4KAWX

Crystal structure of ribosome recycling factor mutant r39g from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
183
structure length
183
Chain Sequence
b'IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSGITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 64
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kawX01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kawX02
1EK8A 3LPXA 4L8IA 2Y3PA 4G0WA 4KAWX 1XXAA 2XCQA 4KC6A 1B4BA 1GE9A 1WQFA 4G0VA 4G0UA 1EH1A 1F9NA 5MLC9 4FM9A 3MMLB 1DD5A 4JLRC 3L4JA 1BJTA 3V4GA 3L4KA 4DDQA 3LAPA 2PHCB 3FOEA 3OEPA 3CAGA 3OPFA 3LHPS 1ZVUA 3ERED 4KB4A 3FOFA 1WIHA 4KB2A 4OYDB 2P5MA 2ZFZA 1IS1A 3BUEA 3OREA 2XCRB 2KWAA 3LF9A 4KDDA 1WQGA 1AB4A 1WQHA 2XCOA 5CJ9A 1Y698 4J3NA 3VA7A 1XXBA 2RGRA 1BGWA 1XXCA 3QX3A 5JVOA 1ISEA 3NUHA 5JSBB 1B4AA 5JSNB 4GFQA 3LAJA 3FHZA
chains in the Genus database with same CATH superfamily
2PPBA 3HOXK 3HOZC 1ZYRD 3GTOA 1R9TK 2JA5C 1F7VA 2JA6K 3H0GK 3GTKC 5MLC9 2WB1L 5IYBC 4FM9A 1MIUA 4JLRC 1A35A 2R93K 3TTGA 3JSTA 3FOEA 2PHCB 1EFWA 3HOWK 3GTLK 1ZYRA 1R49A 1PJ6A 3GTGC 3FOFA 5M3MK 1JQWA 4C3IC 4D3YA 1F7UA 3RZOC 2XCOA 2B63C 3HOYK 1PJ7A 4LJZA 3GTQA 1XPPA 3T02A 1G51A 5IORA 1J6WA 4H3TA 2R7ZK 3DU5A 3LAJA 1R9TC 2ZUEA 4LK1A 3FKIK 4AN8A 1SC7A 3AQPA 2FQTA 3S15K 3K5MA 1WOSA 1EH1A 1VLOA 4KMUA 4Q5GA 4KN7A 4C2MC 3EQLA 3CQZK 1TWGA 1NH3A 1O28A 4XLNA 1TWHC 4MEYA 2YU9C 2E2IA 2GSNA 2F4QA 4J3NA 2BE5A 1RU0A 1SFOK 4L8IA 3PO3K 4X6AK 1USOA 2E2JK 4LOWA 2CFAA 1TWFA 1GE9A 4KM8A 5C4JK 3CQZC 4A3DC 2P8TA 3GTPA 3V4GA 3LAPA 3PO2K 2R92C 1ZVUA 1YNND 3DU6A 4A3BC 4G7HA 1L0WA 5IYDK 4Q5VA 4OYDB 4QJVA 5TJ3A 2ZFZA 5L46A 1K4TA 4A3FK 2Y0SA 3GSIA 5E68A 1IL2A 3HOUK 1AB4A 3A8KA 3H3VD 4O26A 3HKZD 1YNNA 3M4OC 4Q4ZA 2Y3PA 3A8IA 1TWAA 3S2DC 1IE0A 4KASA 1K83K 3GTJC 2GSOA 1WQFA 4FGUA 1USMA 1Y1WC 1I6HC 3HKZA 4G7OA 1YNJD 4ILDA 3AD8C 3ERED 1TWCA 3OEPA 3OPFA 4M1XA 1WCMA 4A3EK 1O27A 5M5XK 1I3QK 4QCLA 1O2AA 4A3MK 1YNJA 3GTOK 4NOIA 1BGWA 1JOEA 3S1MC 1F93A 5JFEA 2JA7A 2NVXC 1ZBSA 1KQ4A 1I50C 4KC6A 4C3HC 2A68D 3K5NA 3M4AA 1BJTA 1VJEA 4GTFA 3GTQK 2GAHC 3BP8C 3S17K 4LQYA 4JK1A 2A68A 4OIRA 3K7AK 3I4NK 4KDDA 3KYLA 4Y52C 3VA7A 4YFKA 1ISEA 3S1QK 1J6VA 3N0CA 3HOVC 1I3QA 1TWGK 1IQ0A 2CFAB 3S1NK 2V6UA 3RZDK 5IOQA 4AYBD 4BBSK 5IYCC 4A3IK 4A3CC 2NVTK 4A3LC 3GTQC 2E2IK 3AQOA 3S16C 2E2HA 4QJVB 1IS1A 4F3EA 4AYBA 3T01A 4XSZA 2NVYC 3GTMA 2VUMA 1TWFK 5C44C 4BY1K 3HOXC 3AD7C 1YCLA 4P9SA 4OIQA 3GTPK 3RZDC 4GTAA 2RH6A 2JA6C 3H0GC 1RRJA 1O2FB 4O2DA 3H3VL 1SEUA 2R93C 4IP9A 4BBRK 5FJ8K 4KN4A 1Y1VA 5TMCA 2V6SA 3L4KA 3GTLC 2BE5D 3HOWC 5IP7K 2JA5A 5CQGA 4A3KK 3S1RK 3GTKA 2PMZD 3HOYC 4P5AA 1TWAK 1Y698 2R7ZC 2CW0A 2PA8D 5TMFA 3G4AA 2A69D 3GTGA 1B4AA 4GTBA 4PABA 1EK8A 3FKIC 3LPXA 4WJ4A 1TWCK 4EJ3A 4OIPA 5M5YK 2PMZA 2B63A 2O5IA 4BBRC 3I4MK 1O25A 2JH3A 3S15C 4A93K 4NOLA 1WCMK 2Y0SD 3SJRA 4BXXK 3K57A 2A69A 4A3JK 1PJ5A 4C3JK 3LHPS 4KMHA 1J98A 3HXAA 2KWAA 5C4XK 1WSVA 2JA7K 4C2MA 2WB1D 1WQHA 4KATA 3TFHA 4LR2A 1SFOC 5C3EK 5M3FK 3PO3C 1TWHA 1K4SA 2E2JC 2WAQL 4X6AC 4KAWX 2YU9A 3MAQA 5C4JC 1XZQA 1IW7D 2WB1A 3SZZA 5EGEA 2ZUFA 3PO2C 2EBBA 2GSUA 1INNA 5IYDC 3IPJA 1WOOA 4A3FC 4GTDA 3S2HK 4QIWD 3K58A 2JA7C 3P9AA 2NVQK 3HOUC 1IW7A 5IP9K 4Q5SA 4XLPA 2R92A 3AD9C 2JA8K 4OIOA 4PAAA 3GDZA 5EGHA 4MQ9A 4QIWA 2FQOA 1K83C 4Y7NK 1VRQC 2WAQA 2E2HK 1V9MA 3MMLB 1DD5A 1J6XA 1VGXA 2R4GA 3GEIA 3GTMK 5FLMK 4A3EC 2VUMK 3M3YK 3GTJA 4KB2A 1I3QC 3BUEA 3OREA 4GTCA 4NOMA 4FYDA 2A6ED 1DCHA 4A3MC 2D6FC 1BDFA 3GTOC 4BY7K 5CJ9A 4G0UA 1XXBA 4KM9A 1WORA 4GTEA 5JSBB 3FHZA 4A3GK 4Y7NC 4G7ZA 1Y1VK 5CHPA 3BP3A 3HOZK 2A6EA 1XZPA 2JA5K 1F9NA 3WODA 3S14K 3GTKK 3L4JA 5IYBK 5IOTA 3WVOA 2NVXA 1I50A 3S17C 1WIHA 4KARA 3GTGK 3K7AC 3I4NC 4C3IK 4GZYA 2Y0SL 3RZOK 2B63K 3S1QC 1A36A 1TWGC 4GT9A 3S1NC 3S14C 1EI6A 1XZQB 3N0BA 4FZBA 4G0VA 4BBSC 4A3IC 2NVTC 4KMDA 2E2IC 1DCPA 3HKZL 4C2MK 3K5OA 2CW0D 4KB4A 4NOKA 4C45A 1UV7A 1O29A 1TWHK 5C9HA 5M5WK 4AH6A 1WOPA 1TWFC 4MEXA 2YU9K 3QX3A 4BY1C 3S0XA 3GTPC 1ZQ1C 3AH5A 4G0WA 4QIWL 3TFJA 1EQRA 2XCQA 2NVYA 4YFNA 1O26A 1WSRA 4WILA 1IBAA 4A3DK 4RMFA 5IP7C 1R9TA 4DDQA 4A3KC 2R92K 3S1RC 2JA6A 4P5BA 3H0GA 4A3BK 2P5MA 5IOSA 3SZYA 2R93A 1VH2A 1TWAC 1WQGA 1SMYD 3GTLA 2GAGC 1C0AA 2B9SB 3NUHA 5JSNB 4GFQA 4WJ3M 3GIRA 3M4OK 1Q8IA 1TWCC 4BLBA 1BS2A 1V5VA 3I4MC 1XZPB 4A93C 1WCMC 4BXXC 4YFXA 3S2DK 2R7ZA 1SMYA 3GTJK 4A3JC 1Y1WK 1I6HK 4C3JC 3FKIA 4OINA 1JVIA 5C4XC 1HQMD 1I6VD 3T00A 2XCRB 3CQZA 2A6HD 3LF9A 4AYBL 1X31C 4XSXA 5C3EC 3S1MK 1HQMA 1I6VA 2NVXK 2A6HA 3A8JA 1I50K 3TFIA 1R5ZA 4FXDA 3GEEA 4C3HK 1SFOA 4GTLA 4LMOA 3S2HC 3ADAC 1RR8C 1EJ9A 2NVQC 4BKWA 1HI9A 5IP9C 4BLAA 1Y1WA 4LLGA 4XCHA 2JA8C 3G4CA 5JVOA 4Y52K 1T8IA 1A31A 3K59A 4ZH4A 4AHCA 3HOVK 5HL8A 2O5JD 1DCOA 2W7VA 1XXAA 1O2BA 2E2HC 2PMZL 4KMAA 4YG2A 5IYCK 3DXJA 3GTMC 4A3CK 2PA8L 5FLMC 4LK0A 2VUMC 4A3LK 1K83A 3CAGA 2V6TA 3M3YC 2WAQD 1TGOA 1LPQA 2O5JA 3S16K 3K5LA 1YX2A 4BY7C 1TL8A 3GEHA 4D3ZA 2RGRA 4IP8A 1XXCA 2NVYK 5D4DA 4A3GC 3N3YA 3Q3QA 3IAYA 1ZXOA 1B4BA 1O24A 5C44K 1Y1VC
chains in the Genus database with same CATH topology
1TWHA 1K4SA 3AH5A 1ZYRD 2JA7A 4G0WA 3GTOA 1ZBSA 4KAWX 2YU9A 1KQ4A 3MAQA 4KC6A 2XCQA 2NVYA 1O26A 4C3HC 1IW7D 2WB1A 2A68D 3K5NA 5EGEA 5MLC9 4FM9A 1MIUA 4JLRC 3M4AA 1A35A 1BJTA 2GSUA 1R9TA 4DDQA 2PHCB 3FOEA 4GTFA 1R49A 4GTDA 3FOFA 2JA6A 4P5BA 3H0GA 3K58A 2P5MA 3P9AA 4C3IC 4LQYA 5IOSA 2R93A 4D3YA 4KDDA 1WQGA 3KYLA 2XCOA 1SMYD 3GTLA 3VA7A 2R92A 2B9SB 3GTQA 1ISEA 3NUHA 5IORA 5JSNB 4H3TA 4GFQA 3DU5A 3LAJA 5EGHA 3N0CA 4QIWA 1Q8IA 1I3QA 4AN8A 4BLBA 1SC7A 2CFAB 3AQPA 1B4BA 3K5MA 2R7ZA 1EH1A 5IOQA 4Q5GA 1V9MA 3MMLB 1DD5A 4C2MC 4C3JC 3FKIA 1TWGA 1NH3A 1O28A 3AQOA 3GTJA 4KB2A 2E2HA 1IS1A 4F3EA 3BUEA 1HQMD 3OREA 1I6VD 4GTCA 4NOMA 4FYDA 2A6ED 3CQZA 2A6HD 4AYBA 2XCRB 3LF9A 2E2IA 2GSNA 5CJ9A 2F4QA 4J3NA 3GTMA 4G0UA 2VUMA 1XXBA 4KM9A 4GTEA 5JSBB 4L8IA 5CHPA 4GTAA 2CFAA 2RH6A 1TWFA 1GE9A 4KM8A 1RRJA 1R5ZA 4FXDA 1SEUA 1F9NA 4IP9A 1SFOA 4GTLA 3L4JA 1Y1VA 3GTPA 4LMOA 2BE5D 3V4GA 5IOTA 3LAPA 3WVOA 2NVXA 3L4KA 1ZVUA 1YNND 3DU6A 1RR8C 1I50A 1EJ9A 1WIHA 4Q5VA 2JA5A 5CQGA 4OYDB 4KARA 5TJ3A 2ZFZA 4BKWA 1K4TA 4BLAA 2Y0SA 3GTKA 1Y1WA 4P5AA 1AB4A 4O26A 1Y698 3G4CA 5JVOA 1A36A 3G4AA 2A69D 1T8IA 3GTGA 1B4AA 4GTBA 1A31A 1EK8A 3LPXA 4GT9A 3K59A 2Y3PA 4AHCA 1TWAA 2O5JD 1XXAA 4EJ3A 4KASA 1O2BA 2PMZA 2B63A 1O25A 2JH3A 3N0BA 2GSOA 1WQFA 4FZBA 4G0VA 4FGUA 4NOLA 3SJRA 3HKZA 4KMAA 1YNJD 3K57A 1O24A 4KMDA 4ILDA 3ERED 1TWCA 3OEPA 3K5OA 1K83A 2CW0D 3LHPS 3CAGA 1TGOA 3OPFA 1LPQA 4KB4A 4NOKA 4KMHA 4M1XA 1WCMA 1O27A 1O29A 3K5LA 4QCLA 2KWAA 1TL8A 1O2AA 5C9HA 4C2MA 1WQHA 4D3ZA 2RGRA 4KATA 4IP8A 3QX3A 1BGWA 1XXCA 3N3YA 3Q3QA 3IAYA 1ZXOA 4LR2A 3S0XA 2WAQA 2R4GA 3FHZA 5JFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EK8 A;  3LPX A;  4L8I A;  2Y3P A;  4G0W A;  4KAW X;  1XXA A;  2XCQ A;  4KC6 A;  1B4B A;  1GE9 A;  1WQF A;  4G0V A;  4G0U A;  1EH1 A;  1F9N A;  5MLC 9;  4FM9 A;  3MML B;  1DD5 A;  4JLR C;  3L4J A;  1BJT A;  3V4G A;  3L4K A;  4DDQ A;  3LAP A;  2PHC B;  3FOE A;  3OEP A;  3CAG A;  3OPF A;  3LHP S;  1ZVU A;  3ERE D;  4KB4 A;  3FOF A;  1WIH A;  4KB2 A;  4OYD B;  2P5M A;  2ZFZ A;  1IS1 A;  3BUE A;  3ORE A;  2XCR B;  2KWA A;  3LF9 A;  4KDD A;  1WQG A;  1AB4 A;  1WQH A;  2XCO A;  5CJ9 A;  1Y69 8;  4J3N A;  3VA7 A;  1XXB A;  2RGR A;  1BGW A;  1XXC A;  3QX3 A;  5JVO A;  1ISE A;  3NUH A;  5JSB B;  1B4A A;  5JSN B;  4GFQ A;  3LAJ A;  3FHZ A; 
#chains in the Genus database with same CATH topology
 2PPB A;  3HOX K;  3HOZ C;  1ZYR D;  3GTO A;  1R9T K;  2JA5 C;  1F7V A;  2JA6 K;  3H0G K;  3GTK C;  5MLC 9;  2WB1 L;  5IYB C;  4FM9 A;  1MIU A;  4JLR C;  1A35 A;  2R93 K;  3TTG A;  3JST A;  3FOE A;  2PHC B;  1EFW A;  3HOW K;  3GTL K;  1ZYR A;  1R49 A;  1PJ6 A;  3GTG C;  3FOF A;  5M3M K;  1JQW A;  4C3I C;  4D3Y A;  1F7U A;  3RZO C;  2XCO A;  2B63 C;  3HOY K;  1PJ7 A;  4LJZ A;  3GTQ A;  1XPP A;  3T02 A;  1G51 A;  5IOR A;  1J6W A;  4H3T A;  2R7Z K;  3DU5 A;  3LAJ A;  1R9T C;  2ZUE A;  4LK1 A;  3FKI K;  4AN8 A;  1SC7 A;  3AQP A;  2FQT A;  3S15 K;  3K5M A;  1WOS A;  1EH1 A;  1VLO A;  4KMU A;  4Q5G A;  4KN7 A;  4C2M C;  3EQL A;  3CQZ K;  1TWG A;  1NH3 A;  1O28 A;  4XLN A;  1TWH C;  4MEY A;  2YU9 C;  2E2I A;  2GSN A;  2F4Q A;  4J3N A;  2BE5 A;  1RU0 A;  1SFO K;  4L8I A;  3PO3 K;  4X6A K;  1USO A;  2E2J K;  4LOW A;  2CFA A;  1TWF A;  1GE9 A;  4KM8 A;  5C4J K;  3CQZ C;  4A3D C;  2P8T A;  3GTP A;  3V4G A;  3LAP A;  3PO2 K;  2R92 C;  1ZVU A;  1YNN D;  3DU6 A;  4A3B C;  4G7H A;  1L0W A;  5IYD K;  4Q5V A;  4OYD B;  4QJV A;  5TJ3 A;  2ZFZ A;  5L46 A;  1K4T A;  4A3F K;  2Y0S A;  3GSI A;  5E68 A;  1IL2 A;  3HOU K;  1AB4 A;  3A8K A;  3H3V D;  4O26 A;  3HKZ D;  1YNN A;  3M4O C;  4Q4Z A;  2Y3P A;  3A8I A;  1TWA A;  3S2D C;  1IE0 A;  4KAS A;  1K83 K;  3GTJ C;  2GSO A;  1WQF A;  4FGU A;  1USM A;  1Y1W C;  1I6H C;  3HKZ A;  4G7O A;  1YNJ D;  4ILD A;  3AD8 C;  3ERE D;  1TWC A;  3OEP A;  3OPF A;  4M1X A;  1WCM A;  4A3E K;  1O27 A;  5M5X K;  1I3Q K;  4QCL A;  1O2A A;  4A3M K;  1YNJ A;  3GTO K;  4NOI A;  1BGW A;  1JOE A;  3S1M C;  1F93 A;  5JFE A;  2JA7 A;  2NVX C;  1ZBS A;  1KQ4 A;  1I50 C;  4KC6 A;  4C3H C;  2A68 D;  3K5N A;  3M4A A;  1BJT A;  1VJE A;  4GTF A;  3GTQ K;  2GAH C;  3BP8 C;  3S17 K;  4LQY A;  4JK1 A;  2A68 A;  4OIR A;  3K7A K;  3I4N K;  4KDD A;  3KYL A;  4Y52 C;  3VA7 A;  4YFK A;  1ISE A;  3S1Q K;  1J6V A;  3N0C A;  3HOV C;  1I3Q A;  1TWG K;  1IQ0 A;  2CFA B;  3S1N K;  2V6U A;  3RZD K;  5IOQ A;  4AYB D;  4BBS K;  5IYC C;  4A3I K;  4A3C C;  2NVT K;  4A3L C;  3GTQ C;  2E2I K;  3AQO A;  3S16 C;  2E2H A;  4QJV B;  1IS1 A;  4F3E A;  4AYB A;  3T01 A;  4XSZ A;  2NVY C;  3GTM A;  2VUM A;  1TWF K;  5C44 C;  4BY1 K;  3HOX C;  3AD7 C;  1YCL A;  4P9S A;  4OIQ A;  3GTP K;  3RZD C;  4GTA A;  2RH6 A;  2JA6 C;  3H0G C;  1RRJ A;  1O2F B;  4O2D A;  3H3V L;  1SEU A;  2R93 C;  4IP9 A;  4BBR K;  5FJ8 K;  4KN4 A;  1Y1V A;  5TMC A;  2V6S A;  3L4K A;  3GTL C;  2BE5 D;  3HOW C;  5IP7 K;  2JA5 A;  5CQG A;  4A3K K;  3S1R K;  3GTK A;  2PMZ D;  3HOY C;  4P5A A;  1TWA K;  1Y69 8;  2R7Z C;  2CW0 A;  2PA8 D;  5TMF A;  3G4A A;  2A69 D;  3GTG A;  1B4A A;  4GTB A;  4PAB A;  1EK8 A;  3FKI C;  3LPX A;  4WJ4 A;  1TWC K;  4EJ3 A;  4OIP A;  5M5Y K;  2PMZ A;  2B63 A;  2O5I A;  4BBR C;  3I4M K;  1O25 A;  2JH3 A;  3S15 C;  4A93 K;  4NOL A;  1WCM K;  2Y0S D;  3SJR A;  4BXX K;  3K57 A;  2A69 A;  4A3J K;  1PJ5 A;  4C3J K;  3LHP S;  4KMH A;  1J98 A;  3HXA A;  2KWA A;  5C4X K;  1WSV A;  2JA7 K;  4C2M A;  2WB1 D;  1WQH A;  4KAT A;  3TFH A;  4LR2 A;  1SFO C;  5C3E K;  5M3F K;  3PO3 C;  1TWH A;  1K4S A;  2E2J C;  2WAQ L;  4X6A C;  4KAW X;  2YU9 A;  3MAQ A;  5C4J C;  1XZQ A;  1IW7 D;  2WB1 A;  3SZZ A;  5EGE A;  2ZUF A;  3PO2 C;  2EBB A;  2GSU A;  1INN A;  5IYD C;  3IPJ A;  1WOO A;  4A3F C;  4GTD A;  3S2H K;  4QIW D;  3K58 A;  2JA7 C;  3P9A A;  2NVQ K;  3HOU C;  1IW7 A;  5IP9 K;  4Q5S A;  4XLP A;  2R92 A;  3AD9 C;  2JA8 K;  4OIO A;  4PAA A;  3GDZ A;  5EGH A;  4MQ9 A;  4QIW A;  2FQO A;  1K83 C;  4Y7N K;  1VRQ C;  2WAQ A;  2E2H K;  1V9M A;  3MML B;  1DD5 A;  1J6X A;  1VGX A;  2R4G A;  3GEI A;  3GTM K;  5FLM K;  4A3E C;  2VUM K;  3M3Y K;  3GTJ A;  4KB2 A;  1I3Q C;  3BUE A;  3ORE A;  4GTC A;  4NOM A;  4FYD A;  2A6E D;  1DCH A;  4A3M C;  2D6F C;  1BDF A;  3GTO C;  4BY7 K;  5CJ9 A;  4G0U A;  1XXB A;  4KM9 A;  1WOR A;  4GTE A;  5JSB B;  3FHZ A;  4A3G K;  4Y7N C;  4G7Z A;  1Y1V K;  5CHP A;  3BP3 A;  3HOZ K;  2A6E A;  1XZP A;  2JA5 K;  1F9N A;  3WOD A;  3S14 K;  3GTK K;  3L4J A;  5IYB K;  5IOT A;  3WVO A;  2NVX A;  1I50 A;  3S17 C;  1WIH A;  4KAR A;  3GTG K;  3K7A C;  3I4N C;  4C3I K;  4GZY A;  2Y0S L;  3RZO K;  2B63 K;  3S1Q C;  1A36 A;  1TWG C;  4GT9 A;  3S1N C;  3S14 C;  1EI6 A;  1XZQ B;  3N0B A;  4FZB A;  4G0V A;  4BBS C;  4A3I C;  2NVT C;  4KMD A;  2E2I C;  1DCP A;  3HKZ L;  4C2M K;  3K5O A;  2CW0 D;  4KB4 A;  4NOK A;  4C45 A;  1UV7 A;  1O29 A;  1TWH K;  5C9H A;  5M5W K;  4AH6 A;  1WOP A;  1TWF C;  4MEX A;  2YU9 K;  3QX3 A;  4BY1 C;  3S0X A;  3GTP C;  1ZQ1 C;  3AH5 A;  4G0W A;  4QIW L;  3TFJ A;  1EQR A;  2XCQ A;  2NVY A;  4YFN A;  1O26 A;  1WSR A;  4WIL A;  1IBA A;  4A3D K;  4RMF A;  5IP7 C;  1R9T A;  4DDQ A;  4A3K C;  2R92 K;  3S1R C;  2JA6 A;  4P5B A;  3H0G A;  4A3B K;  2P5M A;  5IOS A;  3SZY A;  2R93 A;  1VH2 A;  1TWA C;  1WQG A;  1SMY D;  3GTL A;  2GAG C;  1C0A A;  2B9S B;  3NUH A;  5JSN B;  4GFQ A;  4WJ3 M;  3GIR A;  3M4O K;  1Q8I A;  1TWC C;  4BLB A;  1BS2 A;  1V5V A;  3I4M C;  1XZP B;  4A93 C;  1WCM C;  4BXX C;  4YFX A;  3S2D K;  2R7Z A;  1SMY A;  3GTJ K;  4A3J C;  1Y1W K;  1I6H K;  4C3J C;  3FKI A;  4OIN A;  1JVI A;  5C4X C;  1HQM D;  1I6V D;  3T00 A;  2XCR B;  3CQZ A;  2A6H D;  3LF9 A;  4AYB L;  1X31 C;  4XSX A;  5C3E C;  3S1M K;  1HQM A;  1I6V A;  2NVX K;  2A6H A;  3A8J A;  1I50 K;  3TFI A;  1R5Z A;  4FXD A;  3GEE A;  4C3H K;  1SFO A;  4GTL A;  4LMO A;  3S2H C;  3ADA C;  1RR8 C;  1EJ9 A;  2NVQ C;  4BKW A;  1HI9 A;  5IP9 C;  4BLA A;  1Y1W A;  4LLG A;  4XCH A;  2JA8 C;  3G4C A;  5JVO A;  4Y52 K;  1T8I A;  1A31 A;  3K59 A;  4ZH4 A;  4AHC A;  3HOV K;  5HL8 A;  2O5J D;  1DCO A;  2W7V A;  1XXA A;  1O2B A;  2E2H C;  2PMZ L;  4KMA A;  4YG2 A;  5IYC K;  3DXJ A;  3GTM C;  4A3C K;  2PA8 L;  5FLM C;  4LK0 A;  2VUM C;  4A3L K;  1K83 A;  3CAG A;  2V6T A;  3M3Y C;  2WAQ D;  1TGO A;  1LPQ A;  2O5J A;  3S16 K;  3K5L A;  1YX2 A;  4BY7 C;  1TL8 A;  3GEH A;  4D3Z A;  2RGR A;  4IP8 A;  1XXC A;  2NVY K;  5D4D A;  4A3G C;  3N3Y A;  3Q3Q A;  3IAY A;  1ZXO A;  1B4B A;  1O24 A;  5C44 K;  1Y1V C; 
#chains in the Genus database with same CATH homology
 1TWH A;  1K4S A;  3AH5 A;  1ZYR D;  2JA7 A;  4G0W A;  3GTO A;  1ZBS A;  4KAW X;  2YU9 A;  1KQ4 A;  3MAQ A;  4KC6 A;  2XCQ A;  2NVY A;  1O26 A;  4C3H C;  1IW7 D;  2WB1 A;  2A68 D;  3K5N A;  5EGE A;  5MLC 9;  4FM9 A;  1MIU A;  4JLR C;  3M4A A;  1A35 A;  1BJT A;  2GSU A;  1R9T A;  4DDQ A;  2PHC B;  3FOE A;  4GTF A;  1R49 A;  4GTD A;  3FOF A;  2JA6 A;  4P5B A;  3H0G A;  3K58 A;  2P5M A;  3P9A A;  4C3I C;  4LQY A;  5IOS A;  2R93 A;  4D3Y A;  4KDD A;  1WQG A;  3KYL A;  2XCO A;  1SMY D;  3GTL A;  3VA7 A;  2R92 A;  2B9S B;  3GTQ A;  1ISE A;  3NUH A;  5IOR A;  5JSN B;  4H3T A;  4GFQ A;  3DU5 A;  3LAJ A;  5EGH A;  3N0C A;  4QIW A;  1Q8I A;  1I3Q A;  4AN8 A;  4BLB A;  1SC7 A;  2CFA B;  3AQP A;  1B4B A;  3K5M A;  2R7Z A;  1EH1 A;  5IOQ A;  4Q5G A;  1V9M A;  3MML B;  1DD5 A;  4C2M C;  4C3J C;  3FKI A;  1TWG A;  1NH3 A;  1O28 A;  3AQO A;  3GTJ A;  4KB2 A;  2E2H A;  1IS1 A;  4F3E A;  3BUE A;  1HQM D;  3ORE A;  1I6V D;  4GTC A;  4NOM A;  4FYD A;  2A6E D;  3CQZ A;  2A6H D;  4AYB A;  2XCR B;  3LF9 A;  2E2I A;  2GSN A;  5CJ9 A;  2F4Q A;  4J3N A;  3GTM A;  4G0U A;  2VUM A;  1XXB A;  4KM9 A;  4GTE A;  5JSB B;  4L8I A;  5CHP A;  4GTA A;  2CFA A;  2RH6 A;  1TWF A;  1GE9 A;  4KM8 A;  1RRJ A;  1R5Z A;  4FXD A;  1SEU A;  1F9N A;  4IP9 A;  1SFO A;  4GTL A;  3L4J A;  1Y1V A;  3GTP A;  4LMO A;  2BE5 D;  3V4G A;  5IOT A;  3LAP A;  3WVO A;  2NVX A;  3L4K A;  1ZVU A;  1YNN D;  3DU6 A;  1RR8 C;  1I50 A;  1EJ9 A;  1WIH A;  4Q5V A;  2JA5 A;  5CQG A;  4OYD B;  4KAR A;  5TJ3 A;  2ZFZ A;  4BKW A;  1K4T A;  4BLA A;  2Y0S A;  3GTK A;  1Y1W A;  4P5A A;  1AB4 A;  4O26 A;  1Y69 8;  3G4C A;  5JVO A;  1A36 A;  3G4A A;  2A69 D;  1T8I A;  3GTG A;  1B4A A;  4GTB A;  1A31 A;  1EK8 A;  3LPX A;  4GT9 A;  3K59 A;  2Y3P A;  4AHC A;  1TWA A;  2O5J D;  1XXA A;  4EJ3 A;  4KAS A;  1O2B A;  2PMZ A;  2B63 A;  1O25 A;  2JH3 A;  3N0B A;  2GSO A;  1WQF A;  4FZB A;  4G0V A;  4FGU A;  4NOL A;  3SJR A;  3HKZ A;  4KMA A;  1YNJ D;  3K57 A;  1O24 A;  4KMD A;  4ILD A;  3ERE D;  1TWC A;  3OEP A;  3K5O A;  1K83 A;  2CW0 D;  3LHP S;  3CAG A;  1TGO A;  3OPF A;  1LPQ A;  4KB4 A;  4NOK A;  4KMH A;  4M1X A;  1WCM A;  1O27 A;  1O29 A;  3K5L A;  4QCL A;  2KWA A;  1TL8 A;  1O2A A;  5C9H A;  4C2M A;  1WQH A;  4D3Z A;  2RGR A;  4KAT A;  4IP8 A;  3QX3 A;  1BGW A;  1XXC A;  3N3Y A;  3Q3Q A;  3IAY A;  1ZXO A;  4LR2 A;  3S0X A;  2WAQ A;  2R4G A;  3FHZ A;  5JFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...