4KAWX

Crystal structure of ribosome recycling factor mutant r39g from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSGITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 64
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kawX01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kawX02
1ZVUA 4KAWX 3OREA 2Y3PA 4G0WA 1B4AA 3QX3A 3LHPS 4J3NA 1WQGA 3LAJA 4KB4A 2XCQA 4JLRC 1AB4A 2ZFZA 3ERED 1EK8A 2KWAA 3OPFA 4KC6A 1B4BA 3FOFA 5JSBB 5JSNB 1Y698 3BUEA 1WQFA 1GE9A 5MLC9 3CAGA 1ISEA 3FOEA 4GFQA 2PHCB 4KDDA 2XCOA 1WIHA 3VA7A 3NUHA 4FM9A 3LPXA 5JVOA 4OYDB 1XXAA 1BGWA 3LF9A 3LAPA 3FHZA 2P5MA 1XXCA 4L8IA 4DDQA 1EH1A 1XXBA 3L4JA 3MMLB 4G0UA 2RGRA 1WQHA 4KB2A 1DD5A 5CJ9A 1IS1A 1F9NA 3L4KA 3OEPA 3V4GA 4G0VA 1BJTA 2XCRB
chains in the Genus database with same CATH superfamily
3S1NK 2B9SB 1K83A 4C2MK 4J3NA 3GDZA 3T00A 4BBSC 1TWGC 2JA6A 1F7UA 4O26A 4D3YA 1RRJA 2JA5C 1O28A 3S16C 4G7ZA 3I4MK 4WJ3M 3Q3QA 5IP9C 2NVXA 2CW0D 5C4JC 3K5MA 3HKZL 3HOZC 4IP8A 1K4TA 3H3VD 3GTQA 5IYCC 3BP3A 1BS2A 3GTMK 3K5OA 1I3QK 3M4OC 2WB1D 1V9MA 4C3HK 4NOLA 2V6UA 3HKZD 1GE9A 1RU0A 1XZQB 4KMHA 3AH5A 4A3IC 1WIHA 4KASA 4NOIA 2A69D 3GTOK 1YNND 4RMFA 4GTFA 5IOSA 2E2IK 2FQTA 2RGRA 3GTLK 5FJ8K 3K7AK 4OINA 3OEPA 3V4GA 3S17C 3AD8C 1ZXOA 3GTMA 3TFIA 2VUMC 2E2HA 1USMA 3PO3K 1PJ6A 2XCQA 1I3QA 1SEUA 5M5WK 1EK8A 3KYLA 3FKIC 4A3BK 4A3JK 4BKWA 3HOXK 5M3FK 3SJRA 3H0GC 2PPBA 4AH6A 3GTKK 3S2HC 4PABA 3IPJA 4P5BA 3GTPC 4C3IC 3S14C 1WQHA 2E2JK 5EGEA 5IYBC 1R49A 4GTLA 3GTOA 4FXDA 4LMOA 4KAWX 1V5VA 2CFAA 3GTJC 2ZUFA 3M3YC 3WODA 2E2IA 3S2DC 4GTAA 3GTLA 2F4QA 3RZDK 1TWAA 4XCHA 4A3GC 4Y7NC 4A3FK 4GFQA 1G51A 1YNJA 1XZPB 4G7HA 4Y52C 1I50A 4A3LK 3K59A 3EQLA 1Y1WC 1I6VD 2PMZA 1IE0A 2R92K 4QIWA 3DU6A 1TWCK 1O29A 4BY1K 2JA6K 2O5IA 3RZOK 2R4GA 1B4AA 4A93K 3S0XA 1SFOA 1AB4A 4A3CC 3HOUC 2NVXK 2JA7K 3GEHA 4KMAA 1T8IA 1Y698 1IW7A 4XLPA 1A31A 1I6VA 1Y1VK 3JSTA 2YU9K 2D6FC 1J6WA 1R9TK 1DCOA 2FQOA 1EI6A 5L46A 3FHZA 2B63K 4LLGA 5FLMC 4KN4A 3S1RK 4GTCA 4BXXC 4BBRC 3CQZC 1I6HC 4C3JC 4G0WA 3A8IA 1J6VA 3HOYC 2P8TA 5CHPA 5M3MK 1MIUA 1TL8A 4LQYA 2R92A 4KB4A 3ERED 1TWCA 2KWAA 4A3DC 2WB1L 5JFEA 3T02A 3S16K 4KMDA 3BP8C 2A6EA 1TWFC 3GTGC 1XZPA 3G4CA 3SZZA 4AN8A 2XCOA 2PA8L 3I4NK 2A6HA 5TJ3A 3S1QK 2JA7A 5C4JK 3HOZK 1RR8C 5IYCK 4KATA 2JA8K 2E2HK 1Y1VA 2YU9A 1R9TA 1O2AA 5CJ9A 4C2MC 2B63A 1WSRA 1VJEA 1ZVUA 4WILA 3TTGA 1O25A 3M4OK 5HL8A 1TGOA 3GSIA 4Q5SA 1BDFA 3HXAA 4GTEA 3S15C 2CFAB 5M5XK 2R93A 3A8KA 2PA8D 3GEIA 3A8JA 4AYBA 2GSUA 4KM9A 1TWGA 2W7VA 1DCHA 4A3IK 3LF9A 5IP7C 2JA5A 5C3EK 3TFHA 3MMLB 4FGUA 4KB2A 1WSVA 2GSOA 1ZYRA 1TWAK 5IOQA 3LHPS 1KQ4A 3N0BA 1A36A 3S17K 3PO2C 2NVTK 2VUMK 4H3TA 1O26A 4D3ZA 1JQWA 2PMZL 3HOVK 4Q5VA 4MEYA 1I50K 4QIWL 4KM8A 3K57A 5C44K 4FM9A 2O5JA 1TWHC 4EJ3A 1EH1A 3S2HK 3K58A 4G0UA 3GTPK 1SFOK 1IS1A 1LPQA 1YNJD 3S14K 4YFNA 5IYBK 1EQRA 2Y3PA 3GTJK 2R7ZC 4IP9A 2PMZD 2NVQK 4QIWD 1IBAA 4LK1A 4P5AA 2NVYC 2ZUEA 4A3BC 4LOWA 4OIOA 4FZBA 1Q8IA 2A68A 1ZBSA 3FOEA 2VUMA 2GAHC 3GTKC 4BLBA 3LAPA 1XXAA 1BGWA 3HOWC 5TMCA 4L8IA 1SC7A 1IW7D 5C4XC 4Y52K 1Y1WK 1J98A 3S1MC 4Q4ZA 4A3KK 2XCRB 3OREA 1L0WA 1YX2A 1PJ7A 3H0GA 1WCMC 5IYDC 1NH3A 3P9AA 3GTPA 4XLNA 3AQOA 1B4BA 5JSNB 3HOUK 3BUEA 2V6SA 4A3FC 3GTJA 4O2DA 1HQMA 4G7OA 1SMYA 4AHCA 4F3EA 1K83C 4A3MC 3N0CA 2A6ED 3K5NA 1HI9A 4WJ4A 2Y0SA 2JA6C 5IOTA 3RZOC 2A6HD 1DD5A 4BBRK 2WAQA 3L4KA 3TFJA 4A93C 1VH2A 1I6HK 2R93K 4NOMA 4BY7K 1Y1WA 2NVXC 3LAJA 3DXJA 4BBSK 1TWGK 4Q5GA 1INNA 4A3EC 3GTQC 4A3DK 3DU5A 4X6AC 2JA5K 5D4DA 1R9TC 3GTGK 4BLAA 3K5LA 4GT9A 5IP9K 3S1RC 4AYBD 4KARA 4PAAA 1J6XA 4GTBA 3SZYA 1EJ9A 3S1NC 3AD9C 1DCPA 4C45A 3QX3A 4P9SA 4QJVB 3AQPA 3S15K 3CQZA 1ZYRD 3I4MC 3I4NC 1VLOA 4LJZA 3S1QC 2BE5A 4KDDA 5M5YK 3LPXA 4OIQA 1ZQ1C 2P5MA 3ADAC 2JA8C 3GTMC 5IP7K 2E2HC 4YFKA 1K4SA 2JH3A 1I3QC 1TWFA 3GTGA 2O5JD 1YCLA 1F9NA 4FYDA 1A35A 4M1XA 4C3HC 4NOKA 3PO2K 2CW0A 3OPFA 4KC6A 4C2MA 4QCLA 2V6TA 4YG2A 4LK0A 3CAGA 4MQ9A 1O24A 2GAGC 3FKIK 5C3EC 3GTOC 1F93A 1XPPA 1TWHK 4DDQA 2A68D 2E2IC 1C0AA 1XXBA 2WB1A 2RH6A 3H0GK 3L4JA 3GTLC 3IAYA 3K7AC 3T01A 1TWAC 4QJVA 4ZH4A 5TMFA 4C3IK 2NVTC 3HKZA 3PO3C 4ILDA 4KMUA 1WQGA 3G4AA 4JLRC 5EGHA 2ZFZA 4LR2A 3HOVC 2R7ZK 3M3YK 3FOFA 3S2DK 1I50C 2A69A 2Y0SL 5C44C 1YNNA 4OIPA 2NVYK 2WAQL 4A3JC 3HOXC 3VA7A 1WOOA 4A3GK 4Y7NK 4XSXA 4OIRA 4GTDA 4GZYA 1VRQC 1XXCA 3HOWK 1HQMD 1SFOC 5C4XK 1F7VA 2E2JC 3FKIA 1SMYD 3S1MK 1IQ0A 1BJTA 1O27A 1WORA 2EBBA 2NVQC 1TWHA 1WCMK 2Y0SD 1PJ5A 5IYDK 3RZDC 1XZQA 2WAQD 5JSBB 3AD7C 1IL2A 4XSZA 4A3CK 1O2BA 1ISEA 2R7ZA 2GSNA 4A3LC 1K83K 1VGXA 2NVYA 4KN7A 4A3MK 2R92C 4A3KC 1O2FB 3MAQA 5C9HA 1TWCC 3N3YA 4BY1C 5FLMK 4YFXA 4BXXK 3GTKA 4AYBL 3GIRA 3CQZK 1WOSA 4C3JK 4MEXA 3HOYK 2JA7C 5E68A 4A3EK 1WQFA 3GTQK 4JK1A 4X6AK 5MLC9 1WCMA 1Y1VC 2YU9C 3M4AA 2PHCB 1TWFK 3GEEA 3NUHA 2B63C 5JVOA 4OYDB 1USOA 1JOEA 1WOPA 1EFWA 2BE5D 3H3VL 5CQGA 1R5ZA 1UV7A 1JVIA 5IORA 4G0VA 2R93C 4BY7C 3WVOA 1X31C
chains in the Genus database with same CATH topology
4M1XA 2B9SB 2Y3PA 2R4GA 1K83A 1B4AA 4J3NA 4IP9A 4C3HC 3S0XA 4NOKA 1SFOA 1AB4A 2JA6A 4O26A 4D3YA 1RRJA 3OPFA 4KC6A 4P5AA 4KMAA 4C2MA 1T8IA 1Y698 4QCLA 1O28A 4FZBA 1Q8IA 1ZBSA 3CAGA 1A31A 3Q3QA 3FOEA 2VUMA 1O24A 2NVXA 2CW0D 3K5MA 4IP8A 4BLBA 3LAPA 1K4TA 1BGWA 1XXAA 3FHZA 4L8IA 3GTQA 1SC7A 1IW7D 4DDQA 2A68D 1XXBA 2WB1A 2RH6A 3L4JA 4GTCA 3K5OA 3IAYA 2RGRA 4C3JC 2XCRB 4G0WA 3OREA 3HKZA 3H0GA 5CHPA 1MIUA 1TL8A 1V9MA 4ILDA 1WQGA 1NH3A 2R92A 4LQYA 4KB4A 3G4AA 4JLRC 5EGHA 3P9AA 3GTPA 2ZFZA 4NOLA 3AQOA 4LR2A 1TWCA 2KWAA 3FOFA 1B4BA 3ERED 5JSNB 3BUEA 5JFEA 3GTJA 4KMDA 1GE9A 4KMHA 3G4CA 3AH5A 3VA7A 4AN8A 2XCOA 1WIHA 4KASA 4AHCA 5TJ3A 2JA7A 2A69D 4F3EA 4GTDA 1YNND 1RR8C 1XXCA 3N0CA 2A6ED 1HQMD 3K5NA 4GTFA 4KATA 5IOSA 2Y0SA 5IOTA 3FKIA 1Y1VA 2YU9A 1SMYD 2A6HD 1DD5A 1R9TA 1O2AA 5CJ9A 4C2MC 3L4KA 2WAQA 3OEPA 3V4GA 2B63A 1BJTA 1O27A 1ZVUA 1ZXOA 1TWHA 1O25A 3GTMA 4NOMA 1TGOA 2E2HA 1Y1WA 3LAJA 2XCQA 1I3QA 1SEUA 4GTEA 2CFAB 1EK8A 4Q5GA 5JSBB 3KYLA 2R93A 3DU5A 1O2BA 4AYBA 2GSUA 4KM9A 1ISEA 2R7ZA 1TWGA 4BLAA 3K5LA 4BKWA 2GSNA 4GT9A 3SJRA 3LF9A 2JA5A 2NVYA 4KARA 4P5BA 1O29A 3MAQA 4FYDA 5C9HA 3MMLB 3N3YA 1WQHA 4FGUA 4KB2A 1EJ9A 4GTBA 5EGEA 1R49A 4C3IC 2GSOA 3GTKA 3GTOA 4GTLA 4FXDA 4LMOA 4KAWX 2CFAA 5IOQA 3QX3A 3LHPS 1KQ4A 3N0BA 1A36A 2E2IA 4GTAA 3AQPA 3GTLA 4H3TA 1O26A 4D3ZA 2F4QA 3CQZA 1ZYRD 1TWAA 1WQFA 4Q5VA 4KM8A 5MLC9 1WCMA 3K57A 3M4AA 4GFQA 2PHCB 4KDDA 4FM9A 3NUHA 1LPQA 3LPXA 5JVOA 4OYDB 2P5MA 1I50A 3K59A 1K4SA 1I6VD 1EH1A 2BE5D 4EJ3A 2JH3A 2PMZA 1TWFA 3GTGA 2O5JD 5CQGA 1R5ZA 3K58A 4G0UA 5IORA 4QIWA 3DU6A 1IS1A 1F9NA 1YNJD 4G0VA 3WVOA 1A35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVU A;  4KAW X;  3ORE A;  2Y3P A;  4G0W A;  1B4A A;  3QX3 A;  3LHP S;  4J3N A;  1WQG A;  3LAJ A;  4KB4 A;  2XCQ A;  4JLR C;  1AB4 A;  2ZFZ A;  3ERE D;  1EK8 A;  2KWA A;  3OPF A;  4KC6 A;  1B4B A;  3FOF A;  5JSB B;  5JSN B;  1Y69 8;  3BUE A;  1WQF A;  1GE9 A;  5MLC 9;  3CAG A;  1ISE A;  3FOE A;  4GFQ A;  2PHC B;  4KDD A;  2XCO A;  1WIH A;  3VA7 A;  3NUH A;  4FM9 A;  3LPX A;  5JVO A;  4OYD B;  1XXA A;  1BGW A;  3LF9 A;  3LAP A;  3FHZ A;  2P5M A;  1XXC A;  4L8I A;  4DDQ A;  1EH1 A;  1XXB A;  3L4J A;  3MML B;  4G0U A;  2RGR A;  1WQH A;  4KB2 A;  1DD5 A;  5CJ9 A;  1IS1 A;  1F9N A;  3L4K A;  3OEP A;  3V4G A;  4G0V A;  1BJT A;  2XCR B; 
#chains in the Genus database with same CATH topology
 3S1N K;  2B9S B;  1K83 A;  4C2M K;  4J3N A;  3GDZ A;  3T00 A;  4BBS C;  1TWG C;  2JA6 A;  1F7U A;  4O26 A;  4D3Y A;  1RRJ A;  2JA5 C;  1O28 A;  3S16 C;  4G7Z A;  3I4M K;  4WJ3 M;  3Q3Q A;  5IP9 C;  2NVX A;  2CW0 D;  5C4J C;  3K5M A;  3HKZ L;  3HOZ C;  4IP8 A;  1K4T A;  3H3V D;  3GTQ A;  5IYC C;  3BP3 A;  1BS2 A;  3GTM K;  3K5O A;  1I3Q K;  3M4O C;  2WB1 D;  1V9M A;  4C3H K;  4NOL A;  2V6U A;  3HKZ D;  1GE9 A;  1RU0 A;  1XZQ B;  4KMH A;  3AH5 A;  4A3I C;  1WIH A;  4KAS A;  4NOI A;  2A69 D;  3GTO K;  1YNN D;  4RMF A;  4GTF A;  5IOS A;  2E2I K;  2FQT A;  2RGR A;  3GTL K;  5FJ8 K;  3K7A K;  4OIN A;  3OEP A;  3V4G A;  3S17 C;  3AD8 C;  1ZXO A;  3GTM A;  3TFI A;  2VUM C;  2E2H A;  1USM A;  3PO3 K;  1PJ6 A;  2XCQ A;  1I3Q A;  1SEU A;  5M5W K;  1EK8 A;  3KYL A;  3FKI C;  4A3B K;  4A3J K;  4BKW A;  3HOX K;  5M3F K;  3SJR A;  3H0G C;  2PPB A;  4AH6 A;  3GTK K;  3S2H C;  4PAB A;  3IPJ A;  4P5B A;  3GTP C;  4C3I C;  3S14 C;  1WQH A;  2E2J K;  5EGE A;  5IYB C;  1R49 A;  4GTL A;  3GTO A;  4FXD A;  4LMO A;  4KAW X;  1V5V A;  2CFA A;  3GTJ C;  2ZUF A;  3M3Y C;  3WOD A;  2E2I A;  3S2D C;  4GTA A;  3GTL A;  2F4Q A;  3RZD K;  1TWA A;  4XCH A;  4A3G C;  4Y7N C;  4A3F K;  4GFQ A;  1G51 A;  1YNJ A;  1XZP B;  4G7H A;  4Y52 C;  1I50 A;  4A3L K;  3K59 A;  3EQL A;  1Y1W C;  1I6V D;  2PMZ A;  1IE0 A;  2R92 K;  4QIW A;  3DU6 A;  1TWC K;  1O29 A;  4BY1 K;  2JA6 K;  2O5I A;  3RZO K;  2R4G A;  1B4A A;  4A93 K;  3S0X A;  1SFO A;  1AB4 A;  4A3C C;  3HOU C;  2NVX K;  2JA7 K;  3GEH A;  4KMA A;  1T8I A;  1Y69 8;  1IW7 A;  4XLP A;  1A31 A;  1I6V A;  1Y1V K;  3JST A;  2YU9 K;  2D6F C;  1J6W A;  1R9T K;  1DCO A;  2FQO A;  1EI6 A;  5L46 A;  3FHZ A;  2B63 K;  4LLG A;  5FLM C;  4KN4 A;  3S1R K;  4GTC A;  4BXX C;  4BBR C;  3CQZ C;  1I6H C;  4C3J C;  4G0W A;  3A8I A;  1J6V A;  3HOY C;  2P8T A;  5CHP A;  5M3M K;  1MIU A;  1TL8 A;  4LQY A;  2R92 A;  4KB4 A;  3ERE D;  1TWC A;  2KWA A;  4A3D C;  2WB1 L;  5JFE A;  3T02 A;  3S16 K;  4KMD A;  3BP8 C;  2A6E A;  1TWF C;  3GTG C;  1XZP A;  3G4C A;  3SZZ A;  4AN8 A;  2XCO A;  2PA8 L;  3I4N K;  2A6H A;  5TJ3 A;  3S1Q K;  2JA7 A;  5C4J K;  3HOZ K;  1RR8 C;  5IYC K;  4KAT A;  2JA8 K;  2E2H K;  1Y1V A;  2YU9 A;  1R9T A;  1O2A A;  5CJ9 A;  4C2M C;  2B63 A;  1WSR A;  1VJE A;  1ZVU A;  4WIL A;  3TTG A;  1O25 A;  3M4O K;  5HL8 A;  1TGO A;  3GSI A;  4Q5S A;  1BDF A;  3HXA A;  4GTE A;  3S15 C;  2CFA B;  5M5X K;  2R93 A;  3A8K A;  2PA8 D;  3GEI A;  3A8J A;  4AYB A;  2GSU A;  4KM9 A;  1TWG A;  2W7V A;  1DCH A;  4A3I K;  3LF9 A;  5IP7 C;  2JA5 A;  5C3E K;  3TFH A;  3MML B;  4FGU A;  4KB2 A;  1WSV A;  2GSO A;  1ZYR A;  1TWA K;  5IOQ A;  3LHP S;  1KQ4 A;  3N0B A;  1A36 A;  3S17 K;  3PO2 C;  2NVT K;  2VUM K;  4H3T A;  1O26 A;  4D3Z A;  1JQW A;  2PMZ L;  3HOV K;  4Q5V A;  4MEY A;  1I50 K;  4QIW L;  4KM8 A;  3K57 A;  5C44 K;  4FM9 A;  2O5J A;  1TWH C;  4EJ3 A;  1EH1 A;  3S2H K;  3K58 A;  4G0U A;  3GTP K;  1SFO K;  1IS1 A;  1LPQ A;  1YNJ D;  3S14 K;  4YFN A;  5IYB K;  1EQR A;  2Y3P A;  3GTJ K;  2R7Z C;  4IP9 A;  2PMZ D;  2NVQ K;  4QIW D;  1IBA A;  4LK1 A;  4P5A A;  2NVY C;  2ZUE A;  4A3B C;  4LOW A;  4OIO A;  4FZB A;  1Q8I A;  2A68 A;  1ZBS A;  3FOE A;  2VUM A;  2GAH C;  3GTK C;  4BLB A;  3LAP A;  1XXA A;  1BGW A;  3HOW C;  5TMC A;  4L8I A;  1SC7 A;  1IW7 D;  5C4X C;  4Y52 K;  1Y1W K;  1J98 A;  3S1M C;  4Q4Z A;  4A3K K;  2XCR B;  3ORE A;  1L0W A;  1YX2 A;  1PJ7 A;  3H0G A;  1WCM C;  5IYD C;  1NH3 A;  3P9A A;  3GTP A;  4XLN A;  3AQO A;  1B4B A;  5JSN B;  3HOU K;  3BUE A;  2V6S A;  4A3F C;  3GTJ A;  4O2D A;  1HQM A;  4G7O A;  1SMY A;  4AHC A;  4F3E A;  1K83 C;  4A3M C;  3N0C A;  2A6E D;  3K5N A;  1HI9 A;  4WJ4 A;  2Y0S A;  2JA6 C;  5IOT A;  3RZO C;  2A6H D;  1DD5 A;  4BBR K;  2WAQ A;  3L4K A;  3TFJ A;  4A93 C;  1VH2 A;  1I6H K;  2R93 K;  4NOM A;  4BY7 K;  1Y1W A;  2NVX C;  3LAJ A;  3DXJ A;  4BBS K;  1TWG K;  4Q5G A;  1INN A;  4A3E C;  3GTQ C;  4A3D K;  3DU5 A;  4X6A C;  2JA5 K;  5D4D A;  1R9T C;  3GTG K;  4BLA A;  3K5L A;  4GT9 A;  5IP9 K;  3S1R C;  4AYB D;  4KAR A;  4PAA A;  1J6X A;  4GTB A;  3SZY A;  1EJ9 A;  3S1N C;  3AD9 C;  1DCP A;  4C45 A;  3QX3 A;  4P9S A;  4QJV B;  3AQP A;  3S15 K;  3CQZ A;  1ZYR D;  3I4M C;  3I4N C;  1VLO A;  4LJZ A;  3S1Q C;  2BE5 A;  4KDD A;  5M5Y K;  3LPX A;  4OIQ A;  1ZQ1 C;  2P5M A;  3ADA C;  2JA8 C;  3GTM C;  5IP7 K;  2E2H C;  4YFK A;  1K4S A;  2JH3 A;  1I3Q C;  1TWF A;  3GTG A;  2O5J D;  1YCL A;  1F9N A;  4FYD A;  1A35 A;  4M1X A;  4C3H C;  4NOK A;  3PO2 K;  2CW0 A;  3OPF A;  4KC6 A;  4C2M A;  4QCL A;  2V6T A;  4YG2 A;  4LK0 A;  3CAG A;  4MQ9 A;  1O24 A;  2GAG C;  3FKI K;  5C3E C;  3GTO C;  1F93 A;  1XPP A;  1TWH K;  4DDQ A;  2A68 D;  2E2I C;  1C0A A;  1XXB A;  2WB1 A;  2RH6 A;  3H0G K;  3L4J A;  3GTL C;  3IAY A;  3K7A C;  3T01 A;  1TWA C;  4QJV A;  4ZH4 A;  5TMF A;  4C3I K;  2NVT C;  3HKZ A;  3PO3 C;  4ILD A;  4KMU A;  1WQG A;  3G4A A;  4JLR C;  5EGH A;  2ZFZ A;  4LR2 A;  3HOV C;  2R7Z K;  3M3Y K;  3FOF A;  3S2D K;  1I50 C;  2A69 A;  2Y0S L;  5C44 C;  1YNN A;  4OIP A;  2NVY K;  2WAQ L;  4A3J C;  3HOX C;  3VA7 A;  1WOO A;  4A3G K;  4Y7N K;  4XSX A;  4OIR A;  4GTD A;  4GZY A;  1VRQ C;  1XXC A;  3HOW K;  1HQM D;  1SFO C;  5C4X K;  1F7V A;  2E2J C;  3FKI A;  1SMY D;  3S1M K;  1IQ0 A;  1BJT A;  1O27 A;  1WOR A;  2EBB A;  2NVQ C;  1TWH A;  1WCM K;  2Y0S D;  1PJ5 A;  5IYD K;  3RZD C;  1XZQ A;  2WAQ D;  5JSB B;  3AD7 C;  1IL2 A;  4XSZ A;  4A3C K;  1O2B A;  1ISE A;  2R7Z A;  2GSN A;  4A3L C;  1K83 K;  1VGX A;  2NVY A;  4KN7 A;  4A3M K;  2R92 C;  4A3K C;  1O2F B;  3MAQ A;  5C9H A;  1TWC C;  3N3Y A;  4BY1 C;  5FLM K;  4YFX A;  4BXX K;  3GTK A;  4AYB L;  3GIR A;  3CQZ K;  1WOS A;  4C3J K;  4MEX A;  3HOY K;  2JA7 C;  5E68 A;  4A3E K;  1WQF A;  3GTQ K;  4JK1 A;  4X6A K;  5MLC 9;  1WCM A;  1Y1V C;  2YU9 C;  3M4A A;  2PHC B;  1TWF K;  3GEE A;  3NUH A;  2B63 C;  5JVO A;  4OYD B;  1USO A;  1JOE A;  1WOP A;  1EFW A;  2BE5 D;  3H3V L;  5CQG A;  1R5Z A;  1UV7 A;  1JVI A;  5IOR A;  4G0V A;  2R93 C;  4BY7 C;  3WVO A;  1X31 C; 
#chains in the Genus database with same CATH homology
 4M1X A;  2B9S B;  2Y3P A;  2R4G A;  1K83 A;  1B4A A;  4J3N A;  4IP9 A;  4C3H C;  3S0X A;  4NOK A;  1SFO A;  1AB4 A;  2JA6 A;  4O26 A;  4D3Y A;  1RRJ A;  3OPF A;  4KC6 A;  4P5A A;  4KMA A;  4C2M A;  1T8I A;  1Y69 8;  4QCL A;  1O28 A;  4FZB A;  1Q8I A;  1ZBS A;  3CAG A;  1A31 A;  3Q3Q A;  3FOE A;  2VUM A;  1O24 A;  2NVX A;  2CW0 D;  3K5M A;  4IP8 A;  4BLB A;  3LAP A;  1K4T A;  1BGW A;  1XXA A;  3FHZ A;  4L8I A;  3GTQ A;  1SC7 A;  1IW7 D;  4DDQ A;  2A68 D;  1XXB A;  2WB1 A;  2RH6 A;  3L4J A;  4GTC A;  3K5O A;  3IAY A;  2RGR A;  4C3J C;  2XCR B;  4G0W A;  3ORE A;  3HKZ A;  3H0G A;  5CHP A;  1MIU A;  1TL8 A;  1V9M A;  4ILD A;  1WQG A;  1NH3 A;  2R92 A;  4LQY A;  4KB4 A;  3G4A A;  4JLR C;  5EGH A;  3P9A A;  3GTP A;  2ZFZ A;  4NOL A;  3AQO A;  4LR2 A;  1TWC A;  2KWA A;  3FOF A;  1B4B A;  3ERE D;  5JSN B;  3BUE A;  5JFE A;  3GTJ A;  4KMD A;  1GE9 A;  4KMH A;  3G4C A;  3AH5 A;  3VA7 A;  4AN8 A;  2XCO A;  1WIH A;  4KAS A;  4AHC A;  5TJ3 A;  2JA7 A;  2A69 D;  4F3E A;  4GTD A;  1YNN D;  1RR8 C;  1XXC A;  3N0C A;  2A6E D;  1HQM D;  3K5N A;  4GTF A;  4KAT A;  5IOS A;  2Y0S A;  5IOT A;  3FKI A;  1Y1V A;  2YU9 A;  1SMY D;  2A6H D;  1DD5 A;  1R9T A;  1O2A A;  5CJ9 A;  4C2M C;  3L4K A;  2WAQ A;  3OEP A;  3V4G A;  2B63 A;  1BJT A;  1O27 A;  1ZVU A;  1ZXO A;  1TWH A;  1O25 A;  3GTM A;  4NOM A;  1TGO A;  2E2H A;  1Y1W A;  3LAJ A;  2XCQ A;  1I3Q A;  1SEU A;  4GTE A;  2CFA B;  1EK8 A;  4Q5G A;  5JSB B;  3KYL A;  2R93 A;  3DU5 A;  1O2B A;  4AYB A;  2GSU A;  4KM9 A;  1ISE A;  2R7Z A;  1TWG A;  4BLA A;  3K5L A;  4BKW A;  2GSN A;  4GT9 A;  3SJR A;  3LF9 A;  2JA5 A;  2NVY A;  4KAR A;  4P5B A;  1O29 A;  3MAQ A;  4FYD A;  5C9H A;  3MML B;  3N3Y A;  1WQH A;  4FGU A;  4KB2 A;  1EJ9 A;  4GTB A;  5EGE A;  1R49 A;  4C3I C;  2GSO A;  3GTK A;  3GTO A;  4GTL A;  4FXD A;  4LMO A;  4KAW X;  2CFA A;  5IOQ A;  3QX3 A;  3LHP S;  1KQ4 A;  3N0B A;  1A36 A;  2E2I A;  4GTA A;  3AQP A;  3GTL A;  4H3T A;  1O26 A;  4D3Z A;  2F4Q A;  3CQZ A;  1ZYR D;  1TWA A;  1WQF A;  4Q5V A;  4KM8 A;  5MLC 9;  1WCM A;  3K57 A;  3M4A A;  4GFQ A;  2PHC B;  4KDD A;  4FM9 A;  3NUH A;  1LPQ A;  3LPX A;  5JVO A;  4OYD B;  2P5M A;  1I50 A;  3K59 A;  1K4S A;  1I6V D;  1EH1 A;  2BE5 D;  4EJ3 A;  2JH3 A;  2PMZ A;  1TWF A;  3GTG A;  2O5J D;  5CQG A;  1R5Z A;  3K58 A;  4G0U A;  5IOR A;  4QIW A;  3DU6 A;  1IS1 A;  1F9N A;  1YNJ D;  4G0V A;  3WVO A;  1A35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...