4KATA

Crystal structure of fdts from t. maritima mutant (r174k) with fad and dump
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 77
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4katA00
5IOQA 4GTCA 4P5AA 5IORA 3G4AA 5IOSA 3N0CA 5JFEA 4FZBA 3G4CA 4GTAA 1O28A 3N3YA 5IOTA 1O24A 2CFAB 4GTDA 4GTEA 5CHPA 1O29A 4GTLA 4GTBA 4KATA 4P5BA 4GT9A 4KARA 2CFAA 1O2BA 1O25A 1O27A 3AH5A 1O26A 4KASA 4GTFA 1KQ4A 3N0BA 1O2AA
chains in the Genus database with same CATH superfamily
1TWFK 4GFQA 4AH6A 3G4AA 1BJTA 5M5WK 2R92C 1I3QA 4FZBA 4GTAA 5E68A 4LOWA 3GDZA 1EQRA 3PO3C 3CAGA 3GTOC 4X6AK 1WCMC 2RH6A 1TWGK 1IBAA 4JK1A 1O27A 4A3EC 2R92A 2RGRA 1ZBSA 2JA5C 4GTFA 3HOWK 2NVTC 1KQ4A 1USOA 4PABA 1XZQA 5EGHA 1SFOC 1I50C 3GTOA 4KN4A 1WCMA 2V6UA 3GEHA 3A8IA 3N3YA 1BDFA 2NVYC 2CFAB 3CQZK 4OIOA 1TWHK 2JA5A 2Y0SD 1WSVA 5FLMK 1PJ6A 1BGWA 3L4JA 4GT9A 4KMAA 2V6SA 4KN7A 1WQFA 3HKZL 5IYBC 1IW7A 1SFOA 1I50A 1VLOA 1WOOA 1TWAK 1WOSA 3G4CA 3IPJA 4OINA 2NVYA 3TFJA 2VUMK 2B63A 4QJVA 5C4JK 3GTJK 4WJ3M 4G0UA 3TFHA 3GTGA 3AD7C 1TWCK 1J98A 3S0XA 4Y52C 4KC6A 3FHZA 3QX3A 1XXCA 3GTKC 1GE9A 4AYBD 4A3BC 5CHPA 4KB4A 3M3YC 4G0WA 1F7UA 2NVXK 4BY1C 4A3GK 1O2BA 4QIWL 4WJ4A 3S1MC 2JA6K 4LK0A 3V4GA 2PA8L 2KWAA 4C3IK 2PHCB 3GTKA 4A3MK 4BLAA 2V6TA 3A8JA 3FKIC 2YU9C 1ZYRA 1EK8A 2R92K 4A3IK 5IOSA 2GSUA 3S16C 1WIHA 4A93C 3H3VL 3GTPC 1USMA 2R93K 3HOXK 4LR2A 5C4XC 4XLPA 2CW0A 3GSIA 1HQMA 4YFXA 1C0AA 3GTMK 1F93A 1B4AA 2JA5K 1O26A 2WAQL 4A3FK 2PPBA 4C45A 2NVQK 4KM9A 1IL2A 3S17C 1EFWA 3GTPA 1ZQ1C 1O2FB 3I4NC 4A3CC 2XCQA 3HXAA 1B4BA 1J6WA 5IYCK 4C2MK 4BXXC 1EI6A 1XXBA 4C3HC 3HOZC 2GSOA 4GTDA 4M1XA 3GTQC 2B63K 1I6HC 3S2HC 1DCHA 3GTGK 2A69A 3S1QC 4BY7K 3HOUK 5C3EK 2PMZD 2ZFZA 3TTGA 4A3LC 1F7VA 2JH3A 4Y7NK 4BBSC 5IP7C 3K7AC 4XSZA 2D6FC 4BLBA 1Y1WC 4O2DA 5M5XK 3HKZD 5C44K 2R7ZA 2JA7C 1R9TA 1K83C 1O29A 4XLNA 3FOFA 3JSTA 1L0WA 1ZVUA 4RMFA 4YFNA 4OIQA 3H0GC 3TFIA 3WODA 2A6HA 1Y1WA 2A6EA 3S15C 4OIRA 3S14K 1IS1A 4A3DC 2JA7A 3OEPA 3PO2C 1XPPA 4MQ9A 5JFEA 2JA8K 2E2JC 4OIPA 3A8KA 4J3NA 3GTPK 2PA8D 4KMDA 2E2HC 1ISEA 5M5YK 4KB2A 4ILDA 3EQLA 1YX2A 5C4XK 3S2DC 1Y1VC 2E2IK 3RZDK 3T02A 3H3VD 4YFKA 3T01A 5IYDK 1BS2A 5M3FK 3GEIA 2E2HA 3I4NK 4A3CK 4C3JC 4A3JC 3GEEA 3S1NK 2GAHC 4BBRC 1J6VA 1YCLA 2WAQD 4NOIA 4LJZA 3M4OC 3AD9C 3FOEA 1I3QK 4XCHA 1VJEA 1WSRA 2R7ZK 5IP9C 1XZQB 4A3KC 3I4MC 1JVIA 1R9TK 5JVOA 2A68A 1TWFC 2FQTA 5HL8A 2P5MA 5TMFA 4KMHA 4KAWX 1V5VA 2GAGC 3PO3K 4X6AC 1DCPA 1VRQC 1TWGC 3GTOK 4MEXA 1WCMK 1WQHA 2O5IA 3S1RC 4LQYA 3FKIA 5TJ3A 2YU9A 2Y0SL 3VA7A 4QJVB 4A3EK 3LPXA 3ERED 3HOWC 2NVTK 2XCRB 4A3DK 5IORA 3BUEA 1SFOK 1I50K 1TWGA 1IE0A 3N0CA 1G51A 3CQZC 1TWHC 2NVYK 3RZOC 5M3MK 5FLMC 2E2HK 2ZUEA 3HOVC 3ADAC 3MMLB 2XCOA 4G0VA 5IYBK 1XXAA 1EH1A 3AH5A 1TWAC 4AYBL 4KMUA 3HOYC 3AQOA 1X31C 1DCOA 3CQZA 5IOQA 1TWHA 2VUMC 4FM9A 5C4JC 1WQGA 3GTJC 2GSNA 3GTQA 4G7HA 4A3JK 1TWCC 2Y3PA 1IQ0A 1SMYA 1O28A 4Y52K 5IOTA 1J6XA 3GTKK 4A3BK 2NVXC 4A3GC 2VUMA 3M3YK 2CFAA 4BY1K 3GTJA 2JA6C 3S1MK 1TWCA 4C3IC 2BE5A 4PAAA 3NUHA 1UV7A 3Q3QA 5TMCA 4A3MC 3FKIK 4A3IC 2YU9K 1K83A 1JQWA 2NVXA 3S16K 1VGXA 1I6VA 1O24A 4QIWD 3LAJA 4A93K 4Q5SA 2JA6A 4GZYA 2FQOA 3H0GA 4GTBA 2R93C 4ZH4A 3HOXC 3GTLC 1YNJA 3GTMC 3S1RK 4A3FC 1DD5A 4KASA 2NVQC 1F9NA 4GTCA 3S17K 3SZYA 2PMZL 2R93A 3GTLA 2WB1L 5IYCC 3DXJA 4C2MC 3GTMA 4BXXK 3RZOK 2B63C 4C3HK 3HOZK 1Y1VA 3GTQK 3HOVK 1I6HK 3GTGC 5CJ9A 3S2HK 4KATA 1WORA 4P9SA 5L46A 3S1QK 4BY7C 3HOUC 1YNNA 3GIRA 5C3EC 5D4DA 3HOYK 4Y7NC 1JOEA 4A3LK 4BBSK 1XZPA 3BP3A 5IP7K 3K7AK 2P8TA 3AQPA 5C44C 2EBBA 1Y1WK 3SZZA 4LLGA 2JA7K 4GTEA 4GTLA 1K83K 1TWFA 5EGEA 4G7OA 1RU0A 3L4KA 3LAPA 4DDQA 3H0GK 1AB4A 4KDDA 3S14C 3S15K 4KM8A 4P5AA 2O5JA 4Q4ZA 1PJ7A 3PO2K 3AD8C 2JA8C 2W7VA 4MEYA 2E2JK 3GTLK 1XZPB 4YG2A 4KARA 1O25A 1PJ5A 4XSXA 2ZUFA 3OPFA 3S2DK 2E2IC 3RZDC 3BP8C 1Y1VK 1HI9A 5IYDC 4LK1A 4G7ZA 3OREA 3S1NC 4C3JK 3T00A 4BBRK 2E2IA 1INNA 1TWAA 3M4OK 1I3QC 4P5BA 4WILA 2R7ZC 4BKWA 1WOPA 5IP9K 1R9TC 4A3KK 1VH2A 2WB1D 3I4MK 5FJ8K 1ZXOA 3N0BA 1O2AA
chains in the Genus database with same CATH topology
4GTCA 4GFQA 3GTPA 2P5MA 3G4AA 1BJTA 2XCQA 2R93A 4KMHA 4KAWX 3GTLA 1I3QA 4FZBA 1B4BA 4GTAA 4C2MC 3GTMA 1XXBA 4C3HC 2GSOA 4GTDA 4M1XA 1Y1VA 3CAGA 5CJ9A 4KATA 2RH6A 1WQHA 1O27A 4LQYA 3FKIA 5TJ3A 2YU9A 2R92A 2RGRA 1ZBSA 3VA7A 2ZFZA 3LPXA 3ERED 4GTFA 2JH3A 1KQ4A 2XCRB 5EGHA 5IORA 3BUEA 3GTOA 3AQPA 1TWGA 1WCMA 3N0CA 4BLBA 2R7ZA 3N3YA 2CFAB 1R9TA 2JA5A 4GTEA 1O29A 4GTLA 3FOFA 1BGWA 3L4JA 4GT9A 3MMLB 1TWFA 4KMAA 1ZVUA 5EGEA 1WQFA 2XCOA 1SFOA 3L4KA 3LAPA 4G0VA 1I50A 1XXAA 1EH1A 3AH5A 4DDQA 1Y1WA 3AQOA 1AB4A 4KDDA 3G4CA 3CQZA 2NVYA 1IS1A 4KM8A 1TWHA 4P5AA 5IOQA 2JA7A 3OEPA 4FM9A 1WQGA 2GSNA 2B63A 3GTQA 4G0UA 5JFEA 3GTGA 2Y3PA 3S0XA 1O28A 4KC6A 5IOTA 3FHZA 3QX3A 1XXCA 4J3NA 1GE9A 4KMDA 5CHPA 1ISEA 4KB4A 4KB2A 4ILDA 4G0WA 2VUMA 4KARA 2CFAA 1O2BA 1O25A 3GTJA 3OPFA 1TWCA 3V4GA 4C3IC 2KWAA 3NUHA 3Q3QA 2PHCB 4KM9A 3GTKA 4BLAA 2E2HA 1EK8A 3OREA 4C3JC 5IOSA 1K83A 2GSUA 2NVXA 1WIHA 1O24A 2JA6A 3LAJA 2E2IA 3H0GA 1TWAA 4GTBA 3FOEA 4P5BA 4LR2A 4BKWA 1B4AA 1DD5A 1O26A 4KASA 5JVOA 1F9NA 1ZXOA 3N0BA 1O2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOQ A;  4GTC A;  4P5A A;  5IOR A;  3G4A A;  5IOS A;  3N0C A;  5JFE A;  4FZB A;  3G4C A;  4GTA A;  1O28 A;  3N3Y A;  5IOT A;  1O24 A;  2CFA B;  4GTD A;  4GTE A;  5CHP A;  1O29 A;  4GTL A;  4GTB A;  4KAT A;  4P5B A;  4GT9 A;  4KAR A;  2CFA A;  1O2B A;  1O25 A;  1O27 A;  3AH5 A;  1O26 A;  4KAS A;  4GTF A;  1KQ4 A;  3N0B A;  1O2A A; 
#chains in the Genus database with same CATH topology
 1TWF K;  4GFQ A;  4AH6 A;  3G4A A;  1BJT A;  5M5W K;  2R92 C;  1I3Q A;  4FZB A;  4GTA A;  5E68 A;  4LOW A;  3GDZ A;  1EQR A;  3PO3 C;  3CAG A;  3GTO C;  4X6A K;  1WCM C;  2RH6 A;  1TWG K;  1IBA A;  4JK1 A;  1O27 A;  4A3E C;  2R92 A;  2RGR A;  1ZBS A;  2JA5 C;  4GTF A;  3HOW K;  2NVT C;  1KQ4 A;  1USO A;  4PAB A;  1XZQ A;  5EGH A;  1SFO C;  1I50 C;  3GTO A;  4KN4 A;  1WCM A;  2V6U A;  3GEH A;  3A8I A;  3N3Y A;  1BDF A;  2NVY C;  2CFA B;  3CQZ K;  4OIO A;  1TWH K;  2JA5 A;  2Y0S D;  1WSV A;  5FLM K;  1PJ6 A;  1BGW A;  3L4J A;  4GT9 A;  4KMA A;  2V6S A;  4KN7 A;  1WQF A;  3HKZ L;  5IYB C;  1IW7 A;  1SFO A;  1I50 A;  1VLO A;  1WOO A;  1TWA K;  1WOS A;  3G4C A;  3IPJ A;  4OIN A;  2NVY A;  3TFJ A;  2VUM K;  2B63 A;  4QJV A;  5C4J K;  3GTJ K;  4WJ3 M;  4G0U A;  3TFH A;  3GTG A;  3AD7 C;  1TWC K;  1J98 A;  3S0X A;  4Y52 C;  4KC6 A;  3FHZ A;  3QX3 A;  1XXC A;  3GTK C;  1GE9 A;  4AYB D;  4A3B C;  5CHP A;  4KB4 A;  3M3Y C;  4G0W A;  1F7U A;  2NVX K;  4BY1 C;  4A3G K;  1O2B A;  4QIW L;  4WJ4 A;  3S1M C;  2JA6 K;  4LK0 A;  3V4G A;  2PA8 L;  2KWA A;  4C3I K;  2PHC B;  3GTK A;  4A3M K;  4BLA A;  2V6T A;  3A8J A;  3FKI C;  2YU9 C;  1ZYR A;  1EK8 A;  2R92 K;  4A3I K;  5IOS A;  2GSU A;  3S16 C;  1WIH A;  4A93 C;  3H3V L;  3GTP C;  1USM A;  2R93 K;  3HOX K;  4LR2 A;  5C4X C;  4XLP A;  2CW0 A;  3GSI A;  1HQM A;  4YFX A;  1C0A A;  3GTM K;  1F93 A;  1B4A A;  2JA5 K;  1O26 A;  2WAQ L;  4A3F K;  2PPB A;  4C45 A;  2NVQ K;  4KM9 A;  1IL2 A;  3S17 C;  1EFW A;  3GTP A;  1ZQ1 C;  1O2F B;  3I4N C;  4A3C C;  2XCQ A;  3HXA A;  1B4B A;  1J6W A;  5IYC K;  4C2M K;  4BXX C;  1EI6 A;  1XXB A;  4C3H C;  3HOZ C;  2GSO A;  4GTD A;  4M1X A;  3GTQ C;  2B63 K;  1I6H C;  3S2H C;  1DCH A;  3GTG K;  2A69 A;  3S1Q C;  4BY7 K;  3HOU K;  5C3E K;  2PMZ D;  2ZFZ A;  3TTG A;  4A3L C;  1F7V A;  2JH3 A;  4Y7N K;  4BBS C;  5IP7 C;  3K7A C;  4XSZ A;  2D6F C;  4BLB A;  1Y1W C;  4O2D A;  5M5X K;  3HKZ D;  5C44 K;  2R7Z A;  2JA7 C;  1R9T A;  1K83 C;  1O29 A;  4XLN A;  3FOF A;  3JST A;  1L0W A;  1ZVU A;  4RMF A;  4YFN A;  4OIQ A;  3H0G C;  3TFI A;  3WOD A;  2A6H A;  1Y1W A;  2A6E A;  3S15 C;  4OIR A;  3S14 K;  1IS1 A;  4A3D C;  2JA7 A;  3OEP A;  3PO2 C;  1XPP A;  4MQ9 A;  5JFE A;  2JA8 K;  2E2J C;  4OIP A;  3A8K A;  4J3N A;  3GTP K;  2PA8 D;  4KMD A;  2E2H C;  1ISE A;  5M5Y K;  4KB2 A;  4ILD A;  3EQL A;  1YX2 A;  5C4X K;  3S2D C;  1Y1V C;  2E2I K;  3RZD K;  3T02 A;  3H3V D;  4YFK A;  3T01 A;  5IYD K;  1BS2 A;  5M3F K;  3GEI A;  2E2H A;  3I4N K;  4A3C K;  4C3J C;  4A3J C;  3GEE A;  3S1N K;  2GAH C;  4BBR C;  1J6V A;  1YCL A;  2WAQ D;  4NOI A;  4LJZ A;  3M4O C;  3AD9 C;  3FOE A;  1I3Q K;  4XCH A;  1VJE A;  1WSR A;  2R7Z K;  5IP9 C;  1XZQ B;  4A3K C;  3I4M C;  1JVI A;  1R9T K;  5JVO A;  2A68 A;  1TWF C;  2FQT A;  5HL8 A;  2P5M A;  5TMF A;  4KMH A;  4KAW X;  1V5V A;  2GAG C;  3PO3 K;  4X6A C;  1DCP A;  1VRQ C;  1TWG C;  3GTO K;  4MEX A;  1WCM K;  1WQH A;  2O5I A;  3S1R C;  4LQY A;  3FKI A;  5TJ3 A;  2YU9 A;  2Y0S L;  3VA7 A;  4QJV B;  4A3E K;  3LPX A;  3ERE D;  3HOW C;  2NVT K;  2XCR B;  4A3D K;  5IOR A;  3BUE A;  1SFO K;  1I50 K;  1TWG A;  1IE0 A;  3N0C A;  1G51 A;  3CQZ C;  1TWH C;  2NVY K;  3RZO C;  5M3M K;  5FLM C;  2E2H K;  2ZUE A;  3HOV C;  3ADA C;  3MML B;  2XCO A;  4G0V A;  5IYB K;  1XXA A;  1EH1 A;  3AH5 A;  1TWA C;  4AYB L;  4KMU A;  3HOY C;  3AQO A;  1X31 C;  1DCO A;  3CQZ A;  5IOQ A;  1TWH A;  2VUM C;  4FM9 A;  5C4J C;  1WQG A;  3GTJ C;  2GSN A;  3GTQ A;  4G7H A;  4A3J K;  1TWC C;  2Y3P A;  1IQ0 A;  1SMY A;  1O28 A;  4Y52 K;  5IOT A;  1J6X A;  3GTK K;  4A3B K;  2NVX C;  4A3G C;  2VUM A;  3M3Y K;  2CFA A;  4BY1 K;  3GTJ A;  2JA6 C;  3S1M K;  1TWC A;  4C3I C;  2BE5 A;  4PAA A;  3NUH A;  1UV7 A;  3Q3Q A;  5TMC A;  4A3M C;  3FKI K;  4A3I C;  2YU9 K;  1K83 A;  1JQW A;  2NVX A;  3S16 K;  1VGX A;  1I6V A;  1O24 A;  4QIW D;  3LAJ A;  4A93 K;  4Q5S A;  2JA6 A;  4GZY A;  2FQO A;  3H0G A;  4GTB A;  2R93 C;  4ZH4 A;  3HOX C;  3GTL C;  1YNJ A;  3GTM C;  3S1R K;  4A3F C;  1DD5 A;  4KAS A;  2NVQ C;  1F9N A;  4GTC A;  3S17 K;  3SZY A;  2PMZ L;  2R93 A;  3GTL A;  2WB1 L;  5IYC C;  3DXJ A;  4C2M C;  3GTM A;  4BXX K;  3RZO K;  2B63 C;  4C3H K;  3HOZ K;  1Y1V A;  3GTQ K;  3HOV K;  1I6H K;  3GTG C;  5CJ9 A;  3S2H K;  4KAT A;  1WOR A;  4P9S A;  5L46 A;  3S1Q K;  4BY7 C;  3HOU C;  1YNN A;  3GIR A;  5C3E C;  5D4D A;  3HOY K;  4Y7N C;  1JOE A;  4A3L K;  4BBS K;  1XZP A;  3BP3 A;  5IP7 K;  3K7A K;  2P8T A;  3AQP A;  5C44 C;  2EBB A;  1Y1W K;  3SZZ A;  4LLG A;  2JA7 K;  4GTE A;  4GTL A;  1K83 K;  1TWF A;  5EGE A;  4G7O A;  1RU0 A;  3L4K A;  3LAP A;  4DDQ A;  3H0G K;  1AB4 A;  4KDD A;  3S14 C;  3S15 K;  4KM8 A;  4P5A A;  2O5J A;  4Q4Z A;  1PJ7 A;  3PO2 K;  3AD8 C;  2JA8 C;  2W7V A;  4MEY A;  2E2J K;  3GTL K;  1XZP B;  4YG2 A;  4KAR A;  1O25 A;  1PJ5 A;  4XSX A;  2ZUF A;  3OPF A;  3S2D K;  2E2I C;  3RZD C;  3BP8 C;  1Y1V K;  1HI9 A;  5IYD C;  4LK1 A;  4G7Z A;  3ORE A;  3S1N C;  4C3J K;  3T00 A;  4BBR K;  2E2I A;  1INN A;  1TWA A;  3M4O K;  1I3Q C;  4P5B A;  4WIL A;  2R7Z C;  4BKW A;  1WOP A;  5IP9 K;  1R9T C;  4A3K K;  1VH2 A;  2WB1 D;  3I4M K;  5FJ8 K;  1ZXO A;  3N0B A;  1O2A A; 
#chains in the Genus database with same CATH homology
 4GTC A;  4GFQ A;  3GTP A;  2P5M A;  3G4A A;  1BJT A;  2XCQ A;  2R93 A;  4KMH A;  4KAW X;  3GTL A;  1I3Q A;  4FZB A;  1B4B A;  4GTA A;  4C2M C;  3GTM A;  1XXB A;  4C3H C;  2GSO A;  4GTD A;  4M1X A;  1Y1V A;  3CAG A;  5CJ9 A;  4KAT A;  2RH6 A;  1WQH A;  1O27 A;  4LQY A;  3FKI A;  5TJ3 A;  2YU9 A;  2R92 A;  2RGR A;  1ZBS A;  3VA7 A;  2ZFZ A;  3LPX A;  3ERE D;  4GTF A;  2JH3 A;  1KQ4 A;  2XCR B;  5EGH A;  5IOR A;  3BUE A;  3GTO A;  3AQP A;  1TWG A;  1WCM A;  3N0C A;  4BLB A;  2R7Z A;  3N3Y A;  2CFA B;  1R9T A;  2JA5 A;  4GTE A;  1O29 A;  4GTL A;  3FOF A;  1BGW A;  3L4J A;  4GT9 A;  3MML B;  1TWF A;  4KMA A;  1ZVU A;  5EGE A;  1WQF A;  2XCO A;  1SFO A;  3L4K A;  3LAP A;  4G0V A;  1I50 A;  1XXA A;  1EH1 A;  3AH5 A;  4DDQ A;  1Y1W A;  3AQO A;  1AB4 A;  4KDD A;  3G4C A;  3CQZ A;  2NVY A;  1IS1 A;  4KM8 A;  1TWH A;  4P5A A;  5IOQ A;  2JA7 A;  3OEP A;  4FM9 A;  1WQG A;  2GSN A;  2B63 A;  3GTQ A;  4G0U A;  5JFE A;  3GTG A;  2Y3P A;  3S0X A;  1O28 A;  4KC6 A;  5IOT A;  3FHZ A;  3QX3 A;  1XXC A;  4J3N A;  1GE9 A;  4KMD A;  5CHP A;  1ISE A;  4KB4 A;  4KB2 A;  4ILD A;  4G0W A;  2VUM A;  4KAR A;  2CFA A;  1O2B A;  1O25 A;  3GTJ A;  3OPF A;  1TWC A;  3V4G A;  4C3I C;  2KWA A;  3NUH A;  3Q3Q A;  2PHC B;  4KM9 A;  3GTK A;  4BLA A;  2E2H A;  1EK8 A;  3ORE A;  4C3J C;  5IOS A;  1K83 A;  2GSU A;  2NVX A;  1WIH A;  1O24 A;  2JA6 A;  3LAJ A;  2E2I A;  3H0G A;  1TWA A;  4GTB A;  3FOE A;  4P5B A;  4LR2 A;  4BKW A;  1B4A A;  1DD5 A;  1O26 A;  4KAS A;  5JVO A;  1F9N A;  1ZXO A;  3N0B A;  1O2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...