DV0B 2NU7A 2ZWOA 1KIMA 3FNGA 3A9TA 1N5JA 2BTQB 4Z1MD 4IXWA 1NAHA 3LXUX 1LWOA 3RJTA 1RACA 4YBZA 4IHJA 3CZAA 5ALPA 1TIPA 4Q4AA 4HZUB 5GJCA 4FFRA 3PUZA 2H1LA 5C37A 1M2VA 3ZWAA 4GEKA 3TZCA 3P19A 2PU7A 1V5GA 1XCLA 2B7CA 3IC5A 4MLPA 4RDCA 2RE8A 1Z37A 4G4SO 3DONA 1KDOA 1JZQA 3AOEC 2YWRA 1JIKA 4PY2A 3MQ4A 4ER7A 1U2TA 3CNBA 3VISA 4RMIA 1KWGA 4YRZA 2Q46A 2O7RA 2IF0A 1E6EA 3VNAA 1Z8NA 3CX8A 1MFZA 4G0QA 1C1YA 4RH1A 3ZR4B 4A3SA 1VOTA 2XDWA 4YCLA 3BMNA 4C3VA 4MUFA 4O0MA 4QAJA 1JECA 4QUJA 4WZAB 5AVJA 2QLNA 3KUKA 1J5XA 3USES 1EUCB 1LFAA 4JYMA 1E59A 1X39A 2YIJA 3CHYA 4HMPA 3NBKA 4LOJA 1NNUA 2PFGA 1R64A 2UVPA 2PX2A 5JAQA 3OFNA 1B2RA 4MV3A 4R2XA 3DAOA 1EDBA 1YCDA 2XMBA 1N5IA 3JR7A 1J8MF 1UCFA 3ESXA 3BXPA 1U80A 4LHZA 5HGJA 3HP1A 3UAYA 5BYKA 5KMGB 2RHOA 2OAP1 5DULA 3GPBA 3NDRA 3BTOA 3R3UA 2G8LA 4YWJA 2AK3A 2QD1A 4QBGB 1EM6A 3IEXA 2YH2A 2H07A 3AY0A 4HT3B 3KHTA 4EM6A 4OYLA 4U2CA 4WFKA 1J70A 3E9ZA 5DBHX 3OU2A 3OUZA 5JLJA 4FBMA 1BX1A 2OBXA 5B1HA 1C7QA 4Z4QA 2J7PA 4C4ZA 3TQQA 3CT4A 1YMQA 4OLFA 1Z26A 1QTIA 3IT0A 2WWRA 4XFJA 1H4QA 2POCA 3HR7A 3QW4B 5CB4F 3B3FA 1NKVA 4TS4A 1E9BA 1RXUA 3KR1A 1I4TD 4MVJP 2FFBA 3OVMA 4LOAA 4P33A 5NLLA 4B3DA 3REFA 2PMFA 3U39A 3VYSB 4GS5A 2R44A 3IELA 1MLDA 2NYVA 3UF0A 1EHYA 1VJ5A 1VZ3A 2A0WA 3ILSA 4EFMA 1H5UA 1FQKA 1Z0SA 4G09A 4TQUS 4WDRA 4XR9A 5A1JA 5CUQA 5KYTA 2RGUA 3MPUA 4FGLA 5FHQA 4ZYYA 3UAZA 2BKUA 2NVUA 2XOKA 2BGRA 4NOMA 4BKOA 4YPOA 1XRPA 4U2FA 4ZJUA 4DIDA 5PGMA 1YR1A 5BMVF 3E2IA 2F9LA 4F6LA 3AXTA 4O6VA 1Z82A 3COWA 2BFOA 5C46F 2HH9A 1QOZA 2GCEA 3NT2A 2VOEA 3QMMA 3G7SA 5HFNA 3HWWA 2DB3A 4JL6A 3TZLA 1ZGJA 2LCFA 1PW7A 1ZK1A 3LLMA 2AR7A 1M75A 5K3OA 3OQIB 3SHTA 1PX2A 3S1AA 2X1MA 4HUQA 3PHGA 4AN1A 3NOVA 5JWOA 1EB8A 3QENA 5LZ7A 1EA5A 3GN1A 4O2BF 5DT2A 1ML4A 3QVXA 1V5EA 1MB2A 3LC2O 3PVZA 5LUBA 4URVR 7ADHA 3THWB 3I5YA 3EZ7A 3AVXA 1DX6A 3FMIA 4C88A 3O9VA 5CXUA 4A1FA 2BFCB 4E88A 4IAOA 2WAAA 4PXAA 3AU8A 1TM1E 3MFQA 3AVUA 1GEEA 2AG6A 4N8DA 1IQPA 1UXOA 1Z22A 3TE6A 2YXLA 3L5KA 3RK4A 4OHZA 2OD7A 1G2OA 1SUPA 2SKDA 3AV3A 4I1PA 2DY0A 4ND8A 4JJGA 2VF4X 4IOJA 4WCFC 1W4ZA 4I7EA 1Z2AA 1KJ9A 3GRAA 1Z0JA 5FKJA 2D1TA 2WUDA 2ZUCA 3EZYA 2DJIA 2EQAA 1LFDB 5JSKA 4BJ3A 4IBOA 3MIIA 1XFDA 4MW0A 4DC9A 3FCXA 3VU3A 5EPUA 4JP2A 3SWWA 5HEKA 3QKSB 2ES4A 2V59A 1PT5A 1UAGA 4OXNA 1JDNA 4BHTA 4RWEA 3AKCA 1PGQA 2BFPA 4F84A 1KY2A 4WZBE 4EL5A 2BSAA 1GADO 3FNHA 3HXOA 4TRMA 4LYFA 1A04A 3I61A 4NBWA 1U0RA 4PRKA 5TEWA 4EJSB 1KBQA 2O5RA 4C29A 4CL2A 3GVCA 3PX7A 4A8JA 5EXDA 3GRRA 4R2HA 3SZRA 2I3GA 4PQYA 2G6TA 2TRSB 1OH6A 3QHPA 3P9NA 2PQ2A 3EXIB 1L8QA 4HH0A 4I6EA 3WK8A 5FULA 1A76A 2IEDA 4CQMA 3OI7A 3KL2A 3JS5A 3VYVA 4H7IA 5ETJA 1BCRB 1EFKA 5L7YA 1UMBA 3F7NA 1OWPA 3I04A 4TVKA 2CHFA 4L5YA 5AO9A 4ESEA 3QPBA 3NTRA 4BL5A 1UK8A 4EYKA 5A5EA 1ORWA 2JD2A 2BOVA 3WNDA 3ACBA 3C3DA 2NQTA 2X1VA 3EVAA 1MT0A 1LUAA 1TVCA 2NNWB 5GV8A 1L7BA 1JIIA 2WPNA 3GUUA 4KX3A 5IAGA 3CC8A 1TF7A 1WQ4A 1MP0A 1V2GA 2A4MA 1XZNA 2D8AA 3PQ4A 1QE3A 1V35A 1J90A 3IOYA 3IR6A 3O31A 1DG1G 3D8HA 1CP2A 2GH1A 4IZOA 5JANA 1XD2B 1L5SA 2XR1A 2IHUA 2AFHB 3EDOA 4MR7B 2YV3A 4QPNA 4UHCA 1EVJA 1U0FA 4OJYA 1MV8A 1QC5B 1QO7A 3EODA 5SZHB 5JHHB 5JH7F 2BDUA 2FDRA 1W5AA 3EWSA 1FCJA 1Y1KE 4CU2A 4D6XA 2LVBA 5EIAA 1LDBA 3A4NA 5DTMA 1LJ8A 3X1ZA 4RS4A 1NV8A 1XRQA 1YK1A 1HYBA 3UQZA 3F71A 1N36B 1MG0A 3QBVA 3QY0A 3O9ZA 2J9XB 4TTTS 3KZKA 2IPLA 3FYTA 2GSDA 3V00A 1FJGB 3AUAA 1G38A 2AXEA 1UPUA 4XPIB 3WXMA 3DE4X 3MC1A 3WWPA 4ZALA 1N1GA 3Q85A 4OMFG 1WR8A 3LP8A 4LTMA 3GLTA 5CU7A 5A7HA 3RBXA 1KE1A 3DAFA 4NTZA 5IBQA 3H4VA 5AVOA 4CL3A 4YR7A 1DNPA 2EGHA 3G2HA 1ZD5A 4LWZA 2BDEA 3B60A 1G4UR 2WJPA 5MGBA 3OE7D 1VSTA 3DS8A 4E4YA 1Y98A 3OF5A 3GJ4A 2ZB8A 3N70A 1OVMA 1Z88A 5IYZF 3RSSA 2P4QA 5E7MA 4NMWA 5GJWC 3NONA 2NZWA 1UXHA 1X87A 1L7NA 3DCJA 2MMCA 4L78A 2CL6X 2W6QA 1SRRA 2AGVA 3HVKA 3T06B 3LTEA 2F55A 2ESRA 5LA6A 3AF2A 5JNTA 3B85A 1AUOA 5DM1A 3R76A 2IOFA 3LVQE 2G5GX 3OE4A 4MI9A 5JWHA 3L79A 3ZTYA 4JH0A 4B6JA 2WQ6A 2CXOA 5ADUS 3TIXB 1K6JA 3OWXA 4UATA 5LUAA 4CU5A 3LGSA 4ED9A 3G9UA 2IOYA 1CQZA 3LKZA 4KSYA 4WBNB 4LF9B 2R00C 5HR5A 5JZMA 1CJBA 1M67A 3NWJA 4AZWA 1ULZA 3NNNA 4UQPA 3VPSA 2ATEA 5KTTA 4BV8A 1X2EA 3IAFA 2AEEA 4NU8X 1U8EA 2XI4A 4WXYB 4K6CA 3UPUA 4PZDA 2VZ9A 1BMQA 1KYIA 2V3WA 1D2EA 4NZ9A 2ISSD 1WD5A 5AQ1A 4M0LA 4KQJA 1ZK4A 3W1WA 5FLKA 3WVNA 4JXZA 2WG2A 5CM2Z 4XIFA 1PIWA 1UEJA 1JTFA 4TT8A 3DZDA 1VGRA 3RTCA 1CB0A 3GGCA 3H2GA 4L6IA 4D43A 2WJIA 5CXSA 2W7TA 1FL9A 4KNVA 3S2FA 4YPVA 5TIIA 3UMMA 3QEAZ 3AETA 2ZB2A 3GEDA 4B9AA 1N9ZA 2HRZA 4QHTA 2WIDA 3QBTA 3CUVA 1SY7A 5AHOA 2VYVA 2QRPA 2ZQ5A 2MJLA 2NSDA 3U49A 1PF7E 2RGDA 5AXCA 2V74B 3NAGA 2C5HA 4CG0A 1JJBA 3CGGA 1J20A 3ONWA 2WIKA 5D3QA 2BMWA 4WEQA 1RWPA 3RHFA 2ZRCA 5GINE 1EAMA 1U2EA 1QOQB 5C18A 1LSSA 3LX4A 1Q6ZA 2B1GA 2R1ZA 4N41A 1CJSA 4O4HB 2C2HA 1CKEA 1WM1A 4Y2GA 3WA7A 3H83A 3IOCA 4BP9A 1EK1A 4D8XA 4LC1A 4DNPA 3HDQA 4A6DA 4IX9A 4F91B 2ON6A 1P44A 5H83A 1R4AA 4X5OA 2DCMA 1L1EA 4ZHQA 5J23A 1VMDA 1YL6A 3DFKA 3T7AA 4CKCB 1KAEA 3GUYA 1SCKA 2PS0A 1Z6QA 1Q1NA 5ES4B 3IE1A 3ELDA 1EINA 1VMEA 3FHOA 4DSOA 2P6NA 4DCMA 1XO1A 4QDJA 2WE7A 4XUGB 5BSEA 1GXSB 2F90A 1VYTA 3FDFA 1SWVA 3HB4X 1OLXB 4OJQA 5FCDA 2FK8A 4EABA 1H6BA 3HQ4O 3QEMB 1QRAA 3BCSA 4QL3A 4YAJA 3IUYA 4EITA 1JLSA 2WJ6A 3DBRB 3RFVA 2LTAA 2YV4A 2IW3A 3STHA 1PG0A 1ZZEA 3KIPA 3PD1A 5J58A 1NX9A 2Q9UA 2BIFA 4RGQA 2GCPA 1DFIA 3CLUD 3V42A 4CQJA 1CEYA 2JH3A 1EUDB 1LGYA 1U0LA 4QQNA 2YWGA 3GLUA 4TYPA 1Z63A 1LSOA 1YR6A 2CJYA 1QCZA 2G17A 3B2EA 4O8CA 5CVJA 3ZKAA 1OUMA 1QHEA 2G7MC 4DUYB 4KMSA 1N0IA 4WUVA 3ICVA 3BG5A 4I9UA 4DFDA 3ABRB 2Q9CA 3U80A 3CLSD 4ARVA 2QLMA 4U5QA 4BNHA 1XF1A 4RACA 4KXNA 1OH8A 5EE0A 2V1XA 4YI5A 2VRCA 4Y6LA 5AM5A 4DV4B 1R9MA 1RE0A 1X8XA 3F46A 2D0PB 2ZYHA 1UJCA 3HGTA 2Q3JA 4NH4A 2VWHA 3FMFA 3SNHA 5I7WA 3FYDA 1FNBA 4NX2A 2FVXA 2J3DA 2W43A 5LZ5A 3FOAA 2PHZA 3LVBA 1G19A 5F2OA 4CT0A 5JBIA 1YFJA 2GHIA 2GD1O 3L1VA 4U9UA 5BVHA 4C4XA 4YCMA 1YDEA 2CDNA 1T0HB 1DKNA 2IPAB 4Q7KA 3T3PB 5K0BA 5MFZA 1RFLA 3HXQA 3ZJTA 2W6CX 5EQJB 2CLCX 3NYIA 1RE1A 1U0EA 1ZVJA 2L18A 2VHEA 3BTSA 3DNMA 4G1EB 2VUUA 4D4MA 5C52B 3LBNA 2NO1A 1ML3A 2C03A 1ISMA 1TUBB 4OPMA 4UFOA 1KJIA 2VHUA 3WLRA 5BV1A 1K7XB 4M1EA 2Q2OA 2XNHA 1E0KA 4CKWB 1ACJA 2FJPA 1U2RA 3FYUA 3JX9A 4OAOA 4F92B 4ZI7F 4W8GA 4B4WA 4EARA 2PZMA 4B43A 5FWYA 3WGZA 1YFKA 3ZDCA 1P61B 1I3NA 1S7CA 1U6KA 4MAAA 1IBSA 9GPBA 2VIIA 4CTMA 3Q5GA 4ND2A 1CQWA 1PJLA 4RXTA 3EC2A 3KB2A 4YLEA 5JNVA 1MO4A 2QI9F 4P7BA 2PSEA 1YU9A 1KYQA 2O7SA 2Q4EA 2B8TA 1ABEA 1CB7A 1YB2A 5CK5A 1SNYA 3UW3A 2W98A 1JMVA 4XD7D 1CUDA 3BK1A 4XFKA 3FHJA 3TNYA 3EULA 3V2GA 3ZTWA 3ZHQA 1RRCA 4M7OA 1OIVA 2ZBUA 2RHGB 4JQSA 1ZW6A 4BBZA 1NVUQ 4PIVA 2NTNA 1JFSA 2D2FA 2PRSA 4G23A 5TNXA 4JLNA 1JKJB 1UFQA 2I29A 2RARA 2V0NA 3JARB 3SG0A 4DCUA 3VU9A 3WGVA 3EIEA 4MS1B 1KK2A 1M83A 3RABA 1U7DA 3AX6A 1W4RA 2H8KA 1PNQA 2OCLA 3GT3A 4RMJA 4ZRDA 3TL2A 2X0RA 3UMVA 1EG2A 2OVBA 2YJ3A 3BC1A 1P80A 3F7OA 2C2GA 2Z2ZA 1TIKA 3NTOA 4JWKA 4KXXA 2XDQA 3L43A 4AZ0A 6AT1A 2C58A 4IDPA 4WL0A 4HAOA 1C1HA 4AN4A 3C85A 1O57A 2YYZA 3G59A 4PBRA 2W2MA 1KC1A 3SFTA 3SLGA 1ZNXA 1V8BA 1NXWA 3DHYA 4P5DA 2BYTA 1UMDA 5ALXA 4DLXA 2Z56A 1N5KA 3KYIB 1NUPA 2COEA 4KLAA 4MMYB 5JC8A 2QTRA 3IQWA 5DW3A 5C8YA 1DADA 1DT3A 2FVYA 3NEPX 1QR2A 2Q7DA 2C78A 5FBHA 1VBNA 3AF6A 3ZX4A 1SRQA 1KH1A 3EW7A 4CIXA 1YTLA 5FR1A 5EPEA 1E2BA 1FFBA 2PDAA 3B36A 5I7HA 1DCFA 4ZOLA 1C7FA 2AOUA 2I8AA 2NZ2A 4JJAA 2G1UA 1K6XA 4X3OA 2VQ6A 4ER5A 4F56A 1L5MA 1SGWA 1NIJA 4GNKA 4KRFA 3AXSA 3EXAA 3H9JA 3BRWD 4LK3A 1WV0A 1K75A 1UBFA 3MMZA 2G82A 4TSRA 4FGWA 4RKEA 1IUPA 5K8LA 2VYFA 5CLGA 3L6OO 4H3SA 3GRZA 3W5DA 4ZVOA 1G3QA 2IYNA 2UU9B 1XJWA 3KE8A 2H2FA 2QIOA 5HIKA 4I3GA 4ZOBA 1EGMB 2R68A 4PNEA 1SBZA 3H5LA 3ROGA 3OD5A 2HN9A 5ILQA 4LBYA 1ZCFA 5CA0F 3SE7A 3K9QO 4HFRA 3UT6A 1HTWA 3VNRA 4Z1OA 1OAKA 2HNBA 2J7KA 2Z30A 1PN3A 4TN5A 2VWPA 4WFQA 2IUTA 3KLOA 3BFPA 1IOVA 1RCFA 4XJXA 2FTKE 3FVTA 4ZDIA 4L8GA 5HKBA 2JJ1D 2IEYA 3R9KA 3TAHA 2XCRB 1FX1A 4HEA1 1I2BA 5AKJA 4M4SA 4FEAA 4OG2A 4US1R 3QXCA 3X1XA 5EHXA 3BJEA 3I2YX 4LDZA 3W2TA 3MGAA 1O7JA 1KJWA 1DIBA 4KDFA 4TWAA 2IZ1A 3KSBC 1VL6A 4AIIA 1OF1A 1GR1A 1YL7A 3L7OA 2QYOA 1GL6A 3IAEA 4GI2A 3VC3A 4AKEA 1Y6GA 1SPXA 1MVLA 4D2IA 1T6XA 3U4QB 5LU9A 1MRZA 3LECA 4J07A 4CMIA 4YWHA 4GI5A 1A5SB 1RZRD 1L4UA 1G5FA 3OJWA 5AICA 2A0XA 2CUTA 4BFXA 5KS2A 1Q16A 1H9BA 2OGTA 4JLPA 4S1VA 2VDOB 4MP3A 2A2ZA 3E18A 3LC1O 1U3FA 2LCIA 1A7KA 2DWUA 1V4BA 2PCJA 1CZOA 2QHXA 3CX7A 4WESA 1NVAA 5AOBA 3KQYA 4ZD6A 5BQ5A 4I6GA 3RYFA 7MDHA 2VH1A 2CLIB 4MKXA 2ONJA 4OKIA 5A5VA 1BMDA 4UUAA 3P9RA 4GBJA 2Y1WA 4LCEA 5IKMA 2LKCA 3E22B 1U0OC 5F2KA 3ZYCA 3QITA 2C04A 1PJRA 4OMUA 4QRDA 3WL8A 4ZJPA 3RSHA 3FBGA 5CYFA 3ELYA 1LTHR 1TW2A 1YRHA 2W83A 3R6LA 2OSVA 3FFWA 2RI1A 1MC5A 2D0IA 3DZKA 2YMPA 2M1XA 4CMKA 5FBVB 4H7JA 1G5RA 1U8FO 5CB6A 2WP8J 1MFPA 2P9QA 3EVGA 3LY8A 3NMUF 4KGZA 1KMQA 4N7BA 4C2BA 3ABIA 4J0DA 2JI6A 2XCSB 1GPWB 1YQGA 4KBGA 4MZDA 1FQOA 2P1RA 1PEAA 3FAZA 4G07A 4P7FA 1BW9B 4HV4A 2YY7A 1OI2A 4WFJA 1P5FA 3BGOS 1T5HX 4JOCA 2OEPA 4PWZA 4LJ9A 2OHIA 3HC7A 1EFHA 3U61B 1JAIA 5EZYA 3C8ZA 3F5DA 2XNDA 5HQJA 3T12A 2JBAB 4QATA 2CHEA 1D6JA 3FTPA 3Q12A 3PENA 1Z0IA 3JV7A 1B0AA 2FZ5A 3QVGA 1OGJA 2IGBA 4IRUB 2QX6A 5LJLA 1A9XA 4ZREA 3E3LA 2OM6A 3SJAA 1M0EA 2OE2A 2I2BA 2GZ3A 4BWGA 1SXGA 4MGHA 1JFTA 2HR1A 2FOLA 4TUYA 1KQPA 4DMFA 2VS1A 3G5UA 2JHFA 2J32A 1DSSG 4PM4A 4L1KA 4EA8A 4URXR 3GC6A 4MIOA 2IYZA 3EGDB 2OV3A 1K3UB 4ZZ2A 2P8SA 1QE5A 3GGSA 4UM7A 5DTQA 5EUQB 3REQA 4K9NA 1HR0B 4FKZA 4MW1A 2HPHA 3D6MA 2A1UA 4EHNA 2Y0DA 4HKTA 5LD2B 2FWRA 2EEPA 1F4VA 3P26A 2QVBA 3DXYA 1YMUA 2PUHA 2GD2A 3DOCA 3IUSA 1U2GC 3EA5A 2PVPA 2FN8A 4NULA 1CDOA 5D1HA 3U3OA 1M72A 4QDUA 1MB3A 3HNPA 5BQXA 2RHRA 2RONA 2Z95A 5CDTA 5IDQA 4XW2A 5C3UA 4BNJA 5DB4A 1DI0A 2PZEA 4WOJA 2DBZA 2V7PA 1POWA 3TL3A 4QJ5A 3IDOA 4A0FA 3KXLA 2H5EA 3GPLA 3KUXA 3BGWA 2OBLA 3Q6NA 1JT2A 2G07A 3LM8A 4FOTA 4B3HA 4OSOA 1JEQA 1N2GA 2NGRA 4PAQA 2QKYA 5G0WA 3HVIA 3SHQA 2X1LA 1LQUA 5AJZA 1E4YA 1YUMA 1F8GA 4P5PA 3Q1LA 1J7KA 3AZQA 3I2FA 3JQDA 1C4OA 4W1QA 3QA3E 3RS8A 4UQOA 5DNVA 2EFJA 2X0FA 1I33A 2BFDA 3PFHA 4Z3OA 1ZRMA 1IHOA 1CQIB 2WTEA 1CE8A 3BAFA 1KFEB 3WLJA 4WKBA 1JJVA 5HKKD 5KIAA 2F2TA 1AKTA 1TKCA 2GQ0A 4U2DA 4X62B 2GZ2A 1H8EA 3EASA 4C05A 4FSXA 4F8EA 2GFIA 2OB2A 4PYJA 4ZDKA 3L9WA 3RC9A 1OY1A 1EFTA