4KATA

Crystal structure of fdts from t. maritima mutant (r174k) with fad and dump
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 77
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4katA00
4GTEA 5IOQA 1O29A 3G4CA 3N0BA 1O2BA 4KARA 4P5AA 1O27A 4GTLA 4KATA 5CHPA 5IORA 3N3YA 1O2AA 4GT9A 4GTDA 4GTBA 5IOTA 1KQ4A 5IOSA 1O25A 1O28A 5JFEA 4P5BA 4FZBA 3G4AA 4GTFA 4GTCA 4KASA 3N0CA 1O26A 2CFAB 2CFAA 4GTAA 1O24A 3AH5A
chains in the Genus database with same CATH superfamily
2A69A 3EQLA 3HKZL 2R92C 3GTPK 3GTOA 2ZFZA 2R7ZA 2W7VA 4KMAA 5C3EC 2E2HC 4A3CK 4A3IC 1WQFA 4QJVB 1O28A 2A68A 2R93K 1I3QA 4G7ZA 4RMFA 4OIRA 1BJTA 2JA5C 3I4NK 3BP3A 4XCHA 2WB1D 3JSTA 2VUMA 3GTKK 1RU0A 1WSRA 5IP7C 3G4CA 2Y0SL 3M3YC 2BE5A 3NUHA 4G0UA 4GTLA 4BLAA 4X6AC 4DDQA 4A3MK 3AD7C 2NVXA 2YU9K 1TWHA 5IOSA 1EI6A 3HOUK 4C3HC 1XZPB 3S2DC 3K7AC 2XCOA 3GTLK 5TMFA 1ZYRA 3V4GA 3ADAC 5C4JK 1TWCA 1IL2A 1R9TA 3I4MC 1Y1VA 3GTPC 3AH5A 2O5IA 1HQMA 1BGWA 1F93A 3H0GA 4AYBL 4A3JK 2JA8K 4LOWA 3M4OC 4AH6A 2R7ZK 4A3CC 3CAGA 2GSUA 1DCHA 3HXAA 4KN4A 1O2AA 3T00A 1WQGA 5M5YK 1Y1WK 3AQOA 4BXXK 3GTQA 2JA7K 3GTKC 2CFAA 4YFNA 3HOWK 3GTJK 1ISEA 4G0VA 2JA6K 4C45A 1WOOA 3RZDC 1JVIA 1B4AA 2P5MA 4A3MC 4C3IC 3GSIA 4XLNA 2FQOA 2YU9C 5TJ3A 3GTLC 4XSXA 5C4JC 3S1MK 4M1XA 2PMZL 4XLPA 1DCPA 3S1QK 3GEIA 4BBSC 1SMYA 5C3EK 2E2HK 3N0CA 1USMA 4A3IK 4A3JC 2JA8C 3HOVC 1Y1VK 3GTOC 1YX2A 2R7ZC 2NVYA 5IOQA 4OIQA 2NVTK 3S1RK 1I50A 2JA5K 4BY7C 3CQZA 4Q4ZA 2E2JC 1Y1WC 1VJEA 2XCRB 4KATA 1I3QC 4Y7NC 4J3NA 5IP7K 4BXXC 1TWAA 3GEEA 3HOWC 3GTJC 2VUMC 4C2MK 1HI9A 1EQRA 3S2DK 3GTGA 1ZQ1C 2V6SA 2FQTA 4BKWA 4NOIA 2PA8L 3I4MK 3HOYC 4OIOA 3S1MC 4P5AA 2E2IK 5L46A 1I6VA 1TWFA 1IS1A 3S1QC 1TWCC 4GTBA 3M4OK 2B63A 1PJ7A 2ZUFA 1R9TC 2ZUEA 4OINA 1Y1VC 5FLMK 4LLGA 1VRQC 3BUEA 3S17K 2NVTC 3S1RC 3S2HC 2NVQC 3S15C 4GT9A 4MQ9A 4O2DA 1WCMA 3A8KA 5EGHA 5C44K 4Q5SA 2RGRA 4BY1K 1SFOA 1TWGK 5IYDC 5D4DA 4BLBA 3RZDK 5JVOA 5CHPA 4ZH4A 3FOFA 5E68A 1BS2A 2Y3PA 2PPBA 3GTQC 3GTMA 1KQ4A 4C3IK 2GSOA 4C2MC 3DXJA 4P5BA 1YNNA 1ZVUA 2A6EA 3FKIA 4PABA 1J98A 1V5VA 2A6HA 1O26A 2V6UA 5EGEA 1EK8A 1J6XA 2PHCB 3LPXA 1F9NA 4BBSK 2E2IC 1JQWA 1YNJA 3GEHA 1WSVA 3TFJA 3HOVK 3GTOK 4G7OA 1YCLA 3WODA 1TWFK 4A3GK 4KC6A 1F7VA 2R92A 4BY7K 1IQ0A 2WAQL 5FLMC 2E2JK 5IOTA 1VH2A 1O25A 4QJVA 3S17C 1I3QK 4Y7NK 5M3MK 4YFKA 3MMLB 2GAHC 5C44C 1J6WA 2CW0A 4BY1C 4G7HA 1TWGC 4PAAA 2VUMK 1O29A 5IYCK 4Y52K 4WILA 1I6HC 1O27A 3GDZA 3HKZD 5IYBK 1K83A 3HOYK 2NVXK 1IBAA 1TWHK 4A3BC 1INNA 1XZPA 3GTGC 2XCQA 1GE9A 3FKIK 4OIPA 1TWCK 2GAGC 1R9TK 3ERED 3AD9C 1DD5A 1EFWA 3S1NC 1PJ5A 3H0GK 1TWFC 4A3GC 2RH6A 3S2HK 2NVQK 3GTPA 3S15K 3N0BA 2B63C 4A3DC 1IE0A 4A3FC 3OREA 4GFQA 2Y0SD 5IYDK 3BP8C 2R93A 3H3VL 4KM8A 3GTQK 1X31C 4XSZA 4Y52C 5IYCC 1SFOC 4MEXA 4C3JC 1DCOA 1XXCA 4MEYA 3GTKA 5IYBC 4WJ3M 4KMUA 3SZYA 3GTMC 2V6TA 2NVXC 1TWHC 3PO3K 1BDFA 1WQHA 4AYBD 4ILDA 1WOSA 3FKIC 1WOPA 2YU9A 1G51A 4BBRC 5JFEA 3GTLA 4A3LC 4QIWL 4GTCA 2WAQD 3LAPA 3H0GC 1VGXA 1JOEA 4GTAA 3OEPA 4KMHA 2NVYK 3IPJA 3T01A 1I50K 2GSNA 3CQZK 1USOA 3SZZA 3HOZC 1XZQA 4LR2A 1B4BA 1L0WA 4KN7A 5FJ8K 1Y1WA 1TWAK 3T02A 1I6HK 4KM9A 2JH3A 4FZBA 3TFIA 5M5XK 4GZYA 2JA7A 5HL8A 2CFAB 4A3BK 1ZXOA 3GTJA 3GTGK 2PMZD 2JA6A 4KB2A 3PO3C 1K83C 1IW7A 3L4KA 5C4XC 3S1NK 4LJZA 3TTGA 1XPPA 5IP9C 4LK0A 3PO2K 2B63K 4A93K 4A3DK 4GTFA 3HOXK 2E2HA 3AQPA 4A3FK 2NVYC 1WORA 1I50C 3H3VD 4YFXA 3CQZC 4WJ4A 1O2FB 1WCMK 2EBBA 2JA5A 3AD8C 3QX3A 3RZOK 1SFOK 1TWAC 4KARA 5TMCA 4C3JK 5M3FK 2R93C 5IORA 5M5WK 2PA8D 1VLOA 3GTMK 1UV7A 4A3KK 3I4NC 2WB1L 1ZBSA 3A8IA 3Q3QA 3S14K 4KASA 4A3EK 4BBRK 1C0AA 1PJ6A 1XXBA 4A3LK 3TFHA 4FM9A 4QIWD 3S16K 4GTEA 5CJ9A 1J6VA 3LAJA 3HOUC 2E2IA 3PO2C 4A93C 2R92K 2KWAA 3A8JA 3N3YA 3HOXC 4GTDA 4KB4A 2P8TA 3HOZK 4LK1A 1XXAA 3S0XA 1WCMC 2O5JA 1O24A 1AB4A 4JK1A 3RZOC 4G0WA 4KDDA 3L4JA 1WIHA 3FOEA 1XZQB 1TWGA 1O2BA 2D6FC 3GIRA 4A3KC 4LQYA 3OPFA 3FHZA 1K83K 3S14C 1EH1A 4A3EC 2JA7C 3M3YK 5C4XK 3VA7A 4X6AK 2JA6C 3G4AA 4KAWX 5IP9K 3S16C 1F7UA 4C3HK 3K7AK 4P9SA 4YG2A 4KMDA
chains in the Genus database with same CATH topology
4KB2A 2NVYA 5IOQA 1O29A 1I50A 3CQZA 3GTOA 2ZFZA 3L4KA 2XCRB 2R7ZA 1O27A 4KATA 4KMAA 4J3NA 1K83A 1TWAA 1WQFA 1O28A 2XCQA 1I3QA 1GE9A 4GTFA 2E2HA 3AQPA 1BJTA 3ERED 3GTGA 1DD5A 2VUMA 4BKWA 2RH6A 2JA5A 3GTPA 3G4CA 3QX3A 3N0BA 4KARA 4P5AA 4G0UA 3NUHA 4GTLA 1TWFA 1IS1A 4BLAA 5IORA 4DDQA 3OREA 4GTBA 4GFQA 1TWHA 5IOSA 2NVXA 2B63A 4C3HC 2R93A 2XCOA 1ZBSA 4KM8A 3Q3QA 3V4GA 1TWCA 4KASA 3BUEA 1R9TA 1XXBA 1Y1VA 4GT9A 4FM9A 3AH5A 4GTEA 4C3JC 1WCMA 1XXCA 1BGWA 3H0GA 3GTKA 5EGHA 5CJ9A 2RGRA 3LAJA 1SFOA 2E2IA 3CAGA 4BLBA 1WQHA 2GSUA 5JVOA 5CHPA 2KWAA 3N3YA 1O2AA 2Y3PA 4ILDA 1WQGA 4GTDA 4KB4A 3FOFA 2YU9A 3GTMA 1KQ4A 2GSOA 3AQOA 4C2MC 4P5BA 5JFEA 3GTLA 1ZVUA 1XXAA 4GTCA 3GTQA 3S0XA 3FKIA 3LAPA 1O26A 5EGEA 2CFAA 4GTAA 1EK8A 1ISEA 4G0VA 2PHCB 1O24A 1AB4A 3LPXA 3OEPA 1F9NA 4KMHA 4G0WA 4KDDA 3L4JA 1B4AA 2GSNA 1WIHA 3FOEA 2P5MA 1TWGA 1O2BA 4C3IC 4LR2A 4LQYA 1B4BA 4KC6A 2R92A 5TJ3A 3OPFA 3FHZA 1Y1WA 1EH1A 5IOTA 4M1XA 1O25A 3VA7A 4KM9A 2JH3A 4FZBA 3G4AA 4KAWX 3MMLB 2JA7A 3N0CA 2CFAB 1ZXOA 3GTJA 2JA6A 4KMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTE A;  5IOQ A;  1O29 A;  3G4C A;  3N0B A;  1O2B A;  4KAR A;  4P5A A;  1O27 A;  4GTL A;  4KAT A;  5CHP A;  5IOR A;  3N3Y A;  1O2A A;  4GT9 A;  4GTD A;  4GTB A;  5IOT A;  1KQ4 A;  5IOS A;  1O25 A;  1O28 A;  5JFE A;  4P5B A;  4FZB A;  3G4A A;  4GTF A;  4GTC A;  4KAS A;  3N0C A;  1O26 A;  2CFA B;  2CFA A;  4GTA A;  1O24 A;  3AH5 A; 
#chains in the Genus database with same CATH topology
 2A69 A;  3EQL A;  3HKZ L;  2R92 C;  3GTP K;  3GTO A;  2ZFZ A;  2R7Z A;  2W7V A;  4KMA A;  5C3E C;  2E2H C;  4A3C K;  4A3I C;  1WQF A;  4QJV B;  1O28 A;  2A68 A;  2R93 K;  1I3Q A;  4G7Z A;  4RMF A;  4OIR A;  1BJT A;  2JA5 C;  3I4N K;  3BP3 A;  4XCH A;  2WB1 D;  3JST A;  2VUM A;  3GTK K;  1RU0 A;  1WSR A;  5IP7 C;  3G4C A;  2Y0S L;  3M3Y C;  2BE5 A;  3NUH A;  4G0U A;  4GTL A;  4BLA A;  4X6A C;  4DDQ A;  4A3M K;  3AD7 C;  2NVX A;  2YU9 K;  1TWH A;  5IOS A;  1EI6 A;  3HOU K;  4C3H C;  1XZP B;  3S2D C;  3K7A C;  2XCO A;  3GTL K;  5TMF A;  1ZYR A;  3V4G A;  3ADA C;  5C4J K;  1TWC A;  1IL2 A;  1R9T A;  3I4M C;  1Y1V A;  3GTP C;  3AH5 A;  2O5I A;  1HQM A;  1BGW A;  1F93 A;  3H0G A;  4AYB L;  4A3J K;  2JA8 K;  4LOW A;  3M4O C;  4AH6 A;  2R7Z K;  4A3C C;  3CAG A;  2GSU A;  1DCH A;  3HXA A;  4KN4 A;  1O2A A;  3T00 A;  1WQG A;  5M5Y K;  1Y1W K;  3AQO A;  4BXX K;  3GTQ A;  2JA7 K;  3GTK C;  2CFA A;  4YFN A;  3HOW K;  3GTJ K;  1ISE A;  4G0V A;  2JA6 K;  4C45 A;  1WOO A;  3RZD C;  1JVI A;  1B4A A;  2P5M A;  4A3M C;  4C3I C;  3GSI A;  4XLN A;  2FQO A;  2YU9 C;  5TJ3 A;  3GTL C;  4XSX A;  5C4J C;  3S1M K;  4M1X A;  2PMZ L;  4XLP A;  1DCP A;  3S1Q K;  3GEI A;  4BBS C;  1SMY A;  5C3E K;  2E2H K;  3N0C A;  1USM A;  4A3I K;  4A3J C;  2JA8 C;  3HOV C;  1Y1V K;  3GTO C;  1YX2 A;  2R7Z C;  2NVY A;  5IOQ A;  4OIQ A;  2NVT K;  3S1R K;  1I50 A;  2JA5 K;  4BY7 C;  3CQZ A;  4Q4Z A;  2E2J C;  1Y1W C;  1VJE A;  2XCR B;  4KAT A;  1I3Q C;  4Y7N C;  4J3N A;  5IP7 K;  4BXX C;  1TWA A;  3GEE A;  3HOW C;  3GTJ C;  2VUM C;  4C2M K;  1HI9 A;  1EQR A;  3S2D K;  3GTG A;  1ZQ1 C;  2V6S A;  2FQT A;  4BKW A;  4NOI A;  2PA8 L;  3I4M K;  3HOY C;  4OIO A;  3S1M C;  4P5A A;  2E2I K;  5L46 A;  1I6V A;  1TWF A;  1IS1 A;  3S1Q C;  1TWC C;  4GTB A;  3M4O K;  2B63 A;  1PJ7 A;  2ZUF A;  1R9T C;  2ZUE A;  4OIN A;  1Y1V C;  5FLM K;  4LLG A;  1VRQ C;  3BUE A;  3S17 K;  2NVT C;  3S1R C;  3S2H C;  2NVQ C;  3S15 C;  4GT9 A;  4MQ9 A;  4O2D A;  1WCM A;  3A8K A;  5EGH A;  5C44 K;  4Q5S A;  2RGR A;  4BY1 K;  1SFO A;  1TWG K;  5IYD C;  5D4D A;  4BLB A;  3RZD K;  5JVO A;  5CHP A;  4ZH4 A;  3FOF A;  5E68 A;  1BS2 A;  2Y3P A;  2PPB A;  3GTQ C;  3GTM A;  1KQ4 A;  4C3I K;  2GSO A;  4C2M C;  3DXJ A;  4P5B A;  1YNN A;  1ZVU A;  2A6E A;  3FKI A;  4PAB A;  1J98 A;  1V5V A;  2A6H A;  1O26 A;  2V6U A;  5EGE A;  1EK8 A;  1J6X A;  2PHC B;  3LPX A;  1F9N A;  4BBS K;  2E2I C;  1JQW A;  1YNJ A;  3GEH A;  1WSV A;  3TFJ A;  3HOV K;  3GTO K;  4G7O A;  1YCL A;  3WOD A;  1TWF K;  4A3G K;  4KC6 A;  1F7V A;  2R92 A;  4BY7 K;  1IQ0 A;  2WAQ L;  5FLM C;  2E2J K;  5IOT A;  1VH2 A;  1O25 A;  4QJV A;  3S17 C;  1I3Q K;  4Y7N K;  5M3M K;  4YFK A;  3MML B;  2GAH C;  5C44 C;  1J6W A;  2CW0 A;  4BY1 C;  4G7H A;  1TWG C;  4PAA A;  2VUM K;  1O29 A;  5IYC K;  4Y52 K;  4WIL A;  1I6H C;  1O27 A;  3GDZ A;  3HKZ D;  5IYB K;  1K83 A;  3HOY K;  2NVX K;  1IBA A;  1TWH K;  4A3B C;  1INN A;  1XZP A;  3GTG C;  2XCQ A;  1GE9 A;  3FKI K;  4OIP A;  1TWC K;  2GAG C;  1R9T K;  3ERE D;  3AD9 C;  1DD5 A;  1EFW A;  3S1N C;  1PJ5 A;  3H0G K;  1TWF C;  4A3G C;  2RH6 A;  3S2H K;  2NVQ K;  3GTP A;  3S15 K;  3N0B A;  2B63 C;  4A3D C;  1IE0 A;  4A3F C;  3ORE A;  4GFQ A;  2Y0S D;  5IYD K;  3BP8 C;  2R93 A;  3H3V L;  4KM8 A;  3GTQ K;  1X31 C;  4XSZ A;  4Y52 C;  5IYC C;  1SFO C;  4MEX A;  4C3J C;  1DCO A;  1XXC A;  4MEY A;  3GTK A;  5IYB C;  4WJ3 M;  4KMU A;  3SZY A;  3GTM C;  2V6T A;  2NVX C;  1TWH C;  3PO3 K;  1BDF A;  1WQH A;  4AYB D;  4ILD A;  1WOS A;  3FKI C;  1WOP A;  2YU9 A;  1G51 A;  4BBR C;  5JFE A;  3GTL A;  4A3L C;  4QIW L;  4GTC A;  2WAQ D;  3LAP A;  3H0G C;  1VGX A;  1JOE A;  4GTA A;  3OEP A;  4KMH A;  2NVY K;  3IPJ A;  3T01 A;  1I50 K;  2GSN A;  3CQZ K;  1USO A;  3SZZ A;  3HOZ C;  1XZQ A;  4LR2 A;  1B4B A;  1L0W A;  4KN7 A;  5FJ8 K;  1Y1W A;  1TWA K;  3T02 A;  1I6H K;  4KM9 A;  2JH3 A;  4FZB A;  3TFI A;  5M5X K;  4GZY A;  2JA7 A;  5HL8 A;  2CFA B;  4A3B K;  1ZXO A;  3GTJ A;  3GTG K;  2PMZ D;  2JA6 A;  4KB2 A;  3PO3 C;  1K83 C;  1IW7 A;  3L4K A;  5C4X C;  3S1N K;  4LJZ A;  3TTG A;  1XPP A;  5IP9 C;  4LK0 A;  3PO2 K;  2B63 K;  4A93 K;  4A3D K;  4GTF A;  3HOX K;  2E2H A;  3AQP A;  4A3F K;  2NVY C;  1WOR A;  1I50 C;  3H3V D;  4YFX A;  3CQZ C;  4WJ4 A;  1O2F B;  1WCM K;  2EBB A;  2JA5 A;  3AD8 C;  3QX3 A;  3RZO K;  1SFO K;  1TWA C;  4KAR A;  5TMC A;  4C3J K;  5M3F K;  2R93 C;  5IOR A;  5M5W K;  2PA8 D;  1VLO A;  3GTM K;  1UV7 A;  4A3K K;  3I4N C;  2WB1 L;  1ZBS A;  3A8I A;  3Q3Q A;  3S14 K;  4KAS A;  4A3E K;  4BBR K;  1C0A A;  1PJ6 A;  1XXB A;  4A3L K;  3TFH A;  4FM9 A;  4QIW D;  3S16 K;  4GTE A;  5CJ9 A;  1J6V A;  3LAJ A;  3HOU C;  2E2I A;  3PO2 C;  4A93 C;  2R92 K;  2KWA A;  3A8J A;  3N3Y A;  3HOX C;  4GTD A;  4KB4 A;  2P8T A;  3HOZ K;  4LK1 A;  1XXA A;  3S0X A;  1WCM C;  2O5J A;  1O24 A;  1AB4 A;  4JK1 A;  3RZO C;  4G0W A;  4KDD A;  3L4J A;  1WIH A;  3FOE A;  1XZQ B;  1TWG A;  1O2B A;  2D6F C;  3GIR A;  4A3K C;  4LQY A;  3OPF A;  3FHZ A;  1K83 K;  3S14 C;  1EH1 A;  4A3E C;  2JA7 C;  3M3Y K;  5C4X K;  3VA7 A;  4X6A K;  2JA6 C;  3G4A A;  4KAW X;  5IP9 K;  3S16 C;  1F7U A;  4C3H K;  3K7A K;  4P9S A;  4YG2 A;  4KMD A; 
#chains in the Genus database with same CATH homology
 4KB2 A;  2NVY A;  5IOQ A;  1O29 A;  1I50 A;  3CQZ A;  3GTO A;  2ZFZ A;  3L4K A;  2XCR B;  2R7Z A;  1O27 A;  4KAT A;  4KMA A;  4J3N A;  1K83 A;  1TWA A;  1WQF A;  1O28 A;  2XCQ A;  1I3Q A;  1GE9 A;  4GTF A;  2E2H A;  3AQP A;  1BJT A;  3ERE D;  3GTG A;  1DD5 A;  2VUM A;  4BKW A;  2RH6 A;  2JA5 A;  3GTP A;  3G4C A;  3QX3 A;  3N0B A;  4KAR A;  4P5A A;  4G0U A;  3NUH A;  4GTL A;  1TWF A;  1IS1 A;  4BLA A;  5IOR A;  4DDQ A;  3ORE A;  4GTB A;  4GFQ A;  1TWH A;  5IOS A;  2NVX A;  2B63 A;  4C3H C;  2R93 A;  2XCO A;  1ZBS A;  4KM8 A;  3Q3Q A;  3V4G A;  1TWC A;  4KAS A;  3BUE A;  1R9T A;  1XXB A;  1Y1V A;  4GT9 A;  4FM9 A;  3AH5 A;  4GTE A;  4C3J C;  1WCM A;  1XXC A;  1BGW A;  3H0G A;  3GTK A;  5EGH A;  5CJ9 A;  2RGR A;  3LAJ A;  1SFO A;  2E2I A;  3CAG A;  4BLB A;  1WQH A;  2GSU A;  5JVO A;  5CHP A;  2KWA A;  3N3Y A;  1O2A A;  2Y3P A;  4ILD A;  1WQG A;  4GTD A;  4KB4 A;  3FOF A;  2YU9 A;  3GTM A;  1KQ4 A;  2GSO A;  3AQO A;  4C2M C;  4P5B A;  5JFE A;  3GTL A;  1ZVU A;  1XXA A;  4GTC A;  3GTQ A;  3S0X A;  3FKI A;  3LAP A;  1O26 A;  5EGE A;  2CFA A;  4GTA A;  1EK8 A;  1ISE A;  4G0V A;  2PHC B;  1O24 A;  1AB4 A;  3LPX A;  3OEP A;  1F9N A;  4KMH A;  4G0W A;  4KDD A;  3L4J A;  1B4A A;  2GSN A;  1WIH A;  3FOE A;  2P5M A;  1TWG A;  1O2B A;  4C3I C;  4LR2 A;  4LQY A;  1B4B A;  4KC6 A;  2R92 A;  5TJ3 A;  3OPF A;  3FHZ A;  1Y1W A;  1EH1 A;  5IOT A;  4M1X A;  1O25 A;  3VA7 A;  4KM9 A;  2JH3 A;  4FZB A;  3G4A A;  4KAW X;  3MML B;  2JA7 A;  3N0C A;  2CFA B;  1ZXO A;  3GTJ A;  2JA6 A;  4KMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...