4KATA

Crystal structure of fdts from t. maritima mutant (r174k) with fad and dump
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords Thymidylate synthase
total genus 77
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4katA00
2CFAB 4GTDA 4GTLA 4GTEA 3AH5A 3N0CA 3N0BA 5IOTA 4KARA 1O24A 1O25A 4FZBA 4GTFA 5IOQA 4GT9A 1O27A 5IORA 1O2BA 3G4AA 4KASA 5CHPA 5JFEA 1O26A 3G4CA 1O28A 2CFAA 4P5BA 1O29A 4KATA 1O2AA 4P5AA 4GTCA 4GTAA 1KQ4A 4GTBA 3N3YA 5IOSA
chains in the Genus database with same CATH superfamily
5L46A 3GTMC 5JVOA 2V6SA 2E2IK 3GTKK 1O24A 1I6HC 3GTPC 5D4DA 2JH3A 3LAJA 4YG2A 1INNA 1EI6A 4A3JK 3GTQA 5C4JK 4KAWX 3GTPK 1BS2A 2R92C 4A3CC 4OIPA 2E2IC 2PA8D 5FJ8K 3M3YC 4BY1C 3GTJA 2PA8L 4C2MC 4A3MK 1TWGA 3T01A 4OIRA 3SZZA 1ZXOA 4QJVB 1EFWA 1AB4A 1F93A 3S1QC 1WOPA 3S2HC 1VGXA 3AQOA 1XZPA 3I4NK 3GTGA 3GTOK 3HOUK 1IW7A 4KM8A 1IS1A 1YNNA 4Q5SA 4LJZA 3GTKA 3DXJA 1USMA 2GAHC 1DD5A 3IPJA 2PPBA 2NVXK 2CFAB 2WB1D 1R9TC 5IOTA 3N0BA 2VUMK 4A3KK 5IOQA 1O2BA 5EGHA 3S1MK 4BBSC 1IL2A 5IYDC 4Y7NK 2NVXC 2R93C 4A3DC 1K83C 4M1XA 4XLPA 3PO2C 2JA6C 5E68A 3TFIA 3GEEA 1TWHA 3HOXC 3GTQK 3VA7A 2JA7K 2JA5A 1TWFC 3LPXA 3GTJC 4GTLA 3FKIK 5HL8A 1B4BA 1VH2A 5C44C 2ZFZA 3S14K 3AQPA 4GFQA 2WAQL 3GSIA 3GTMA 2E2JC 3HKZD 2E2HK 5C3EK 3GTOA 2RH6A 1I3QA 3S2DK 4QJVA 4KATA 4KMAA 4YFKA 3TFHA 2NVYK 3S15C 1I50A 1HI9A 1IQ0A 2FQTA 1J6XA 4G0VA 2JA7C 4LOWA 4BLBA 1ISEA 4G7HA 4G0UA 4BXXK 3HOZK 4KN4A 1PJ7A 2VUMA 3SZYA 4A3DK 3S17K 2A68A 2NVQK 1B4AA 2JA8K 2GSNA 5CHPA 1O26A 1I50C 4MQ9A 5C4XC 2E2HA 5IYBK 1K83A 2RGRA 2P5MA 2VUMC 1WCMK 1WSRA 5C3EC 3FHZA 3TFJA 1TWHK 4C45A 1SFOA 3N3YA 3OREA 3HOYK 1VLOA 4A3FK 5IORA 4YFXA 1O27A 3K7AC 4FM9A 4KC6A 2A6HA 1TWFA 3S2HK 3S1QK 4BY7K 3Q3QA 3S16C 4AYBL 1TWCK 3WODA 3LAPA 4GTCA 2PMZL 2A6EA 4XLNA 3V4GA 2GAGC 5TMCA 4A3KC 1Y1VC 2JA8C 3L4JA 3S17C 4LQYA 5IYCC 1V5VA 1SMYA 5IP7K 3S1NK 4Y52C 5M3FK 4A3BC 4MEXA 4P5BA 5IYCK 4Q4ZA 4J3NA 2NVTC 3EQLA 3M4OK 2R7ZC 1XZQB 3I4NC 1XXAA 2O5IA 2E2HC 3S15K 1GE9A 3ADAC 2GSOA 3GTPA 4AYBD 4AH6A 1WOSA 4A3MC 3GEIA 1L0WA 4KASA 3H0GA 3HOVK 3GTLA 4BY7C 4G7OA 1UV7A 1TWAC 1X31C 4DDQA 3H3VD 2CW0A 4A3JC 1YCLA 4GTBA 1XZQA 4ILDA 3I4MC 1XPPA 3S0XA 1K83K 2ZUEA 4O2DA 3A8JA 1WSVA 4GTFA 4GZYA 1I3QK 4A3EK 2BE5A 1R9TK 1VJEA 4LLGA 4KDDA 4BBSK 1I50K 5C4XK 4C3IC 3QX3A 1IBAA 3PO3C 2PHCB 3GEHA 2YU9A 2ZUFA 4KMUA 1YNJA 5IP9C 1F7UA 3I4MK 3GIRA 5EGEA 4C3JK 4G7ZA 3BP3A 3S2DC 3HKZL 2A69A 2JA6A 4X6AK 2JA7A 1TWAK 4A3FC 5TJ3A 3ERED 1Y1WA 3T00A 3A8KA 1WQGA 4C2MK 3HOYC 1PJ6A 1WIHA 2WAQD 3HXAA 4XSZA 1TWHC 2KWAA 3FOFA 4KN7A 2R92K 4A3CK 3GTJK 4KM9A 3GDZA 1TWFK 2XCQA 3CQZK 3AD9C 2Y3PA 4KMHA 4GTEA 1DCOA 4BBRC 3H3VL 2NVTK 3HOXK 4GT9A 4KB2A 2JA6K 3CQZC 4A3BK 4Y52K 3GTGK 3GTMK 3G4CA 3FOEA 4OIOA 5IP7C 3S1NC 1WCMA 2V6TA 3S1MC 2NVYC 3H0GC 3A8IA 4GTAA 1Y1VK 1ZVUA 1XXCA 3CQZA 2Y0SD 1WORA 3RZDK 5CJ9A 4RMFA 1JVIA 2E2JK 4C3JC 1WQFA 2YU9C 4P9SA 3S1RK 2B63K 1TWCC 4A3GC 2R92A 5C44K 5JFEA 3AD8C 4QIWL 3GTOC 3HOUC 3BP8C 1JOEA 4XCHA 1HQMA 4BKWA 1PJ5A 4LR2A 1IE0A 1O2AA 2W7VA 3GTQC 4C3IK 5FLMK 2PMZD 3AD7C 3CAGA 1SFOK 3L4KA 2FQOA 3H0GK 1O2FB 4KMDA 4BY1K 3M3YK 2V6UA 4Y7NC 5IYDK 3RZOC 3N0CA 1TWCA 4KARA 4JK1A 1J98A 4C3HC 1USOA 4A93C 3GTGC 3G4AA 2XCRB 3NUHA 5M5YK 4A3IK 3GTLC 4ZH4A 2CFAA 4WJ4A 2NVQC 4BBRK 1C0AA 3HOZC 1TWAA 2NVYA 4BXXC 4OIQA 2O5JA 4A3LC 3HOVC 4QIWD 4A3GK 1VRQC 2EBBA 3S1RC 1RU0A 3HOWC 3AH5A 5M5XK 1BGWA 3FKIA 1BDFA 1J6WA 2B63A 2Y0SL 4X6AC 2R7ZK 4MEYA 2JA5C 1O28A 2R93A 3MMLB 1ZBSA 2P8TA 3S14C 1O29A 3JSTA 5IP9K 2XCOA 1ZQ1C 3FKIC 1YX2A 5C4JC 4A3LK 4YFNA 3GTLK 5M5WK 4WJ3M 4GTDA 1EQRA 1EH1A 4LK0A 1F9NA 4BLAA 4A93K 1WOOA 1O25A 1R9TA 4C3HK 1Y1VA 3OPFA 4PAAA 4A3IC 1I6HK 3GTKC 4WILA 3PO2K 2R7ZA 1BJTA 4A3EC 3BUEA 1I3QC 2NVXA 2R93K 1SFOC 1Y1WC 3TTGA 1DCPA 3RZOK 1DCHA 1JQWA 2E2IA 3S16K 1J6VA 3T02A 4P5AA 4KB4A 2GSUA 1TWGC 1XZPB 4XSXA 5FLMC 3K7AK 4NOIA 1ZYRA 4FZBA 4G0WA 2YU9K 1WQHA 1F7VA 1EK8A 2JA5K 4OINA 2B63C 1XXBA 1G51A 1TWGK 4PABA 1WCMC 2D6FC 1I6VA 3PO3K 5IYBC 2WB1L 4LK1A 5TMFA 3RZDC 1KQ4A 5M3MK 3HOWK 3OEPA 1Y1WK 3M4OC 5IOSA
chains in the Genus database with same CATH topology
3S0XA 4BLBA 5JVOA 1ISEA 4KMDA 3N0CA 4G0UA 1TWCA 4KARA 1O24A 4GTFA 4C3HC 2VUMA 3G4AA 1B4AA 2XCRB 2JH3A 2GSNA 5CHPA 3LAJA 4KDDA 1O26A 3NUHA 4C3IC 2E2HA 3QX3A 2RGRA 2CFAA 1K83A 2P5MA 3GTQA 2PHCB 4KAWX 3FHZA 1TWAA 2NVYA 2YU9A 1SFOA 3N3YA 3OREA 3GTJA 4C2MC 1TWGA 1ZXOA 3AH5A 1BGWA 5EGEA 5IORA 3FKIA 1O27A 1AB4A 4KC6A 4FM9A 2JA6A 2JA7A 5TJ3A 1TWFA 3ERED 2B63A 3AQOA 1Y1WA 3GTGA 1WQGA 1O28A 1WIHA 4KM8A 3Q3QA 2R93A 1IS1A 3MMLB 1ZBSA 2KWAA 3GTKA 1O29A 3FOFA 3LAPA 2XCOA 4GTCA 1DD5A 4KM9A 2XCQA 2CFAB 3V4GA 4GTDA 1EH1A 1F9NA 2Y3PA 4KMHA 4GTEA 5IOTA 3N0BA 4BLAA 3L4JA 4LQYA 1O25A 5IOQA 1R9TA 4GT9A 1Y1VA 3OPFA 1O2BA 4KB2A 5EGHA 2R7ZA 1BJTA 3G4CA 3FOEA 2NVXA 3BUEA 1WCMA 4M1XA 4P5BA 2E2IA 4J3NA 1TWHA 4P5AA 4GTAA 3VA7A 4KB4A 1ZVUA 2GSUA 1XXAA 1XXCA 2JA5A 3CQZA 1GE9A 3LPXA 5CJ9A 4GTLA 4C3JC 2GSOA 1B4BA 1WQFA 3GTPA 4FZBA 2ZFZA 4G0WA 2R92A 3AQPA 4GFQA 1WQHA 4KASA 5JFEA 3GTMA 3H0GA 3GTLA 1EK8A 1XXBA 4BKWA 4DDQA 4LR2A 3GTOA 2RH6A 1I3QA 4KATA 1O2AA 4KMAA 1KQ4A 4GTBA 4ILDA 3OEPA 1I50A 4G0VA 3CAGA 3L4KA 5IOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA B;  4GTD A;  4GTL A;  4GTE A;  3AH5 A;  3N0C A;  3N0B A;  5IOT A;  4KAR A;  1O24 A;  1O25 A;  4FZB A;  4GTF A;  5IOQ A;  4GT9 A;  1O27 A;  5IOR A;  1O2B A;  3G4A A;  4KAS A;  5CHP A;  5JFE A;  1O26 A;  3G4C A;  1O28 A;  2CFA A;  4P5B A;  1O29 A;  4KAT A;  1O2A A;  4P5A A;  4GTC A;  4GTA A;  1KQ4 A;  4GTB A;  3N3Y A;  5IOS A; 
#chains in the Genus database with same CATH topology
 5L46 A;  3GTM C;  5JVO A;  2V6S A;  2E2I K;  3GTK K;  1O24 A;  1I6H C;  3GTP C;  5D4D A;  2JH3 A;  3LAJ A;  4YG2 A;  1INN A;  1EI6 A;  4A3J K;  3GTQ A;  5C4J K;  4KAW X;  3GTP K;  1BS2 A;  2R92 C;  4A3C C;  4OIP A;  2E2I C;  2PA8 D;  5FJ8 K;  3M3Y C;  4BY1 C;  3GTJ A;  2PA8 L;  4C2M C;  4A3M K;  1TWG A;  3T01 A;  4OIR A;  3SZZ A;  1ZXO A;  4QJV B;  1EFW A;  1AB4 A;  1F93 A;  3S1Q C;  1WOP A;  3S2H C;  1VGX A;  3AQO A;  1XZP A;  3I4N K;  3GTG A;  3GTO K;  3HOU K;  1IW7 A;  4KM8 A;  1IS1 A;  1YNN A;  4Q5S A;  4LJZ A;  3GTK A;  3DXJ A;  1USM A;  2GAH C;  1DD5 A;  3IPJ A;  2PPB A;  2NVX K;  2CFA B;  2WB1 D;  1R9T C;  5IOT A;  3N0B A;  2VUM K;  4A3K K;  5IOQ A;  1O2B A;  5EGH A;  3S1M K;  4BBS C;  1IL2 A;  5IYD C;  4Y7N K;  2NVX C;  2R93 C;  4A3D C;  1K83 C;  4M1X A;  4XLP A;  3PO2 C;  2JA6 C;  5E68 A;  3TFI A;  3GEE A;  1TWH A;  3HOX C;  3GTQ K;  3VA7 A;  2JA7 K;  2JA5 A;  1TWF C;  3LPX A;  3GTJ C;  4GTL A;  3FKI K;  5HL8 A;  1B4B A;  1VH2 A;  5C44 C;  2ZFZ A;  3S14 K;  3AQP A;  4GFQ A;  2WAQ L;  3GSI A;  3GTM A;  2E2J C;  3HKZ D;  2E2H K;  5C3E K;  3GTO A;  2RH6 A;  1I3Q A;  3S2D K;  4QJV A;  4KAT A;  4KMA A;  4YFK A;  3TFH A;  2NVY K;  3S15 C;  1I50 A;  1HI9 A;  1IQ0 A;  2FQT A;  1J6X A;  4G0V A;  2JA7 C;  4LOW A;  4BLB A;  1ISE A;  4G7H A;  4G0U A;  4BXX K;  3HOZ K;  4KN4 A;  1PJ7 A;  2VUM A;  3SZY A;  4A3D K;  3S17 K;  2A68 A;  2NVQ K;  1B4A A;  2JA8 K;  2GSN A;  5CHP A;  1O26 A;  1I50 C;  4MQ9 A;  5C4X C;  2E2H A;  5IYB K;  1K83 A;  2RGR A;  2P5M A;  2VUM C;  1WCM K;  1WSR A;  5C3E C;  3FHZ A;  3TFJ A;  1TWH K;  4C45 A;  1SFO A;  3N3Y A;  3ORE A;  3HOY K;  1VLO A;  4A3F K;  5IOR A;  4YFX A;  1O27 A;  3K7A C;  4FM9 A;  4KC6 A;  2A6H A;  1TWF A;  3S2H K;  3S1Q K;  4BY7 K;  3Q3Q A;  3S16 C;  4AYB L;  1TWC K;  3WOD A;  3LAP A;  4GTC A;  2PMZ L;  2A6E A;  4XLN A;  3V4G A;  2GAG C;  5TMC A;  4A3K C;  1Y1V C;  2JA8 C;  3L4J A;  3S17 C;  4LQY A;  5IYC C;  1V5V A;  1SMY A;  5IP7 K;  3S1N K;  4Y52 C;  5M3F K;  4A3B C;  4MEX A;  4P5B A;  5IYC K;  4Q4Z A;  4J3N A;  2NVT C;  3EQL A;  3M4O K;  2R7Z C;  1XZQ B;  3I4N C;  1XXA A;  2O5I A;  2E2H C;  3S15 K;  1GE9 A;  3ADA C;  2GSO A;  3GTP A;  4AYB D;  4AH6 A;  1WOS A;  4A3M C;  3GEI A;  1L0W A;  4KAS A;  3H0G A;  3HOV K;  3GTL A;  4BY7 C;  4G7O A;  1UV7 A;  1TWA C;  1X31 C;  4DDQ A;  3H3V D;  2CW0 A;  4A3J C;  1YCL A;  4GTB A;  1XZQ A;  4ILD A;  3I4M C;  1XPP A;  3S0X A;  1K83 K;  2ZUE A;  4O2D A;  3A8J A;  1WSV A;  4GTF A;  4GZY A;  1I3Q K;  4A3E K;  2BE5 A;  1R9T K;  1VJE A;  4LLG A;  4KDD A;  4BBS K;  1I50 K;  5C4X K;  4C3I C;  3QX3 A;  1IBA A;  3PO3 C;  2PHC B;  3GEH A;  2YU9 A;  2ZUF A;  4KMU A;  1YNJ A;  5IP9 C;  1F7U A;  3I4M K;  3GIR A;  5EGE A;  4C3J K;  4G7Z A;  3BP3 A;  3S2D C;  3HKZ L;  2A69 A;  2JA6 A;  4X6A K;  2JA7 A;  1TWA K;  4A3F C;  5TJ3 A;  3ERE D;  1Y1W A;  3T00 A;  3A8K A;  1WQG A;  4C2M K;  3HOY C;  1PJ6 A;  1WIH A;  2WAQ D;  3HXA A;  4XSZ A;  1TWH C;  2KWA A;  3FOF A;  4KN7 A;  2R92 K;  4A3C K;  3GTJ K;  4KM9 A;  3GDZ A;  1TWF K;  2XCQ A;  3CQZ K;  3AD9 C;  2Y3P A;  4KMH A;  4GTE A;  1DCO A;  4BBR C;  3H3V L;  2NVT K;  3HOX K;  4GT9 A;  4KB2 A;  2JA6 K;  3CQZ C;  4A3B K;  4Y52 K;  3GTG K;  3GTM K;  3G4C A;  3FOE A;  4OIO A;  5IP7 C;  3S1N C;  1WCM A;  2V6T A;  3S1M C;  2NVY C;  3H0G C;  3A8I A;  4GTA A;  1Y1V K;  1ZVU A;  1XXC A;  3CQZ A;  2Y0S D;  1WOR A;  3RZD K;  5CJ9 A;  4RMF A;  1JVI A;  2E2J K;  4C3J C;  1WQF A;  2YU9 C;  4P9S A;  3S1R K;  2B63 K;  1TWC C;  4A3G C;  2R92 A;  5C44 K;  5JFE A;  3AD8 C;  4QIW L;  3GTO C;  3HOU C;  3BP8 C;  1JOE A;  4XCH A;  1HQM A;  4BKW A;  1PJ5 A;  4LR2 A;  1IE0 A;  1O2A A;  2W7V A;  3GTQ C;  4C3I K;  5FLM K;  2PMZ D;  3AD7 C;  3CAG A;  1SFO K;  3L4K A;  2FQO A;  3H0G K;  1O2F B;  4KMD A;  4BY1 K;  3M3Y K;  2V6U A;  4Y7N C;  5IYD K;  3RZO C;  3N0C A;  1TWC A;  4KAR A;  4JK1 A;  1J98 A;  4C3H C;  1USO A;  4A93 C;  3GTG C;  3G4A A;  2XCR B;  3NUH A;  5M5Y K;  4A3I K;  3GTL C;  4ZH4 A;  2CFA A;  4WJ4 A;  2NVQ C;  4BBR K;  1C0A A;  3HOZ C;  1TWA A;  2NVY A;  4BXX C;  4OIQ A;  2O5J A;  4A3L C;  3HOV C;  4QIW D;  4A3G K;  1VRQ C;  2EBB A;  3S1R C;  1RU0 A;  3HOW C;  3AH5 A;  5M5X K;  1BGW A;  3FKI A;  1BDF A;  1J6W A;  2B63 A;  2Y0S L;  4X6A C;  2R7Z K;  4MEY A;  2JA5 C;  1O28 A;  2R93 A;  3MML B;  1ZBS A;  2P8T A;  3S14 C;  1O29 A;  3JST A;  5IP9 K;  2XCO A;  1ZQ1 C;  3FKI C;  1YX2 A;  5C4J C;  4A3L K;  4YFN A;  3GTL K;  5M5W K;  4WJ3 M;  4GTD A;  1EQR A;  1EH1 A;  4LK0 A;  1F9N A;  4BLA A;  4A93 K;  1WOO A;  1O25 A;  1R9T A;  4C3H K;  1Y1V A;  3OPF A;  4PAA A;  4A3I C;  1I6H K;  3GTK C;  4WIL A;  3PO2 K;  2R7Z A;  1BJT A;  4A3E C;  3BUE A;  1I3Q C;  2NVX A;  2R93 K;  1SFO C;  1Y1W C;  3TTG A;  1DCP A;  3RZO K;  1DCH A;  1JQW A;  2E2I A;  3S16 K;  1J6V A;  3T02 A;  4P5A A;  4KB4 A;  2GSU A;  1TWG C;  1XZP B;  4XSX A;  5FLM C;  3K7A K;  4NOI A;  1ZYR A;  4FZB A;  4G0W A;  2YU9 K;  1WQH A;  1F7V A;  1EK8 A;  2JA5 K;  4OIN A;  2B63 C;  1XXB A;  1G51 A;  1TWG K;  4PAB A;  1WCM C;  2D6F C;  1I6V A;  3PO3 K;  5IYB C;  2WB1 L;  4LK1 A;  5TMF A;  3RZD C;  1KQ4 A;  5M3M K;  3HOW K;  3OEP A;  1Y1W K;  3M4O C;  5IOS A; 
#chains in the Genus database with same CATH homology
 3S0X A;  4BLB A;  5JVO A;  1ISE A;  4KMD A;  3N0C A;  4G0U A;  1TWC A;  4KAR A;  1O24 A;  4GTF A;  4C3H C;  2VUM A;  3G4A A;  1B4A A;  2XCR B;  2JH3 A;  2GSN A;  5CHP A;  3LAJ A;  4KDD A;  1O26 A;  3NUH A;  4C3I C;  2E2H A;  3QX3 A;  2RGR A;  2CFA A;  1K83 A;  2P5M A;  3GTQ A;  2PHC B;  4KAW X;  3FHZ A;  1TWA A;  2NVY A;  2YU9 A;  1SFO A;  3N3Y A;  3ORE A;  3GTJ A;  4C2M C;  1TWG A;  1ZXO A;  3AH5 A;  1BGW A;  5EGE A;  5IOR A;  3FKI A;  1O27 A;  1AB4 A;  4KC6 A;  4FM9 A;  2JA6 A;  2JA7 A;  5TJ3 A;  1TWF A;  3ERE D;  2B63 A;  3AQO A;  1Y1W A;  3GTG A;  1WQG A;  1O28 A;  1WIH A;  4KM8 A;  3Q3Q A;  2R93 A;  1IS1 A;  3MML B;  1ZBS A;  2KWA A;  3GTK A;  1O29 A;  3FOF A;  3LAP A;  2XCO A;  4GTC A;  1DD5 A;  4KM9 A;  2XCQ A;  2CFA B;  3V4G A;  4GTD A;  1EH1 A;  1F9N A;  2Y3P A;  4KMH A;  4GTE A;  5IOT A;  3N0B A;  4BLA A;  3L4J A;  4LQY A;  1O25 A;  5IOQ A;  1R9T A;  4GT9 A;  1Y1V A;  3OPF A;  1O2B A;  4KB2 A;  5EGH A;  2R7Z A;  1BJT A;  3G4C A;  3FOE A;  2NVX A;  3BUE A;  1WCM A;  4M1X A;  4P5B A;  2E2I A;  4J3N A;  1TWH A;  4P5A A;  4GTA A;  3VA7 A;  4KB4 A;  1ZVU A;  2GSU A;  1XXA A;  1XXC A;  2JA5 A;  3CQZ A;  1GE9 A;  3LPX A;  5CJ9 A;  4GTL A;  4C3J C;  2GSO A;  1B4B A;  1WQF A;  3GTP A;  4FZB A;  2ZFZ A;  4G0W A;  2R92 A;  3AQP A;  4GFQ A;  1WQH A;  4KAS A;  5JFE A;  3GTM A;  3H0G A;  3GTL A;  1EK8 A;  1XXB A;  4BKW A;  4DDQ A;  4LR2 A;  3GTO A;  2RH6 A;  1I3Q A;  4KAT A;  1O2A A;  4KMA A;  1KQ4 A;  4GTB A;  4ILD A;  3OEP A;  1I50 A;  4G0V A;  3CAG A;  3L4K A;  5IOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...