4KAJA

X-ray structure of the complex of haloalkane dehalogenase halotag7 with halts, northeast structural genomics consortium (nesg) target or151
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
304
structure length
300
Chain Sequence
b'HHHHHEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAETHYLENE GLYCOL
molecule tags Hydrolase
source organism Rhodococcus sp.
publication title Northeast Structural Genomics Consortium Target OR151
rcsb
total genus 95
structure length 300
sequence length 304
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kajA00
4B81A 4WFIA 2Y6VA 3I1YA 3EQ9A 4CG1A 1QIEA 1EDDA 2UZ0A 1HLGA 1ACJA 2CEKA 3W9UA 2WFZA 4J3JA 1WHTA 5EIAA 4M0FA 2YH2A 2O7RA 2XMRA 5EHZA 1CUHA 1K5PA 4ARBA 4Y2PA 4TGLA 1NU8A 1G4HA 5LKRA 3SX4A 1EA5A 3ZLTA 3BWXA 2QTBA 4IH1A 1Q0ZA 3CN7A 3FCYA 4B0PA 2QKYA 1CUCA 2I3DA 3LLCA 5FRDA 1R4ZA 2HIHA 5HF5A 5A7HA 2ZSIA 3RLIA 5C7YA 1N1MA 2CMFA 4MYSA 4BAUA 3O4GA 2HRQA 2PM8A 2XUPA 1QIGA 4PSDA 5DNWA 3TJMA 3KD2A 3O95A 1PFQA 1KU6A 2VJAA 2XQIA 4GLBA 4IQ4A 1AQLA 4W1SA 4BCDA 5JD5A 4AB1A 2VATA 3EBLA 3PICA 3G0CA 3I2IA 4HXEB 1ORVA 5KBYA 5CT5A 4DM7A 1J1IA 4GECA 2XT0A 1JJIA 4ZWNA 3TEJA 4LYDA 1NX9A 3D5EA 1QIMA 2OLEA 3FSGA 4UBOA 1E66A 1ZD4A 4BCBA 1J07A 1WPRA 5FUMA 5AI6A 2PVSA 4UBJA 1KU0A 4K2AA 4J0IA 2E3JA 3G8YA 2QJWA 2R8BA 3HJUA 4WDRA 4BZWA 2ZYSA 2PPLA 2JIDA 4GW3A 2QT9A 2RHWA 1UWCA 1EXWA 1AX9A 4CG3A 1JU4A 2ZYIA 2Y2VA 1VJ5A 4P92A 2WJ6A 2RHTA 1YS1X 2B9VA 3WWPA 3G9XA 5A7GA 3C6XA 3FYTA 3KXPA 3I6YA 1YS2X 4AMYA 1ACLA 3OOSA 5AH0A 5A2GA 1QIJA 1K6EA 5YASA 1QIDA 2D5LA 4BB0A 4EA6A 1LBSA 3AJAA 3RM3A 4FHZA 2XMCA 5HF9A 5FLKA 1QFMA 2CB9A 2VF2A 2RIPA 4G5XA 2GYWA 1ZIYA 1Q84A 5ALMA 4QWMA 3UMJA 5AI8A 2C5GA 3WIOA 2ORYA 3GA7A 2O2HA 1JJFA 2EDAA 1J06A 4JEIA 5A6VA 4Y2QA 1R3DA 1THGA 2ECFA 2GZRA 1K4YA 3AIMA 1TAHA 2X5XA 2HA3A 2O7VA 2ZYRA 4J0CA 1EB8A 3ED1A 1VOTA 1XFDA 3W9BA 3WYDA 1JU3A 4BZZA 1XZJA 3P2MA 1BU8A 4WFJA 4WJLA 4B80A 2BGNA 1BCSA 2WUFA 4KRYA 3PF9A 3R3ZA 5AI4A 4AN1A 4XVCA 1CUSA 4C4XA 1OXMA 3R3WA 5ALHA 5ALXA 1THTA 1QTIA 4DMCA 2JGMA 1ISPA 1LPSA 2DHEA 3PE6A 1XLUA 3CCBA 4KACA 2H7XA 3FYUB 5HZGA 3GBSA 5JADA 3K2IA 2HHAA 2ACKA 3I1IA 4FTWA 1YB6A 5HFNA 5E4JA 4Y2TA 2OPHA 5AK6A 1GZ7A 2HRRA 3KSRA 2ZYHA 4IH4A 4GBGA 1X70A 1MTZA 5K5EA 1DWOA 3VJMA 4Z49A 3T52A 4RE6A 5IVIA 3C5VA 4ZXFA 2DCMA 4A5SA 2BFNA 2OGTA 4K6KA 1WHSA 2CKMA 3NUZA 3D59A 5I9IA 4PSUA 3SC2A 2XMBA 3WK7A 5CH3A 3ICWA 3G0DA 1XQYA 3BIWA 4QDUA 1QONA 3QMVA 4OYLA 5LZ2A 1LNSA 1ZD5A 2OCGA 4X3CA 4WY5A 3ZI7A 3H2IA 4C88A 2Z3ZA 4E46A 3IA2A 4N8EA 4BATA 1JFRA 4ETWA 2QJRA 4A23A 4FNMA 4G9GA 1L7AA 4EB0A 3QYJA 2PSHA 4G1FA 4E15A 5IKXA 3FNBA 5EHNA 3DL7A 1DINA 2YXPX 4FFWA 4P08A 4W1RA 5DJ5A 3X3HA 3O9MA 2JGIA 5JARA 3WL7A 5AOAA 4HXFB 1GT6A 1CPYA 3N2ZB 2BUBA 4I4CA 4DNOA 1X2EA 1AURA 3H2KA 1XZEA 5ALYA 5JASA 1G5FA 1PV1A 1QIKA 2OAGA 4DMKA 2WU4A 4MJ3A 2HA7A 5ALPA 2B61A 5ALQA 5JATA 2R11A 2Z8ZA 3E3AA 5I7UA 3G0IA 4CCYA 1P0PA 2XUQA 1XLVA 5JAPA 1AC5A 4DTCA 1R9NA 5DTJA 1GPKA 3FVTA 1UOPA 5JZBA 2OCLA 3AFIA 2H1IA 2PU7A 2IIVA 2V9ZA 4OPMA 2LIPA 2AJCA 3RKSA 3AILA 4PW0A 4G8CA 5AHXA 5LKAA 1QTRA 3R40A 4Q82A 5E4TA 3BIXA 1CFJA 4HRXA 2AJLI 3ZLVA 3TRDA 2HA5A 2WKWA 5E2IA 1X2BA 3LP5A 2HA2A 4PV7A 1FSSA 3V9AA 2H9YA 1R9MA 2XMQA 4L72A 2JBWA 3D7RA 2VJBA 4U2CA 3ZV7A 5A71A 1XZAA 4UHBA 1U8EA 4P9NA 5LYYA 1IUOA 2WIJA 2Y6UA 3HRHA 4KAAA 4BC0A 2GZSA 3HXKA 2K2QB 4DSAA 2XE4A 4Q3OA 2BKLA 2WG1A 1ODTC 2EEPA 4H7KA 2CUTA 1P0QA 5FP0A 4H7FA 3MUOA 1FFCA 1EDEA 3AIOA 3PDCA 2HU8A 1YA8A 3VJKA 1BE0A 1ZIXA 4BDSA 4MEBA 4F0JA 3IIIA 4DMFA 2WIDA 1HDEA 2XQGA 2ZJ7A 3WKBA 1MAHA 2B4KA 2HA0A 3QH4A 6YASA 3O4JA 4K5QA 3BXPA 4OB7A 4JUIA 5LZ4A 2XQFA 2GYUA 3WMRA 4F21A 5JANA 3I2JA 3MUNA 4EY8A 3WKDA 1LBTA 4J0GA 1H23A 2RI6A 1Z68A 1DX6A 4DNQA 2Z3WA 2QXUA 3VVLA 5T4EA 3KWFA 4YX9A 5FPPA 3QBJA 4X92A 5C8VA 4L9AA 4Y2VA 1SCQA 1GPLA 3DCNA 1T4MA 5AKYA 1DT5A 1ZICA 2QMQA 3H0CA 4LXIA 3H2HA 2HFJA 3GFFA 4MQMA 2RONA 2XLBA 5JYCA 1TCAA 2OXEA 3WK9A 4BBZA 2Y2UA 3D2CA 1WB6A 1CEXA 4G4IA 2C58A 2YYSA 2WILA 1DWQA 5BOVA 5ALTA 1BN6A 3NOXA 3WA7A 5LLSA 2QRUA 1YAHA 5ALWA 1EK1A 3GUUA 4DSZA 2CBGA 1W76A 3G9ZA 1IUNA 5K3FA 3F8SA 1EX9A 3H1BA 1YSCA 1IVYA 1B6GA 3R0VA 3WK8A 4Y2YA 1GPNA 5AM5A 1OILA 2GYVA 2VEOA 4INZA 1XZLA 3V1KA 3STXA 5AKGA 1QO9A 3R3YA 4DIUA 2CJPA 4QDOA 1TK3A 5ALNA 3E0XA 1E8MA 1IMJA 4LKOA 3LIIA 1XQVA 1ZI9A 2QS9A 5JIBA 2DHDA 3WL8A 3QPAA 5CH8A 4HS9A 4DYHA 5JD6A 3GELA 1MO2A 1MJ5A 3EIOA 4MYDA 3LS2A 1UKBA 2V96A 2Q0XA 1WM1A 3UUFA 5AOCA 2RGUA 3C6YA 2C0PA 4UHCA 1EINA 5FXMA 5LZ5A 4YASA 5ALJA 5EIEA 1U2EA 1P0IA 3I2GA 1E89A 1XROA 3CCCA 3WZLA 5LZ9A 1MNAA 1MX1A 1CUIA 2WU3A 3UUEA 3AUKA 2QOEA 2XQKA 2WTMA 4RE5A 3JYHA 1MU0A 4CFSA 4W9RA 1VE7A 3DNMA 3WK6A 1Y7IA 2XUHA 4AXBA 1EVEA 5LIPA 4PF1A 4EY6A 5CRIA 1FFAA 1BN7A 5BV7A 2DFPA 3KWJA 5HQ3B 3ANSA 4B9EA 1C7IA 1H22A 1F0NA 4G4GA 1ZJ5A 4W1PA 3EF3A 2W22A 4FMPA 4QEKA 4C01A 1SCKA 3HSSA 3JWEA 5ALZA 4NMWA 1BS9A 1UXOA 4ARAA 2BJHA 1DTEA 3B12A 4FOLA 3QZUA 2XMDA 4KE8A 1U65A 5CXUA 1HQDA 3R3UA 4BRSA 3C6BA 4K6GA 3PI6A 3A2NA 2FJPA 4DNPA 4Q1VA 2ACEA 4CIAA 4YK7A 3ZWQA 1QFSA 1XZIA 4E14A 3HABA 4X00A 3QMWA 4FKBA 1JT2A 5AK3A 4H7JA 1YB7A 3QM1A 3I2KA 4K6HA 1QZ3A 1U4NA 1LPNA 3F9CA 1JMYA 4OB8A 4OD0A 4UHHA 5AOBA 2C5FA 4HZGA 1K8QA 2W6CX 4F5ZA 2OGSA 1CUYA 2WSLA 1XRNA 5KWJA 4GI1A 4FNGA 3ESDA 1KEZA 5DLPA 4BAGA 5CT8A 2Z8XA 3G7NA 2XUGA 4B7ZA 3V1MA 4NS4A 4U2FA 3DD5A 1FFEA 2HA4A 3JW8A 1XQXA 4X6XA 4DNFA 1WPXA 1W4LA 4M0EA 1BROA 3ESBA 3HYSA 5ALSA 5D6OA 1AGYA 3I2FA 3TGLA 1QOZA 4ZV9A 1A7UA 2HL6A 2VA9A 3M81A 4DGQA 1JI3A 4Y2XA 4Y2JA 1QLWA 4EY4A 2BUCA 3H2GA 4FLMA 4L0CA 5AM1A 2HM7A 1BEEA 4GEGA 1CR6A 2CZQA 1XZFA 3FLEA 5FOQA 4MEAA 2Y1KA 2X76A 4JH0A 1H2XA 5J3JA 3PUIA 1RYYA 3WWOA 4MQLA 4BVLA 1C7JA 4UBMA 4ZI5A 4KYVA 1UKCA 3O4HA 1N5RA 2WIFA 1XRRA 1EH5A 4ROTA 5AIAA 3IUNA 5CBKA 3Q0TA 2H7YA 4BP8A 2IITA 5A62A 3NWOA 3BJRA 1R88A 4ZGBA 5CTAA 4UPDA 1Y7HA 4EUSA 2WHPA 4G9EA 3QPCA 2IX9A 4N8SA 1B41A 1O6FA 3CN9A 5D3KA 2QUAA 2GBFA 1CQWA 5SYNA 3G02A 4AO8A 5CT6A 4AZ0A 1VZ3A 1TQHA 3N0TA 3STWA 1XZKA 1CUZA 5AM2A 3ESAA 1WB4A 3G9UA 3O4IA 2AJBA 3S2ZA 3H17A 1EHYA 1YAJA 4QLOA 3B5EA 3FCXA 3OTQA 5HK8A 1LPOA 1LPBB 1XZHA 4O08A 1OCEA 4QNNA 2VJDA 2WIKA 4HTAA 4OU5A 4CG2A 2NW6A 5CXXA 2C7BA 5LZ7A 4KAJA 4Y2RA 2J4CA 3AINA 4A16A 2O2GA 4MWSA 2ZJFA 4L3WA 3DJYA 1UK7A 4BRZA 3I6MA 2OCIA 3FBWA 3R3VA 4NVRA 5AKKA 3DKKA 4E11A 2DR0A 5HKBA 1IZ7A 3WKEA 1O6GA 3H04A 5AIBA 4KR0A 2XUFA 4N5HX 3GZJA 2DQZA 4Q34A 1DQYA 1XRQA 3IULA 1VZ2A 4RPCA 4KRXA 3STTA 5CMLA 3G9TA 5AKZA 1TRHA 4BE4A 2C0QA 4X71A 3E1GA 2PU5A 1XZDA 3DOIA 2AXEA 4AX4A 4FFVA 2DQYA 4QA9A 3DDUA 4MXDA 4HRYA 3H18A 1HBJA 4C4YA 3FLBA 2X8BA 3ESCA 1RP1A 4U2DA 4LHEA 1R1DA 4UBNA 3SK0A 5DYTA 4M0MA 4MWTA 3AIKA 1JKMA 5ALLA 3BF7A 4J0DA 5CURA 2VSQA 2XQJA 5ALVA 2J3DA 1GQRA 4UFOA 2HADA 2G4LA 3WL5A 4OCZA 4IHAA 4HAIA 4DMHA 1TIBA 2XDWA 4AO7A 4H35A 3WK4A 3BE8A 3FSGD 3DYIA 2AJDA 3U0VA 3C6ZA 4J7AA 2XB6A 2QVBA 3DEAA 1A8UA 1VE6A 2BGRA 2WJ3A 2XUDA 1MN6A 4Y2SA 1MNQA 4ZREA 1GGVA 1QGED 2C4HA 2WG0A 5FKJA 1H2YA 2WFLA 1ZJ4A 3FVRA 2PSJA 4B0OA 5JAHA 5E4YA 2OAEA 5DYWA 3C5WP 4H7DA 4QWWA 4EZIA 4QZVA 1ZI6A 1GKLA 3M83A 1WCYA 1W75A 3A70A 4UBIA 4S0XA 4G8DA 4LXHA 2XI4A 2WHRA 5LP1A 2HA6A 1MX5A 4EBBA 2XUAA 5I8PA 1YASA 2ES4A 2HU7A 2PL5A 4OYYA 5T4FA 2VAVA 1W6RA 4Y7DA 2DSNA 3W04A 2J3QA 4LXGA 1UK6A 2I03A 2J4FA 2V97A 4BVKA 4X94A 5ALKA 1A88A 3A2LA 1MPXA 3VISA 3KOOA 5EHXA 1CUJA 4CI9A 3F97A 5JZ9A 3ANTA 3H19A 5JD4A 5T4BA 4XX1A 2XMGA 4FBMA 4GDMA 3V1LA 1E3QA 4P93A 4RGYA 1H2ZA 4XIIA 4X91A 1E8DA 3F96A 5FDFA 2Z5GA 2PSEA 4X95A 5HKAA 2V98A 3C8DA 3WYNA 1ORWA 2I78A 1GQSA 4PQEA 3Q8WA 3QMMA 3G0BA 1UFOA 2G5PA 1UT6A 2OQIA 5JZSA 4C4ZA 4BTVA 3OPMA 5DNVA 3FAKA 4AMZA 4Q05A 4BP9A 4QDXA 1XZMA 3GROA 4KE6A 1L7RA 2OGZA 4AQDA 1DWPA 4H0CA 1BRTA 4W1QA 5AK4A 4XWGA 3HACA 4X6UA 4CCYB 3I6ZA 1GXSA 4WY8A 1CUWA 1UKAA 2B20A 1G42A 1UOQA 2PKYX 4KAFA 4BTLA 3B3QA 3DLTA 1SOMA 5ALGA 4JYMA 3HZOA 1QO7A 1UOOA 3V48A 1DQZA 1QJ4A 3FLAA 4YPVA 3RARA 4B9AA 2FX5A 5AICA 1EDBA 2QM0A 3ILSA 4BDTA 5C81A 5FV4A 1VXOA 1D07A 3C45A 4UUQA 1VXRA 4C89A 1NU6A 1LPMA 4I3FA 1LZKA 4X90A 3F67A 5IH7A 2GBCA 5A7FA 5CT9A 1YR2A 3C70A 2P8SA 3KDAA 5K3BA 3BF8A 2WFLB 3BJMA 1SC9A 3D4LA 3WA6A 4X85A 4GHWA 2WUEA 3IUJA 4BVJA 3WL6A 5K3EA 3FWHA 3WKCA 1XLWA 4OU4A 3VJLA 1AKNA 4FDMA 1TCCA 3DQZA 1IUPA 4N5IX 1DX4A 1R50A 5AP9A 1K63A 3W06A 1P0MA 4QDZA 4XJVA 2YASA 2GBIA 1MAAA 5HQ3A 4Q3LA 1M33A 3I2HA 4ITVA 3WI7A 4PO3X 5AKJA 3WQHA 4WDQA 3M3DA 2WIGA 1ZI8A 2XMSA 3VXKA 4H18A 3WIBA 1DT3A 2WLSA 3AZOA 1Q83A 5FPQA 5C8ZA 2G5TA 1F0PA 1MX9A 4UFNA 4D9JA 4LYEA 1LPAB 4JYPA 1LPPA 3ZPXA 1SCIA 5AI0A 4C87A 5AKXA 1H2WA 1VKHA 1MT3A 5K3DA 4W63A 2WTNA 3AZQA 1HKHA 3A2MA 1F8UA 1CUBA 1HPLA 2PX6A 4LIPD 5HF8A 5AKHA 4B85A 2VTVA 4UHEA 5AI5A 3C87A 1QIFA 5IVHA 1EVQA 1CUFA 5AM4A 4AZ3A 5ALFA 3YASA 3IDAA 2VAXA 4X97A 3WLAA 2HFKA 3STVA 1AZWA 4J0HA 2VJCA 3ZLUA 4FBLA 2JF0A 1CVLA 4X6YA 2ROQA 3QVMA 3EQ8A 2WQZA 1XKLA 3WJ2A 3L1HA 2QR5A 2PUJA 1ODSA 5HK9A 3H2JA 4H77A 4CCWA 3E4DA 1XZBA 5C8XA 3BDIA 3L1JA 4V2IA 4FWBA 4B6GA 5ALEA 5IVDA 1UZAA 3W2TA 3IUMA 1YCDA 2WUDA 3IB3A 5CT4A 1AMNA 4G4JA 3D3NA 2VT7A 3K6KA 5ALIA 4KE7A 1ZGBA 4IO0A 4OSEA 2XUIA 3D2BA 1UK8A 3OG9A 1F6WA 1LLFA 3IURA 4AN0A 3DL4A 4X7BA 4DLNA 5KWIA 2XUJA 4EY7A 2ZSHA 3PF8A 4PNZA 5D3ZA 1CUUA 5ALRA 3WJ1A 1C4XA 3WZMA 1XRPA 1CLEA 3SWWA 5H3HA 1LGYA 5JAOA 4PSCA 2WHPB 5AKIA 5AM0A 3VDXA 1IZ8A 4JNCA 1S8OA 3DOHA 3S8YA 2WG2A 2I3ZA 2ZJ6A 4G8BA 1XZCA 3WK5A 2PBLA 5KREA 4OUKX 3C8HA 2VQ6A 5IVKA 2XLCA 2PSFA 3BL8A 4H7HA 1A8SA 3CXUA 4HXGA 4NZZA 2BUAA 2JGEA 3DKRA 1ZGCA 2GBGA 2JEZA 3R3XA 5AM3A 1USWA 5DYYA 5EI5A 2HDWA 1JMKC 2PSDA 4AO6A 2WHQA 1L7QA 4KE9A 1WB5A 3VKFA 4B84A 3R41A 5AK5A 1TCBA 3OURA 5ESRA 1BCRA 3C43A 4X93A 4CIBA 3U1TA 2QXTA 3FYUC 5EFZA 1CUVA 3I28A 1TKRA 3D0KA 5K3CA 3F98A 5ALUA 3WKAA 2WFMA 4FLFA 1N5MA 4ZRDA 2AJ8A 1E8NA 5CW2A 4UFPA 3AZPA 2G63A 2ZVDA 2PUHA 5D7BA 4UHDA 5ALOA 1PJAA 1Y37A 2DHCA 2WJ4A 3D2AA 1CUGA 4U2EA 1LZLA 3FYUA 3WWEA 4TVKA 3G0GA 4UBLA 1ZOIA 2WM2A 5AKLA 5T4HA 3FOBA 4BCCA 1ZD3A 5AI9A 5HF6A 1J2EA 2OCKA 4BYMA 2OG1A 2VT6A 5K3AA 2JGLA 4HVTA 1XRMA 4J03A 1VA4A 4Y9SA 1SFRA 4Y2UA 2XUOA 3WWCA 3HI4A 4UBKA 4H7IA 3MVEA 3V1NA 1JJBA 5AO9A 2WUGA 3STUA 4B82A 2EDCA 3PFBA 1AUOA 4H7EA 5K3FB 5AKEA 5JALA 4F60A 4U2GA 1CUAA 4GWLA 3EQ7A 1HL7A 4UHFA 1XRLA 1QIHA 3HEAA 3PFCA 3O9VA 5SYMA 1YA4A 5EIHA 1EI9A 1XQWA 1I6WA 4BC1A 5BWBA 1FJ2A 3NGMA 3BDVA 1UK9A 1DU4A 2BAGA 4C6HA 5DNUA 2BCEA 1XKTA 3WWDA 4Q3KA 2JGJA 3DYVA 2ONCA 1QIIA 3VVMA 1VA5A 2XUKA 3QITA 1EK2A 5ALDA 4IH9A 3LCRA 2JGKA 3RK4A 2JGFA 5ISMA 1G66A 4N8DA 4RNCA 5DTIA 5EGNA 1EB9A 2HU5A 1ZD2P 4J0JA 4TPKA 1QE3A 3DS8A 2O2IA 1A8QA 1E5TA 1FFBA 4WCVA 3STYA 1GKKA 4ZV7A 2JEYA 1CUEA 1W1IA 3PUHA 3IUQA 4QLAA 3LIPA 1CIJA 2FUKA 1ODCA 3O0DA 3HC7A 1Q0RA 3MGAA 4J0KA 4EHBA 1VLQA 5F4ZA 5BWCA 4WFKA 1CQZA 2QZPA 4QDTA 1RWQA 5CH5A 5JAUA 3HLKA 7YASA 1WOMA 4U2BA 5HFAA 4EY5A 1CUDA 5AJHA 1T2NA 3OC0A 3QPDA 2D0DA 2OQVA 2FJ0A 1XZGA 1W52X 1ETHA 1FFDA 4QE3A 3OM8A 3W05A 3L1IA 2QUBA 3A6ZA 4GXNA 1CV2A 4BAZA 3K9BA 4KEAA 3T4UA 3H1AA 5HCUA 4BE9A 3M82A 2XMZA 4OB6A 1BEZA 5LZ8A 1CUXA 2H7CA 1CRLA 2RAUA 5DWDA 4I19A 4KJXA 4B83A 3IBTA 3ICVA 3IVMA 5EHQA 1N8SA 4FLEA
chains in the Genus database with same CATH superfamily
4BMPB 1RQ2A 4ILKA 5JSQA 1E7QA 1OIXA 4DJ5X 4CG1A 1QIEA 1TA9A 4YMSA 4L8YA 1UEIA 2JLCA 3NNDA 4B6FA 1MPTA 4NCHA 4HPJB 1BX3A 3PQ2A 4L2IA 4ZFNA 3G8AA 4BO6A 2D5IA 2WWVD 2A4KA 1GNQA 4OQNA 3UK1A 3GGPA 3W9UA 1D3AA 2PPVA 2QTVA 4BLVA 5L53A 4J3JA 3IGFA 2WYIA 4GG1A 4YMUA 1GILA 2IDJA 3I9V1 4KP7A 4GLOA 4OHUA 1TJYA 5IKEA 1RXSA 1EFAA 1R6BX 3C3DA 4LXQA 1J21A 1CUHA 1NYTA 1PLJA 3H3JA 4RDHA 4UMVA 5E2AA 2XOKA 3ZKAA 1CBUA 3VNUA 2OYCA 3KHSA 3O92A 4IOJA 5EJFA 1F51E 2ZWOA 4TYQA 4NAVA 2FSGA 4CLOB 2G1AA 3BOSA 1NUQA 4NS1A 2V0NA 3CRQA 4H3HB 1MF7A 1NLFA 3PKZA 1QVZA 4QOGA 3GEHA 2ZB8A 5LBIA 4D9EA 2ZITA 4ZICA 3B1VA 2VH5R 4PBTA 4RD1A 1X6VA 1IPFA 3GFPA 3I76A 4ZIRB 3K72B 2C88A 4D3FA 1KHHA 4HP8A 4FC6A 4IRUB 4UZFA 4IF4A 1Q0ZA 4IIXA 1ULAA 2GKOA 3BS4A 2QKYA 1CUCA 3QE2A 2D7JA 1SGWA 2I3DA 3IUYA 4NPCA 3DTNA 3UG6A 1Z6YA 2EIXA 1J0EA 1PT7A 1XU9A 2RJOA 3IR6A 1K4KA 2HIHA 1Y4ZA 1QX3A 4XEHA 2FNAA 4NL4H 3ZXXA 1HE1C 2IH4A 2ZVPX 3H42B 3Q2IA 1KSGA 3USZA 2YQ5A 1KO7A 1XDBA 1HL3A 1RBYA 3ZTTA 3F2VA 1T2DA 1ZN8A 4EJSB 3I5AA 3NM6B 3U4DA 1JHXA 2VUHB 3VC3A 1YTLA 3IKMB 5C7YA 1RLMA 1X8LA 4UCQA 3AI7A 3LA6A 3M6XA 1N1MA 3TRKA 5EEGA 3WGQA 3U7GA 3O4GA 1CULC 1SC6A 2R6R1 3W77A 3CE9A 4MZDA 4G0VA 1M34E 3UAGA 2YDXA 3H86A 2A59A 5IJ0A 1W59A 1UUFA 2PM8A 4ZMRA 1KK3A 2HRCA 2Z30A 2NQ8A 2QUHA 2WABA 3A0RB 4KIWA 4J4HA 3VM6A 3SLGA 3P9NA 4C5BA 4G37A 3OZUA 3M8KA 1GZHB 3T0FA 5AW0A 1QCDA 2W83A 1D2HA 1RVV1 3EOBI 4QOEA 4EUHA 4RZQA 4M1ZA 1T5HX 1EFPA 2IZ7A 1TL7C 3TL6A 1J56A 4J7UA 3VVCA 5CR9A 3BHNA 3T5GA 1XWWA 1XE3A 5JD5A 1VI6A 3NB0A 4DA4A 3DLBA 4HLNA 4E33A 5EJ9A 1M2FA 3LJKA 1FXUA 1MA0A 1BMTA 3K4QA 2RHCA 2WMYA 3REOA 2J46A 2KM1A 1DB3A 1P9OA 2HHLA 4FB5A 4PFQA 5E1OA 3A37A 4M49A 5DISB 2P6MA 1RAIA 1KI3A 4QODA 3CONA 1SBTA 1O6ZA 1OAKA 2JIZD 1J1IA 2JJ1D 2PR7A 3ABIA 4LTNA 5AVJA 2P4EA 5CDSA 2DLDA 3PHGA 2R7LA 2XSZA 3A8TA 1Q3HA 4C0LA 3A3NA 2ONYA 4IOKA 1PK8A 2WM3A 3B82A 3SJAA 2FZ5A 1N2EA 2EFDB 5DTRA 1W1UA 1NMQA 2R4UA 4HMQA 2CFRA 1ZESA 4MA4A 1IJEA 1ENYA 2WSYB 4AS3A 2PZGA 2PT6A 1NX6A 4K6FA 4UOZA 2EHDA 3BZWA 1ZG3A 2B9EA 4UBOA 4KJZA 4OP3A 3RFCA 3ZVKA 2K2WA 4ZDJA 3Q8LA 1WPRA 2EL7A 4LJ5A 4BBAA 3OQJA 3ND7A 1H8HD 5IZ4A 3FGPA 1Z5PA 4QHYA 5IJ9B 4LPSA 4NNPA 5CVJA 1VHWA 5DN9A 4HAZA 1KU0A 2ZJ8A 3R0JA 3P4XA 4K2AA 4J0IA 4UCFA 3TXXA 2NYUA 3QE3A 4BV2A 3OZFA 3DO5A 1U4SA 2GS9A 3NHFA 1TMKA 5FTWA 2FEOA 2G1UA 4BP3A 5JCXA 2QJWA 2R8BA 3AOEA 1U3CA 4E08A 5CFQA 5I7SA 2ZT8A 3AM1A 1BGVA 1N5DA 4JP1A 4QHSA 2CNWD 2ZYSA 1BWPA 4JLNA 2JIDA 1N1EA 2RHWA 4AURA 2QP3A 1MZPA 3HFJA 3A9VA 5AW2A 2G7MC 4DR5B 3H4MA 4KQ1A 1E1MA 2YIVX 2ZIXB 1JU4A 1XHEA 3P9KA 4QL3A 4EEKA 3DSRA 3CRNA 3L7DA 3F5DA 2WU0A 3UJAA 2WJ6A 3PDJA 1C80A 2OV1A 3RSFA 4XD7D 1UMDB 4OMUA 1A9YA 1Y7PA 3SBXA 4J4BA 2B9VA 1IZYA 1SKQA 3WWPA 1PIWA 1BJRE 3MM4A 4FD3A 5A7GA 2WA1A 3PVZA 4M9ZA 3MWLA 1YS2X 2VJYA 3ZZNA 2ET6A 2ENUA 3UXEA 3ADCA 5GOTA 2X15A 4AMYA 4D97A 3AUTA 3LQKA 2H4JA 4CKZA 1MRNA 1YOVB 3KHTA 4MPDA 2WJGA 1NIJA 2Z5LA 3C1UA 1QIJA 3MCZA 3ETGA 3HYTA 4AC9A 3I2YX 1HYGA 2ERCA 1KWKA 2D5LA 3WVNA 4ASUD 2RG1A 3VKHA 2FF7A 3PQEA 1X1DA 2UVQA 2XVZA 2VF7A 3C5EA 3Q10A 3AHGA 4EA6A 2R8RA 2PZEA 2VK8A 4IOMA 3BQNB 3EWIA 3FJYA 1KO8A 1QDEA 5JVDB 1EVJA 1WW8A 1G5IA 5HF9A 2ZT5A 3TOCA 4DCGA 4BO4A 1A2KC 3PPXA 1QFMA 1SKUA 3V46A 4FYVA 3PGLA 4UKDA 5K03A 3TDNA 5K6TA 5BYAA 4G5XA 1V1JA 1G21E 1E9EA 3VSCA 2OO7A 3BVPA 5B37A 1WE2A 4PHFA 3OQMA 5EKDA 5THKA 2GYWA 3K6JA 2MR5A 4N40A 1ZISA 4KWEA 5LMCA 3PQ4A 1N92A 4KSCA 1CY0A 4W7HA 1R6VA 4YREA 2ZEJA 3P9YA 2HC9A 2NLOA 4KO8A 2XDQA 4MVJA 4IWNA 3IMGA 2B34A 4Q93A 4Z2YA 1VG8A 5SY4A 1H5NA 5FUYA 2GPYA 4ZAFA 2IVZA 2C5GA 3OAAD 3WIOA 2CHGA 2VDRB 3CIOA 2QN1A 3NT2A 5B58T 2FFBA 5HBRA 1I6MA 1DELA 3HYLA 1X74A 3ZVLA 2GKSA 5I7EA 1XDSA 4MWDA 2QLNA 1P19A 1DRVA 1ONBA 1L5ZA 1PN3A 2EDAA 2JJ8A 3V4VB 4NECA 1X7WB 2XGOA 4L76A 4BMXA 4ZMBA 2G36A 3L8DA 3ND9A 4U0JA 4YI3A 5KKAA 2W58A 2OAQ1 4Y2QA 3D6JA 4K46A 2WNSA 2JA1A 1T4CB 2KI5A 3OJOA 3SQNA 1W29A 3V4LA 5C2JB 2ECFA 2GZRA 1F20A 5E7QA 2QG9A 2SKCA 3AIMA 1Q15A 3LX6A 2H4HA 3QUTA 1XI2A 1VL1A 3CRMA 2Q9BA 3Q7RA 3BE5A 5IANA 1VG0B 3KZKA 4YR9A 1KZ9A 3QX8A 3R44A 4BV8A 4EPYA 4A27A 3U6BA 3RADC 2V6GA 4DV6B 1NLZA 1UBNA 1XUOA 3DEIA 3TQQA 1B43A 1GG8A 1JU3A 1Y34E 2EQBA 2GPBA 3ESRA 4Z2AA 3DKIA 4N41A 3DHVA 2I9KA 2ZRDA 1U5CA 1ZWKA 4MUMA 2WSSD 4XGIA 2WAOA 1GUDA 4GLJA 3K05A 3PNSA 1LF0A 2WUFA 4L0QA 2BGTA 1FXWA 1IVNA 1WXWA 2ZBDA 5EP4A 1F6BA 3TOVA 2J41A 1T29A 2A0UA 2BM1A 2OXFA 3OIVA 5F76A 4IGEA 4KC0A 2GPWA 3H6KA 3ITKA 3LCVB 4L2IB 4XVCA 1JQ5A 5IK2D 2W6QA 1LS1A 1HDOA 2BWJA 3GP5A 4FVTA 4Q19A 5CA1F 4YO7A 2X5OA 3NIFB 2CFTA 4KUEA 1YE3A 3JAKB 3UHFA 4Q5IA 2IE0A 3R3WA 1YBAA 2AR0A 2VVTA 2NPFA 4XVHA 3T1NA 5CA0B 3AVUA 5ALHA 2VNSA 4NZPA 1E6EA 3MCTA 3ZU2A 1CB0A 5FI5A 4UTRA 3KKEA 1R4MA 2VUIB 1TYDE 1AY0A 2DHEA 2ZPAA 1JG2A 3PE6A 3GJRA 3CCBA 4KR3A 1JEQB 3GJ0A 3LZCA 4M0PA 2C2XA 4RDIA 3TQIA 4RK5A 4KGVA 1ECFA 4DAEA 3IR7A 3NAMA 2JJ2A 2BEUA 1KAOA 3K2IA 1U8XX 2W6ID 2X4DA 1DV2A 2C9DA 1XMQB 1U0TA 2JI8A 4Y2TA 3IQHX 4TWAA 2M2IA 2EVWX 4WLNA 3S7TA 3QX3A 1FYFA 1R0KA 2PGXA 1JALA 1T26A 1WDKA 2AMLA 2AYZA 4QT0A 4UVEA 5K5EA 4KLAA 5EA2A 1RWKA 4M38A 2JA2A 3FCOA 4O2BB 3VJMA 4HUTA 3OMXA 1ZOOA 4IDCA 1CYEA 4BNMA 4F3RA 1X19A 3CF2A 4DABA 1DAIA 2GILA 1MB9A 2H2GA 1EGMB 5EPEA 3ROPA 4BFYA 3R5XA 1PV4A 2HUPA 1PUXA 4ZXFA 1JWAB 1ZGHA 3E05A 4JQCA 3Q8MA 2YY7A 3N8GA 2HJHA 4A5SA 2XB4A 2IS2A 2NTEA 2QIPA 1QDLB 4U9HS 5DASA 3S1AA 4LZPA 1WHSA 2MJLA 3NUZA 4JLMA 4D4MA 3CVVA 2RGCA 1JSLA 3FVWA 1D04A 4PQFA 1EA7A 3CVOA 5J5VA 2ISQA 3E23A 4BB9A 2PZKA 3NIWA 4HDOB 4DLYA 2JFUA 3EFEA 2XMBA 3GLRA 4NE7A 2RKWA 3OKFA 5CH3A 2JASA 1NRWA 2B1QA 5DP2A 4L50A 1PJ4A 3CNBA 1TM2A 2NTYC 1ADJA 1CEQA 4BIMA 3PA8A 3DCYA 3MTBA 1OFIA 3TAXA 2JGNA 3M4JA 2Y71A 3BQ9A 2ESRA 3CLTC 2E82A 3HJBA 3O2JA 4KFTA 3QMVA 2P2DA 3MJTA 3CPSA 3M4NA 3PFKA 2CYCA 5HZKA 5KVAA 1N7GA 2GK6A 4JBHA 2SICE 1PWHA 3S2GA 1AKVA 4O0MA 4OBBA 3IT2A 3TSZA 1NPYA 1I9GA 3W9SA 5C7IO 1TQ2A 1PG5A 3A6KA 1XJ0A 4LVOA 3NTOA 1Z6XA 2YZNA 2RGDA 1ES9A 1G7SA 1YR9A 3IA2A 1VPEA 3Q6NA 4PC1A 3SS7X 1COWA 2AN1A 3QFSA 4IIDA 5SZIA 2ZQZA 2ZS9A 3Q2KA 5KX5A 1QV9A 1JFRA 2OFFA 3FPHA 4OP1A 4F91B 1ZK3A 2QJRA 2VF8A 2JFBA 3TOZA 2OC9A 4NDZA 3ZWBA 1JYFA 1NXTA 4QKQA 2V5UA 1OLXA 5JNVA 2F64A 2C3UA 1KVUA 4RFSA 4A10A 3QYJA 3UHAA 4G1FA 4EYSA 3G2PA 5IXJA 1UPCA 1XNRB 2SCUA 3DL7A 2FWPA 2QRNA 3IEIA 3T7TA 4J9UE 2PEYA 3EEYA 3CLRD 5FAKA 4Q9LA 2XYVA 2W9XA 4TQ9A 2DQSA 4NDNE 1LC0A 5COQA 1WLSA 4S12A 3LW7A 1CHNA 1MRZA 2PVCA 1I4LD 3G49A 1BWRA 2KQUA 4FR0A 4CM5A 5JC8A 4HGYA 2BONA 5JPIA 1CHDA 3C3EA 3FYHA 2O7SA 1P2BA 2JVKA 3RT7A 1JVBA 4E0BA 4OLFA 1SQSA 2QI9F 4CQLA 2IW3A 4CM6A 1RQNA 1V5EA 4AKGA 4MH0R 2OB2A 1IN5A 2P79A 2Q8PA 4I4CA 5JWRA 3UCFA 4IRXA 4YCSA 3RS9A 2CN1A 2PG3A 1X2EA 1I2BA 1RLJA 4MUJA 3OHMA 4HQ0A 1SZJG 3W79A 2KLBA 3PWTA 5B1IA 2Q6VA 2VNKA 5JASA 3PRJA 4IJVA 5KC9A 3GD5A 1PV1A 2UZ3A 4DMKA 4TS3A 1CTQA 5L3VA 3FDFA 2Y05A 4IM7A 3VZQA 1Z63A 2ZT7A 2B61A 4UD2A 3ACBA 4OFWA 1DCFA 1E0JA 5JATA 4MO9A 3S5JA 3QE9Y 3TZLA 4KRGA 2Z8ZA 4TWJA 4O2BF 3CKYA 3E3AA 3TQFA 3KALA 2IU6A 3JZAA 3N07A 2F6RA 2IOYA 4MIYA 4YRTA 4NAHA 3GLVA 1P0PA 3ZHSA 1JDTA 1DDGA 3ROQA 2ZUWA 3NATA 1AC5A 3DAYA 1F38A 3RVDA 1GPKA 2JEOA 1IN6A 2O3SA 5HRAA 2OCLA 2PU7A 2IIVA 3IEPA 1NI5A 2X7JA 3IEUA 2YMLA 1R8SA 2Z8YM 4NBTA 5CLIA 1BX0A 4ZOBA 4Q00A 2XXBA 2H4FA 2I7VA 2AI3A 1PUJA 1TYEB 3HCBA 3U7JA 3AILA 1M76A 3OEED 3INTA 4QDJA 2VSYA 3CZ9A 4KG7A 3G79A 5LKAA 4IUDS 4FZVA 5G4KB 4GOND 3BXGA 5GZ3A 5CLJA 2QBYA 1J70A 1AB6A 2MSWA 1NR5A 1VHTA 3D0QA 4MTCA 4X44A 5EKSA 5F35A 5IAEA 3UAXA 3VTAA 4ZXPA 4K8OA 1WZNA 1Z2CA 3THYB 4XOIA 2C3YA 1LX6A 2CVPA 2H07A 1VKRA 1YNOA 2HA5A 2WKWA 4MICA 4EG5A 5FBLB 5BSWA 3QHQA 4TTAA 3TTYA 4UTPA 3H05A 3EX7C 2D59A 3RTEA 4UASA 3A1UA 3LP5A 4PV7A 4X1IB 4WV3A 1FSSA 3V9AA 1WZIA 1R9MA 3C98A 3E8XA 3JQFA 4LOJA 5EL0A 5I5GA 1UWVA 3NHBA 4L72A 2JBWA 2WMDA 5JMPA 1W36D 1NRJB 4II3A 2GHTA 2OL4A 3RAGA 4E2FA 3B6EA 2JLXA 1N3YA 2X7XA 1JJ7A 2OFWA 3COJA 3UBMA 2YHUA 2FZGA 3EEFA 3L7AA 3ZDXB 4LWOA 1J20A 2P6PA 4JVOA 3USES 2WIJA 1TMGE 1V4BA 2GZSA 4ZCPA 3HXKA 4YJGB 4C29A 4YCMA 1L5VA 2K2QB 1H66A 4ZOLA 4Q3OA 1TGYA 5LSAA 1TO6A 3HUFA 1SK9A 2HCRA 4MLDA 3AL3A 3FCAA 3IAS6 1HF3A 4M4SA 1RQ7A 2EEPA 3H1FA 5E1DA 1K66A 3FGZA 2CUTA 2K6GA 4CG0A 1NULA 2PMEA 3IPRA 1W5AA 5BPFA 1FFCA 3TTSA 1JZTA 4CF7A 4KHPB 3AIOA 5F1PA 4Y6SA 1VHLA 1PQPA 1VE3A 2Q3CA 2ZRPA 4G0YA 4M55A 1YA8A 1UOEA 4OGLA 3TW8A 4OSPA 3TZQA 1DJNA 4JEMA 4MVJP 4NC9A 3I23A 1ZIXA 3NBQA 5EERA 3VX4A 1Z83A 2ZRCA 3TX2A 3D0RA 3IQGX 1Q1GA 5L3RA 4E5UA 3T3PB 1WUKS 4QXQA 1YUMA 4RLHA 2I6SA 2VRCD 4N5DA 4PCUA 2XGSA 2CFSA 3QLTA 3WLMA 3IV9A 4AZTA 3THYA 2P2LA 4OB7A 3SR4A 3U44B 2O20A 1J2JA 1TNDA 4HS4A 2XQFA 1F5NA 3U3OA 1BSVA 2VR1A 4Y9UA 4F21A 1NN3A 2ZWPA 4K9DA 4O02B 4DG5A 3F6RA 3ASZA 4EHNA 4EA7A 5IYZA 4TVSA 1JGTA 1CR2A 1Z45A 3PEFA 1WVGA 3R20A 3TD6A 3TIIA 5A0VA 1L5GB 3KETA 1HOXA 1C7QA 3Q3EA 2JZCA 3L92A 3FMVA 5IPFA 4UUPA 3H99A 1CY8A 3GCZA 2Z3WA 4M22A 4C4PA 2Z8YA 1JAYA 4MUXA 4PYKA 2J3MA 1IK4A 4QRDA 5BQFA 4V3BA 5M5BA 2VXBA 3WRXA 1H0KA 3AJ9A 4LZAA 2BD0A 1YIOA 3CX3A 4QBFA 3UJ9A 3ZJYA 3RBAA 3IAHA 3HO8A 2Q5CA 1FQOA 4JS0A 1PJLA 1Z0FA 1U1DA 3CMCO 5KX5B 1N5JA 1E9AA 3DCNA 5AKYA 3L0YA 1POWA 1G4AE 5FWYA 4D56A 2J85A 3R6LA 1U9IA 1D4FA 4DRXA 5CDUA 3LHIA 3GFSA 5L4LA 5IARA 3HSYA 3DV9A 1E1YA 4YP5A 1R6UA 3GFBA 4UZEA 1KYVA 3L93A 4XDZA 2VDJA 1LBHA 4N7RA 3GFFA 1OAOA 5H16A 4DS3A 4MHSA 5IM4F 3C5CA 3THXB 1XDWA 2LWIA 1KVRA 1R8XA 5A5FA 3KSAC 1L7DA 1W0KA 4P38A 2OCDA 2DR3A 5TF0A 1D0SA 1PTJC 4NONA 9LDTA 2PGDA 3LUPA 5KPDA 4IDGA 2HPAA 1P45A 3D2CA 3EYWA 4I5GA 4R3UC 4YMTA 3EMKA 4HNAA 2Z9DA 3KQYA 2DXIA 1YVEI 2H31A 1KJYA 2VLBA 1JIUA 2C58A 4JKYA 3UXMA 3IMKA 1R5JA 2OFOA 1DWQA 2BL4A 3DOUA 5ALTA 5SZHB 2PE5A 3UJ7A 1R0YA 4XYMA 4OGKA 3W78A 5JEDA 3TX6A 2C92A 2GAIA 1H93A 2R1VA 2R7NA 5LLSA 3E8MA 1U7TA 1YAHA 2F55A 3IKLA 3U4MA 1Z2EA 1EK1A 4JVLA 3EDCA 2FLVA 1G38A 1H9AA 4XW2A 1IUNA 5K3FA 2GBLC 5H9WA 3TZCA 1L4NA 1I7NA 3LDUA 4TKVA 5HZHA 1FUYB 1Y1KE 2WAYA 2X7HA 3T5PA 2ZYVX 3A1EA 1A4XA 2QORA 3MBKA 1R8JA 5IBQA 1IVYA 1SB9A 3WK8A 2ACWA 3FHJA 5CDTA 2BLNA 4OGWA 4EKGA 5JEEA 3QXSA 4D4JA 2ZIAA 4LBVA 2O50A 3WSWA 1G8PA 1BZYA 3SFVA 1YZ3A 2ZUDA 3EVDA 3QF7A 4PC6A 1WO8A 1GYRA 1CSEE 1R2QA 5DCUA 5AUNB 1F2UB 1NZFA 1QO9A 3R3YA 1GFIA 2ON6A 3R76A 1TK3A 5TGTA 4MKGA 1WCV1 1LFAA 4PS1A 5ALNA 2VYND 3K0CA 4BO3A 2F59A 3CNQS 4HEHA 2JLWA 3FCUB 5KB3A 1IMJA 4LKOA 2ZUTA 2PWYA 4AJPA 1E7MA 1N2GA 1XQVA 4LQCA 3GMTA 3NTLA 1KJ8A 3KZ1E 4JWTA 4WJZA 4FM9A 4QECA 4U3JB 5K8CA 5DNCA 2BBOA 1A76A 1SKYE 2QUIA 4K9PA 1HEIA 3SP1A 4DCJA 3OD5A 3GELA 1MO2A 3B36A 2F7SA 3M0EA 2W43A 4WOCA 2QVYX 3SQXA 5AWFC 1QGUA 1BW9B 2YC2C 3E81A 3SC6A 3AVTA 5K6AC 4MYDA 3D43A 3FGOA 3M4YA 1WUTA 1RHKA 1PX2A 1UP4A 2IDZA 2G8NA 3MSXA 3PLNA 2V7QD 3QGMA 2P75A 4L0DA 4XGRA 5H80A 1O0BA 4MA0A 4EGCB 5AOCA 3DVAB 1WXQA 2NGRA 1HWYA 1U1GA 2C0PA 2CK3D 1TZKA 3MW8A 3WXMA 5BR1A 2W00A 4F11A 4QNMA 5G0VA 3FH0A 4FJ2A 2IYEA 4YXWA 3ZI4A 1L3BA 5H0IA 5EIEA 1T36A 4FFLA 2NP6A 2IC5A 4YHBA 3QX9A 5FA8A 5JS7A 3ACDA 2IHJA 3A27A 1LF5A 1YJXA 3L7BA 4KW7A 2R97A 4EAQA 3T15A 2PLRA 2QL5A 5TVKA 2F8MA 5EZYB 1ID8A 3DFUA 1QORA 3WJ7A 2FPGB 1MQ9A 1OF1A 1M5RA 5KVCA 3AUKA 2ZBEA 4Q7LA 2JIRA 2WKPA 2VSOA 5IC5A 4BIIA 4RIFA 3A14A 1BJTA 3VUFA 2JFOA 4BQFA 1WULS 1M75A 3Q9UA 4DJJA 3FCSB 1V45E 3OT5A 2QMYA 2JJQA 2VWHA 4R1MA 1MU0A 5CEJA 2CXUA 4FX2A 5HVNA 3LUFA 3W2GA 3U5ZB 3WK6A 1ZCJA 3BGOS 4ZVPA 3NGLA 1NOIA 1YR1A 4RQAA 4D96A 2MYPA 1M2VB 1Z34A 4UUOA 4XE5A 2FWJA 4DV0B 3CTPA 5BSHA 1EVEA 4GI3A 1KBQA 1MTOA 5LJLA 5A1JA 2YRFA 3TQTA 2QNIA 4AECA 1XTQA 3ICPA 1Q22A 1C1HA 3CG4A 1L5RA 5IDVA 4TT8A 3VRHA 2PH5A 2QAIA 4R6XA 3KWJA 5FWXA 1U9ZA 8GPBA 1A8PA 1GU0A 5HQ3B 1P81A 4OATA 1E0KA 1QLJA 1X14A 3EHDA 5C34B 1XB2A 3EPJA 1F7UA 3IOYA 3L7LA 3RVNA 4CL0A 3LPDA 4G4GA 3EWNA 3L3BA 2ZIZA 4D9KA 1YI1A 4I7EA 4A0HA 2X6QA 3ZDRA 4EMBA 2XWPA 4MARA 3O1IC 3ER9A 1Y48E 2ZSBA 1RRGA 5BNTA 4YT5A 2F1IA 1SCKA 4G5FA 3IPCA 1ATIA 1I13A 2P67A 2H3EA 4JSRA 1C3XA 2INGX 4XSGA 5K7SA 1YZLA 1G59A 3DQPA 3I37X 5EOVA 1P1JA 4URYR 4Q1BA 1NE2A 1DTEA 4R2KA 4B3FX 2IODA 3B12A 3ZKWA 4E2YA 3GZ4A 3IE0A 1Y9DA 2DP4E 1JFLA 2R60A 2ZDGA 3I1JA 1UBTS 4IL5A 5GP1A 3PNLA 4DQVA 1RXYA 3IVAA 4QFDA 4KE8A 4ZO6A 2D6FA 4Q4AB 1S02A 4M54A 1XA4A 2EFCB 3LX8A 3R3UA 4ZA2A 1QG0A 5BV1A 5FNVB 3ZCQA 3GK3A 3PI6A 3PPWA 2FJPA 3IBSA 4OAQA 4DNPA 3MTIA 2XCUA 3RTGA 5EKXA 4HNRA 5CB0A 2ZCJA 2QYOA 1SXJA 4CIAA 2ZRBA 4BX2A 4D6YA 3JATB 3GRKA 4UE6A 5HP4A 3BGVA 3RASA 2GPNA 4B6RA 1C4OA 1XZIA 2O05A 4E14A 4J7CA 2BZ0A 1KQOA 2ADFA 3QMWA 4ZJYA 4FKBA 1XCLA 4JUAA 4ARUA 3L18A 3WRVA 1JT2A 5AK3A 1E2PA 2GPAA 4DEYA 1ZBDA 4PYOA 3I2KA 4HCJA 2CVZA 2O1XA 4Q01A 3O2SB 1QZ3A 1U4NA 4J6EA 2OZKA 3TSAA 2PA3A 1NVVR 2LKCA 2H17A 4OD0A 1N6NA 1JYEA 4Q7KA 1E4OA 2DLNA 3M1AA 3HPRA 1PJCA 3NZEA 1RHJA 4GMKA 2WA2A 3DE5X 2GH1A 2W6CX 3LGXA 4ER3A 4H60A 4F5ZA 4N5LA 2OGSA 2A86A 3EW9A 3KV1A 3I9NA 5ICMA 2ACVA 1GVNB 1WAMA 3WMEA 3OCJA 2W2PA 3OJLA 1NM5C 4HB4A 3R8CA 5KWJA 3H8JA 1C30B 3UJ3X 1PJZA 4FNGA 1E1NA 1JPUA 4R81A 4CMJA 2YYZA 4DA9A 6PFKA 5GADl 2A5DA 4OJKA 2FR0A 1E79A 5D51S 5KQRA 1U98A 4HZUB 2SKDA 3MOGA 4QJ3A 1O9BA 4QQFA 5FADA 4EW1A 5CFOA 1HA3A 4PFKA 3TM5A 1E7WA 3RRMA 3VZRA 1IWBB 1I1HA 1D7OA 1W4BA 5AJTA 4D79A 4NG5A 4JT8A 1QFYA 4UU8A 1M66A 3MS7A 3RHZA 1C7EA 2V7VA 1TAGA 1XQXA 4I50B 5IM5A 3RTDA 3VZPA 1RAHA 3GJTA 2MMGA 1IZZA 1YDEA 1Z08A 1SUFA 2D8AA 4OJQA 5A4MS 2VJMA 5F9HA 2GOYA 5IYZB 3BSFA 1UEJA 1QQ7A 1U2DA 4Y2GA 2Q1YA 3QW2A 1W4LA 2QUJA 2XTZA 4IOLA 4OF4A 3ESBA 4KH1A 4FFNA 4PWYA 5TJHA 1MD9A 1V43A 4MCIA 1ZRMA 1YMQA 5ALSA 3TDMA 1NR7A 1X7WA 2AGVA 2WF7A 2P27A 3RFXA 4C08A 1EFDN 2B4YA 3OBIA 2WHXA 4FI3F 5CPFA 5D6OA 5JRJA 2FZVA 3PXCX 2H52A 3PUXA 3CF0A 2FP3A 2QDKA 4HN4B 4KWIA 2XADA 1D7AA 1A7UA 1E63A 3DB1A 5I8WA 4O4IA 3ZQUA 2VA9A 1N3LA 4YDRA 1L1EA 2Q5JA 4I5IA 3PKJA 4N48A 4X84A 2HWKA 2J6IA 3DWIA 2VDLB 3P2IA 4XVRA 1O2DA 2I1QA 4TM8A 4XJXA 2BUCA 3NVMB 4EY4A 3LBYA 3I5XA 3K73O 4DDVA 1BEEA 1TDJA 2CZQA 1XZFA 1V1MB 3B1KA 1B2RA 3OE4A 2HQOA 3Q3VA 3RBZA 4AZWA 4Z54A 2R1VB 3QYFA 2Q1WA 3CPJB 2CLCX 4F6RB 2MTBA 1F2TB 1EHCA 4AULA 2VIIA 1EIWA 1G16A 1C7JA 4KO3S 5CA1A 3Q41A 3KKKA 2FK7A 1NF9A 2EP7A 1UKCA 1OD6A 1XNHA 3EGCA 1SU8A 3O4HA 4IJWA 4JUFA 7ADHA 1Z7YA 2TECE 3GQBB 4PLVA 4KZKA 1MVOA 1TPZA 1PR0A 1G2QA 4NY1A 4ARZB 4BEWA 5BSVA 2W2KA 3GOQA 5KAPA 4M99A 5AIAA 4KXNA 3RWBA 3SHVA 1G7RA 1M6HA 3OZIA 3AH8A 2QD2A 3CHYA 3PTZA 5ERGB 4EZEA 2K7FA 3L6CA 2ZRFA 3M9XA 4FONA 4Y18A 1A1SA 3UK2A 5EXDA 4BEVA 1YRLA 1J00A 2AF4C 2IITA 3O3OB 5FWAA 5A62A 4IZ6A 3N0XA 1V4NA 1R88A 3DEJA 3CG0A 4GAEA 4ZGBA 1QHIA 2NU8A 3VR2A 3P0EA 3U3MA 2Q1TA 4PAOA 1P6QA 5AVTA 3H5VA 1YE5A 2YS7A 3NDRA 1EUDA 2M1XA 5J4KA 1NF8A 2FU5C 3QPCA 4GBMA 2DVMA 2P1RA 4U3JA 4ENQA 4MMXB 3DXZA 4BV3A 3DFKA 1FNNA 1T0IA 1D5WA 3BSSA 3Q3IA 2HDOA 3N7AA 3CN9A 4G0ZA 1A2OA 4KO2S 3THRA 2QUAA 2GBFA 4KQXA 3PNOA 5SYNA 2FRDA 4AO8A 1XTIA 2ZDHA 2QXYA 1F2UA 2Y0DA 3OY7A 3AF0A 4TVOA 3FUTA 3FTQA 5C4MA 1VM6A 3U3KA 3TWOA 4JR2A 2A0WA 1XZKA 4M7OA 1Z2PX 2AW5A 4B4WA 4I8IA 4RVGA 5AM2A 1WB4A 4DREA 4QAQA 3WIVA 2UZAA 2PLAA 2QGFA 1RWXA 1JF8A 3E3OA 3NKLA 4GM1A 4LE0A 2WDZA 4MINA 3TF5A 4NYMQ 4YJFB 3VU9B 3ZIUA 3KUUA 2EEZA 2AW3A 1NVAA 2ZIEA 4P7BA 4U7TB 3S2ZA 3GLIE 3NKFA 4KHZA 4J7XA 4URWR 3RNLA 1CQXA 1Z33A 1BMFD 5AHKA 3FHOA 4QLOA 2Y93A 2A5YB 1DRWA 2O2CA 1JI0A 3FCXA 3ZWAA 4Z1MD 1XZHA 2AFRA 4L8FA 3A7EA 5F23A 2WYVA 3TMYA 3FWKA 1E5XA 3PD0A 4QYSA 3UA3A 2F3TA 4Z1OA 3NP7A 4Q3DA 3E9ZA 4EHAA 4QNNA 3OQIA 4FDVA 1IQ0A 3ZWNA 5EZ5A 4HTAA 1NRIA 4KGDA 4UEJA 4Y6GB 4RVSA 3DOCA 5DX0A 5LP6C 5K0FA 2ZBQA 1RJEA 2C7BA 2HLDD 3CSUA 3LX4A 3EPHA 2A3NA 3E82A 3ZEIA 4KAJA 4GXRA 4G56A 4AROA 2J4CA 4NFYA 3AINA 3PL1A 3OQVA 3SR0A 4X65B 2FJUA 4ZODA 2W2QA 2RB5A 5JDIC 2BDTA 4DBLE 2VP0A 1PYOA 2PCJA 3DE3X 3KTOA 4RCVA 1A9XA 1Y3DE 4YRRA 1C14A 3OEWA 1P2TA 1UJBA 1ZNWA 2PGOA 3KOXA 4MUYA 2FPGA 4R2IA 1FBNA 4G5GA 5A9RA 2YHBA 2Z5VA 1R10A 3L7MA 5HXAA 3KQUA 2V7QA 3P2JA 3F46A 1TU3A 4DB4A 1E3SA 4D4IA 2HCTA 1IZ0A 2JH3A 3AG5A 3GMDA 4OQLA 4QGBA 3LXXA 1AXEA 5H70A 4DMUB 4X1YB 3BTUA 3B2QA 4ID3A 2DSTA 1O6GA 2IYWA 4KBFA 5FBHA 3T7SA 1KARA 3VZCA 3HU2A 3ZBUA 3ZDZB 2BTOA 1ZVKA 1DC4A 1ULHA 3ZOKA 2JK1A 4R05A 4NH4A 1IDOA 3QNUA 5CNJA 4UUBA 4LC1A 2JFHA 4N5HX 1X80A 2N75A 4HFMA 2F67A 5KMGA 1J2RA 2FOXA 1SCAA 4FIDA 3P2OA 4PZDA 2ZUEA 4OQFA 2OHIA 3RC9A 1NMYA 2BJVA 3EFOA 3F6SA 4X20A 3DBLB 5KYWB 1CJKC 1G2PA 4UM7A 1FQKA 3Q9LA 3STTA 1Y1RA 1GQFA 1SRQA 3G9TA 5GWXA 5HGXA 3AKZA 1N34B 2P4SA 4CUZA 3PLRA 2I2BA 3TBKA 4ZOQI 3TLMA 2ASEA 1PR4A 2GEFA 4GE0A 1ZIPA 6CHYA 1NNLA 2G72A 2V3WA 4CODB 1TRHA 4DZRA 2OO5C 4BE4A 1OB5A 4H1VA 4UHKA 1T1SA 1FQWA 1RLTA 1XZDA 1SU7A 3T8YA 4CDNA 1MV5A 1PVVA 1R37A 3DOIA 4ZCLA 2N9UA 1YJAA 2AXEA 3O7MA 2C94A 1RI2A 1OT3A 3NWJA 4XWKA 2IU3A 2JARA 3HN7A 2FAXA 2FH5B 2PANA 4QA9A 5EWJB 3G3EA 5TQ2B 3X1JA 1ORHA 3UC5A 4BNVA 5L3ZA 4URXR 3CVYA 1N77A 1Y42X 1C0EA 1LCIA 5EP1A 4BB5A 1ZR2A 1RJWA 4HRYA 3NHPA 1USIA 4J2TA 2ZAYA 1AKUA 1C3JA 3PJEA 1WMSA 4C4YA 3ES9A 2DECA 4Q4DA 1BE8A 2X8BA 3ESCA 3RG8A 1B8PA 1RP1A 2CCKA 2ZLBA 4U2DA 5EUCA 4Q7QA 4EBFA 2QY6A 4NULA 4FMCF 5IJZA 2CC2A 1FSPA 4QPJC 1QH0A 4HAYA 1Y5MA 3EGEA 4P4LA 4M0MA 5DGCA 5DYTA 1M2OB 5G1OA 3UAVA 2C4MA 4BGIA 3H16A 1JKMA 2ATCA 3GVHA 3KZMA 2G5CA 1QZZA 1A7JA 1FTGA 3EH2A 2JKZA 4KDRA 1MLDA 4DY4A 3J7AC 4XUEA 3A36A 1RC1A 2XQJA 4BUZA 4TLMB 3B1ZA 4UFOA 3LVQE 4JMLA 1YJQA 2G4LA 3P0RA 3TUIC 3VHLB 4BFUA 4OCZA 2EOAA 1KDTA 4IHAA 1I4TD 3KZNA 4KKXB 4NCXA 3UV6A 1RRPA 4O4JF 1H8HA 4KPUB 1RLIA 4IV5A 2XDWA 4FNOA 3A9SA 1DAMA 3HBMA 3G8DA 4XYGA 3QU4A 1JQAA 2D62A 3KOMA 4Z9AA 2E4AA 2XCTB 1DSSG 3BE8A 3DXFA 3QJYA 4D0RA 3K4HA 3C6ZA 1T9ZA 1Z5GA 1P74A 2ZU6A 4J7AA 1JEQA 5EMHA 4K9RA 1GGHA 4KAXA 4AICA 4YN3A 3H13A 5FF9A 2VHCA 3BG5A 3V6LA 1YS9A 4TRMA 1F4VA 2A2ZA 3BX1A 1JPNA 1K7FB 1TUBA 2XSZD 1F06A 1K06A 2AL7A 3AFOA 4F2WA 3QVUA 2BGRA 3L4JA 2PX5A 3OF5A 4DIBA 1UAAA 2ZSKA 1MN6A 1L6IA 2HXGA 3FMGA 3GLKA 2JJYA 3R0QA 1IRXA 1QFJA 5H3CA 3EWAA 2RKOA 4YEDA 1QGED 4GGPA 2VO1A 3NHRA 1NL3A 1SBNE 2V6FA 1FNSA 3PC8C 2GUGA 2PH7A 2F9LA 3PNBA 3R0XA 2Y1OA 4I1IA 4XUCA 1UPBA 2YV2A 4IIGA 3W2IA 3BFVA 2OYRA 1E2KA 5LA6F 1VDZA 2RHBA 4PLYA 1JLKA 5E4YA 4ND1A 1OGJA 2OAEA 4PG8A 2C4UA 5DN6D 4NFLA 1T8PA 1J1ZA 5DOZA 2HJVA 3C3YA 4MHTA 3AVWA 4WHMA 1PL6A 2Z57A 1X86B 2ZRJA 1YDMA 3FSJX 1WCYA 1S7CA 2IPAB 1PQ4A 2Y3IA 4RPGA 4YUZA 4YWHA 3SF0A 1JA0A 4WD3A 1ZUWA 3B7GA 4U39A 4XSHA 4LY6A 1KBZA 3CEAA 1MX5A 2IXGA 3C8UA 3TCXB 4Z4QA 3BAZA 3TLEA 3ELYA 1ECGA 2O7QA 1U04A 1V96A 2RHMA 4LTDA 1AT1A 4INOA 1U8ZA 1YASA 2ES4A 1WKBA 4OYYA 5T4FA 4CWAA 2R6JA 2ZANA 3DDWA 1FLVA 1W6RA 3DFZA 4WLFA 1LVGA 4N7MA 2PMDA 4BV9A 2O2SA 3CKKA 4FD2A 2X8AA 5CDGA 3W04A 4NCAA 4ZAWA 5ECDA 4CL2A 3KJHA 2J3QA 2R00C 1HE8B 5CVCA 3GQVA 3NDIA 2J4FA 1U28A 2V97A 3DOFA 2YRXA 2ZYDA 3H0KA 3W8DA 4EUFA 4Z6KA 3B51X 3N74A 1VYHA 1H9BA 4KYIB 3FPKA 5ALKA 1ONSA 2C57A 4GP9A 4G0XA 3U37A 4QJ4A 5JQGA 1YHYA 4HC4A 3IDQA 4QPPA 5LM3A 4S1TA 4IHJB 3OUUA 4P0QB 2D06A 1Z5NA 4D25A 2QSUA 3L02A 4IQ0A 2DPYA 2Y9PB 3O8NA 4QVKA 3WMWA 2C04A 4KVFA 1CUJA 4CI9A 1Q1QA 2BEVB 2FP4A 3LNCA 3H19A 1KDRA 2D1SA 5K45A 3GJXC 2ZCUA 1YGPA 5DBIA 3NYQA 1BNCA 2UYCA 4Z4HA 1OFVA 3DZ8A 4CN9A 1QUEA 2ALJA 4I6JA 4ZD6A 2C5BA 2QX6A 3OC6A 3T95A 5KYXA 2HMTA 4P93A 2W6ZA 1UC8A 4WK0B 2PO7A 5FQOA 4LFAB 1GAXA 1U3GA 4MDFA 5C1BA 5F5NA 4UATA 5MGNA 1XR3A 1XCMA 2EP5A 3AONB 3RIMA 4CTMA 2O8NA 1YV9A 1NKSA 5ADHA 5BYJA 2YR0A 5GM2A 3SVTA 1SVMA 1XPOA 3TZHA 5J4HA 5BUSA 1SWVA 4MRRA 4KFUA 4Y6PA 1EK0A 2HR1A 4MVYA 1NVMB 1ZEMA 4Q24A 4R0NA 5JTUA 1AO3A 4BLQA 3FLMA 2XCRB 3LVBA 3C8DA 3WYNA 2OT3B 5FWDA 1OWMA 1DWUA 1ORWA 4FGZA 4W5JA 2QGNA 2YWJA 4HQRA 5DHAA 5F2KA 3RSGA 3WGJA 4DLTA 1EFRD 1DNPA 5IP5A 1XLTC 3DE4X 3N2IA 4GSLA 4CQLB 5FD8A 1JX6A 3L06A 3QMMA 5KTKA 4I36A 4ANFA 1SUPA 4C4ZA 4WRRA 4BTVA 1CS4C 2CYBA 1SBHA 1W2HA 1ZA2A 1SUCA 3UC9A 3NXSA 3SZLA 3HDTA 3M1LA 2ZIWB 2PWPA 4A1FA 3X1YA 3FFBA 2QT0A 3T9CA 3ZJ5A 2FLKA 2QN2A 2YNMD 2B8EA 5KNDA 1JV2B 4LDQA 4XKJA 2C42A 3PDUA 3GROA 4EVQA 1GTVA 2W11A 1JHPA 3KT8A 3PX3A 4YC7A 2BIFA 3AHDA 4AQDA 2AI1A 1IN4A 5F21A 2FPXA 4H0CA 4F93B 3CLVA 2DTDA 4GF5A 5JNWA 5DN6A 2ZAMA 3HACA 2BEVA 2FP4B 3IODA 2FG7C 4CCYB 4JWKA 1V8ZA 2VXYA 4KVAA 4MLPA 5CU7A 2PIAA 3LBHA 1U3DA 2JLRA 2HMVA 4FR5A 4Q9IA 5DNEA 3UATA 1D6JA 1GXSA 4P83A 4WY8A 4HDMB 2AC7A 1CUWA 1I2AA 1AF7A 3WGOA 2WD9A 1L5HA 1TO1E 3BORA 3RB8A 2OFPA 1OZFA 4DVGA 1SK8A 2GFHA 1E9BA 3DLTA 3W5AA 3ZH9B 4NJMA 1J99A 4A0FA 3KOWA 4O5OA 2D2FA 4ZU6X 9ATCA 4LOAA 4EFMA 1X1AA 2NZJA 4OHOA 5L8VA 1A8HA 2YQ4A 1DZIA 3NW9A 2FW8A 1P2SA 4KK4A 3C39A 2AFIA 1UOOA 4TL6A 3TTXA 4AQYB 1QJ4A 1ZM9A 4WESA 1TUGA 3QOFA 1IJFA 1CF9A 1QG6A 1R9GA 2YZKA 3FNHA 3N5CA 3OWXA 5B3KA 4IXNA 4JYCA 1YU9A 1IY8A 4DZTA 2QM0A 4Y1GA 5C81A 1VXOA 3LK7A 2XTNA 5BR8B 1D07A 2OV3A 4GC9A 4P5EA 2X1VA 4WA8A 1JHOA 5JRZA 1N6HA 4AI6A 4CLXA 3AKEA 1LXCA 1LPMA 1NVUQ 3V2IA 4EENA 2GZ1A 2QP9X 3QUQA 1P4SA 3ZYZA 1F8GA 4IICA 1KQ3A 3AFGA 4HLQB 1OI3A 1JG6A 2VP5A 2Z98A 2W93A 10MHA 3ZY4A 1PZXA 3BTSA 3RT1A 4B34A 4BLTA 3C70A 5CT9A 3REFA 1XAHA 3HLYA 3BXZA 4FYHA 3TM4A 3V55A 5IT4A 4QRHA 1QK3A 2VCYA 3RNOA 1HKUA 2G0TA 4LYFA 2E4XA 2PZBA 3EARA 3LOPA 2P69A 4FFOA 3D4LA 4G81A 1I4DD 2GAOA 4MQFB 3TUZC 3AL2A 1GV1A 2ID4A 5LVAA 2GAAA 1UT8A 1HFKA 2A92A 2Q3DA 1YC2A 3C3BA 1DKOA 1XRSB 2CLMB 4M8LA 2FVYA 4MGHA 1RC8A 2JAWA 1ISSA 4EG6A 3K7EA 1O5TA 2ZTLA 2I87A 3VQTA 4BVJA 5K3EA 4C4RA 2F4NA 1HY3A 2GWHA 1VYTA 3A11A 3IH5A 4LV5B 4OXKA 1XLWA 2MSNA 1M0TA 4YMLA 4LBZA 5DSTA 5GV8A 5IAGA 1RI3A 5I4CA 3ZX5A 3KEGA 2UZIR 4EECA 5FUQA 3OJEA 1Z16A 1TVKB 3VR5H 2GARA 3S44A 4QATA 3P52A 4OGGA 3BRSA 4RZUA 4OHCA 3ISJA 2H1OA 1GKYA 2E7ZA 2PBZA 3IERA 4LDAA 2H00A 4XJVA 4NFHA 1GCIA 5L4SA 1ANKA 1KJZA 3T3HA 4IS2A 3KSDO 4YFVA 4NV1A 4UNPA 4WZ6A 1CD5A 1KYYA 3V2UA 3W0LB 3QPBA 1FZQA 1UBEA 2QRKA 2QTRA 4PLPA 4DIDA 2VSXA 4H17A 1V5IA 3Q85A 3QEJA 4YUWA 3LT2A 3EZXA 1CK4A 1RYMA 3AR4A 2YRWA 3PJRA 1E3WB 4C0WA 1AG9A 1EP2B 1O0SA 1E2FA 1M54A 1N7IA 2AD1A 4P86A 2NSJA 4YP1A 4F4DA 1ACMA 2CCGA 4RXTA 4IQGA 3M3DA 2AFVA 2WJAA 4IDOA 1ZI8A 4EFNA 4DLKA 4BEJA 4G5SA 1JAXA 4RHXA 2AOVA 5D8DA 3RODA 5AW8A 2IZ1A 4CIWA 1CE8B 3DFFA 3RRYA 3EASA 3V42A 1T25A 1US8A 3HXQA 3BILA 3VXKA 4H18A 3IIEA 4HYTA 3GFOA 1UJ4A 4LMRA 3W4IA 8ABPA 3AZOA 1RRKA 3HO1A 6REQA 1Q83A 2A5GA 4OFBA 4MQFA 1RLOA 4M1TA 5C8ZA 1QU2A 2VNIA 3H1GA 3LLMA 3O73A 4OMDA 2QRQA 3P97A 4YJHB 4PE5B 2G5TA 2H4ZA 4U2KA 3UOWA 1TO2E 1T1RA 4TL8A 3O47A 1E5LA 1CF4A 4D9JA 2VXOA 5DB4A 4NK4A 2E5LB 1JR3A 2B6NA 1C3LA 1X7ZA 3EOZA 4TTSA 3ZXUB 2O59A 2QN3A 3JATA 2JIPA 4L1KA 4QVGA 1DHTA 3IOMA 2GCOA 4JB0A 2JPDA 4TTRA 3DUWA 2H0RA 1RMQA 2JCSA 3I0MA 5A3SA 4FKZA 5AKXA 4TRRA 3G1UA 4R9RA 1MT3A 4PHGA 5K3DA 3GAZA 3RHFA 1XD2A 4IP0A 4ZPJA 5KSZA 2ZJ1A 2MSDB 3B6IA 5F2NA 4K0KB 3OZTA 2CNDA 3AESA 3T3OA 1UBRS 2NM0A 1Z3CA 1USGA 2QZ9A 2WF5A 1LDYA 3H4VA 3M1YA 2IHUA 1EXMA 3KZVA 3CIFA 4LIPD 4EJSA 1BVRA 5IC4A 5C52B 4KYTA 5AKHA 3P7MA 2JLYA 2F17A 4E31A 2DGDA 3C4QA 3CZ5A 4GR5A 5AHRA 3VZDA 4WW0A 3GLGE 3EGXA 1QIFA 2Y1WA 3M7IA 3OWOA 4OQYA 5AM4A 3RU3A 4AZ3A 2H1LA 1WQ4A 3KYDA 4IHJA 1JIQA 3B9PA 4QTXA 5IBPA 1J49A 3IDAA 4X97A 3IO3A 3N3BC 3STVA 1AZWA 4BNJA 2VJCA 1HRKA 1RM3A 4XB1A 1KBOA 1J5XA 3UV7A 3F9IA 4NNOA 4QOIA 1CDEA 3ECAA 3QU9A 2JF0A 4UM5A 4BNTA 5L3SA 1AHIA 3FTCA 4ZOAA 4BXOB 4BASA 2A57A 1P17A 2ROQA 3KFXA 3QVMA 5JNLA 3FNQA 2BF4A 5CXSA 1CP2A 2IPLA 5ILGA 4QLBA 2WQZA 3SLRA 3W4KA 3UFXA 2AEFA 4ZVTA 2Z0MA 1S3GA 3M49A 4URHA 2A58A 3MWKA 4PZ0A 5EVJA 1U8AA 4K28A 1ODSA 1YQ9A 1GCOA 2OG2A 2XEXA 1T8TA 3R74A 3K6SB 4QTTB 3FZEA 4H77A 4YJ2B 4CCWA 1HYQA 2QVZX 3MPUA 1FU7A 1C2TA 2EATA 1HNXB 1RYDA 4GOXA 2Z6UA 2IEBA 2D0PB 4HH0A 3NETA 5ADWA 2GVZC 1N3IA 5C8XA 2J1LA 3WHIA 5IU6A 3L1JA 1VE1A 4MS1B 4L4XA 4DCUA 4DMMA 4FWBA 1IEXA 1NASA 2ZRHA 1JG1A 3AXTA 1V8BA 3MWEB 4BB6A 4YIHA 1L7VC 3KR2A 5B1YA 1H8EA 3E2PA 2C1EA 2O8CA 3P2KA 1AMUA 4D44A 1G6OA 1PFKA 3SHTA 3GA5A 4RJIA 3HBJA 2V6MA 5T8KC 4U5XA 1M6VA 3DC7A 3MRTA 3LWBA 4DHEA 4JKOA 1DDOA 5LP6A 2ZT6A 1JDBB 3M4ZA 4PSKA 1KEKA 4X66B 4XGKA 4RAQA 4AYTA 3H7AA 2NPIA 4FPXA 1ZGBA 3ABSB 4WXEA 2A0YA 2FQYA 1HLFA 3LDFA 1A97A 3QELA 4V0MA 2LCQA 1PK9A 3F0TA 2O6LA 2XX3A 3JD1A 3AWIA 1N4AA 2IF0A 1IM8A 2HWWA 2R8ZA 4ZQFA 5H8WA 4EPXA 3L07A 1S2LA 3OG9A 3BWVA 2PRIA 5E6UB 1LLFA 1ZOSA 3D6MA 3IURA 4PLFA 3DL4A 3RK1A 2CLOB 4JL8A 4IVRA 5GONF 1TUIA 1WXIA 1AUXA 3EMVA 5KWIA 1E32A 1BJKA 1C1DA 1VL5A 4BO8A 1E0DA 3K0EA 3RC7A 1X1QA 5ITZB 5IFLA 2PLWA 5KTPA 4B47A 5CLLA 3PF8A 3IBFA 3DCJA 4PNZA 4NPHA 4DEXA 3CA8A 2H4YA 3CVWA 4L4UA 3VAYA 2P9TA 2IZZA 1Q3KA 3AETB 4BKRA 3PC4A 3D3KA 2XCSB 2H51A 3SWWA 1OWNA 1AHNA 2OUKA 3EGVA 4R1UA 3D7SA 3G89A 4RZIA 1M2JA 3U13A 3C3PA 4WN3A 3KS9A 4B5KA 4YV2A 1L7BA 3K0KA 3MJDA 3PRYA 4HB3A 1VCHA 5E3HA 4YJ2A 1EUCA 1XDGA 3VJRA 2J6BA 3I39X 5D5QA 1QZTA 3ZEAA 1UBGA 1EUDB 3JWHA 4QOJA 1XK6A 2QX8A 2VYVA 4CIDA 5AKIA 1PKEA 3CQ9A 2BEJA 1IZ8A 4L57A 1W88B 3FWNA 3NT4A 4RL6A 2TRSB 3LUHA 4LC9A 1RRCA 2RGXA 3PEYA 3KK0A 2WG2A 3S8YA 2O6HA 4Z3OA 1S96A 2YWRA 4Q9KA 1J0BA 2AG6A 1TEXA 2PBLA 3KPVA 3SJCA 4AW9A 2X8JA 3OUTA 5HDQA 4OUKX 3CW8X 2V7WA 3O8OA 1TIKA 3ZGZA 1FBTA 3ZY3A 4WASA 4KFRA 5LP6B 4RA6B 3G0HA 3P9ZA 2B3TA 3OPNA 3NMUF 4IYJA 1NP3A 1EESA 2X6TA 3C3KA 1HE5A 4H7HA 1A8SA 2QM3A 3B1YA 1WDLA 1X7XA 5E6SA 4A6DA 2OXRA 4N01A 3U4HA 4R68A 1NBIA 3PC6A 3VH1A 3VSBA 1JEYB 1ZSVA 2GBGA 1GPBA 3VO9A 4RIHA 2IHBA 3AGQA 4RYLA 1XALA 4D41A 5GZ1A 5JCOA 4YPFA 1N6RA 3OQIB 1P39A 5AM3A 2ZZMA 4ZZIA 3TSWA 5JYEA 5DYYA 4QGSA 4DUGD 4TYMA 2KB0A 1WS6A 4TQAA 3ZDCA 3C2QA 4U4AA 4H1UA 1T24A 2IPMA 2I6XA 4KDEA 4RVHA 3TXAA 1IJKA 3LT1A 1WSBA 4D80A 3V7WA 1L0BA 1WB5A 2CL6X 3AY6A 3LF1A 2O8VA 2ZTUA 3LZ6A 5B2ZA 1WKVA 3C8ZA 3G7SA 1KAHA 3T0GA 2EX0A 4AMGA 5KNDD 3PIDA 2JNWA 1ABEA 2G70A 3FFTA 1X1EA 2J5KA 2ZREA 1R16A 2BKVA 2KBFA 3JTMA 3QVWA 3EUWA 5FAXA 3VYTB 4G67A 1NXXA 3QVXA 5HBGA 1QTQA 2QLBA 4B87A 2WF8A 4XPIA 5KINB 1QRAA 1U8CB 2CVHA 3A3PA 3ENNA 3U1TA 5A5EA 2QXTA 3DMYA 3K8YA 3MAGA 3OT1A 2CNNA 5BV2P 1L4HA 3RIGA 2EJVA 2P41A 4UAUA 4MMYB 1DBSA 3UWDA 4A8HA 2NPOA 2R68A 1N2CE 4EGAA 1EXNA 1C9MA 1JH8A 1MB3A 1LWOA 2JAOA 2C3OA 3WKAA 2AQKA 2C3PA 3GUYA 2R1ZA 4NJEB 1YS7A 2O0JA 5BWNA 5I51A 3TE7A 2KS6A 1N5MA 1Q57A 2HB6A 3AQ4A 4RA6A 4KN6A 4WAUA 3P5SA 3SFZA 3V8NA 3W6ZA 1CJBA 5A3QA 4UFPA 2H63A 1YZHA 2O14A 2BI8A 3HCDA 1WHTB 4S2EA 4BVBA 2QDXA 3OLCX 4DMGA 4N03A 3LVRE 4TXNA 3UHJA 4KI7A 5DM2A 3U9SA 2HK7A 2X0DA 1M1NA 4CI0B 5D7BA 1IE3A 1M8KA 1YCHA 4NCIA 4EVSA 1GU1A 2NZ2A 3AVVA 1DEXA 1NFRA 2AFHA 2GO1A 2L2QA 2PX0A 3LT5A 3AR6A 4N7BA 1XVTA 4K6MA 1YJCA 3I72A 1VPDA 1U80A 2H85A 3EXFB 4P36A 4E88A 5CYGA 3G1TA 2IOHA 1Y37A 2VJMB 2OUIA 3Q1KA 1X7YA 2NACA 4H6VA 3VZSA 2GCPA 2J48A 2OXIA 3WQBA 1W94A 1G18A 3OLQA 5GY7A 3D2AA 4YGXB 4TMWA 1TEZA 2NTJA 2DYKA 4U2EA 2V3CC 1A71A 3GGJA 3WWEA 5KCZA 4F97A 5M04A 4BFLA 1BYIA 5HMMA 5DTMA 2B2XA 4GMFA 4CVNA 5TQ0A 3BWDD 2XVYA 3EC7A 5EIFA 1YQEA 5T4HA 1KMIY 4RGQA 4LHWA 1W2GA 1TYBE 3SXJA 4BCCA 2ZIVB 4XD2A 2QQGA 9ABPA 1JDJA 2I33A 4MV6A 1ISIA 1HH4A 1WJGA 2ERXA 3BD6A 4J1TA 5HJ2A 4RSMA 5AI9A 2OOKA 5HF6A 4C0QC 1PVOA 1M1YE 2A0XA 2AMYA 5K4AA 4WZAE 4ZZ1A 1TVMA 3FRHA 2XNJA 1ISJA 2WVJA 3PHHA 4G65A 4KXYA 5CB6A 2JGLA 3C41J 4BTEA 2HPZA 3OX4A 5JJLA 3UA4A 3AQIA 5CIWA 1GGMA 1KTVA 3HA2A 2RH5A 3PUYA 4HMPA 4EGSA 3ROTA 4AJ2A 4LOLA 1EAMA 1VI2A 2QU7A 3GUVA 4GR4A 2ZPUA 4HHEA 3B2EA 2E4YA 4WLEA 4JX9A 5EGSA 3WAJA 4PZCA 4UBKA 1KFJB 2LE0A 1L5MA 3CLSD 4O5AA 1JXMA 1PUIA 2P2YA 1NAHA 2R66A 2OBYA 1KI2A 3AB7A 3HY4A 1HQCA 2CFIA 3L0DA 1B0UA 2WLTA 1JJBA 3A4NA 4HSEA 3UMBA 2LP4Y 1YA6A 1A5ZA 2LIVA 3ZCSA 1YB1A 4EKEA 5LBUA 2B83A 4JHXA 3U7QB 1E1DA 1EEHA 3B8HA 1Q6YA 4JFRA 3I45A 4DV4B 2IIPA 1KDZA 3EF0A 3ZDAA 3IHLA 1XBTA 4XDGA 3IJEB 1AUOA 3QLVC 1P80A 3SZRA 1GPAA 3D81A 1YE8A 4H7EA 1Q0PA 4PG4A 1SXIA 5JALA 4YRDA 3ABRB 3QE0A 1MOPA 4LQ4A 4U2GA 1CUAA 4CMKA 2B5OA 4CXMA 4WY2A 1U0EA 3T06B 5LWQA 4NBRA 1FZTA 2VUTA 2FVXA 1W46A 1NP7A 1Z3IX 3C7AA 3IJPA 3LWDA 3ORYA 4K40A 4IIBA 3L6BA 1J24A 3CR7A 4ZYWA 1QIHA 3HEAA 4HK4A 2ANBA 2CYAA 4OHPA 3U6KA 3JASA 3ADKA 1S2MA 4LGMA 3UXYA 3RVRA 1S0UA 1NV8A 1EI9A 2OZVA 3DBIA 3NFYA 4WJKB 1AK9A 3ZTWA 1JMVA 4JI4B 1G6HA 3FWZA 1NHGA 1I6WA 1OLXB 3BHIA 3AJRA 4G01B 1GZ5A 4TTQA 4WVFA 5EWLA 4GYWA 3TQCA 5BWBA 4YQYA 4QM6A 1FJ2A 1HX7A 2BM9A 2Q5FA 2B30A 4DDUA 4KGZA 3WGNA 5JMOA 1JR6A 3T9BA 1NXSA 2YOFA 3OIYA 3I05A 2ADMA 2QGZA 1OTXA 3OZXA 1IL0A 1IN7A 4M53A 5LNK6 1DU4A 2UUAB 3PXGA 4UNNA 1GGJA 2BCEA 4DM3A 3WWDA 4Q3KA 2JGJA 2O0HA 1DUSA 5K2MA 2VQDA 3KV3O 3AOGA 4P3NA 3I32A 3PGMA 4N82A 5F73A 3WICA 1QIIA 4MW6A 3VVMA 5C32A 2C8LA 4EAAA 3HGTA 1ZGZA 1WY5A 2LNDA 4JQSA 5FI1B 2ILTA 4XVUA 1QQ6A 4HAWA 4B32A 1ZITA 2QRGA 3CISA 3FMIA 2H06A 4IH9A 1SN7A 1JKXA 1QC5A 4JA0A 3TL3A 3OIWA 2EZ8A 3DQQA 3FUXA 4P33A 4AS1A 2JGKA 3CGGA 5LYJB 1H6DA 4YMVA 5HR5A 5ISMA 5KTSA 4RKQA 2DTEA 3F8TA 5DO9A 2CF5A 1U2SA 2D54A 4N8DA 3NHSA 1WCXA 1WV0A 5DTIA 3AC0A 5EXEA 3NFRA 3DO6A 3WADA 4J16C 3A6DA 4Q4CA 2O8DA 2O8BA 3CRZA 2R2GA 3KJQA 3EW7A 1YB4A 4J0JA 1ZFNA 2AX3A 3OQPA 4DLLA 5MN5A 1T9GS 1FFBA 2CBXA 3EY4A 4U6NA 2RARA 3NTXA 3N2KA 4HVCA 1F9EA 4Y6RA 5I7OA 2CB0A 2H7VA 2YXLA 4MVCA 4KMMA 4M9RA 4OK5A 4L08A 2VZEA 1Z6TA 2CDNA 2XNSA 1QE5A 1W1IA 3NH9A 1V37A 2FFQA 4ER0A 3AVOA 1EHIA 3W2EA 3WRWA 2AF3C 4OQMA 2DZDA 4R2HA 4B4VA 4EHLA 1JQBA 2J9XB 3LIPA 1CIJA 4G0OA 1AXGA 1SQ5A 4Z8XA 5JS2A 4E1AA 1VJ1A 4KIUA 3GLTA 1ODCA 3W90A 3O0DA 3ZLJA 4F9FA 3CW2A 3FKSD 1E2UA 121PA 3MGAA 3F3MA 1WR8A 4QDKA 3RS8A 1E6MA 5F4ZA 5AXAA 4LWQA 1FYVA 1CQZA 1EWYA 4Q18A 3U3RA 2ZSDA 3EGIA 4M87A 4BN4A 1XA0A 4TQGA 3K0FA 1RHMA 4PZAA 4YGYA 3DWFA 5E2BA 4LZZA 2YW9A 4BNDB 4UQOA 5ILQA 1MB4A 4Q9HA 5JAUA 3PUKA 5AK0A 5TR9A 1N6PA 3RE1A 1R3UA 1J25A 3DKPA 1D9ZA 3T99A 2QV7A 1AE1A 3JQAA 4D9IA 3VOBA 1CUDA 4RH3A 1DKNA 5AW4A 3L7OA 1XCBA 2I8AA 2ZUSA 3OC0A 4IJUA 4RQUA 4V02A 1Q21A 1KRWA 2GEUA 3RSLA 4O4HF 1T5OA 4UMDA 3X43A 3ND6A 2W6JD 1W0JA 2BKAA 3UMMA 2Y0PA 3STHA 4DBLC 1W52X 3KZCA 4INPA 4UU0A 4XIYA 3UGQA 4E30A 1R0XA 1T6NA 2JCXA 4BP1A 1B6RA 3NI2A 3MPOA 1Y1PA 2RFLA 3EZ9A 2KBEA