4KAWX

Crystal structure of ribosome recycling factor mutant r39g from mycobacterium tuberculosis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
183
structure length
183
Chain Sequence
IDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSGITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 64
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kawX01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kawX02
1WQFA 4KB2A 3ERED 4KDDA 4JLRC 5JVOA 4KAWX 1Y698 3LHPS 1WQHA 2RGRA 4G0VA 5MLC9 3MMLB 3L4KA 1BGWA 5JSBB 4L8IA 4GFQA 2Y3PA 3OREA 3OPFA 5CJ9A 3FOEA 1WQGA 2XCQA 2ZFZA 2XCRB 1B4BA 1BJTA 3LPXA 3VA7A 1AB4A 1IS1A 3LF9A 4J3NA 4KB4A 3V4GA 3NUHA 3BUEA 4FM9A 1XXAA 2PHCB 1EH1A 1ISEA 1GE9A 4DDQA 1WIHA 3L4JA 4G0WA 1F9NA 5JSNB 2KWAA 3OEPA 3FHZA 4OYDB 1XXBA 1B4AA 3FOFA 1EK8A 4KC6A 1DD5A 2XCOA 3QX3A 1XXCA 1ZVUA 3LAPA 3CAGA 3LAJA 2P5MA 4G0UA
chains in the Genus database with same CATH superfamily
3GTKC 2FQTA 1Y1VK 3PO3C 1TWGC 3HOWK 2B63K 2JA7A 2P8TA 3G4AA 2V6TA 4BLAA 2E2IA 4MEXA 1VH2A 3S17K 4G7ZA 3CQZK 3I4MK 3GTLC 1IBAA 3GTMA 2YU9A 2A6ED 3AH5A 2NVXK 4KASA 4A3BK 4C2MK 1SFOC 3S1RC 2A6EA 4A3CC 4PAAA 1R9TA 3BP3A 4A3KK 2JH3A 5IOSA 4NOMA 2PA8D 4C3JC 3K5OA 3AQPA 4IP8A 3GIRA 4G0VA 1O24A 1BS2A 1PJ5A 2NVXC 2JA6K 3GTJK 4BLBA 3HOUC 4AYBD 2W7VA 1F7VA 5FLMC 5TJ3A 2E2JC 3K58A 3HOVK 2B63C 1WCMC 1VGXA 1I3QC 1EH1A 5E68A 4AH6A 5EGHA 1IW7D 2V6UA 4A3IK 2BE5D 1WSVA 2JA8K 2A69A 5C4JC 3S2HK 1K4SA 3ERED 1VRQC 4H3TA 1I50C 3HXAA 1JVIA 5IP7K 3HOYK 5M5YK 5TMCA 1L0WA 4A3LC 5C3EK 1Y1WK 5IYDK 5C44K 4FM9A 4GTBA 2JA6C 4QIWA 2PHCB 4G7HA 4XSZA 2R93K 4BBRC 2VUMA 1WOPA 3Q3QA 4X6AK 3SZYA 3SJRA 1ZBSA 3H0GA 1C0AA 4GT9A 2PPBA 1WCMA 3CAGA 3HOWC 3T00A 4KMAA 1V5VA 3LAJA 3GTOK 4AYBA 4IP9A 5IP7C 3S1QK 3GEIA 3G4CA 3K7AK 1BGWA 1ZYRD 4OINA 3JSTA 2E2HC 3GTPC 3K59A 1SC7A 2WAQL 4WILA 1ZYRA 5M5XK 4Y52C 1IE0A 3HKZD 4LMOA 3HOUK 3AQOA 1ISEA 1GE9A 1HQMA 5FJ8K 5C9HA 1Y1WA 3FHZA 4D3ZA 4LK0A 3EQLA 3S1QC 2A6HA 1T8IA 1RRJA 1K83A 1SMYA 4KAWX 5IORA 3LHPS 3K57A 2ZUEA 3GTLA 4MQ9A 4GFQA 5C44C 3OREA 1EFWA 2F4QA 5IYCC 4A3EC 4C2MC 1SFOA 1B4BA 2WB1D 3RZDK 4J3NA 3BUEA 2E2HK 2E2HA 2CFAB 3HOZK 2A68D 2O5JD 3OEPA 2R7ZC 3RZOK 1SFOK 2R93C 1B4AA 1V9MA 1SEUA 2XCOA 1I6VA 3GTJA 5JFEA 1TWAK 3QX3A 4QJVA 4Q4ZA 1YNND 1TWHC 4NOKA 3K5LA 1K83K 2RGRA 2NVTC 5MLC9 3S16C 3T01A 4D3YA 5JSBB 2Y3PA 1ZXOA 3OPFA 2E2JK 2E2IC 3HOVC 4BBRK 3HOZC 1K83C 5IP9K 4M1XA 2YU9C 4A93K 3FKIK 4Q5GA 4OIOA 4KB4A 4FZBA 2PMZA 1USMA 5M5WK 4WJ4A 1WIHA 1YX2A 4GTEA 3HOXC 5C4XC 5CQGA 5JSNB 2KWAA 1R9TC 4AHCA 1XXBA 3N0BA 3TFJA 4QCLA 1I3QK 4OIRA 2NVTK 2A68A 1O28A 2CFAA 1Y1VA 5FLMK 2Y0SL 1Y698 3DXJA 5IYCK 3MAQA 3GTOA 1J6XA 1WCMK 3WVOA 2ZFZA 3H0GK 4BY1K 2VUMC 4AN8A 4EJ3A 3PO2K 4KM8A 1SMYD 1I3QA 4FXDA 2GSUA 2CW0A 4Y7NC 3L4JA 4A3FK 1TWCA 2R92A 2JA5C 3GTKK 3M4OC 3P9AA 3M4AA 1ZVUA 3K5NA 4MEYA 1WOOA 5IYBC 1O2AA 3KYLA 3S17C 4KDDA 1Q8IA 4JLRC 1J98A 2B9SB 2FQOA 1WQHA 4BBSK 4A3JC 3DU5A 3FOEA 3S2DC 5CJ9A 3ADAC 1TGOA 4Y7NK 4A3FC 1TWAA 1YNJD 4PABA 4XLNA 4GTAA 4LR2A 3S1MC 3GEHA 1A36A 4ZH4A 4G0WA 1PJ7A 3A8JA 4C45A 2WAQD 3S0XA 3A8IA 4A3MK 4A3DC 3HKZL 2PMZL 1XZPA 4OIPA 5IOTA 2JA5K 1I6HC 4YFKA 2Y0SD 4A93C 3HOYC 4KN4A 4A3GK 2R4GA 4F3EA 1J6WA 1RR8C 1INNA 5C4XK 1R9TK 4X6AC 3V4GA 3IPJA 3NUHA 3GTGK 4C3IC 2NVYC 3GTKA 2V6SA 2NVXA 1XZQB 3GEEA 5IYDC 1TWCK 4OIQA 3BP8C 2YU9K 2GAHC 3CQZA 1USOA 2ZUFA 3FOFA 1DD5A 1TWHA 4QIWL 4C3JK 3A8KA 4KARA 2B63A 1UV7A 1O2BA 3AD8C 4Q5VA 3TFHA 4YG2A 1RU0A 4GZYA 4BBSC 4BXXK 4LLGA 4A3KC 1XXAA 2GSOA 4A3EK 1DCOA 2VUMK 2R93A 1I6HK 4A3BC 1YNNA 1Y1VC 3S1RK 3FKIA 3S14C 4G0UA 1PJ6A 2R7ZK 3TFIA 1DCPA 1EI6A 4NOLA 4BY1C 2O5JA 1XZQA 1IL2A 3PO3K 4P9SA 3M3YK 3HKZA 3VA7A 1XZPB 1TWCC 4KMDA 3LF9A 1VLOA 4O2DA 4GTDA 3M3YC 3S15C 2NVQC 5M3MK 4NOIA 3GTPA 4Q5SA 1WORA 3PO2C 4OYDB 3SZZA 1I50K 1MIUA 4XSXA 4KC6A 3GTQK 3H3VD 1WOSA 3LAPA 2EBBA 4YFXA 3HOXK 3K7AC 4P5BA 1WQFA 1O26A 2JA6A 3GTLK 5C3EC 1Y1WC 3GTOC 1TWAC 3MMLB 3L4KA 4C3IK 3FKIC 3AD7C 4JK1A 1HQMD 1HI9A 3GTQA 4BXXC 2CW0D 3N3YA 3I4NK 4P5AA 3LPXA 1F93A 1AB4A 3GTPK 4BKWA 1JOEA 5D4DA 4C2MA 4ILDA 2WAQA 4A3MC 4A3DK 1R49A 1XXCA 4WJ3M 5IOQA 4A3IC 2D6FC 1KQ4A 4XCHA 4XLPA 2WB1A 2E2IK 4A3GC 4KB2A 1EJ9A 1J6VA 2R7ZA 5C4JK 1YNJA 1IW7A 3RZDC 2GSNA 3T02A 3GTGC 1WQGA 2RH6A 2XCQA 2XCRB 2NVYA 1TWGA 4QIWD 1IS1A 1O27A 1ZQ1C 3K5MA 4LOWA 1F7UA 1LPQA 4LK1A 1TWGK 1EQRA 5IYBK 1O2FB 2NVYK 4AYBL 2GAGC 3RZOC 3M4OK 4A3JK 1I6VD 5M3FK 4Y52K 1TWHK 3S15K 4A3CK 4LJZA 3N0CA 1VJEA 3AD9C 1K4TA 3GTGA 3CQZC 4A3LK 1G51A 1O25A 1A31A 1TWFK 1JQWA 3GDZA 1EK8A 4KMHA 3S16K 2A6HD 4KMUA 1IQ0A 2PMZD 1YCLA 1DCHA 3IAYA 2JA5A 1X31C 4L8IA 1I50A 4G7OA 1BJTA 2O5IA 1A35A 2WB1L 4C3HK 3S1NC 4BY7K 3GSIA 1TL8A 3DU6A 4O26A 1TWFA 5EGEA 3S14K 2JA8C 4RMFA 1BDFA 5HL8A 4YFNA 2JA7C 3GTMK 5L46A 2PA8L 4FGUA 4KN7A 1WSRA 3H0GC 5JVOA 3GTQC 2JA7K 3GTMC 3I4NC 4C3HC 3S1NK 1O29A 4BY7C 1R5ZA 4GTLA 2R92C 2BE5A 3S2HC 4GTFA 2NVQK 3H3VL 4LQYA 2A69D 3WODA 2R92K 3S2DK 5IP9C 1NH3A 4QJVB 4DDQA 4GTCA 1F9NA 1XPPA 3I4MC 5CHPA 3S1MK 3TTGA 5TMFA 4KATA 1TWFC 4KM9A 4FYDA 2P5MA 3GTJC 2Y0SA
chains in the Genus database with same CATH topology
4KB2A 5IOTA 1EJ9A 4KAWX 5IORA 3LHPS 3K57A 2R7ZA 3GTLA 2P5MA 2R4GA 2JA7A 3G4AA 4GFQA 2GSNA 4F3EA 3OREA 2F4QA 1RR8C 1WQGA 2E2IA 2RH6A 2XCQA 4BLAA 2NVYA 1TWGA 1SFOA 1B4BA 4C2MC 2XCRB 3GTMA 2YU9A 1IS1A 1O27A 4J3NA 2A6ED 3AH5A 3V4GA 3NUHA 3BUEA 4KASA 3K5MA 4C3IC 2E2HA 2CFAB 3GTKA 2NVXA 1LPQA 2A68D 2O5JD 3OEPA 3CQZA 1R9TA 1B4AA 3FOFA 1V9MA 1DD5A 1TWHA 1SEUA 2XCOA 3GTJA 2JH3A 4KARA 2B63A 5JFEA 3QX3A 5IOSA 1O2BA 4NOMA 1I6VD 4C3JC 1YNND 4Q5VA 3K5OA 4NOKA 4IP8A 3K5LA 3AQPA 2RGRA 4G0VA 1O24A 5MLC9 4D3YA 5JSBB 2Y3PA 1ZXOA 3OPFA 4BLBA 4M1XA 4Q5GA 5TJ3A 4KB4A 3K58A 4FZBA 3N0CA 1K4TA 1XXAA 2PMZA 2GSOA 1EH1A 1WIHA 3GTGA 4GTEA 5EGHA 1IW7D 5CQGA 5JSNB 2KWAA 1O25A 1A31A 4AHCA 2R93A 1XXBA 3N0BA 4QCLA 2BE5D 1EK8A 4KMHA 3FKIA 2A6HD 1O28A 1K4SA 4G0UA 2CFAA 3ERED 1Y1VA 3IAYA 4H3TA 1Y698 2JA5A 4NOLA 3MAQA 3GTOA 4L8IA 3WVOA 1I50A 2ZFZA 1BJTA 1A35A 3HKZA 4AN8A 3VA7A 4EJ3A 4KMDA 3LF9A 4FM9A 4GTBA 1TL8A 4KM8A 4QIWA 1SMYD 1I3QA 4GTDA 4FXDA 2PHCB 3DU6A 4O26A 2GSUA 1TWFA 5EGEA 2VUMA 3L4JA 3Q3QA 1TWCA 3GTPA 2R92A 4OYDB 3SJRA 3P9AA 1ZBSA 3H0GA 1MIUA 4KC6A 4GT9A 3M4AA 1WCMA 1ZVUA 3LAPA 3CAGA 3K5NA 4KMAA 3LAJA 4P5BA 4FGUA 4AYBA 1WQFA 4IP9A 3KYLA 1O2AA 4KDDA 1Q8IA 4JLRC 5JVOA 1O26A 2B9SB 2JA6A 3G4CA 1WQHA 3MMLB 4C3HC 3L4KA 1BGWA 1ZYRD 1O29A 1R5ZA 4GTLA 3DU5A 1HQMD 3K59A 1SC7A 3GTQA 5CJ9A 3FOEA 1TGOA 4GTFA 2CW0D 3N3YA 4P5AA 1TWAA 3LPXA 4LQYA 1YNJD 2A69D 1AB4A 4BKWA 4GTAA 4LMOA 1NH3A 4LR2A 1A36A 1ISEA 1GE9A 3AQOA 4DDQA 4GTCA 4G0WA 1F9NA 5C9HA 1Y1WA 5CHPA 4D3ZA 3FHZA 4C2MA 4ILDA 2WAQA 1R49A 3S0XA 4KATA 1XXCA 4KM9A 5IOQA 4FYDA 1KQ4A 1T8IA 2Y0SA 2WB1A 1RRJA 1K83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQF A;  4KB2 A;  3ERE D;  4KDD A;  4JLR C;  5JVO A;  4KAW X;  1Y69 8;  3LHP S;  1WQH A;  2RGR A;  4G0V A;  5MLC 9;  3MML B;  3L4K A;  1BGW A;  5JSB B;  4L8I A;  4GFQ A;  2Y3P A;  3ORE A;  3OPF A;  5CJ9 A;  3FOE A;  1WQG A;  2XCQ A;  2ZFZ A;  2XCR B;  1B4B A;  1BJT A;  3LPX A;  3VA7 A;  1AB4 A;  1IS1 A;  3LF9 A;  4J3N A;  4KB4 A;  3V4G A;  3NUH A;  3BUE A;  4FM9 A;  1XXA A;  2PHC B;  1EH1 A;  1ISE A;  1GE9 A;  4DDQ A;  1WIH A;  3L4J A;  4G0W A;  1F9N A;  5JSN B;  2KWA A;  3OEP A;  3FHZ A;  4OYD B;  1XXB A;  1B4A A;  3FOF A;  1EK8 A;  4KC6 A;  1DD5 A;  2XCO A;  3QX3 A;  1XXC A;  1ZVU A;  3LAP A;  3CAG A;  3LAJ A;  2P5M A;  4G0U A; 
#chains in the Genus database with same CATH topology
 3GTK C;  2FQT A;  1Y1V K;  3PO3 C;  1TWG C;  3HOW K;  2B63 K;  2JA7 A;  2P8T A;  3G4A A;  2V6T A;  4BLA A;  2E2I A;  4MEX A;  1VH2 A;  3S17 K;  4G7Z A;  3CQZ K;  3I4M K;  3GTL C;  1IBA A;  3GTM A;  2YU9 A;  2A6E D;  3AH5 A;  2NVX K;  4KAS A;  4A3B K;  4C2M K;  1SFO C;  3S1R C;  2A6E A;  4A3C C;  4PAA A;  1R9T A;  3BP3 A;  4A3K K;  2JH3 A;  5IOS A;  4NOM A;  2PA8 D;  4C3J C;  3K5O A;  3AQP A;  4IP8 A;  3GIR A;  4G0V A;  1O24 A;  1BS2 A;  1PJ5 A;  2NVX C;  2JA6 K;  3GTJ K;  4BLB A;  3HOU C;  4AYB D;  2W7V A;  1F7V A;  5FLM C;  5TJ3 A;  2E2J C;  3K58 A;  3HOV K;  2B63 C;  1WCM C;  1VGX A;  1I3Q C;  1EH1 A;  5E68 A;  4AH6 A;  5EGH A;  1IW7 D;  2V6U A;  4A3I K;  2BE5 D;  1WSV A;  2JA8 K;  2A69 A;  5C4J C;  3S2H K;  1K4S A;  3ERE D;  1VRQ C;  4H3T A;  1I50 C;  3HXA A;  1JVI A;  5IP7 K;  3HOY K;  5M5Y K;  5TMC A;  1L0W A;  4A3L C;  5C3E K;  1Y1W K;  5IYD K;  5C44 K;  4FM9 A;  4GTB A;  2JA6 C;  4QIW A;  2PHC B;  4G7H A;  4XSZ A;  2R93 K;  4BBR C;  2VUM A;  1WOP A;  3Q3Q A;  4X6A K;  3SZY A;  3SJR A;  1ZBS A;  3H0G A;  1C0A A;  4GT9 A;  2PPB A;  1WCM A;  3CAG A;  3HOW C;  3T00 A;  4KMA A;  1V5V A;  3LAJ A;  3GTO K;  4AYB A;  4IP9 A;  5IP7 C;  3S1Q K;  3GEI A;  3G4C A;  3K7A K;  1BGW A;  1ZYR D;  4OIN A;  3JST A;  2E2H C;  3GTP C;  3K59 A;  1SC7 A;  2WAQ L;  4WIL A;  1ZYR A;  5M5X K;  4Y52 C;  1IE0 A;  3HKZ D;  4LMO A;  3HOU K;  3AQO A;  1ISE A;  1GE9 A;  1HQM A;  5FJ8 K;  5C9H A;  1Y1W A;  3FHZ A;  4D3Z A;  4LK0 A;  3EQL A;  3S1Q C;  2A6H A;  1T8I A;  1RRJ A;  1K83 A;  1SMY A;  4KAW X;  5IOR A;  3LHP S;  3K57 A;  2ZUE A;  3GTL A;  4MQ9 A;  4GFQ A;  5C44 C;  3ORE A;  1EFW A;  2F4Q A;  5IYC C;  4A3E C;  4C2M C;  1SFO A;  1B4B A;  2WB1 D;  3RZD K;  4J3N A;  3BUE A;  2E2H K;  2E2H A;  2CFA B;  3HOZ K;  2A68 D;  2O5J D;  3OEP A;  2R7Z C;  3RZO K;  1SFO K;  2R93 C;  1B4A A;  1V9M A;  1SEU A;  2XCO A;  1I6V A;  3GTJ A;  5JFE A;  1TWA K;  3QX3 A;  4QJV A;  4Q4Z A;  1YNN D;  1TWH C;  4NOK A;  3K5L A;  1K83 K;  2RGR A;  2NVT C;  5MLC 9;  3S16 C;  3T01 A;  4D3Y A;  5JSB B;  2Y3P A;  1ZXO A;  3OPF A;  2E2J K;  2E2I C;  3HOV C;  4BBR K;  3HOZ C;  1K83 C;  5IP9 K;  4M1X A;  2YU9 C;  4A93 K;  3FKI K;  4Q5G A;  4OIO A;  4KB4 A;  4FZB A;  2PMZ A;  1USM A;  5M5W K;  4WJ4 A;  1WIH A;  1YX2 A;  4GTE A;  3HOX C;  5C4X C;  5CQG A;  5JSN B;  2KWA A;  1R9T C;  4AHC A;  1XXB A;  3N0B A;  3TFJ A;  4QCL A;  1I3Q K;  4OIR A;  2NVT K;  2A68 A;  1O28 A;  2CFA A;  1Y1V A;  5FLM K;  2Y0S L;  1Y69 8;  3DXJ A;  5IYC K;  3MAQ A;  3GTO A;  1J6X A;  1WCM K;  3WVO A;  2ZFZ A;  3H0G K;  4BY1 K;  2VUM C;  4AN8 A;  4EJ3 A;  3PO2 K;  4KM8 A;  1SMY D;  1I3Q A;  4FXD A;  2GSU A;  2CW0 A;  4Y7N C;  3L4J A;  4A3F K;  1TWC A;  2R92 A;  2JA5 C;  3GTK K;  3M4O C;  3P9A A;  3M4A A;  1ZVU A;  3K5N A;  4MEY A;  1WOO A;  5IYB C;  1O2A A;  3KYL A;  3S17 C;  4KDD A;  1Q8I A;  4JLR C;  1J98 A;  2B9S B;  2FQO A;  1WQH A;  4BBS K;  4A3J C;  3DU5 A;  3FOE A;  3S2D C;  5CJ9 A;  3ADA C;  1TGO A;  4Y7N K;  4A3F C;  1TWA A;  1YNJ D;  4PAB A;  4XLN A;  4GTA A;  4LR2 A;  3S1M C;  3GEH A;  1A36 A;  4ZH4 A;  4G0W A;  1PJ7 A;  3A8J A;  4C45 A;  2WAQ D;  3S0X A;  3A8I A;  4A3M K;  4A3D C;  3HKZ L;  2PMZ L;  1XZP A;  4OIP A;  5IOT A;  2JA5 K;  1I6H C;  4YFK A;  2Y0S D;  4A93 C;  3HOY C;  4KN4 A;  4A3G K;  2R4G A;  4F3E A;  1J6W A;  1RR8 C;  1INN A;  5C4X K;  1R9T K;  4X6A C;  3V4G A;  3IPJ A;  3NUH A;  3GTG K;  4C3I C;  2NVY C;  3GTK A;  2V6S A;  2NVX A;  1XZQ B;  3GEE A;  5IYD C;  1TWC K;  4OIQ A;  3BP8 C;  2YU9 K;  2GAH C;  3CQZ A;  1USO A;  2ZUF A;  3FOF A;  1DD5 A;  1TWH A;  4QIW L;  4C3J K;  3A8K A;  4KAR A;  2B63 A;  1UV7 A;  1O2B A;  3AD8 C;  4Q5V A;  3TFH A;  4YG2 A;  1RU0 A;  4GZY A;  4BBS C;  4BXX K;  4LLG A;  4A3K C;  1XXA A;  2GSO A;  4A3E K;  1DCO A;  2VUM K;  2R93 A;  1I6H K;  4A3B C;  1YNN A;  1Y1V C;  3S1R K;  3FKI A;  3S14 C;  4G0U A;  1PJ6 A;  2R7Z K;  3TFI A;  1DCP A;  1EI6 A;  4NOL A;  4BY1 C;  2O5J A;  1XZQ A;  1IL2 A;  3PO3 K;  4P9S A;  3M3Y K;  3HKZ A;  3VA7 A;  1XZP B;  1TWC C;  4KMD A;  3LF9 A;  1VLO A;  4O2D A;  4GTD A;  3M3Y C;  3S15 C;  2NVQ C;  5M3M K;  4NOI A;  3GTP A;  4Q5S A;  1WOR A;  3PO2 C;  4OYD B;  3SZZ A;  1I50 K;  1MIU A;  4XSX A;  4KC6 A;  3GTQ K;  3H3V D;  1WOS A;  3LAP A;  2EBB A;  4YFX A;  3HOX K;  3K7A C;  4P5B A;  1WQF A;  1O26 A;  2JA6 A;  3GTL K;  5C3E C;  1Y1W C;  3GTO C;  1TWA C;  3MML B;  3L4K A;  4C3I K;  3FKI C;  3AD7 C;  4JK1 A;  1HQM D;  1HI9 A;  3GTQ A;  4BXX C;  2CW0 D;  3N3Y A;  3I4N K;  4P5A A;  3LPX A;  1F93 A;  1AB4 A;  3GTP K;  4BKW A;  1JOE A;  5D4D A;  4C2M A;  4ILD A;  2WAQ A;  4A3M C;  4A3D K;  1R49 A;  1XXC A;  4WJ3 M;  5IOQ A;  4A3I C;  2D6F C;  1KQ4 A;  4XCH A;  4XLP A;  2WB1 A;  2E2I K;  4A3G C;  4KB2 A;  1EJ9 A;  1J6V A;  2R7Z A;  5C4J K;  1YNJ A;  1IW7 A;  3RZD C;  2GSN A;  3T02 A;  3GTG C;  1WQG A;  2RH6 A;  2XCQ A;  2XCR B;  2NVY A;  1TWG A;  4QIW D;  1IS1 A;  1O27 A;  1ZQ1 C;  3K5M A;  4LOW A;  1F7U A;  1LPQ A;  4LK1 A;  1TWG K;  1EQR A;  5IYB K;  1O2F B;  2NVY K;  4AYB L;  2GAG C;  3RZO C;  3M4O K;  4A3J K;  1I6V D;  5M3F K;  4Y52 K;  1TWH K;  3S15 K;  4A3C K;  4LJZ A;  3N0C A;  1VJE A;  3AD9 C;  1K4T A;  3GTG A;  3CQZ C;  4A3L K;  1G51 A;  1O25 A;  1A31 A;  1TWF K;  1JQW A;  3GDZ A;  1EK8 A;  4KMH A;  3S16 K;  2A6H D;  4KMU A;  1IQ0 A;  2PMZ D;  1YCL A;  1DCH A;  3IAY A;  2JA5 A;  1X31 C;  4L8I A;  1I50 A;  4G7O A;  1BJT A;  2O5I A;  1A35 A;  2WB1 L;  4C3H K;  3S1N C;  4BY7 K;  3GSI A;  1TL8 A;  3DU6 A;  4O26 A;  1TWF A;  5EGE A;  3S14 K;  2JA8 C;  4RMF A;  1BDF A;  5HL8 A;  4YFN A;  2JA7 C;  3GTM K;  5L46 A;  2PA8 L;  4FGU A;  4KN7 A;  1WSR A;  3H0G C;  5JVO A;  3GTQ C;  2JA7 K;  3GTM C;  3I4N C;  4C3H C;  3S1N K;  1O29 A;  4BY7 C;  1R5Z A;  4GTL A;  2R92 C;  2BE5 A;  3S2H C;  4GTF A;  2NVQ K;  3H3V L;  4LQY A;  2A69 D;  3WOD A;  2R92 K;  3S2D K;  5IP9 C;  1NH3 A;  4QJV B;  4DDQ A;  4GTC A;  1F9N A;  1XPP A;  3I4M C;  5CHP A;  3S1M K;  3TTG A;  5TMF A;  4KAT A;  1TWF C;  4KM9 A;  4FYD A;  2P5M A;  3GTJ C;  2Y0S A; 
#chains in the Genus database with same CATH homology
 4KB2 A;  5IOT A;  1EJ9 A;  4KAW X;  5IOR A;  3LHP S;  3K57 A;  2R7Z A;  3GTL A;  2P5M A;  2R4G A;  2JA7 A;  3G4A A;  4GFQ A;  2GSN A;  4F3E A;  3ORE A;  2F4Q A;  1RR8 C;  1WQG A;  2E2I A;  2RH6 A;  2XCQ A;  4BLA A;  2NVY A;  1TWG A;  1SFO A;  1B4B A;  4C2M C;  2XCR B;  3GTM A;  2YU9 A;  1IS1 A;  1O27 A;  4J3N A;  2A6E D;  3AH5 A;  3V4G A;  3NUH A;  3BUE A;  4KAS A;  3K5M A;  4C3I C;  2E2H A;  2CFA B;  3GTK A;  2NVX A;  1LPQ A;  2A68 D;  2O5J D;  3OEP A;  3CQZ A;  1R9T A;  1B4A A;  3FOF A;  1V9M A;  1DD5 A;  1TWH A;  1SEU A;  2XCO A;  3GTJ A;  2JH3 A;  4KAR A;  2B63 A;  5JFE A;  3QX3 A;  5IOS A;  1O2B A;  4NOM A;  1I6V D;  4C3J C;  1YNN D;  4Q5V A;  3K5O A;  4NOK A;  4IP8 A;  3K5L A;  3AQP A;  2RGR A;  4G0V A;  1O24 A;  5MLC 9;  4D3Y A;  5JSB B;  2Y3P A;  1ZXO A;  3OPF A;  4BLB A;  4M1X A;  4Q5G A;  5TJ3 A;  4KB4 A;  3K58 A;  4FZB A;  3N0C A;  1K4T A;  1XXA A;  2PMZ A;  2GSO A;  1EH1 A;  1WIH A;  3GTG A;  4GTE A;  5EGH A;  1IW7 D;  5CQG A;  5JSN B;  2KWA A;  1O25 A;  1A31 A;  4AHC A;  2R93 A;  1XXB A;  3N0B A;  4QCL A;  2BE5 D;  1EK8 A;  4KMH A;  3FKI A;  2A6H D;  1O28 A;  1K4S A;  4G0U A;  2CFA A;  3ERE D;  1Y1V A;  3IAY A;  4H3T A;  1Y69 8;  2JA5 A;  4NOL A;  3MAQ A;  3GTO A;  4L8I A;  3WVO A;  1I50 A;  2ZFZ A;  1BJT A;  1A35 A;  3HKZ A;  4AN8 A;  3VA7 A;  4EJ3 A;  4KMD A;  3LF9 A;  4FM9 A;  4GTB A;  1TL8 A;  4KM8 A;  4QIW A;  1SMY D;  1I3Q A;  4GTD A;  4FXD A;  2PHC B;  3DU6 A;  4O26 A;  2GSU A;  1TWF A;  5EGE A;  2VUM A;  3L4J A;  3Q3Q A;  1TWC A;  3GTP A;  2R92 A;  4OYD B;  3SJR A;  3P9A A;  1ZBS A;  3H0G A;  1MIU A;  4KC6 A;  4GT9 A;  3M4A A;  1WCM A;  1ZVU A;  3LAP A;  3CAG A;  3K5N A;  4KMA A;  3LAJ A;  4P5B A;  4FGU A;  4AYB A;  1WQF A;  4IP9 A;  3KYL A;  1O2A A;  4KDD A;  1Q8I A;  4JLR C;  5JVO A;  1O26 A;  2B9S B;  2JA6 A;  3G4C A;  1WQH A;  3MML B;  4C3H C;  3L4K A;  1BGW A;  1ZYR D;  1O29 A;  1R5Z A;  4GTL A;  3DU5 A;  1HQM D;  3K59 A;  1SC7 A;  3GTQ A;  5CJ9 A;  3FOE A;  1TGO A;  4GTF A;  2CW0 D;  3N3Y A;  4P5A A;  1TWA A;  3LPX A;  4LQY A;  1YNJ D;  2A69 D;  1AB4 A;  4BKW A;  4GTA A;  4LMO A;  1NH3 A;  4LR2 A;  1A36 A;  1ISE A;  1GE9 A;  3AQO A;  4DDQ A;  4GTC A;  4G0W A;  1F9N A;  5C9H A;  1Y1W A;  5CHP A;  4D3Z A;  3FHZ A;  4C2M A;  4ILD A;  2WAQ A;  1R49 A;  3S0X A;  4KAT A;  1XXC A;  4KM9 A;  5IOQ A;  4FYD A;  1KQ4 A;  1T8I A;  2Y0S A;  2WB1 A;  1RRJ A;  1K83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...