4KAWX

Crystal structure of ribosome recycling factor mutant r39g from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSGITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 64
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kawX01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kawX02
1DD5A 4OYDB 5MLC9 1BJTA 4KAWX 3CAGA 3V4GA 1WIHA 1WQHA 5JSBB 1EK8A 4KC6A 1BGWA 4J3NA 3L4JA 2RGRA 3FOFA 1ZVUA 2ZFZA 4L8IA 3OREA 1WQFA 4G0WA 3BUEA 3NUHA 5JVOA 4KB2A 5JSNB 3L4KA 3FOEA 1B4BA 2XCOA 3MMLB 2XCQA 4DDQA 4FM9A 3QX3A 4G0VA 3FHZA 1IS1A 1AB4A 3OPFA 4JLRC 4G0UA 2Y3PA 1XXCA 2PHCB 4KDDA 5CJ9A 2XCRB 3ERED 3LHPS 1XXBA 3LAPA 3LF9A 1Y698 2P5MA 3OEPA 4KB4A 1WQGA 4GFQA 1GE9A 2KWAA 1F9NA 1EH1A 3LPXA 3LAJA 1ISEA 1XXAA 3VA7A 1B4AA
chains in the Genus database with same CATH superfamily
4NOIA 1F93A 2A68A 2ZUEA 3M4OC 1MIUA 1ISEA 4J3NA 2RGRA 2ZFZA 3S15K 4L8IA 1Y1VA 3S1NC 3FOEA 4A3JC 4G0VA 2V6SA 3K5MA 3EQLA 3N0BA 3I4MK 1TWFK 4X6AC 1ZYRA 2R7ZA 2NVXC 1F7UA 5IOTA 2YU9A 4G7ZA 2JA5C 2NVYA 4FXDA 5IP7K 4KATA 4F3EA 1JOEA 1O29A 1R9TC 3KYLA 2JA8C 4KMUA 1TWGA 3GTPA 1XZPA 2JA5K 5C44C 3AH5A 1TWCK 1EQRA 1WQHA 4A3IK 4BBSK 4Q5GA 3BP8C 3FOFA 2A6ED 3HOXC 4P9SA 5C3EK 3GTOA 1A36A 3S14C 4JK1A 3OPFA 1WOOA 3GTPK 3I4NK 4XSZA 3K57A 5C4XC 3AD8C 2Y0SD 4C45A 3LHPS 4QIWL 3A8JA 4KB4A 1O28A 4A3CK 4BLAA 5JFEA 3CAGA 3AQPA 1Y1VK 1HQMD 1BGWA 3L4JA 1ZXOA 3HOZC 4KARA 1TWHA 3BUEA 4C2MC 3L4KA 4LLGA 1WOSA 2FQTA 5IYCK 1O25A 3H3VL 3GTGA 3P9AA 5IORA 3GTJK 3ERED 4GTLA 3GTOC 4AN8A 1HI9A 3HKZD 3LAJA 1X31C 4A3EK 1JQWA 2RH6A 2PMZL 2V6TA 3T02A 2R92K 1I6HK 2P8TA 1L0WA 4A3GK 2PMZA 2Y0SL 5M5XK 1Y1WC 3K5OA 3JSTA 3S16C 5E68A 1LPQA 2XCQA 1Q8IA 4KM9A 1G51A 4WILA 1R5ZA 3IAYA 2JH3A 2R92A 1SC7A 4A3GC 2NVTK 2O5JD 3WODA 3HOVC 1Y698 3S0XA 5C9HA 1BDFA 4BBRK 4O26A 5IOQA 2PPBA 3K5NA 1VJEA 3S1QC 4BXXK 4YFKA 3GIRA 4A3BK 4BY7K 3OREA 3M3YK 4KB2A 4QCLA 2YU9K 3S1RK 3MAQA 3G4AA 2WB1D 4FM9A 1O27A 4A3BC 4BY7C 3GTMC 2ZUFA 3HOZK 1ZBSA 1SFOA 3FKIK 4GTAA 1USOA 1YNND 4AYBD 4WJ3M 3HOVK 1ZQ1C 4A3CC 1VRQC 4H3TA 4A3LK 2A68D 3S1MK 3A8IA 1J6WA 3IPJA 1WCMA 1TWGC 4LR2A 5C4JC 4YFNA 2GSOA 3K7AK 4LQYA 1O26A 4LK0A 3H0GK 2NVXA 2R7ZC 4MEYA 3S2DC 2PHCB 1IW7D 4D3ZA 2PA8L 4QIWD 1NH3A 1YNJA 4IP8A 2P5MA 4Y7NC 2B63K 2E2HK 1I50C 3GEHA 5HL8A 5IP9C 2E2IK 4XSXA 1DCHA 3SZYA 3V4GA 5M3FK 1XZPB 4AH6A 3S2DK 5CQGA 1TWFC 3I4MC 3T00A 4P5BA 2GSNA 4LMOA 3K7AC 1PJ6A 4A3JK 4GT9A 4P5AA 4O2DA 4YFXA 2GSUA 2A69A 4ZH4A 5TJ3A 3TFHA 2JA6C 3OEPA 5EGEA 4A3EC 1GE9A 2E2IC 2R4GA 4A3MC 3LPXA 2PMZD 2E2HA 3BP3A 4Y7NK 4OIPA 3GTJC 3GTPC 2VUMA 3K59A 2BE5A 5TMFA 3G4CA 3RZOC 1I3QC 1IE0A 5IYCC 2F4QA 2FQOA 1RR8C 1DCPA 2VUMK 3GSIA 4JLRC 1TWGK 4BXXC 3T01A 1SMYD 5CJ9A 3CQZC 4GTBA 4AHCA 4BY1C 1BS2A 4Q4ZA 4X6AK 3FKIC 4QJVA 3TFJA 2WAQL 4KN4A 3HOWC 2WAQD 2CW0D 2NVQK 3TFIA 1SFOK 3GTQK 2WB1L 3MMLB 3HOXK 4EJ3A 1T8IA 3M3YC 3GTGK 4KM8A 2Y3PA 4A3IC 3WVOA 1SMYA 3AD9C 3S1QK 2E2HC 1EJ9A 1C0AA 2KWAA 4YG2A 1IL2A 2B63C 1RRJA 3HXAA 3K5LA 1I50A 3Q3QA 3AQOA 3GTOK 1BJTA 4C2MA 4PAAA 2NVXK 3GTGC 4A3DK 1IBAA 2JA7A 4Y52K 4BKWA 2CW0A 3NUHA 1IW7A 4KASA 1Y1WA 4C2MK 4OINA 1YCLA 2R93A 3HOWK 1Y1VC 1O2AA 3S15C 4A3LC 1WCMK 3GTLA 1K4SA 2PA8D 1VLOA 3LF9A 2R92C 1EFWA 1I6HC 5IYDC 3RZDC 3K58A 4ILDA 4Q5SA 3GTKA 3GTKC 1VH2A 5M3MK 1WCMC 3GTJA 2VUMC 2CFAA 1YX2A 2Y0SA 1I3QK 3H3VD 2E2IA 4G0UA 4Y52C 2WB1A 4GZYA 4LOWA 4NOLA 4QIWA 1TWCC 1KQ4A 5C44K 4IP9A 1IQ0A 1TWHK 1TWAK 3HKZL 3PO2K 4XCHA 1USMA 1A31A 5M5YK 1EI6A 5FLMC 3VA7A 2EBBA 4FZBA 1R49A 4NOMA 2WAQA 5IOSA 4KC6A 4KN7A 3I4NC 3AD7C 4A3FC 1VGXA 1B4BA 3GTQC 1SFOC 1Y1WK 4GTDA 2NVQC 1XZQA 1O24A 1F7VA 4RMFA 4BBSC 1K4TA 4G7OA 3HKZA 1O2BA 3DXJA 3FKIA 3M4AA 1I50K 5IP9K 4BY1K 2JA5A 1F9NA 1RU0A 1EH1A 3GDZA 1XZQB 3SJRA 1TWCA 1R9TK 1TWAC 3PO2C 5M5WK 5D4DA 2BE5D 2V6UA 1JVIA 2R7ZK 4LK1A 3S17K 1XPPA 1WSRA 1J98A 2NVYK 4GTFA 4WJ4A 3QX3A 1TWFA 5C4JK 1UV7A 3GEIA 1AB4A 2O5IA 3A8KA 4QJVB 2O5JA 4A3KK 3M4OK 2R93C 3GTQA 4C3IC 3GEEA 4BLBA 2A69D 4OIRA 1WQGA 3HOUK 4MEXA 1K83K 5IYDK 1A35A 1B4AA 3H0GA 3HOYK 1DD5A 5MLC9 5C4XK 4GTEA 4KAWX 2JA6K 1TGOA 1EK8A 4A3KC 2D6FC 2R93K 4NOKA 1I6VA 3S14K 2B63A 4M1XA 4G0WA 5C3EC 5JSNB 4A3FK 2JA6A 4DDQA 2JA7K 3TTGA 3PO3C 1YNJD 3N0CA 4KDDA 4GTCA 5L46A 1DCOA 5IYBK 1WOPA 5FLMK 1V9MA 4BBRC 3ADAC 4OIOA 2JA8K 1TWAA 1V5VA 1TWHC 4LJZA 5IP7C 2E2JK 5IYBC 3GTLC 2NVTC 4OYDB 1I3QA 1O2FB 4KMDA 1WIHA 1I6VD 1SEUA 4KMHA 5JVOA 1ZYRD 3H0GC 4AYBL 3S16K 2XCOA 3S1NK 2B9SB 2CFAB 2GAGC 3FHZA 4D3YA 3SZZA 4AYBA 1IS1A 1YNNA 5FJ8K 3GTKK 1TL8A 4MQ9A 2W7VA 3S1MC 1XXBA 3LAPA 4XLPA 3GTLK 3HOUC 2E2JC 1PJ7A 3RZDK 3S2HC 1J6VA 4A93K 3DU6A 1WSVA 2A6EA 4G7HA 3DU5A 1HQMA 4C3IK 2A6HD 1R9TA 4OIQA 4FYDA 4C3HC 3CQZK 5JSBB 5EGHA 1PJ5A 1ZVUA 4C3JK 3PO3K 1WQFA 3GTMK 5TMCA 4Q5VA 2JA7C 2NVYC 1WORA 3S1RC 3S17C 2YU9C 4C3JC 2A6HA 5CHPA 3RZOK 4FGUA 4A3DC 3GTMA 1XXCA 4C3HK 2XCRB 1INNA 1J6XA 3CQZA 2GAHC 4KMAA 4XLNA 3HOYC 4A93C 4GFQA 3S2HK 4A3MK 1K83C 1K83A 3N3YA 1XXAA 4PABA
chains in the Genus database with same CATH topology
2BE5D 1MIUA 3N3YA 4J3NA 2RGRA 2CW0D 2ZFZA 4L8IA 3OREA 1Y1VA 4GTFA 4KB2A 4QCLA 3FOEA 3MAQA 3G4AA 3MMLB 3QX3A 1TWFA 4FM9A 1O27A 4EJ3A 4G0VA 1T8IA 3K5MA 3N0BA 1AB4A 4KM8A 2Y3PA 1ZBSA 2R7ZA 3GTQA 3WVOA 5IOTA 1SFOA 2YU9A 4C3IC 4GTAA 2NVYA 4FXDA 4BLBA 4KATA 2A69D 4F3EA 1O29A 1WQGA 3KYLA 1YNND 1EJ9A 2KWAA 1TWGA 1RRJA 3GTPA 1A35A 3K5LA 3H0GA 1I50A 1B4AA 1DD5A 5MLC9 3AQOA 3AH5A 3Q3QA 4H3TA 4KAWX 4C2MA 1BJTA 2A68D 4GTEA 1TGOA 1WQHA 1EK8A 4Q5GA 1WCMA 4NOKA 1XXAA 3FOFA 2JA7A 2B63A 4LR2A 4M1XA 4G0WA 4BKWA 3NUHA 5JSNB 2GSOA 4KASA 4LQYA 1Y1WA 2JA6A 2A6ED 1O26A 4DDQA 3GTOA 1A36A 2R93A 2NVXA 3OPFA 1O2AA 1YNJD 3N0CA 2PHCB 1IW7D 4KDDA 4D3ZA 3K57A 1K4SA 3GTLA 4GTCA 3LHPS 3LF9A 1V9MA 1NH3A 4IP8A 4KB4A 1O28A 2P5MA 1TWAA 3K58A 4ILDA 4BLAA 4OYDB 3GTKA 1I3QA 5JFEA 3V4GA 3CAGA 4KMDA 1WIHA 1I6VD 1SEUA 3AQPA 5CQGA 1HQMD 1BGWA 3GTJA 1ZXOA 3L4JA 4KARA 1TWHA 2CFAA 2Y0SA 4KMHA 3BUEA 4P5BA 4C2MC 5JVOA 1ZYRD 2GSNA 4LMOA 3L4KA 2XCOA 2B9SB 2CFAB 1O25A 3GTGA 4GT9A 4D3YA 2E2IA 4AYBA 1IS1A 4P5AA 3FHZA 2GSUA 2WB1A 4G0UA 3P9AA 4NOLA 4QIWA 1TL8A 5TJ3A 1KQ4A 5IORA 3ERED 4GTLA 4IP9A 4AN8A 1XXBA 3LAPA 3OEPA 5EGEA 1GE9A 2R4GA 1A31A 3LPXA 3DU6A 3LAJA 3VA7A 3DU5A 2RH6A 2E2HA 4FZBA 2A6HD 1R49A 1R9TA 4FYDA 4NOMA 4C3HC 2WAQA 5JSBB 4KC6A 5IOSA 2PMZA 2VUMA 5EGHA 3K59A 1ZVUA 3G4CA 3K5OA 1WQFA 4Q5VA 1B4BA 1LPQA 2XCQA 2F4QA 1Q8IA 4KM9A 4C3JC 1RR8C 4GTDA 5CHPA 4FGUA 4JLRC 1R5ZA 3IAYA 3GTMA 1O24A 1XXCA 2JH3A 2R92A 1SC7A 1SMYD 1K4TA 5CJ9A 2XCRB 3HKZA 3CQZA 2O5JD 1O2BA 4GTBA 4KMAA 3FKIA 1Y698 3S0XA 3M4AA 4GFQA 5C9HA 2JA5A 4O26A 1F9NA 1EH1A 4AHCA 3SJRA 1K83A 1ISEA 1TWCA 5IOQA 3K5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD5 A;  4OYD B;  5MLC 9;  1BJT A;  4KAW X;  3CAG A;  3V4G A;  1WIH A;  1WQH A;  5JSB B;  1EK8 A;  4KC6 A;  1BGW A;  4J3N A;  3L4J A;  2RGR A;  3FOF A;  1ZVU A;  2ZFZ A;  4L8I A;  3ORE A;  1WQF A;  4G0W A;  3BUE A;  3NUH A;  5JVO A;  4KB2 A;  5JSN B;  3L4K A;  3FOE A;  1B4B A;  2XCO A;  3MML B;  2XCQ A;  4DDQ A;  4FM9 A;  3QX3 A;  4G0V A;  3FHZ A;  1IS1 A;  1AB4 A;  3OPF A;  4JLR C;  4G0U A;  2Y3P A;  1XXC A;  2PHC B;  4KDD A;  5CJ9 A;  2XCR B;  3ERE D;  3LHP S;  1XXB A;  3LAP A;  3LF9 A;  1Y69 8;  2P5M A;  3OEP A;  4KB4 A;  1WQG A;  4GFQ A;  1GE9 A;  2KWA A;  1F9N A;  1EH1 A;  3LPX A;  3LAJ A;  1ISE A;  1XXA A;  3VA7 A;  1B4A A; 
#chains in the Genus database with same CATH topology
 4NOI A;  1F93 A;  2A68 A;  2ZUE A;  3M4O C;  1MIU A;  1ISE A;  4J3N A;  2RGR A;  2ZFZ A;  3S15 K;  4L8I A;  1Y1V A;  3S1N C;  3FOE A;  4A3J C;  4G0V A;  2V6S A;  3K5M A;  3EQL A;  3N0B A;  3I4M K;  1TWF K;  4X6A C;  1ZYR A;  2R7Z A;  2NVX C;  1F7U A;  5IOT A;  2YU9 A;  4G7Z A;  2JA5 C;  2NVY A;  4FXD A;  5IP7 K;  4KAT A;  4F3E A;  1JOE A;  1O29 A;  1R9T C;  3KYL A;  2JA8 C;  4KMU A;  1TWG A;  3GTP A;  1XZP A;  2JA5 K;  5C44 C;  3AH5 A;  1TWC K;  1EQR A;  1WQH A;  4A3I K;  4BBS K;  4Q5G A;  3BP8 C;  3FOF A;  2A6E D;  3HOX C;  4P9S A;  5C3E K;  3GTO A;  1A36 A;  3S14 C;  4JK1 A;  3OPF A;  1WOO A;  3GTP K;  3I4N K;  4XSZ A;  3K57 A;  5C4X C;  3AD8 C;  2Y0S D;  4C45 A;  3LHP S;  4QIW L;  3A8J A;  4KB4 A;  1O28 A;  4A3C K;  4BLA A;  5JFE A;  3CAG A;  3AQP A;  1Y1V K;  1HQM D;  1BGW A;  3L4J A;  1ZXO A;  3HOZ C;  4KAR A;  1TWH A;  3BUE A;  4C2M C;  3L4K A;  4LLG A;  1WOS A;  2FQT A;  5IYC K;  1O25 A;  3H3V L;  3GTG A;  3P9A A;  5IOR A;  3GTJ K;  3ERE D;  4GTL A;  3GTO C;  4AN8 A;  1HI9 A;  3HKZ D;  3LAJ A;  1X31 C;  4A3E K;  1JQW A;  2RH6 A;  2PMZ L;  2V6T A;  3T02 A;  2R92 K;  1I6H K;  2P8T A;  1L0W A;  4A3G K;  2PMZ A;  2Y0S L;  5M5X K;  1Y1W C;  3K5O A;  3JST A;  3S16 C;  5E68 A;  1LPQ A;  2XCQ A;  1Q8I A;  4KM9 A;  1G51 A;  4WIL A;  1R5Z A;  3IAY A;  2JH3 A;  2R92 A;  1SC7 A;  4A3G C;  2NVT K;  2O5J D;  3WOD A;  3HOV C;  1Y69 8;  3S0X A;  5C9H A;  1BDF A;  4BBR K;  4O26 A;  5IOQ A;  2PPB A;  3K5N A;  1VJE A;  3S1Q C;  4BXX K;  4YFK A;  3GIR A;  4A3B K;  4BY7 K;  3ORE A;  3M3Y K;  4KB2 A;  4QCL A;  2YU9 K;  3S1R K;  3MAQ A;  3G4A A;  2WB1 D;  4FM9 A;  1O27 A;  4A3B C;  4BY7 C;  3GTM C;  2ZUF A;  3HOZ K;  1ZBS A;  1SFO A;  3FKI K;  4GTA A;  1USO A;  1YNN D;  4AYB D;  4WJ3 M;  3HOV K;  1ZQ1 C;  4A3C C;  1VRQ C;  4H3T A;  4A3L K;  2A68 D;  3S1M K;  3A8I A;  1J6W A;  3IPJ A;  1WCM A;  1TWG C;  4LR2 A;  5C4J C;  4YFN A;  2GSO A;  3K7A K;  4LQY A;  1O26 A;  4LK0 A;  3H0G K;  2NVX A;  2R7Z C;  4MEY A;  3S2D C;  2PHC B;  1IW7 D;  4D3Z A;  2PA8 L;  4QIW D;  1NH3 A;  1YNJ A;  4IP8 A;  2P5M A;  4Y7N C;  2B63 K;  2E2H K;  1I50 C;  3GEH A;  5HL8 A;  5IP9 C;  2E2I K;  4XSX A;  1DCH A;  3SZY A;  3V4G A;  5M3F K;  1XZP B;  4AH6 A;  3S2D K;  5CQG A;  1TWF C;  3I4M C;  3T00 A;  4P5B A;  2GSN A;  4LMO A;  3K7A C;  1PJ6 A;  4A3J K;  4GT9 A;  4P5A A;  4O2D A;  4YFX A;  2GSU A;  2A69 A;  4ZH4 A;  5TJ3 A;  3TFH A;  2JA6 C;  3OEP A;  5EGE A;  4A3E C;  1GE9 A;  2E2I C;  2R4G A;  4A3M C;  3LPX A;  2PMZ D;  2E2H A;  3BP3 A;  4Y7N K;  4OIP A;  3GTJ C;  3GTP C;  2VUM A;  3K59 A;  2BE5 A;  5TMF A;  3G4C A;  3RZO C;  1I3Q C;  1IE0 A;  5IYC C;  2F4Q A;  2FQO A;  1RR8 C;  1DCP A;  2VUM K;  3GSI A;  4JLR C;  1TWG K;  4BXX C;  3T01 A;  1SMY D;  5CJ9 A;  3CQZ C;  4GTB A;  4AHC A;  4BY1 C;  1BS2 A;  4Q4Z A;  4X6A K;  3FKI C;  4QJV A;  3TFJ A;  2WAQ L;  4KN4 A;  3HOW C;  2WAQ D;  2CW0 D;  2NVQ K;  3TFI A;  1SFO K;  3GTQ K;  2WB1 L;  3MML B;  3HOX K;  4EJ3 A;  1T8I A;  3M3Y C;  3GTG K;  4KM8 A;  2Y3P A;  4A3I C;  3WVO A;  1SMY A;  3AD9 C;  3S1Q K;  2E2H C;  1EJ9 A;  1C0A A;  2KWA A;  4YG2 A;  1IL2 A;  2B63 C;  1RRJ A;  3HXA A;  3K5L A;  1I50 A;  3Q3Q A;  3AQO A;  3GTO K;  1BJT A;  4C2M A;  4PAA A;  2NVX K;  3GTG C;  4A3D K;  1IBA A;  2JA7 A;  4Y52 K;  4BKW A;  2CW0 A;  3NUH A;  1IW7 A;  4KAS A;  1Y1W A;  4C2M K;  4OIN A;  1YCL A;  2R93 A;  3HOW K;  1Y1V C;  1O2A A;  3S15 C;  4A3L C;  1WCM K;  3GTL A;  1K4S A;  2PA8 D;  1VLO A;  3LF9 A;  2R92 C;  1EFW A;  1I6H C;  5IYD C;  3RZD C;  3K58 A;  4ILD A;  4Q5S A;  3GTK A;  3GTK C;  1VH2 A;  5M3M K;  1WCM C;  3GTJ A;  2VUM C;  2CFA A;  1YX2 A;  2Y0S A;  1I3Q K;  3H3V D;  2E2I A;  4G0U A;  4Y52 C;  2WB1 A;  4GZY A;  4LOW A;  4NOL A;  4QIW A;  1TWC C;  1KQ4 A;  5C44 K;  4IP9 A;  1IQ0 A;  1TWH K;  1TWA K;  3HKZ L;  3PO2 K;  4XCH A;  1USM A;  1A31 A;  5M5Y K;  1EI6 A;  5FLM C;  3VA7 A;  2EBB A;  4FZB A;  1R49 A;  4NOM A;  2WAQ A;  5IOS A;  4KC6 A;  4KN7 A;  3I4N C;  3AD7 C;  4A3F C;  1VGX A;  1B4B A;  3GTQ C;  1SFO C;  1Y1W K;  4GTD A;  2NVQ C;  1XZQ A;  1O24 A;  1F7V A;  4RMF A;  4BBS C;  1K4T A;  4G7O A;  3HKZ A;  1O2B A;  3DXJ A;  3FKI A;  3M4A A;  1I50 K;  5IP9 K;  4BY1 K;  2JA5 A;  1F9N A;  1RU0 A;  1EH1 A;  3GDZ A;  1XZQ B;  3SJR A;  1TWC A;  1R9T K;  1TWA C;  3PO2 C;  5M5W K;  5D4D A;  2BE5 D;  2V6U A;  1JVI A;  2R7Z K;  4LK1 A;  3S17 K;  1XPP A;  1WSR A;  1J98 A;  2NVY K;  4GTF A;  4WJ4 A;  3QX3 A;  1TWF A;  5C4J K;  1UV7 A;  3GEI A;  1AB4 A;  2O5I A;  3A8K A;  4QJV B;  2O5J A;  4A3K K;  3M4O K;  2R93 C;  3GTQ A;  4C3I C;  3GEE A;  4BLB A;  2A69 D;  4OIR A;  1WQG A;  3HOU K;  4MEX A;  1K83 K;  5IYD K;  1A35 A;  1B4A A;  3H0G A;  3HOY K;  1DD5 A;  5MLC 9;  5C4X K;  4GTE A;  4KAW X;  2JA6 K;  1TGO A;  1EK8 A;  4A3K C;  2D6F C;  2R93 K;  4NOK A;  1I6V A;  3S14 K;  2B63 A;  4M1X A;  4G0W A;  5C3E C;  5JSN B;  4A3F K;  2JA6 A;  4DDQ A;  2JA7 K;  3TTG A;  3PO3 C;  1YNJ D;  3N0C A;  4KDD A;  4GTC A;  5L46 A;  1DCO A;  5IYB K;  1WOP A;  5FLM K;  1V9M A;  4BBR C;  3ADA C;  4OIO A;  2JA8 K;  1TWA A;  1V5V A;  1TWH C;  4LJZ A;  5IP7 C;  2E2J K;  5IYB C;  3GTL C;  2NVT C;  4OYD B;  1I3Q A;  1O2F B;  4KMD A;  1WIH A;  1I6V D;  1SEU A;  4KMH A;  5JVO A;  1ZYR D;  3H0G C;  4AYB L;  3S16 K;  2XCO A;  3S1N K;  2B9S B;  2CFA B;  2GAG C;  3FHZ A;  4D3Y A;  3SZZ A;  4AYB A;  1IS1 A;  1YNN A;  5FJ8 K;  3GTK K;  1TL8 A;  4MQ9 A;  2W7V A;  3S1M C;  1XXB A;  3LAP A;  4XLP A;  3GTL K;  3HOU C;  2E2J C;  1PJ7 A;  3RZD K;  3S2H C;  1J6V A;  4A93 K;  3DU6 A;  1WSV A;  2A6E A;  4G7H A;  3DU5 A;  1HQM A;  4C3I K;  2A6H D;  1R9T A;  4OIQ A;  4FYD A;  4C3H C;  3CQZ K;  5JSB B;  5EGH A;  1PJ5 A;  1ZVU A;  4C3J K;  3PO3 K;  1WQF A;  3GTM K;  5TMC A;  4Q5V A;  2JA7 C;  2NVY C;  1WOR A;  3S1R C;  3S17 C;  2YU9 C;  4C3J C;  2A6H A;  5CHP A;  3RZO K;  4FGU A;  4A3D C;  3GTM A;  1XXC A;  4C3H K;  2XCR B;  1INN A;  1J6X A;  3CQZ A;  2GAH C;  4KMA A;  4XLN A;  3HOY C;  4A93 C;  4GFQ A;  3S2H K;  4A3M K;  1K83 C;  1K83 A;  3N3Y A;  1XXA A;  4PAB A; 
#chains in the Genus database with same CATH homology
 2BE5 D;  1MIU A;  3N3Y A;  4J3N A;  2RGR A;  2CW0 D;  2ZFZ A;  4L8I A;  3ORE A;  1Y1V A;  4GTF A;  4KB2 A;  4QCL A;  3FOE A;  3MAQ A;  3G4A A;  3MML B;  3QX3 A;  1TWF A;  4FM9 A;  1O27 A;  4EJ3 A;  4G0V A;  1T8I A;  3K5M A;  3N0B A;  1AB4 A;  4KM8 A;  2Y3P A;  1ZBS A;  2R7Z A;  3GTQ A;  3WVO A;  5IOT A;  1SFO A;  2YU9 A;  4C3I C;  4GTA A;  2NVY A;  4FXD A;  4BLB A;  4KAT A;  2A69 D;  4F3E A;  1O29 A;  1WQG A;  3KYL A;  1YNN D;  1EJ9 A;  2KWA A;  1TWG A;  1RRJ A;  3GTP A;  1A35 A;  3K5L A;  3H0G A;  1I50 A;  1B4A A;  1DD5 A;  5MLC 9;  3AQO A;  3AH5 A;  3Q3Q A;  4H3T A;  4KAW X;  4C2M A;  1BJT A;  2A68 D;  4GTE A;  1TGO A;  1WQH A;  1EK8 A;  4Q5G A;  1WCM A;  4NOK A;  1XXA A;  3FOF A;  2JA7 A;  2B63 A;  4LR2 A;  4M1X A;  4G0W A;  4BKW A;  3NUH A;  5JSN B;  2GSO A;  4KAS A;  4LQY A;  1Y1W A;  2JA6 A;  2A6E D;  1O26 A;  4DDQ A;  3GTO A;  1A36 A;  2R93 A;  2NVX A;  3OPF A;  1O2A A;  1YNJ D;  3N0C A;  2PHC B;  1IW7 D;  4KDD A;  4D3Z A;  3K57 A;  1K4S A;  3GTL A;  4GTC A;  3LHP S;  3LF9 A;  1V9M A;  1NH3 A;  4IP8 A;  4KB4 A;  1O28 A;  2P5M A;  1TWA A;  3K58 A;  4ILD A;  4BLA A;  4OYD B;  3GTK A;  1I3Q A;  5JFE A;  3V4G A;  3CAG A;  4KMD A;  1WIH A;  1I6V D;  1SEU A;  3AQP A;  5CQG A;  1HQM D;  1BGW A;  3GTJ A;  1ZXO A;  3L4J A;  4KAR A;  1TWH A;  2CFA A;  2Y0S A;  4KMH A;  3BUE A;  4P5B A;  4C2M C;  5JVO A;  1ZYR D;  2GSN A;  4LMO A;  3L4K A;  2XCO A;  2B9S B;  2CFA B;  1O25 A;  3GTG A;  4GT9 A;  4D3Y A;  2E2I A;  4AYB A;  1IS1 A;  4P5A A;  3FHZ A;  2GSU A;  2WB1 A;  4G0U A;  3P9A A;  4NOL A;  4QIW A;  1TL8 A;  5TJ3 A;  1KQ4 A;  5IOR A;  3ERE D;  4GTL A;  4IP9 A;  4AN8 A;  1XXB A;  3LAP A;  3OEP A;  5EGE A;  1GE9 A;  2R4G A;  1A31 A;  3LPX A;  3DU6 A;  3LAJ A;  3VA7 A;  3DU5 A;  2RH6 A;  2E2H A;  4FZB A;  2A6H D;  1R49 A;  1R9T A;  4FYD A;  4NOM A;  4C3H C;  2WAQ A;  5JSB B;  4KC6 A;  5IOS A;  2PMZ A;  2VUM A;  5EGH A;  3K59 A;  1ZVU A;  3G4C A;  3K5O A;  1WQF A;  4Q5V A;  1B4B A;  1LPQ A;  2XCQ A;  2F4Q A;  1Q8I A;  4KM9 A;  4C3J C;  1RR8 C;  4GTD A;  5CHP A;  4FGU A;  4JLR C;  1R5Z A;  3IAY A;  3GTM A;  1O24 A;  1XXC A;  2JH3 A;  2R92 A;  1SC7 A;  1SMY D;  1K4T A;  5CJ9 A;  2XCR B;  3HKZ A;  3CQZ A;  2O5J D;  1O2B A;  4GTB A;  4KMA A;  3FKI A;  1Y69 8;  3S0X A;  3M4A A;  4GFQ A;  5C9H A;  2JA5 A;  4O26 A;  1F9N A;  1EH1 A;  4AHC A;  3SJR A;  1K83 A;  1ISE A;  1TWC A;  5IOQ A;  3K5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...