4KB1A

Crystal structure of rnase t in complex with a bluge dna (two nucleotide insertion ct )
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
b'TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
molecule tags Hydrolase/dna
source organism Escherichia coli
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
total genus 60
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kb1A00
3L2VA 2B5JA 3QIPA 4C8MA 5CZ2A 4CHOA 3KLGA 3L3VA 4KHWA 4MQ3A 3NCIA 3KK1A 2P5GA 4OLAA 1NOZA 1KFSA 3HPGA 3LAMA 4FW2A 4CHYA 4HTUA 5DK5A 2VG5A 4M3YA 3QETA 5I42A 1BISA 4CEOA 3OJUA 1VK0A 1KTQA 5J2MA 3V6DA 1BCMA 1S9EA 4J2DA 3AO5A 5C25A 3L2UA 4PWDA 1VSFA 1RBRA 3ULDA 1I3AA 4OGCA 4KV8A 2DY4A 1ZYQA 2F96A 3O4QA 3DRPA 4JLHA 3SQ4A 2D0BA 3V9XA 3L2WA 2KFNA 1SL2A 1D5AA 3ZSOA 2Z1JA 1WSIA 1B9FA 4BDZA 3D45A 4F8RA 4L8RB 1QSYA 1HYVA 2X74A 3RWUA 4H4OA 4YNQA 3AVCA 2G8HA 1RBSA 4CEZA 3AVMA 2IGIA 3DRRA 3SYZA 3SUOA 2X6NA 4I9QA 3S9HA 3LANA 1QS4A 4HHTA 3V1RA 1XWLA 3AA3A 4OPKA 3SUPA 3MXMA 4IKFA 2XHBA 1S1UA 3F73A 2OZMA 3V81A 1L3TA 4BE2A 4FJJA 3HP6A 3SUNA 2XY7A 1RDCA 1RTIA 3HPHA 2KTQA 3AVGA 3LP1A 4DTJA 4DTNA 1TKDA 3LP0A 4CEAA 1L3SA 4DU3A 4KPYA 5D3GA 1MU2A 3LP3A 3VQBA 3TABA 1NOYA 4TSXA 4I2PA 5CYMA 1HYZA 2PYLA 2Y1JA 3SQ1A 3AVBA 2FBVA 1HQUA 5JS1A 4CIFA 1CXQA 3O3GA 1D9DA 3VQCA 4CJVA 3MAQA 5CYQA 5HRSA 3SZ2A 4CECA 2D0AA 2VWKA 4KHQA 4JS5A 2YV0X 3RMCA 1VRUA 1QQCA 3LWMA 4KHYA 4GMJB 4R5PA 4LSLA 1WAFA 3OS2A 1DLOA 4OJRA 3JYTA 4Z0UA 4OPJA 4DU4A 4DQPA 3DYAA 2JGUA 3ITHA 4W5QA 3CFPA 4CGHA 4F3OA 4CJTA 1IG9A 4CJUA 2DFFA 2FC0A 3VQ8A 1TK0A 1GOAA 3NGIA 4DTMA 5FRNA 1JLGA 4O0IA 3M8QA 1NJYA 4FYDA 1RILA 3DOLA 4DMNA 3OS1A 3PO5A 1EETA 3VQQA 3TR8A 3SCXA 1VSMA 3ZT4A 1NK4A 4ZTJA 3C94A 1KVCA 1SKSA 1U49A 4IFYA 3VQAA 4UQGA 3SV4A 2X78A 3SPYA 4KB1A 1I39A 1LW2A 3KLEA 3M8RA 2ZD1A 3HM9A 4H8KA 3HPOA 4DF8A 5HP1A 3O3HA 5HLFA 4Z4IA 4B9NA 1ITGA 2D5RA 4CEDA 2OPPA 2A1RA 1ASUA 4Z4HA 1EX4A 3HL8A 2P5OA 4FM2A 3OJSA 1J53A 4CF1A 3I0RA 4KREA 3IS9A 4B3OA 3OYEA 1FKPA 2ATQA 2NUBA 4LY7A 4CJQA 4FJ5A 4DG1A 4DQRA 3OYJA 4CK1A 3VA3A 3CM5A 3OYIA 4FM0A 3M8PA 2BE2A 5FDLA 4FK2A 3LWLA 3TAMA 4BDPA 5I3UA 3IRXA 4DSKA 1VSIA 1WSGA 2B6AA 4KTZA 1S9GA 1W9HA 3SQ2A 1RTDA 2YKMA 2QK9A 2VWJA 4CEEA 1CLQA 4M3RA 4ZTFA 4OKJA 5JS2A 4RW8A 4CEFA 4KAZA 4CEQA 1U47A 4E0DA 4AHRA 3QO9A 2PZSA 4CJ5A 4LH5A 2YNHA 2WOMA 3VN5A 3NE6A 4FJIA 4LSNA 4BWJA 3SV3A 2X6SA 1LWFA 1TK5A 1BCOA 3BGRA 4GW6A 4CE9A 3MXIA 1BIZA 1LWCA 1ZBHA 4CFBA 4KI4A 3ZSQA 1RT2A 3THVA 4I2QA 3ISNC 3QLHA 5KRTA 3SUQA 1SL0A 2FBYA 2Z1IA 3SQ0A 5KI6A 4IG3A 3VQ4A 2EX3A 2IOCA 4Y1CA 5HRRA 3KLFA 5KRSA 1VSJA 3V4IA 3K5NA 1RT4A 4CK3A 4E3SA 1XI1A 2XRIA 3KKSA 4DTSA 1U4BA 3KTQA 1VSDA 4Y1DA 4GVMA 3KLIA 3P1GA 5J2QA 3RR7A 2EHGA 3ZT0A 1NK8A 4DFPA 4IFVA 1RT3A 1SKRA 4M3WA 3LDSA 3TAEA 4C8OA 4C8KA 1RT7A 1RDBA 3CFRA 1S1WA 1T03A 4AILC 4NCBA 3EZ5A 3O3FA 5HRPA 1XHXA 4N5SA 4FJLA 2F8SA 1IH7A 3NF8A 4KTQA 4QCLA 4CJSA 2KZZA 4O44A 2HHWA 2Q3SA 4OKEA 3AA2A 1TV6A 3VQ6A 3SNNA 4KO0A 1NK9A 2VG7A 3AA4A 2IC3A 3K57A 2YHAA 3DLBA 5J1EA 1TAUA 1WNSA 4KTWA 1A5XA 4DTRA 3RRHA 4Z4FA 2KFZA 3LP2A 1JXEA 3AA5X 1F21A 3AVAA 2OA8A 4CFDA 4HCBA 1GOCA 3TWHA 3SPZA 2ZQBA 1IKYA 4E7LA 5KGWA 2ZE2A 3VQ7A 4CFCA 2YHBA 3QINA 4CEBA 2G8IA 3OY9A 2AJQA 2PYJA 3MEGA 1HYSA 1T7PA 3KD5E 2XO7A 4IG0A 1KFDA 4NYNA 3CYMA 4B8AB 3LZJA 2YKNA 3AVIA 3OYBA 3HXMA 4KHNA 1UAXA 2RKIA 2HHUA 3ZSYA 1L3UA 3B6PA 4B9LA 1KVAA 3CG7A 4CHZA 3QEWA 2PY5A 4FJMA 1RT6A 3QESA 5SWMA 4DSJA 1ZBFA 3ZCMA 4DLEA 3TI0A 2GV9A 2JLEA 1CZBA 1RTHA 3DLGA 4E1MA 4BE1A 3D0PA 1NKBA 2QKKA 1KVBA 1C1AA 1KSPA 4ELVA 4ELUA 1O1WA 4F2RA 3P83D 5KGXA 2RPIA 3QEIA 3T1AA 4DTUA 4G1QA 3QNNA 1T8EA 3C6UA 4N47A 1TKTA 4FJKA 2IAJA 3KIOA 3C6TA 3UIQA 1C0UA 3TAQA 2W42A 3RMAA 1S6QA 1TL1A 3AO4A 4ICLA 4OKKA 3MECA 1BHLA 1RBTA 1RCHA 3T3FA 4CCHA 4KKOA 3OYDA 2D0CA 2QKBA 2HHSA 4DS4A 3SI6A 3SJJA 1ZBUA 4DWIA 4J2BA 4FM1A 1QTMA 5EU7A 1HPZA 4FJ7A 4KRFA 2O4IA 3PX4A 1RBUA 1KCFA 1Z26A 2HNDA 3AO1A 1D8YA 4E7KA 2DTUA 1VRTA 1S6PA 4FJNA 4AHCA 1ASVA 1UOCA 1G15A 4KFBA 1T05A 2HW3A 3NH2A 3K5LA 3S3MA 2OPSA 1WSHA 4DTXA 1NKCA 1REVA 3V1OA 1TAQA 2P51A 1NKEA 3B6OA 3WNHA 3NFAA 2HHVA 4FK0A 4W5RA 5K14A 1ZBIA 1WN7A 3MXJA 1JKHA 3I8DA 3L2RA 2ETJA 4CJFA 4FZYA 1BQMA 4FXDA 3JSMA 2E6MA 3OYKA 2IDOA 1KLMA 1NK0A 5J2PA 2DFHA 4N76A 4CGGA 3TAFA 3PO4A 4FZXC 4DFJA 5FROA 3ZT2A 3HT3A 4FJXA 4NCAA 4KI6A 4M3TA 4PY5A 4C8LA 4RW7A 1YT3A 4E7IA 3K59A 1Z25A 3TARA 1RNHA 5FRMA 3HP9A 3KJVA 4E7JA 4CF0A 4CJEA 4FJGA 3T19A 2LSNA 4K8ZA 2YNFA 1Q8IA 3O4NA 1RTJA 3WNGA 3CFOA 3QERA 4PUOA 3ZSRA 4DSIA 3AO2A 1BIUA 1S5JA 4C8NA 4Z4GA 2F8TA 4MFBA 3PY8A 4B9VA 3QEVA 2FBXA 2QXFA 1LV5A 1JLAA 3NAEA 1Q9YA 3AVHA 5CZ1A 2RF2A 3OS0A 1WLJA 1NJZA 1QHTA 1N6QA 1QSSA 3DMJA 4FLWA 1TKXA 4LH4A 1L3VA 2G8UA 1J54A 1WSJA 4M45A 1R0AA 2IS3A 2ITGA 4PA1A 3U3GA 4LD0A 2Z1GA 3V9WA 5DMRA 4CJRA 1IKXA 3E01A 4CGDA 4J2EA 4CFAA 2B4JA 3NHGA 1FXXA 1JLQA 4B9UA 3DM2A 4CESA 1J9AA 2FBTA 1B9DA 3G0ZA 3KKRA 4AHTA 4FJ8A 3TAGA 3LPTA 3MEDA 2DFEA 1QE1A 1KRPA 3DI6A 5E41A 4KHUA 1TKZA 2XY6A 4DQQA 4AHSA 3OYCA 4FLTA 1RDAA 3I0SA 3NBPA 3OVNA 3OYMA 4QAGA 1WAJA 3ALYA 1NJWA 4W5TA 1KLNA 1ZBLA 1C1CA 4FLVA 1WSFA 1NK6A 1Q9XA 1YVUA 1VSEA 2GUIA 4F3TA 1UWBA 2BGGA 3OYAA 1UA1A 4DSLA 3K5MA 5HROA 4HVJA 2P1JA 2E4LA 3HO1A 1B92A 1A5VA 2A1SA 4HUFA 4JRQA 2RN2A 3DLKA 1J5OA 4M3XA 3QEPA 4DSFA 3AVNA 4CIEA 4CGIA 4BE0A 4HCCA 2YNIA 3PUFA 3HVRA 1NJXA 4K8XA 1YTAA 3CQ8A 1JLFA 4O0JA 4CERA 2GBZA 4DLGA 1TK8A 4B9MA 3QIOA 1JL1A 1SUQA 4CHPA 3ZSZA 4CHNA 3NDKA 2G8FA 4FJHA 1NK7A 1RBVA 4OGEA 4W5NA 3LAKA 1EKEA 3DLEA 3OYGA 3AVJA 3RR8A 5KTQA 4F2SA 4EZ9A 1TVRA 2XY5A 4W5OA 1DTQA 3MEEA 3VA0A 3QNOA 3L2QA 1VSLA 1LWEA 4I9LA 3NGZA 4CJPA 1HQEA 4DQSA 3DLHA 4ELTA 1HJRA 4E89A 4PQUA 1EXQA 3K2PA 2HB5A 4RW9A 4CF9A 4KB0A 4CJLA 4FK4A 3HJFA 4Q0BA 4CJ4A 2XY8A 1IKVA 1BQNA 3V9UA 3LZIA 3H08A 2G8VA 4AHVA 1YTUA 3LPUA 1C0MA 1BGXT 4BDYA 2VG6A 4B9TA 2KW4A 2HVHA 1BI4B 1BI4A 4OVLA 3V9ZA 1LAWA 2WONA 2I5JA 4FZZA 3KLHA 3WNEA 2O4GA 4FVMA 3AVLA 2HHTA 5T7BA 4B9SA 4N41A 3C95A 4CJ3A 4Z4EA 3KK3A 3NF6A 4AHUA 4E1NA 4CK2A 1FKOA 4JRPA 4HUEA 3PV8A 3QEXA 3U6FA 1SKWA 1VSKA 4M3UA 4YFUA 4FLZA 3PX6A 1U45A 1SL1A 3WNFA 3ZSWA 2HMIA 1D9FA 1N5YA 2OPQA 3U3YA 2OPRA 4RW6A 1X1PA 3AVFA 4DTPA 4M3ZA 1S1VA 4CIGA 4M41A 1C0TA 4OLBA 4BWMA 4O5BA 5C42A 4FJ9A 3RMBA 1LW0A 4WE1A 2HNZA 4Z4CA 1HNIA 2Y1IA 4EP5A 4CF2A 3LALA 4I7FA 2KZMA 1C6VA 3NF7A 1JLBA 4ID1A 4AH9A 3A2FA 3EY1A 3DLRA 4CHQA 4QOZB 3CM6A 1JLEA 3G10A 4E19A 2BANA 4ZHRA 2Z1HA 1JL2A 4BACA 2YNGA 1RT1A 3P5JA 1X9MA 1DTTA 1U04A 3AV9A 3VQ5A 3KD1E 2G8KA 1L5UA 3L8BA 1GOBA 3IG1A 3FFIA 4RG8A 1W0HA 3TANA 1X9SA 3HYFA 4ID5A 4M42A 1JLCA 3RMDA 1EP4A 3VQDA 1FK9A 1XC9A 1UA0A 4EP4A 1NK5A 2BDPA 4KHSA 4CF8A 4F4KA 3F9KA 4NYFA 1CXUA 3DOKA 3VQEA 4N56A 3OYHA 1LAVA 1TL3A 3K58A 4IDKA 5SZTA 3IAYA 4EZ6A 4CJWA 1S1XA 2HHQA 2HVIA 1VSHA 4DS5A 2E6LA 4FCYA 3BDPA 1SV5A 3OYFA 4CGJA 3V1QA 1U48A 3ZSXA 3VQ9A 1BL3A 4CGFA 5HRNA 4Q5VA 1CZ9A 2HNYA 1JXBA 3ASMA 3V9SA 4E7HA 1IKWA 2R7YA 3L3UA 4O55A 4DF4A 1RDDA 4DU1A 4J2AA 5HBMA 1XHZA 4RW4A 3HVTA 4FLUA 3RTVA 4B8CA 5CY4A 3DRSA 3VQPA 1HNVA 3ZT3A 2KQ2A 3K5OA 3PX0A 4JS4A 3NGYA 1QSLA 4FLXA 1Y97A 4CJKA 1HMVA 1TGOA 3AVKA 1HRHA 3NF9A 4XIUA 4DFKA 4FLYA 2HHXA 1C1BA 3KK2A 3AO3A 4O4GA 3NH1A 3EYZA 4HUGA 1WSEA 3ZSVA 3RRGA 1ASWA 5J2NA 3NH0A 4DTOA 2OZSA 3OYLA 4H4MA 3HK2A 1S1TA 2G8WA 3HSTB 4IBNA 1K6YA 4B08A 4DSEA 3TAPA 4DFMA 4FW1A 3M8SA 1X9WA 1IO2A 3OYNA 3S3NA 3S3OA 4DQIA 1A5WA 5C24A 2OYQA 3ZT1A 4NCGA 1RT5A
chains in the Genus database with same CATH superfamily
3L2VA 2B5JA 3QIPA 3OHRA 5CZ2A 4CHOA 1YVNA 3L3VA 3D2EB 2P5GA 3VEVA 2ZGZA 5DK5A 2VG5A 4YHHK 3V6DA 1P8ZA 1S9EA 3PLAA 3HI0A 4J2DA 3AO5A 1NGIA 1RBRA 4KV8A 5MLCQ 3H1QA 3SQ4A 1N8RO 2D0BA 3VPZA 3L2WA 1QZ5A 1B9FA 4F8RA 4L8RB 3WXKA 4NXNK 3AVMA 4CZJA 4ILJA 3CCSN 3SYZA 4I9QA 5EX5A 1XWLA 3MXMA 3SUPA 2XHBA 3F73A 1T44A 5JLHA 4AM6A 2UYTA 2V7ZA 4JKGA 4DU3A 4H0TB 1MU2A 1H1VA 3M3ZA 2P9SA 3CPWM 2Y1JA 2ASPA 5M1OA 1HNWK 2A6AA 3O3GA 4JKEA 1YI2N 4CJVA 3OW2M 1GLLO 1OVYA 5HRSA 3M6GA 4JS5A 1VRUA 1QQCA 4GMJB 3CXCM 2Q2RA 3VF6A 4OJRA 2BH1A 2VYPA 2IVPA 5M1NA 4LFCK 1HX1A 4DU4A 1E4FT 2JGUA 5AQSA 4W5QA 1U2VB 1E3MA 2GUPA 4CJTA 1BA1A 3VQ8A 1TK0A 1S3XA 3QDKA 1GLDG 1NJYA 2O8DA 1RILA 2P9NA 3QMLA 3C94A 5AQTA 1SKSA 3VQAA 4UQGA 1JCGA 3VESA 1VQ6N 3M8RA 3HM9A 4Z4IA 4B9NA 1ZXOA 1K8AO 2D5RA 3SMSA 1ASUA 4Z4HA 1EX4A 4O5FA 2YHYA 1E4GT 3I0RA 1JJ2M 1Z05A 5BN8A 2A42A 2BUPA 3G25A 5C10A 2WFBA 3H1VX 4IOCL 5GAEP 4FM0A 2BE2A 1VAZA 3IRXA 3OBWA 1S9GA 4M3RA 1NWKA 1OH8A 4JK7A 4RW8A 4CEQA 4E0DA 3CCMN 2Q0RA 4FJIA 1LWFA 1RDWX 3BGRA 4GW6A 2ASMA 3U9ZA 5F0XA 2NRHA 4KI4A 4QS7A 1RT2A 4H0OA 2Z1IA 1RGIA 2EX3A 2IOCA 4WF9L 3KLFA 2F7TA 4IEIA 1XI1A 3KTQA 1VSDA 3VGLA 3LDQA 3KLIA 4GVMA 3T7ZA 3ZEUA 3P1GA 3WEEB 3VGKA 5J2QA 3RR7A 4KBOA 4C8OA 3OBYA 1SZ2A 1RT7A 3CI5A 3Q7CA 4PKIA 4A2BA 3A5OC 1T03A 2KTQA 4GVEA 4QS8A 4CJSA 2KZZA 1NNEA 4JEPA 4A5BA 1YF5L 1G99A 2VG7A 3AA4A 4CZMA 3K57A 3DLBA 3U9DA 3RRHA 4Z4FA 3AA5X 4NO7A 1F21A 3AVAA 3G6EN 1Q7YO 3E9PA 3SPZA 3WQTA 3CCVN 2QWOA 5KGWA 2G8IA 3K9JA 2YHBA 3RVCA 2AJQA 3UE5A 3THWA 3BY5A 2UXDK 1T7PA 4BR4A 3KD5E 3D2EA 3LZJA 3O8MA 2YKNA 4DUZK 1OKJA 4LF5K 2Q0UA 2O8FA 4B9LA 2PY5A 5SWMA 3UKUB 4DLEA 2GV9A 5E26A 4F2RA 4B1WB 4ELUA 1O1WA 5KGXA 1HLUA 4DTUA 3BEXA 4N47A 1C0UA 4CW7B 3TAQA 4XEIA 2W42A 3AO4A 1TYQB 3O1BA 2HBKA 2FXUA 4CZGA 3OYDA 2QKBA 4JN4A 3SI6A 5LY3A 4YOWA 1QTMA 1BUPA 2QW9A 1Z26A 2HNDA 4E7KA 4A61A 2YI1A 4B3TK 1G15A 4DV3K 3CERA 4CZHA 3CPEA 3LDNA 3ZETB 2P9LB 4DTXA 4FO0A 1LOTB 1VQON 1NKEA 3B6OA 2JWKA 3WNHA 4FK0A 3L0QA 3CJAA 3MXJA 4H0YB 2GWJA 4ILGB 4MO5A 3QBXA 4FL9A 5M1QA 3I8DA 3TSPA 4CJFA 1N32K 2UUAK 3P39A 2I7PA 3ZX3A 4EHTA 3OTOK 3HT3A 4NCAA 2W6LA 3SK3A 4KI6A 5C15A 1YT3A 5FRMA 3HP9A 5GIPA 1Q8IA 2NRRA 5AQKA 3CFOA 4DSIA 1BIUA 2FSNA 3SAFA 3BZKA 1JLAA 3NAEA 3AVHA 2RF2A 5IWAK 4N76A 1QHTA 2G8UA 1TKXA 4M45A 1R0AA 2IS3A 4PA1A 4DV6K 1IKXA 3LDOA 3E01A 4J2EA 4B9UA 3DM2A 4CESA 1J9AA 4FJ8A 3G0ZA 3KKRA 1QE1A 4H5RA 3DI6A 4H0XB 4GV3A 2WC9A 1O13A 3DWLA 3VENA 4QAGA 3OYMA 4W5TA 1ZBLA 1C1CA 4FLVA 4GY2B 1VSEA 2GUIA 1UA1A 4YOVA 1A5VA 4JNEA 4JRQA 3FZFA 1BWFO 4M3XA 1GLFO 3AVNA 4BE0A 5BR8K 5FLXO 4F9OA 3HVRA 4K8XA 4CERA 4O0JA 2GBZA 3FE1A 3QIOA 4PKGA 3LAKA 1EKEA 3DLEA 3E9OA 2E1YA 2GX9A 3RR8A 5KTQA 4F2SA 2HBMA 1DTQA 3MEEA 4JI4K 4DQSA 4CJPA 1HJRA 4BR2A 4Q0BA 4FWPA 3H08A 1FJGK 2F9TA 1NMNA 1NGBA 3P31A 1VQKN 4N41A 3NF6A 2ZJPL 2O8EA 3PX6A 3WNFA 5BR9A 1QVGM 2OPQA 1Y64A 4DTPA 1IV0A 1S1VA 1C0TA 4OLBA 4H5WA 4FJ9A 2E20A 3ULEA 1X3MA 2HNZA 4EP5A 1HKBA 1JLBA 3NF7A 1BG3A 3DLRA 3G10A 4DV1K 4BR0A 3VETA 4BACA 3KD1E 3U4LA 4B1YB 4WFAL 4MLEA 3HYFA 1X9SA 5GIOA 4M42A 1X3NA 3VQDA 1NK5A 3DOKA 3VQEA 3OYHA 4EZ6A 3K58A 4IDKA 5SZTA 4CJWA 3KVGA 2HVIA 1VQ4N 5EVZA 1SV5A 3VQ9A 3ATUA 4CGFA 5HRNA 4DV2K 4E7HA 3ASMA 1IKWA 2R7YA 3L3UA 1RDDA 3DRSA 2QWRA 1HNVA 3VQPA 3L4QA 3ZT3A 3NGYA 4CJKA 1T6CA 3AVKA 3P4IA 2HHXA 3TPQA 4O4GA 3EYZA 3NH1A 1YIJN 2D0OA 3OYLA 3HSTB 2D1KA 1ATRA 4B08A 3O9UA 4ISGA 2GELA 1X9WA 1IO2A 3C65A 3OYNA 3S3NA 5AQMA 1A5WA 5C24A 5GAHP 3ZT1A 2O8DB 4C8MA 5AJ3K 3NCIA 3CQXA 4CZEA 3VF4A 4K0KK 4HTUA 5I42A 1BISA 1VK0A 5J2MA 3CC4N 1BCMA 3CETA 4IO9L 5C25A 3L2UA 1VSFA 4DR5K 3A5LC 3ULDA 1I3AA 1IJJA 4DR2K 4BQLA 2F96A 3O4QA 5GADP 1X9JA 3AY9A 3V9XA 1SL2A 3EL2A 5LMNK 3J8AA 4OPAA 4JI6K 3AVCA 4A62A 3SUOA 4JKGB 3S9HA 3OA9A 1YAGA 4LF7K 3FZKA 5HOOA 2PFUA 4A5AA 3V81A 1L3TA 4XH1A 2NRWA 5ELZA 4DB3A 2WUSA 1VQMN 3AVGA 3IFRA 3S41A 4DTJA 4DTNA 4KPYA 1S22A 5D3GA 3C6AA 3VQBA 3TABA 1NOYA 4I2PA 3JS6A 1HKCA 3SQ1A 3AVBA 2FBVA 4B1UB 5ADXH 1WBDA 1M1KO 4O8KA 4CIFA 4CJ7A 1D9DA 3VQCA 4FWMA 3SZ2A 5AQPA 4PKHA 1J5EK 4KHYA 4R5PA 5C2DA 2P9SB 1DLOA 4BRHA 4X65K 4Z0UA 4C1NK 3F2KA 1VQ7N 3ITHA 3O9RA 5AQXA 4H5NA 3CFPA 4IOAL 2FC0A 3NGIA 4DTMA 1JLGA 2O8CB 1EETA 3VQQA 3SCXA 1VSMA 4DHYA 4ZTJA 2VCPA 3UB5A 3CCLN 3DXKB 4IFYA 3SV4A 1LW2A 3KLEA 1FW6A 4FPBA 2VQFK 4CEDA 3M5RA 4YORA 1MWMA 2P9IA 3H46O 4FM2A 3OJSA 2JWLA 2ATQA 4LY7A 5BREA 4CJQA 4DQRA 2W40A 2BTFA 3RSEA 1K8KA 4M7XA 3CM5A 3OYIA 1HR0K 1ATSA 4FK2A 4BDPA 5I3UA 1VSIA 3HZ6A 4KTZA 3CCJN 1RTDA 3U8XA 5BPNA 3MK6A 5B8HA 4DQ8A 4CEFA 2WOMA 2P9KB 4HWIA 5AQIA 3SV3A 2X6SA 1NGAA 2IVNA 1TK5A 1NMDA 4I6MB 1HNZK 1LWCA 1ZBHA 1Z6RA 4CFBA 4CZKA 4UY8O 5M1FA 3M1FA 4AQYK 3CF5L 3ISNC 2UXBK 3SUQA 5KRTA 5CHIA 5E84A 4IG3A 5KI6A 3IMXA 3FFKB 4Y1CA 4E3SA 4FOIA 1VQPN 2EHGA 3ZT0A 3O6WA 1NK8A 3SBGA 3O80A 4C8KA 3DXMB 1HNXK 3ULEB 4NCBA 3EZ5A 4FJLA 2I7NA 1IH7A 4QCLA 3SNNA 4KO0A 1NK9A 2IC3A 2YHAA 1KAZA 5J1EA 4KTWA 4B3SK 1IG8A 4DTRA 5AZIB 4CFDA 3AAPA 5ADXA 1QQNA 3BF3A 1IKYA 4E7LA 3VQ7A 4CFCA 4CEBA 4IJNA 1HYSA 2GWKA 3MWPA 3O1WA 2OANA 1WUAA 4JAXA 1UAXA 2HHUA 3VMFB 2CH5A 3B6PA 5EY4A 4CHZA 3QEWA 4FWKA 3ZCMA 3TI0A 3DLGA 1RTHA 2QKKA 1KSPA 2QWQA 4MO4A 1TKTA 1SS6A 3KIOA 1GLEG 2WBNA 3RMAA 2PYJA 4BGBA 1RBTA 1RCHA 3VEWA 3MCPA 4MDBA 4J2BA 3CMEN 5AZJB 3K9KA 3PX4A 1VQLN 1KCFA 4B9QA 4NB4A 1VQ9N 3K5LA 5GINA 4GNIA 1REVA 3HOSA 2HHVA 2HBLA 5K14A 4BC3A 1JKHA 1MDUB 4X64K 1W2BM 4FXDA 3JSMA 5J2PA 2HMPA 4FZXC 4DFJA 4JI1K 2E2OA 3MN5A 3O4WA 4RW7A 3K59A 3TARA 4E7JA 4CJEA 4K8ZA 3EKUA 3WNGA 4B1VA 4Z4GA 3MX2A 3EKSA 4CBXA 4B9VA 2D0PA 3ENBA 3A8YA 4BG8A 5CZ1A 1WLJA 4FWNA 2CH6A 3DMJA 5LMUK 1L3VA 3ZYYX 2NZTA 3U3GA 2Z1GA 4IXCA 5DMRA 4CJRA 2E2PA 4CFAA 3NHGA 1JLQA 1XQSC 2DFEA 4CZLA 1LCUA 4E1JA 3OYCA 4DUYK 3OVNA 4KHPK 1KLNA 3WXMB 1NK6A 3KHYA 1IBKK 3J7YP 4F3TA 1UWBA 3BP8A 3OYAA 3K5MA 3SAGA 3HO1A 2NRVA 3FZLA 4HUFA 1V4TA 1NJXA 3F9MA 1JL1A 2G8FA 1NK7A 1TYQA 3CHWA 4LF4K 4EZ9A 1VSLA 1HQEA 4PQUA 1EXQA 1OH6A 2HB5A 4EFHA 1IKVA 1BQNA 3V9UA 3LZIA 3C7NA 1IBLK 4JV5K 4WFBL 2V52B 4AHVA 1V4SA 1YTUA 5M1KA 4H0VB 1DKGD 3THXB 4DKWA 2HVHA 1BI4A 3EE9A 3THWB 5DM6L 2O4GA 4FVMA 3AVLA 1VQNN 5T7BA 4B9SA 1NLVA 4Z4EA 3C7NB 3KK3A 4AHUA 4FOEA 4HUEA 3EN9A 3PV8A 1VSKA 4FLZA 1D9FA 5EXWA 4CD3A 1P90A 4AM7A 1X1PA 3AVFA 4YDUC 4CIGA 5FPMA 1U6ZA 3FZHA 1LW0A 2Y1IA 1HNIA 5BPMA 3CJ7A 4I7FA 3THYB 2NRXA 3A2FA 1KQSM 4CHQA 4ZHRA 3J7ZO 1YXQA 2YNGA 3P5JA 1DTTA 1U04A 3AV9A 3CIPA 3VQ5A 3L8BA 3HSCA 3IG1A 3KWGA 3D2FB 1W0HA 2YX6A 1EP4A 5H1SQ 3ENOA 3UKRB 4EP4A 4JHDA 1CXUA 2FF3B 4N56A 2PAVA 4U7BA 3IAYA 4PHTX 4EHUA 1S1XA 1VSHA 4DS5A 2E6LA 3BDPA 2E2QA 2FLOA 3V1QA 2G8HA 2HNYA 4DF4A 4DU1A 3CCRN 3HVTA 3RTVA 4NLBA 4L3QA 2UUCK 3K5OA 3TTDA 4JS4A 1D4XA 3L6QA 4FLXA 2QWNA 1TGOA 4H5VA 3LM2A 3NF9A 4DV7K 2Q36A 2QEXN 1W7AA 3AO3A 5M1PA 3RRGA 1ASWA 3QB0A 5J2NA 4DTOA 1RDUA 2G8WA 4DSEA 3WXIA 1Q82O 4FW1A 2A40A 1SQKA 3S3OA 2P9NB 1ZC6A 1QHAA 2HBJA 4FWLA 3KLGA 1YHQN 1YJWN 1KFSA 3CJCA 3HPGA 4CHYA 5IT9O 4M3YA 3QETA 4CEOA 4JHDB 1GLJO 1WB9A 2P9UA 4BRGA 4OGCA 2DY4A 1ZYQA 4JLHA 4EIAA 3WT0A 5AQQA 2KFNA 1D5AA 2Z1JA 3D45A 4NXMK 1HYVA 4DV5K 1RBSA 4YOTA 4HHTA 1S1UA 1YJ9N 5JLFA 4BE2A 1XMOK 4H03B 3HP6A 2XY7A 4X66K 1RDCA 1RTIA 3HBTA 1MWKA 3LP1A 4BRPA 4JI3K 3O9TA 3LP0A 4CEAA 4BRFA 1L3SA 4IWVA 3LP3A 1Q18A 4TSXA 4BG9A 5CYMA 2PYLA 3ID6A 1HKGA 1HQUA 2W41A 5I9EB 3JXUA 5CYQA 4C1NI 2D0AA 2VWKA 4K41A 4KHQA 4DR7K 3RMCA 3LWMA 4BRKA 4RCHA 1WAFA 3OS2A 4DQPA 1J6ZA 3DXMA 4F3OA 2RHKA 3EO3A 5C12A 3H3OB 4CJUA 2DFFA 3TU5A 2YHWA 5FRNA 3AGKA 4FYDA 1EWRA 3DOLA 4DMNA 3CD6N 1NK4A 1NBWA 3C0BA 2ZF5O 1ZBSA 3SPYA 4KB1A 4DF8A 2ZD1A 5HLFA 4YOUA 4KH6A 1ITGA 5JVHL 2ZGYA 2OPPA 3AARA 3HL8A 4H5TA 2P5OA 4I6MA 3CJ9A 4KREA 1NGGA 3OYEA 1FKPA 4LF8K 2NUBA 1NJIO 4FJ5A 4CK1A 3VA3A 3M8PA 4H0PA 3G71N 3TAMA 1WSGA 3SQ2A 1KD1O 2QK9A 1DGKN 4JI7K 3QICA 4M7YA 3UKRA 1U47A 4AHRA 3QO9A 2PZSA 3VN5A 4BWJA 3QFPA 2OTLN 1VQ8N 3AGRA 4BREA 1BCOA 3TSQA 3THXA 3R9PA 4BY9C 1NGJA 3ZSQA 3QLHA 1SL0A 2QA4N 5HRRA 5KRSA 1VSJA 3K5NA 1RT4A 1QQMA 4DTSA 3CC7N 4A59A 4DFPA 1RT3A 1SKRA 3TAEA 1MA9B 3JAMO 4DR6K 3I8BA 3CCEN 3CFRA 4LF6K 5HRPA 1XHXA 4N5SA 2F8SA 3NF8A 2YCHA 1KC8O 2HHWA 2Q3SA 4OKEA 1TV6A 5A2QO 1TAUA 3ENHA 4ISFA 5AFUA 2J4RA 4BC2A 2OA8A 1EWQA 2ZE2A 3QINA 3OY9A 5AZJA 3MEGA 3J80O 4OO1J 4NYNA 5AQFA 1XMQK 3IDHA 3OYBA 1ATNA 3E66A 3K0SA 3ZSYA 4BRLA 4FJMA 3CG7A 1RT6A 2E1ZA 3SMPA 2JLEA 4BE1A 3MN6A 1NKBA 3D0PA 2UUBK 1KVBA 3P83D 2HSTA 2VQEK 3QEIA 3E9LA 1GLBG 3T1AA 4BRQA 3QNNA 3C6UA 4DV4K 3C6TA 3UIQA 2P9PB 3T3FA 1I94K 2E88A 2QWPA 4KKOA 3GG4A 4DS4A 3SJJA 1ZBUA 2Q1NA 4DWIA 4FM1A 4FJ7A 4KRFA 1HPZA 5JVGL 3NVMA 5GAGP 4CI6A 4LFAK 2P9UB 1RBUA 2V51B 1VRTA 1S6PA 1ASVA 1UOCA 4KFBA 1WOQA 1NGEA 4YOXA 1T05A 1Q86O 2FSJA 3VTHA 2OPSA 1NKCA 2ZM6K 3V1OA 1TAQA 2P51A 3NFAA 2KHOA 4BR7A 4W5RA 3BF1A 3L2RA 2ETJA 4FZYA 1BQMA 3GE1A 1QVFM 2E8AA 2E6MA 4BRMA 3OYKA 1BA0A 1KLMA 4C23A 4CGGA 3O08A 3TAFA 3PO4A 4FJXA 3ZT2A 2VWBA 1S72N 4PY5A 5BN9A 3PIPL 4C8LA 1KAYA 3VEYA 3KJVA 4FJGA 2LSNA 3O4NA 1RTJA 3R1XA 4JKAA 4M63C 3ZSRA 3QBWA 2ITMA 3AO2A 4C8NA 2ZWHA 4MFBA 3PY8A 2WTUA 3QEVA 2FBXA 4IO8A 2QXFA 1LV5A 1Q9YA 1K9MO 3MWTA 1QSSA 5F1XA 4FLWA 2D4WA 4LH4A 1J54A 4LD0A 2VGMA 3V9WA 2FBTA 1B9DA 4AHTA 2P9LA 3LPTA 3MEDA 3VOVA 1KRPA 5C0YA 4FPAA 1Q81O 4KHUA 3BZCA 1TKZA 2XY6A 4DQQA 4AHSA 3CJ1A 5F2RA 1NM1A 4FLTA 3I0SA 3NBPA 1WAJA 3ALYA 4WYBA 4GKKK 1WSFA 3MCAB 3PSIA 1YVUA 4DSLA 3AAQA 4HVJA 2E4LA 2A1SA 1NGCA 2RN2A 1J5OA 3GBTA 3QEPA 2FF6A 4DSFA 4JKFA 4CGIA 4IJAA 3TTCA 3HM8A 5AQJA 1YTAA 4DLGA 1TK8A 3HK2A 4CHPA 2HF3A 4OGEA 3OYGA 2XY5A 3DAWA 4W5OA 3VA0A 4KH5A 1LWEA 4I9LA 5FPEA 2ZJRL 3CMAN 4CF9A 4RW9A 3DLLL 4FK4A 3HJFA 2O8EB 4BROA 4V19S 2G8VA 3LPUA 1BGXT 1BI4B 3C6HA 3R6MA 2I5JA 3KLHA 3WNEA 2HHTA 2GEMA 3C95A 3N4PA 1XUPO 4E1NA 3H45C 4WQ4C 1FKOA 4CK2A 4JRPA 5AQNA 1K73O 1SKWA 3U6FA 4M3UA 4YFUA 4IEEA 1U45A 3ZSWA 2HMIA 1QZ6A 5BRFA 3VEOA 3PSFA 4RW6A 4M3ZA 5BRHA 2HF4A 4M41A 4EAHD 1YUWA 4O5BA 3RSEB 5C42A 3LALA 2CGKA 4JD2A 3VGMA 2KZMA 1C6VA 4JI8K 4ID1A 2E2NA 3EY1A 3CM6A 1JLEA 4ILHA 3W3DA 4Z94A 3SBTA 2E5LK 4BRCA 1RT1A 4B1XB 4G9ZA 3FZMA 1L5UA 3FFIA 4RG8A 4ID5A 1JLCA 1FK9A 5TKWA 2BDPA 3HTVA 4KHSA 4CF8A 3I55N 4NYFA 4HTLA 2Q31A 1KAXA 4FWRA 4FCYA 3SLCA 3OYFA 4CGJA 5JICA 1BL3A 1CZ9A 1NGDA 3DJCA 4J2AA 1XHZA 4FLUA 5CY4A 1RFQA 2KQ2A 3PX0A 4JI0K 1QSLA 5BRDA 2F4VK 2QTDA 1HMVA 4BC5A 4XIUA 4JKCA 4FLYA 4JK9A 1C1BA 3KK2A 4HUGA 1WSEA 3ZSVA 1T3VA 2OZSA 4H4MA 1S1TA 3CCUN 4JD2B 3CC2N 2YJFA 3M8SA 1U2VA 3ZLJA 4CBUA 2OYQA 2QWLA 4NCGA 1QS4A 4GKJK 2A5XA 3H3NO 4KHWA 4MQ3A 4KH4A 3KK1A 5KPTA 4OLAA 1NOZA 3VF2A 4BRIA 3LAMA 4FW2A 3J81O 3B8AX 3OJUA 1KTQA 1K8KB 4AF1A 4PWDA 3NMUA 2HHHK 2IVOA 3F5TA 1TUYA 3EEQA 3DRPA 4BVPA 3L4IA 3ZSOA 1WSIA 1R59O 4BDZA 1QSYA 2X74A 3RWUA 4H4OA 4YNQA 4CZFA 1KXPA 4CEZA 2IGIA 3DRRA 2X6NA 3LANA 4WQ5C 2NRTA 2UXCK 5EOYA 3V1RA 3AA3A 4OPKA 4IKFA 3MMVA 3KWIA 2OZMA 4FJJA 4BC4A 4K43A 3SUNA 4K42A 3HPHA 3T1YK 3MDQA 2QXLA 1TKDA 2RE2A 4U67L 4FWOA 1HYZA 1XC3A 2YHXA 1SAZA 5JMVA 2W6KA 2Q97A 5AQGA 5JS1A 4O8UA 4B3RK 1CXQA 3MAQA 2UU9K 4CECA 3P38A 4RWTA 2YV0X 4J8FA 4X62K 4LSLA 2A41A 3JYTA 4OPJA 3DYAA 3O9SA 4CGHA 1IG9A 1WBBA 1GOAA 4O0IA 3VEXA 3M8QA 3LL3A 2QWMA 5KPZA 3OS1A 3PO5A 3TR8A 3ZT4A 4BR5A 1KVCA 2PBDA 1U49A 2X78A 3IKMA 4CZIA 1I39A 4H8KA 3HPOA 4PL7A 5HP1A 3O3HA 4IFEA 2A3ZA 5AR0A 2A1RA 3WUHA 4A57A 3LM9A 2EWSA 1J53A 4CF1A 3IS9A 4B3OA 3BUZB 4DG1A 1XNQK 3OYJA 1C0FA 1NG9A 5FDLA 3LWLA 4DR4K 4DSKA 2B6AA 4CBWA 4K25A 1W9HA 2YKMA 2VWJA 4CEEA 1CLQA 4RTFD 4ZTFA 4OKJA 5JS2A 1M90O 4KAZA 3MN9A 5AQOA 3SJHA 2CGJA 2YNHA 4LH5A 4CJ5A 5AQHA 3NE6A 2ZJQL 4LSNA 3ATVA 4CE9A 2P9IB 3MXIA 1BIZA 1VHXA 4JKDA 5BPLA 3THVA 4I2QA 2FBYA 3SQ0A 3KK7A 4WCEL 3VQ4A 3A0IX 5AQLA 3VTIA 3V4IA 3A5MC 3O5BA 4LC9B 4CK3A 2XRIA 3KKSA 5FPNA 1U4BA 2IIRA 4Y1DA 1DT9A 4IFVA 4M3WA 3LDSA 1YITN 1RDBA 3IUCA 4PL8A 1S1WA 4AILC 1ILYA 3O3FA 2QM1A 4FVUA 4KTQA 4JI5K 3N4QA 4O44A 3WXJA 3AA2A 3VQ6A 4YOYA 5AQWA 1N36K 4JI2K 1WNSA 3MX5A 1A5XA 1DEJA 2KFZA 3LP2A 1JXEA 3D7EO 4HCBA 4DR3K 1GOCA 3VERA 3TWHA 2ZQBA 1HUXA 4FWSA 3CCQN 2XO7A 4IG0A 3T69A 1KFDA 4MLHA 3Q7BA 3D2FA 3CYMA 5KQDA 4WFNL 4B8AB 3AVIA 4BRAA 5KQ8A 3HXMA 4KHNA 2RKIA 4WQ5A 1L3UA 5LL6Z 4MDAA 1KVAA 3T1HK 3D6RA 3QESA 4DSJA 1ZBFA 4E1MA 1CZBA 2HOEA 3GDQA 1C1AA 4ELVA 1CZAN 2NRZA 2RPIA 1EO1A 4G1QA 1T8EA 4FJKA 2O8BB 4BGAA 2IAJA 2O8FB 4JKHA 1S6QA 1TL1A 4CCHA 4OKKA 4ICLA 3MECA 1BHLA 3A5NC 2D0CA 2HHSA 3HOTA 4JYAK 5EU7A 4DCHA 2CGLA 2O4IA 1D8YA 2DTUA 3AO1A 3FR0A 2YJEA 3ZX0A 3MN7A 3CQYA 4AHCA 4FJNA 4GV6A 3O9QA 3KZBA 3G4SN 2AA4A 5AZIA 1YJNN 3LDPA 2HW3A 3NH2A 4XH5A 4IOXA 4YY3K 3S3MA 1WSHA 3ID8A 5LJWA 3W0LA 4DR1K 4Y0WA 1ZBIA 1WN7A 4QS9A 1JCFA 1C0GA 4CD1A 2IDOA 3R8EA 1NK0A 2DFHA 4M3TA 5FROA 2H3GX 5FPDA 4E7IA 3CJBA 1Z25A 2NNWA 1RNHA 1NGFA 5AQRA 4CF0A 3T19A 2YNFA 3LDLA 4LFBK 3QERA 4PUOA 5AQYA 1S5JA 2F8TA 3VEZA 3THYA 1IBMK 4LF9K 1NJZA 3OS0A 1N6QA 5DM7L 2OCEA 1WSJA 2ITGA 4BRDA 1GLAG 2F9WA 4CGDA 2B4JA 1FXXA 3H6EA 3ZETA 3TAGA 4R79A 3PIOL 5CR4A 2DPNA 5E41A 4JK8A 1BOTO 1RDAA 2OTJN 1NJWA 2FSKA 1BU6O 1VQ5N 4B3MK 1Q9XA 4BQZA 4DV0K 2BGGA 3FLCO 5HROA 2P1JA 1B92A 3DLKA 3I56N 4CIEA 4HCCA 2NLXA 2O8BA 2YNIA 3PUFA 3TSUA 3CQ8A 1JLFA 3DXKA 4B9MA 1SUQA 3I33A 3ZSZA 4CHNA 3NDKA 4FJHA 4A2AA 1RBVA 2P9PA 3UKUA 4W5NA 5HL7L 3AVJA 2O8CA 1TVRA 3SAHA 1HPMA 3QNOA 3L2QA 4WQ4A 1ESVA 3NGZA 1EQYA 3DLHA 4ELTA 4E89A 4KB0A 3K2PA 4CJLA 4CJ4A 2XY8A 3R3LA 4FWQA 4OPHA 1C0MA 4BDYA 2VG6A 4B9TA 2KW4A 4NLCA 2KLAA 4OVLA 1LAWA 2WONA 3V9ZA 4FZZA 1OVQA 3WXLA 5LJVA 4CVNE 3WQUA 4CJ3A 4OX9K 3EE8A 3TTFA 1W97L 5C2FA 5KPRA 3QEXA 4ISEA 2V7YA 1JCEA 5AQVA 2AP1A 4IZ9A 1OH7A 4YDUA 3J7AP 1SL1A 1N5YA 3U3YA 2OPRA 4B1ZA 3WEEA 3ZEUB 1BDGA 4BWMA 3RMBA 4WE1A 4Z4CA 4CF2A 2QI2A 4AH9A 1NGHA 4QOZB 4E19A 2BANA 2Z1HA 1JL2A 3NVKA 1X9MA 1BO5O 2G8KA 3GL1A 1GOBA 3TANA 3RMDA 1N34K 2KKZA 1XC9A 1UA0A 4F4KA 3F9KA 1QQOA 1LAVA 1TL3A 1N33K 2HHQA 1HJOA 4IDHA 4JKBA 2GTDA 1U48A 3ZSXA 4Q5VA 3V9SA 1JXBA 5AQUA 4O55A 1TUUA 5AFUH 5TKYA 5HBMA 3GOIA 4RW4A 1XNRK 4B8CA 5CE3A 1OH5A 1Y97A 2VGNA 5AQZA 3EZWA 3HRGA 1HRHA 3QFUA 4DFKA 4FSVA 4XH4A 2ASOA 4BVOA 3FGUA 4BR9A 1T6DA 1GLCG 4BRNA 3NH0A 4IBNA 1K6YA 3TAPA 3ZX2A 4DFMA 1NU0A 2P9KA 4GV9A 4DQIA 3E1YA 1RT5A
chains in the Genus database with same CATH topology
3L2VA 2B5JA 3QIPA 4C8MA 5CZ2A 4CHOA 3KLGA 3L3VA 4KHWA 4MQ3A 3NCIA 3KK1A 2P5GA 4OLAA 1NOZA 1KFSA 3HPGA 3LAMA 4FW2A 4CHYA 4HTUA 5DK5A 2VG5A 4M3YA 3QETA 5I42A 1BISA 4CEOA 3OJUA 1VK0A 1KTQA 5J2MA 3V6DA 1BCMA 1S9EA 4J2DA 3AO5A 5C25A 3L2UA 4PWDA 1VSFA 1RBRA 3ULDA 1I3AA 4OGCA 4KV8A 2DY4A 1ZYQA 2F96A 3O4QA 3DRPA 4JLHA 3SQ4A 2D0BA 3V9XA 3L2WA 2KFNA 1SL2A 1D5AA 3ZSOA 2Z1JA 1WSIA 1B9FA 4BDZA 3D45A 4F8RA 4L8RB 1QSYA 1HYVA 2X74A 3RWUA 4H4OA 4YNQA 3AVCA 2G8HA 1RBSA 4CEZA 3AVMA 2IGIA 3DRRA 3SYZA 3SUOA 2X6NA 4I9QA 3S9HA 3LANA 1QS4A 4HHTA 3V1RA 1XWLA 3AA3A 4OPKA 3SUPA 3MXMA 4IKFA 2XHBA 1S1UA 3F73A 2OZMA 3V81A 1L3TA 4BE2A 4FJJA 3HP6A 3SUNA 2XY7A 1RDCA 1RTIA 3HPHA 2KTQA 3AVGA 3LP1A 4DTJA 4DTNA 1TKDA 3LP0A 4CEAA 1L3SA 4DU3A 4KPYA 5D3GA 1MU2A 3LP3A 3VQBA 3TABA 1NOYA 4TSXA 4I2PA 5CYMA 1HYZA 2PYLA 2Y1JA 3SQ1A 3AVBA 2FBVA 1HQUA 5JS1A 4CIFA 1CXQA 3O3GA 1D9DA 3VQCA 4CJVA 3MAQA 5CYQA 5HRSA 3SZ2A 4CECA 2D0AA 2VWKA 4KHQA 4JS5A 2YV0X 3RMCA 1VRUA 1QQCA 3LWMA 4KHYA 4GMJB 4R5PA 4LSLA 1WAFA 3OS2A 1DLOA 4OJRA 3JYTA 4Z0UA 4OPJA 4DU4A 4DQPA 3DYAA 2JGUA 3ITHA 4W5QA 3CFPA 4CGHA 4F3OA 4CJTA 1IG9A 4CJUA 2DFFA 2FC0A 3VQ8A 1TK0A 1GOAA 3NGIA 4DTMA 5FRNA 1JLGA 4O0IA 3M8QA 1NJYA 4FYDA 1RILA 3DOLA 4DMNA 3OS1A 3PO5A 1EETA 3VQQA 3TR8A 3SCXA 1VSMA 3ZT4A 1NK4A 4ZTJA 3C94A 1KVCA 1SKSA 1U49A 4IFYA 3VQAA 4UQGA 3SV4A 2X78A 3SPYA 4KB1A 1I39A 1LW2A 3KLEA 3M8RA 2ZD1A 3HM9A 4H8KA 3HPOA 4DF8A 5HP1A 3O3HA 5HLFA 4Z4IA 4B9NA 1ITGA 2D5RA 4CEDA 2OPPA 2A1RA 1ASUA 4Z4HA 1EX4A 3HL8A 2P5OA 4FM2A 3OJSA 1J53A 4CF1A 3I0RA 4KREA 3IS9A 4B3OA 3OYEA 1FKPA 2ATQA 2NUBA 4LY7A 4CJQA 4FJ5A 4DG1A 4DQRA 3OYJA 4CK1A 3VA3A 3CM5A 3OYIA 4FM0A 3M8PA 2BE2A 5FDLA 4FK2A 3LWLA 3TAMA 4BDPA 5I3UA 3IRXA 4DSKA 1VSIA 1WSGA 2B6AA 4KTZA 1S9GA 1W9HA 3SQ2A 1RTDA 2YKMA 2QK9A 2VWJA 4CEEA 1CLQA 4M3RA 4ZTFA 4OKJA 5JS2A 4RW8A 4CEFA 4KAZA 4CEQA 1U47A 4E0DA 4AHRA 3QO9A 2PZSA 4CJ5A 4LH5A 2YNHA 2WOMA 3VN5A 3NE6A 4FJIA 4LSNA 4BWJA 3SV3A 2X6SA 1LWFA 1TK5A 1BCOA 3BGRA 4GW6A 4CE9A 3MXIA 1BIZA 1LWCA 1ZBHA 4CFBA 4KI4A 3ZSQA 1RT2A 3THVA 4I2QA 3ISNC 3QLHA 5KRTA 3SUQA 1SL0A 2FBYA 2Z1IA 3SQ0A 5KI6A 4IG3A 3VQ4A 2EX3A 2IOCA 4Y1CA 5HRRA 3KLFA 5KRSA 1VSJA 3V4IA 3K5NA 1RT4A 4CK3A 4E3SA 1XI1A 2XRIA 3KKSA 4DTSA 1U4BA 3KTQA 1VSDA 4Y1DA 4GVMA 3KLIA 3P1GA 5J2QA 3RR7A 2EHGA 3ZT0A 1NK8A 4DFPA 4IFVA 1RT3A 1SKRA 4M3WA 3LDSA 3TAEA 4C8OA 4C8KA 1RT7A 1RDBA 3CFRA 1S1WA 1T03A 4AILC 4NCBA 3EZ5A 3O3FA 5HRPA 1XHXA 4N5SA 4FJLA 2F8SA 1IH7A 3NF8A 4KTQA 4QCLA 4CJSA 2KZZA 4O44A 2HHWA 2Q3SA 4OKEA 3AA2A 1TV6A 3VQ6A 3SNNA 4KO0A 1NK9A 2VG7A 3AA4A 2IC3A 3K57A 2YHAA 3DLBA 5J1EA 1TAUA 1WNSA 4KTWA 1A5XA 4DTRA 3RRHA 4Z4FA 2KFZA 3LP2A 1JXEA 3AA5X 1F21A 3AVAA 2OA8A 4CFDA 4HCBA 1GOCA 3TWHA 3SPZA 2ZQBA 1IKYA 4E7LA 5KGWA 2ZE2A 3VQ7A 4CFCA 2YHBA 3QINA 4CEBA 2G8IA 3OY9A 2AJQA 2PYJA 3MEGA 1HYSA 1T7PA 3KD5E 2XO7A 4IG0A 1KFDA 4NYNA 3CYMA 4B8AB 3LZJA 2YKNA 3AVIA 3OYBA 3HXMA 4KHNA 1UAXA 2RKIA 2HHUA 3ZSYA 1L3UA 3B6PA 4B9LA 1KVAA 3CG7A 4CHZA 3QEWA 2PY5A 4FJMA 1RT6A 3QESA 5SWMA 4DSJA 1ZBFA 3ZCMA 4DLEA 3TI0A 2GV9A 2JLEA 1CZBA 1RTHA 3DLGA 4E1MA 4BE1A 3D0PA 1NKBA 2QKKA 1KVBA 1C1AA 1KSPA 4ELVA 4ELUA 1O1WA 4F2RA 3P83D 5KGXA 2RPIA 3QEIA 3T1AA 4DTUA 4G1QA 3QNNA 1T8EA 3C6UA 4N47A 1TKTA 4FJKA 2IAJA 3KIOA 3C6TA 3UIQA 1C0UA 3TAQA 2W42A 3RMAA 1S6QA 1TL1A 3AO4A 4ICLA 4OKKA 3MECA 1BHLA 1RBTA 1RCHA 3T3FA 4CCHA 4KKOA 3OYDA 2D0CA 2QKBA 2HHSA 4DS4A 3SI6A 3SJJA 1ZBUA 4DWIA 4J2BA 4FM1A 1QTMA 5EU7A 1HPZA 4FJ7A 4KRFA 2O4IA 3PX4A 1RBUA 1KCFA 1Z26A 2HNDA 3AO1A 1D8YA 4E7KA 2DTUA 1VRTA 1S6PA 4FJNA 4AHCA 1ASVA 1UOCA 1G15A 4KFBA 1T05A 2HW3A 3NH2A 3K5LA 3S3MA 2OPSA 1WSHA 4DTXA 1NKCA 1REVA 3V1OA 1TAQA 2P51A 1NKEA 3B6OA 3WNHA 3NFAA 2HHVA 4FK0A 4W5RA 5K14A 1ZBIA 1WN7A 3MXJA 1JKHA 3I8DA 3L2RA 2ETJA 4CJFA 4FZYA 1BQMA 4FXDA 3JSMA 2E6MA 3OYKA 2IDOA 1KLMA 1NK0A 5J2PA 2DFHA 4N76A 4CGGA 3TAFA 3PO4A 4FZXC 4DFJA 5FROA 3ZT2A 3HT3A 4FJXA 4NCAA 4KI6A 4M3TA 4PY5A 4C8LA 4RW7A 1YT3A 4E7IA 3K59A 1Z25A 3TARA 1RNHA 5FRMA 3HP9A 3KJVA 4E7JA 4CF0A 4CJEA 4FJGA 3T19A 2LSNA 4K8ZA 2YNFA 1Q8IA 3O4NA 1RTJA 3WNGA 3CFOA 3QERA 4PUOA 3ZSRA 4DSIA 3AO2A 1BIUA 1S5JA 4C8NA 4Z4GA 2F8TA 4MFBA 3PY8A 4B9VA 3QEVA 2FBXA 2QXFA 1LV5A 1JLAA 3NAEA 1Q9YA 3AVHA 5CZ1A 2RF2A 3OS0A 1WLJA 1NJZA 1QHTA 1N6QA 1QSSA 3DMJA 4FLWA 1TKXA 4LH4A 1L3VA 2G8UA 1J54A 1WSJA 4M45A 1R0AA 2IS3A 2ITGA 4PA1A 3U3GA 4LD0A 2Z1GA 3V9WA 5DMRA 4CJRA 1IKXA 3E01A 4CGDA 4J2EA 4CFAA 2B4JA 3NHGA 1FXXA 1JLQA 4B9UA 3DM2A 4CESA 1J9AA 2FBTA 1B9DA 3G0ZA 3KKRA 4AHTA 4FJ8A 3TAGA 3LPTA 3MEDA 2DFEA 1QE1A 1KRPA 3DI6A 5E41A 4KHUA 1TKZA 2XY6A 4DQQA 4AHSA 3OYCA 4FLTA 1RDAA 3I0SA 3NBPA 3OVNA 3OYMA 4QAGA 1WAJA 3ALYA 1NJWA 4W5TA 1KLNA 1ZBLA 1C1CA 4FLVA 1WSFA 1NK6A 1Q9XA 1YVUA 1VSEA 2GUIA 4F3TA 1UWBA 2BGGA 3OYAA 1UA1A 4DSLA 3K5MA 5HROA 4HVJA 2P1JA 2E4LA 3HO1A 1B92A 1A5VA 2A1SA 4HUFA 4JRQA 2RN2A 3DLKA 1J5OA 4M3XA 3QEPA 4DSFA 3AVNA 4CIEA 4CGIA 4BE0A 4HCCA 2YNIA 3PUFA 3HVRA 1NJXA 4K8XA 1YTAA 3CQ8A 1JLFA 4O0JA 4CERA 2GBZA 4DLGA 1TK8A 4B9MA 3QIOA 1JL1A 1SUQA 4CHPA 3ZSZA 4CHNA 3NDKA 2G8FA 4FJHA 1NK7A 1RBVA 4OGEA 4W5NA 3LAKA 1EKEA 3DLEA 3OYGA 3AVJA 3RR8A 5KTQA 4F2SA 4EZ9A 1TVRA 2XY5A 4W5OA 1DTQA 3MEEA 3VA0A 3QNOA 3L2QA 1VSLA 1LWEA 4I9LA 3NGZA 4CJPA 1HQEA 4DQSA 3DLHA 4ELTA 1HJRA 4E89A 4PQUA 1EXQA 3K2PA 2HB5A 4RW9A 4CF9A 4KB0A 4CJLA 4FK4A 3HJFA 4Q0BA 4CJ4A 2XY8A 1IKVA 1BQNA 3V9UA 3LZIA 3H08A 2G8VA 4AHVA 1YTUA 3LPUA 1C0MA 1BGXT 4BDYA 2VG6A 4B9TA 2KW4A 2HVHA 1BI4B 1BI4A 4OVLA 3V9ZA 1LAWA 2WONA 2I5JA 4FZZA 3KLHA 3WNEA 2O4GA 4FVMA 3AVLA 2HHTA 5T7BA 4B9SA 4N41A 3C95A 4CJ3A 4Z4EA 3KK3A 3NF6A 4AHUA 4E1NA 4CK2A 1FKOA 4JRPA 4HUEA 3PV8A 3QEXA 3U6FA 1SKWA 1VSKA 4M3UA 4YFUA 4FLZA 3PX6A 1U45A 1SL1A 3WNFA 3ZSWA 2HMIA 1D9FA 1N5YA 2OPQA 3U3YA 2OPRA 4RW6A 1X1PA 3AVFA 4DTPA 4M3ZA 1S1VA 4CIGA 4M41A 1C0TA 4OLBA 4BWMA 4O5BA 5C42A 4FJ9A 3RMBA 1LW0A 4WE1A 2HNZA 4Z4CA 1HNIA 2Y1IA 4EP5A 4CF2A 3LALA 4I7FA 2KZMA 1C6VA 3NF7A 1JLBA 4ID1A 4AH9A 3A2FA 3EY1A 3DLRA 4CHQA 4QOZB 3CM6A 1JLEA 3G10A 4E19A 2BANA 4ZHRA 2Z1HA 1JL2A 4BACA 2YNGA 1RT1A 3P5JA 1X9MA 1DTTA 1U04A 3AV9A 3VQ5A 3KD1E 2G8KA 1L5UA 3L8BA 1GOBA 3IG1A 3FFIA 4RG8A 1W0HA 3TANA 1X9SA 3HYFA 4ID5A 4M42A 1JLCA 3RMDA 1EP4A 3VQDA 1FK9A 1XC9A 1UA0A 4EP4A 1NK5A 2BDPA 4KHSA 4CF8A 4F4KA 3F9KA 4NYFA 1CXUA 3DOKA 3VQEA 4N56A 3OYHA 1LAVA 1TL3A 3K58A 4IDKA 5SZTA 3IAYA 4EZ6A 4CJWA 1S1XA 2HHQA 2HVIA 1VSHA 4DS5A 2E6LA 4FCYA 3BDPA 1SV5A 3OYFA 4CGJA 3V1QA 1U48A 3ZSXA 3VQ9A 1BL3A 4CGFA 5HRNA 4Q5VA 1CZ9A 2HNYA 1JXBA 3ASMA 3V9SA 4E7HA 1IKWA 2R7YA 3L3UA 4O55A 4DF4A 1RDDA 4DU1A 4J2AA 5HBMA 1XHZA 4RW4A 3HVTA 4FLUA 3RTVA 4B8CA 5CY4A 3DRSA 3VQPA 1HNVA 3ZT3A 2KQ2A 3K5OA 3PX0A 4JS4A 3NGYA 1QSLA 4FLXA 1Y97A 4CJKA 1HMVA 1TGOA 3AVKA 1HRHA 3NF9A 4XIUA 4DFKA 4FLYA 2HHXA 1C1BA 3KK2A 3AO3A 4O4GA 3NH1A 3EYZA 4HUGA 1WSEA 3ZSVA 3RRGA 1ASWA 5J2NA 3NH0A 4DTOA 2OZSA 3OYLA 4H4MA 3HK2A 1S1TA 2G8WA 3HSTB 4IBNA 1K6YA 4B08A 4DSEA 3TAPA 4DFMA 4FW1A 3M8SA 1X9WA 1IO2A 3OYNA 3S3NA 3S3OA 4DQIA 1A5WA 5C24A 2OYQA 3ZT1A 4NCGA 1RT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  2B5J A;  3QIP A;  4C8M A;  5CZ2 A;  4CHO A;  3KLG A;  3L3V A;  4KHW A;  4MQ3 A;  3NCI A;  3KK1 A;  2P5G A;  4OLA A;  1NOZ A;  1KFS A;  3HPG A;  3LAM A;  4FW2 A;  4CHY A;  4HTU A;  5DK5 A;  2VG5 A;  4M3Y A;  3QET A;  5I42 A;  1BIS A;  4CEO A;  3OJU A;  1VK0 A;  1KTQ A;  5J2M A;  3V6D A;  1BCM A;  1S9E A;  4J2D A;  3AO5 A;  5C25 A;  3L2U A;  4PWD A;  1VSF A;  1RBR A;  3ULD A;  1I3A A;  4OGC A;  4KV8 A;  2DY4 A;  1ZYQ A;  2F96 A;  3O4Q A;  3DRP A;  4JLH A;  3SQ4 A;  2D0B A;  3V9X A;  3L2W A;  2KFN A;  1SL2 A;  1D5A A;  3ZSO A;  2Z1J A;  1WSI A;  1B9F A;  4BDZ A;  3D45 A;  4F8R A;  4L8R B;  1QSY A;  1HYV A;  2X74 A;  3RWU A;  4H4O A;  4YNQ A;  3AVC A;  2G8H A;  1RBS A;  4CEZ A;  3AVM A;  2IGI A;  3DRR A;  3SYZ A;  3SUO A;  2X6N A;  4I9Q A;  3S9H A;  3LAN A;  1QS4 A;  4HHT A;  3V1R A;  1XWL A;  3AA3 A;  4OPK A;  3SUP A;  3MXM A;  4IKF A;  2XHB A;  1S1U A;  3F73 A;  2OZM A;  3V81 A;  1L3T A;  4BE2 A;  4FJJ A;  3HP6 A;  3SUN A;  2XY7 A;  1RDC A;  1RTI A;  3HPH A;  2KTQ A;  3AVG A;  3LP1 A;  4DTJ A;  4DTN A;  1TKD A;  3LP0 A;  4CEA A;  1L3S A;  4DU3 A;  4KPY A;  5D3G A;  1MU2 A;  3LP3 A;  3VQB A;  3TAB A;  1NOY A;  4TSX A;  4I2P A;  5CYM A;  1HYZ A;  2PYL A;  2Y1J A;  3SQ1 A;  3AVB A;  2FBV A;  1HQU A;  5JS1 A;  4CIF A;  1CXQ A;  3O3G A;  1D9D A;  3VQC A;  4CJV A;  3MAQ A;  5CYQ A;  5HRS A;  3SZ2 A;  4CEC A;  2D0A A;  2VWK A;  4KHQ A;  4JS5 A;  2YV0 X;  3RMC A;  1VRU A;  1QQC A;  3LWM A;  4KHY A;  4GMJ B;  4R5P A;  4LSL A;  1WAF A;  3OS2 A;  1DLO A;  4OJR A;  3JYT A;  4Z0U A;  4OPJ A;  4DU4 A;  4DQP A;  3DYA A;  2JGU A;  3ITH A;  4W5Q A;  3CFP A;  4CGH A;  4F3O A;  4CJT A;  1IG9 A;  4CJU A;  2DFF A;  2FC0 A;  3VQ8 A;  1TK0 A;  1GOA A;  3NGI A;  4DTM A;  5FRN A;  1JLG A;  4O0I A;  3M8Q A;  1NJY A;  4FYD A;  1RIL A;  3DOL A;  4DMN A;  3OS1 A;  3PO5 A;  1EET A;  3VQQ A;  3TR8 A;  3SCX A;  1VSM A;  3ZT4 A;  1NK4 A;  4ZTJ A;  3C94 A;  1KVC A;  1SKS A;  1U49 A;  4IFY A;  3VQA A;  4UQG A;  3SV4 A;  2X78 A;  3SPY A;  4KB1 A;  1I39 A;  1LW2 A;  3KLE A;  3M8R A;  2ZD1 A;  3HM9 A;  4H8K A;  3HPO A;  4DF8 A;  5HP1 A;  3O3H A;  5HLF A;  4Z4I A;  4B9N A;  1ITG A;  2D5R A;  4CED A;  2OPP A;  2A1R A;  1ASU A;  4Z4H A;  1EX4 A;  3HL8 A;  2P5O A;  4FM2 A;  3OJS A;  1J53 A;  4CF1 A;  3I0R A;  4KRE A;  3IS9 A;  4B3O A;  3OYE A;  1FKP A;  2ATQ A;  2NUB A;  4LY7 A;  4CJQ A;  4FJ5 A;  4DG1 A;  4DQR A;  3OYJ A;  4CK1 A;  3VA3 A;  3CM5 A;  3OYI A;  4FM0 A;  3M8P A;  2BE2 A;  5FDL A;  4FK2 A;  3LWL A;  3TAM A;  4BDP A;  5I3U A;  3IRX A;  4DSK A;  1VSI A;  1WSG A;  2B6A A;  4KTZ A;  1S9G A;  1W9H A;  3SQ2 A;  1RTD A;  2YKM A;  2QK9 A;  2VWJ A;  4CEE A;  1CLQ A;  4M3R A;  4ZTF A;  4OKJ A;  5JS2 A;  4RW8 A;  4CEF A;  4KAZ A;  4CEQ A;  1U47 A;  4E0D A;  4AHR A;  3QO9 A;  2PZS A;  4CJ5 A;  4LH5 A;  2YNH A;  2WOM A;  3VN5 A;  3NE6 A;  4FJI A;  4LSN A;  4BWJ A;  3SV3 A;  2X6S A;  1LWF A;  1TK5 A;  1BCO A;  3BGR A;  4GW6 A;  4CE9 A;  3MXI A;  1BIZ A;  1LWC A;  1ZBH A;  4CFB A;  4KI4 A;  3ZSQ A;  1RT2 A;  3THV A;  4I2Q A;  3ISN C;  3QLH A;  5KRT A;  3SUQ A;  1SL0 A;  2FBY A;  2Z1I A;  3SQ0 A;  5KI6 A;  4IG3 A;  3VQ4 A;  2EX3 A;  2IOC A;  4Y1C A;  5HRR A;  3KLF A;  5KRS A;  1VSJ A;  3V4I A;  3K5N A;  1RT4 A;  4CK3 A;  4E3S A;  1XI1 A;  2XRI A;  3KKS A;  4DTS A;  1U4B A;  3KTQ A;  1VSD A;  4Y1D A;  4GVM A;  3KLI A;  3P1G A;  5J2Q A;  3RR7 A;  2EHG A;  3ZT0 A;  1NK8 A;  4DFP A;  4IFV A;  1RT3 A;  1SKR A;  4M3W A;  3LDS A;  3TAE A;  4C8O A;  4C8K A;  1RT7 A;  1RDB A;  3CFR A;  1S1W A;  1T03 A;  4AIL C;  4NCB A;  3EZ5 A;  3O3F A;  5HRP A;  1XHX A;  4N5S A;  4FJL A;  2F8S A;  1IH7 A;  3NF8 A;  4KTQ A;  4QCL A;  4CJS A;  2KZZ A;  4O44 A;  2HHW A;  2Q3S A;  4OKE A;  3AA2 A;  1TV6 A;  3VQ6 A;  3SNN A;  4KO0 A;  1NK9 A;  2VG7 A;  3AA4 A;  2IC3 A;  3K57 A;  2YHA A;  3DLB A;  5J1E A;  1TAU A;  1WNS A;  4KTW A;  1A5X A;  4DTR A;  3RRH A;  4Z4F A;  2KFZ A;  3LP2 A;  1JXE A;  3AA5 X;  1F21 A;  3AVA A;  2OA8 A;  4CFD A;  4HCB A;  1GOC A;  3TWH A;  3SPZ A;  2ZQB A;  1IKY A;  4E7L A;  5KGW A;  2ZE2 A;  3VQ7 A;  4CFC A;  2YHB A;  3QIN A;  4CEB A;  2G8I A;  3OY9 A;  2AJQ A;  2PYJ A;  3MEG A;  1HYS A;  1T7P A;  3KD5 E;  2XO7 A;  4IG0 A;  1KFD A;  4NYN A;  3CYM A;  4B8A B;  3LZJ A;  2YKN A;  3AVI A;  3OYB A;  3HXM A;  4KHN A;  1UAX A;  2RKI A;  2HHU A;  3ZSY A;  1L3U A;  3B6P A;  4B9L A;  1KVA A;  3CG7 A;  4CHZ A;  3QEW A;  2PY5 A;  4FJM A;  1RT6 A;  3QES A;  5SWM A;  4DSJ A;  1ZBF A;  3ZCM A;  4DLE A;  3TI0 A;  2GV9 A;  2JLE A;  1CZB A;  1RTH A;  3DLG A;  4E1M A;  4BE1 A;  3D0P A;  1NKB A;  2QKK A;  1KVB A;  1C1A A;  1KSP A;  4ELV A;  4ELU A;  1O1W A;  4F2R A;  3P83 D;  5KGX A;  2RPI A;  3QEI A;  3T1A A;  4DTU A;  4G1Q A;  3QNN A;  1T8E A;  3C6U A;  4N47 A;  1TKT A;  4FJK A;  2IAJ A;  3KIO A;  3C6T A;  3UIQ A;  1C0U A;  3TAQ A;  2W42 A;  3RMA A;  1S6Q A;  1TL1 A;  3AO4 A;  4ICL A;  4OKK A;  3MEC A;  1BHL A;  1RBT A;  1RCH A;  3T3F A;  4CCH A;  4KKO A;  3OYD A;  2D0C A;  2QKB A;  2HHS A;  4DS4 A;  3SI6 A;  3SJJ A;  1ZBU A;  4DWI A;  4J2B A;  4FM1 A;  1QTM A;  5EU7 A;  1HPZ A;  4FJ7 A;  4KRF A;  2O4I A;  3PX4 A;  1RBU A;  1KCF A;  1Z26 A;  2HND A;  3AO1 A;  1D8Y A;  4E7K A;  2DTU A;  1VRT A;  1S6P A;  4FJN A;  4AHC A;  1ASV A;  1UOC A;  1G15 A;  4KFB A;  1T05 A;  2HW3 A;  3NH2 A;  3K5L A;  3S3M A;  2OPS A;  1WSH A;  4DTX A;  1NKC A;  1REV A;  3V1O A;  1TAQ A;  2P51 A;  1NKE A;  3B6O A;  3WNH A;  3NFA A;  2HHV A;  4FK0 A;  4W5R A;  5K14 A;  1ZBI A;  1WN7 A;  3MXJ A;  1JKH A;  3I8D A;  3L2R A;  2ETJ A;  4CJF A;  4FZY A;  1BQM A;  4FXD A;  3JSM A;  2E6M A;  3OYK A;  2IDO A;  1KLM A;  1NK0 A;  5J2P A;  2DFH A;  4N76 A;  4CGG A;  3TAF A;  3PO4 A;  4FZX C;  4DFJ A;  5FRO A;  3ZT2 A;  3HT3 A;  4FJX A;  4NCA A;  4KI6 A;  4M3T A;  4PY5 A;  4C8L A;  4RW7 A;  1YT3 A;  4E7I A;  3K59 A;  1Z25 A;  3TAR A;  1RNH A;  5FRM A;  3HP9 A;  3KJV A;  4E7J A;  4CF0 A;  4CJE A;  4FJG A;  3T19 A;  2LSN A;  4K8Z A;  2YNF A;  1Q8I A;  3O4N A;  1RTJ A;  3WNG A;  3CFO A;  3QER A;  4PUO A;  3ZSR A;  4DSI A;  3AO2 A;  1BIU A;  1S5J A;  4C8N A;  4Z4G A;  2F8T A;  4MFB A;  3PY8 A;  4B9V A;  3QEV A;  2FBX A;  2QXF A;  1LV5 A;  1JLA A;  3NAE A;  1Q9Y A;  3AVH A;  5CZ1 A;  2RF2 A;  3OS0 A;  1WLJ A;  1NJZ A;  1QHT A;  1N6Q A;  1QSS A;  3DMJ A;  4FLW A;  1TKX A;  4LH4 A;  1L3V A;  2G8U A;  1J54 A;  1WSJ A;  4M45 A;  1R0A A;  2IS3 A;  2ITG A;  4PA1 A;  3U3G A;  4LD0 A;  2Z1G A;  3V9W A;  5DMR A;  4CJR A;  1IKX A;  3E01 A;  4CGD A;  4J2E A;  4CFA A;  2B4J A;  3NHG A;  1FXX A;  1JLQ A;  4B9U A;  3DM2 A;  4CES A;  1J9A A;  2FBT A;  1B9D A;  3G0Z A;  3KKR A;  4AHT A;  4FJ8 A;  3TAG A;  3LPT A;  3MED A;  2DFE A;  1QE1 A;  1KRP A;  3DI6 A;  5E41 A;  4KHU A;  1TKZ A;  2XY6 A;  4DQQ A;  4AHS A;  3OYC A;  4FLT A;  1RDA A;  3I0S A;  3NBP A;  3OVN A;  3OYM A;  4QAG A;  1WAJ A;  3ALY A;  1NJW A;  4W5T A;  1KLN A;  1ZBL A;  1C1C A;  4FLV A;  1WSF A;  1NK6 A;  1Q9X A;  1YVU A;  1VSE A;  2GUI A;  4F3T A;  1UWB A;  2BGG A;  3OYA A;  1UA1 A;  4DSL A;  3K5M A;  5HRO A;  4HVJ A;  2P1J A;  2E4L A;  3HO1 A;  1B92 A;  1A5V A;  2A1S A;  4HUF A;  4JRQ A;  2RN2 A;  3DLK A;  1J5O A;  4M3X A;  3QEP A;  4DSF A;  3AVN A;  4CIE A;  4CGI A;  4BE0 A;  4HCC A;  2YNI A;  3PUF A;  3HVR A;  1NJX A;  4K8X A;  1YTA A;  3CQ8 A;  1JLF A;  4O0J A;  4CER A;  2GBZ A;  4DLG A;  1TK8 A;  4B9M A;  3QIO A;  1JL1 A;  1SUQ A;  4CHP A;  3ZSZ A;  4CHN A;  3NDK A;  2G8F A;  4FJH A;  1NK7 A;  1RBV A;  4OGE A;  4W5N A;  3LAK A;  1EKE A;  3DLE A;  3OYG A;  3AVJ A;  3RR8 A;  5KTQ A;  4F2S A;  4EZ9 A;  1TVR A;  2XY5 A;  4W5O A;  1DTQ A;  3MEE A;  3VA0 A;  3QNO A;  3L2Q A;  1VSL A;  1LWE A;  4I9L A;  3NGZ A;  4CJP A;  1HQE A;  4DQS A;  3DLH A;  4ELT A;  1HJR A;  4E89 A;  4PQU A;  1EXQ A;  3K2P A;  2HB5 A;  4RW9 A;  4CF9 A;  4KB0 A;  4CJL A;  4FK4 A;  3HJF A;  4Q0B A;  4CJ4 A;  2XY8 A;  1IKV A;  1BQN A;  3V9U A;  3LZI A;  3H08 A;  2G8V A;  4AHV A;  1YTU A;  3LPU A;  1C0M A;  1BGX T;  4BDY A;  2VG6 A;  4B9T A;  2KW4 A;  2HVH A;  1BI4 B;  1BI4 A;  4OVL A;  3V9Z A;  1LAW A;  2WON A;  2I5J A;  4FZZ A;  3KLH A;  3WNE A;  2O4G A;  4FVM A;  3AVL A;  2HHT A;  5T7B A;  4B9S A;  4N41 A;  3C95 A;  4CJ3 A;  4Z4E A;  3KK3 A;  3NF6 A;  4AHU A;  4E1N A;  4CK2 A;  1FKO A;  4JRP A;  4HUE A;  3PV8 A;  3QEX A;  3U6F A;  1SKW A;  1VSK A;  4M3U A;  4YFU A;  4FLZ A;  3PX6 A;  1U45 A;  1SL1 A;  3WNF A;  3ZSW A;  2HMI A;  1D9F A;  1N5Y A;  2OPQ A;  3U3Y A;  2OPR A;  4RW6 A;  1X1P A;  3AVF A;  4DTP A;  4M3Z A;  1S1V A;  4CIG A;  4M41 A;  1C0T A;  4OLB A;  4BWM A;  4O5B A;  5C42 A;  4FJ9 A;  3RMB A;  1LW0 A;  4WE1 A;  2HNZ A;  4Z4C A;  1HNI A;  2Y1I A;  4EP5 A;  4CF2 A;  3LAL A;  4I7F A;  2KZM A;  1C6V A;  3NF7 A;  1JLB A;  4ID1 A;  4AH9 A;  3A2F A;  3EY1 A;  3DLR A;  4CHQ A;  4QOZ B;  3CM6 A;  1JLE A;  3G10 A;  4E19 A;  2BAN A;  4ZHR A;  2Z1H A;  1JL2 A;  4BAC A;  2YNG A;  1RT1 A;  3P5J A;  1X9M A;  1DTT A;  1U04 A;  3AV9 A;  3VQ5 A;  3KD1 E;  2G8K A;  1L5U A;  3L8B A;  1GOB A;  3IG1 A;  3FFI A;  4RG8 A;  1W0H A;  3TAN A;  1X9S A;  3HYF A;  4ID5 A;  4M42 A;  1JLC A;  3RMD A;  1EP4 A;  3VQD A;  1FK9 A;  1XC9 A;  1UA0 A;  4EP4 A;  1NK5 A;  2BDP A;  4KHS A;  4CF8 A;  4F4K A;  3F9K A;  4NYF A;  1CXU A;  3DOK A;  3VQE A;  4N56 A;  3OYH A;  1LAV A;  1TL3 A;  3K58 A;  4IDK A;  5SZT A;  3IAY A;  4EZ6 A;  4CJW A;  1S1X A;  2HHQ A;  2HVI A;  1VSH A;  4DS5 A;  2E6L A;  4FCY A;  3BDP A;  1SV5 A;  3OYF A;  4CGJ A;  3V1Q A;  1U48 A;  3ZSX A;  3VQ9 A;  1BL3 A;  4CGF A;  5HRN A;  4Q5V A;  1CZ9 A;  2HNY A;  1JXB A;  3ASM A;  3V9S A;  4E7H A;  1IKW A;  2R7Y A;  3L3U A;  4O55 A;  4DF4 A;  1RDD A;  4DU1 A;  4J2A A;  5HBM A;  1XHZ A;  4RW4 A;  3HVT A;  4FLU A;  3RTV A;  4B8C A;  5CY4 A;  3DRS A;  3VQP A;  1HNV A;  3ZT3 A;  2KQ2 A;  3K5O A;  3PX0 A;  4JS4 A;  3NGY A;  1QSL A;  4FLX A;  1Y97 A;  4CJK A;  1HMV A;  1TGO A;  3AVK A;  1HRH A;  3NF9 A;  4XIU A;  4DFK A;  4FLY A;  2HHX A;  1C1B A;  3KK2 A;  3AO3 A;  4O4G A;  3NH1 A;  3EYZ A;  4HUG A;  1WSE A;  3ZSV A;  3RRG A;  1ASW A;  5J2N A;  3NH0 A;  4DTO A;  2OZS A;  3OYL A;  4H4M A;  3HK2 A;  1S1T A;  2G8W A;  3HST B;  4IBN A;  1K6Y A;  4B08 A;  4DSE A;  3TAP A;  4DFM A;  4FW1 A;  3M8S A;  1X9W A;  1IO2 A;  3OYN A;  3S3N A;  3S3O A;  4DQI A;  1A5W A;  5C24 A;  2OYQ A;  3ZT1 A;  4NCG A;  1RT5 A; 
#chains in the Genus database with same CATH topology
 3L2V A;  2B5J A;  3QIP A;  3OHR A;  5CZ2 A;  4CHO A;  1YVN A;  3L3V A;  3D2E B;  2P5G A;  3VEV A;  2ZGZ A;  5DK5 A;  2VG5 A;  4YHH K;  3V6D A;  1P8Z A;  1S9E A;  3PLA A;  3HI0 A;  4J2D A;  3AO5 A;  1NGI A;  1RBR A;  4KV8 A;  5MLC Q;  3H1Q A;  3SQ4 A;  1N8R O;  2D0B A;  3VPZ A;  3L2W A;  1QZ5 A;  1B9F A;  4F8R A;  4L8R B;  3WXK A;  4NXN K;  3AVM A;  4CZJ A;  4ILJ A;  3CCS N;  3SYZ A;  4I9Q A;  5EX5 A;  1XWL A;  3MXM A;  3SUP A;  2XHB A;  3F73 A;  1T44 A;  5JLH A;  4AM6 A;  2UYT A;  2V7Z A;  4JKG A;  4DU3 A;  4H0T B;  1MU2 A;  1H1V A;  3M3Z A;  2P9S A;  3CPW M;  2Y1J A;  2ASP A;  5M1O A;  1HNW K;  2A6A A;  3O3G A;  4JKE A;  1YI2 N;  4CJV A;  3OW2 M;  1GLL O;  1OVY A;  5HRS A;  3M6G A;  4JS5 A;  1VRU A;  1QQC A;  4GMJ B;  3CXC M;  2Q2R A;  3VF6 A;  4OJR A;  2BH1 A;  2VYP A;  2IVP A;  5M1N A;  4LFC K;  1HX1 A;  4DU4 A;  1E4F T;  2JGU A;  5AQS A;  4W5Q A;  1U2V B;  1E3M A;  2GUP A;  4CJT A;  1BA1 A;  3VQ8 A;  1TK0 A;  1S3X A;  3QDK A;  1GLD G;  1NJY A;  2O8D A;  1RIL A;  2P9N A;  3QML A;  3C94 A;  5AQT A;  1SKS A;  3VQA A;  4UQG A;  1JCG A;  3VES A;  1VQ6 N;  3M8R A;  3HM9 A;  4Z4I A;  4B9N A;  1ZXO A;  1K8A O;  2D5R A;  3SMS A;  1ASU A;  4Z4H A;  1EX4 A;  4O5F A;  2YHY A;  1E4G T;  3I0R A;  1JJ2 M;  1Z05 A;  5BN8 A;  2A42 A;  2BUP A;  3G25 A;  5C10 A;  2WFB A;  3H1V X;  4IOC L;  5GAE P;  4FM0 A;  2BE2 A;  1VAZ A;  3IRX A;  3OBW A;  1S9G A;  4M3R A;  1NWK A;  1OH8 A;  4JK7 A;  4RW8 A;  4CEQ A;  4E0D A;  3CCM N;  2Q0R A;  4FJI A;  1LWF A;  1RDW X;  3BGR A;  4GW6 A;  2ASM A;  3U9Z A;  5F0X A;  2NRH A;  4KI4 A;  4QS7 A;  1RT2 A;  4H0O A;  2Z1I A;  1RGI A;  2EX3 A;  2IOC A;  4WF9 L;  3KLF A;  2F7T A;  4IEI A;  1XI1 A;  3KTQ A;  1VSD A;  3VGL A;  3LDQ A;  3KLI A;  4GVM A;  3T7Z A;  3ZEU A;  3P1G A;  3WEE B;  3VGK A;  5J2Q A;  3RR7 A;  4KBO A;  4C8O A;  3OBY A;  1SZ2 A;  1RT7 A;  3CI5 A;  3Q7C A;  4PKI A;  4A2B A;  3A5O C;  1T03 A;  2KTQ A;  4GVE A;  4QS8 A;  4CJS A;  2KZZ A;  1NNE A;  4JEP A;  4A5B A;  1YF5 L;  1G99 A;  2VG7 A;  3AA4 A;  4CZM A;  3K57 A;  3DLB A;  3U9D A;  3RRH A;  4Z4F A;  3AA5 X;  4NO7 A;  1F21 A;  3AVA A;  3G6E N;  1Q7Y O;  3E9P A;  3SPZ A;  3WQT A;  3CCV N;  2QWO A;  5KGW A;  2G8I A;  3K9J A;  2YHB A;  3RVC A;  2AJQ A;  3UE5 A;  3THW A;  3BY5 A;  2UXD K;  1T7P A;  4BR4 A;  3KD5 E;  3D2E A;  3LZJ A;  3O8M A;  2YKN A;  4DUZ K;  1OKJ A;  4LF5 K;  2Q0U A;  2O8F A;  4B9L A;  2PY5 A;  5SWM A;  3UKU B;  4DLE A;  2GV9 A;  5E26 A;  4F2R A;  4B1W B;  4ELU A;  1O1W A;  5KGX A;  1HLU A;  4DTU A;  3BEX A;  4N47 A;  1C0U A;  4CW7 B;  3TAQ A;  4XEI A;  2W42 A;  3AO4 A;  1TYQ B;  3O1B A;  2HBK A;  2FXU A;  4CZG A;  3OYD A;  2QKB A;  4JN4 A;  3SI6 A;  5LY3 A;  4YOW A;  1QTM A;  1BUP A;  2QW9 A;  1Z26 A;  2HND A;  4E7K A;  4A61 A;  2YI1 A;  4B3T K;  1G15 A;  4DV3 K;  3CER A;  4CZH A;  3CPE A;  3LDN A;  3ZET B;  2P9L B;  4DTX A;  4FO0 A;  1LOT B;  1VQO N;  1NKE A;  3B6O A;  2JWK A;  3WNH A;  4FK0 A;  3L0Q A;  3CJA A;  3MXJ A;  4H0Y B;  2GWJ A;  4ILG B;  4MO5 A;  3QBX A;  4FL9 A;  5M1Q A;  3I8D A;  3TSP A;  4CJF A;  1N32 K;  2UUA K;  3P39 A;  2I7P A;  3ZX3 A;  4EHT A;  3OTO K;  3HT3 A;  4NCA A;  2W6L A;  3SK3 A;  4KI6 A;  5C15 A;  1YT3 A;  5FRM A;  3HP9 A;  5GIP A;  1Q8I A;  2NRR A;  5AQK A;  3CFO A;  4DSI A;  1BIU A;  2FSN A;  3SAF A;  3BZK A;  1JLA A;  3NAE A;  3AVH A;  2RF2 A;  5IWA K;  4N76 A;  1QHT A;  2G8U A;  1TKX A;  4M45 A;  1R0A A;  2IS3 A;  4PA1 A;  4DV6 K;  1IKX A;  3LDO A;  3E01 A;  4J2E A;  4B9U A;  3DM2 A;  4CES A;  1J9A A;  4FJ8 A;  3G0Z A;  3KKR A;  1QE1 A;  4H5R A;  3DI6 A;  4H0X B;  4GV3 A;  2WC9 A;  1O13 A;  3DWL A;  3VEN A;  4QAG A;  3OYM A;  4W5T A;  1ZBL A;  1C1C A;  4FLV A;  4GY2 B;  1VSE A;  2GUI A;  1UA1 A;  4YOV A;  1A5V A;  4JNE A;  4JRQ A;  3FZF A;  1BWF O;  4M3X A;  1GLF O;  3AVN A;  4BE0 A;  5BR8 K;  5FLX O;  4F9O A;  3HVR A;  4K8X A;  4CER A;  4O0J A;  2GBZ A;  3FE1 A;  3QIO A;  4PKG A;  3LAK A;  1EKE A;  3DLE A;  3E9O A;  2E1Y A;  2GX9 A;  3RR8 A;  5KTQ A;  4F2S A;  2HBM A;  1DTQ A;  3MEE A;  4JI4 K;  4DQS A;  4CJP A;  1HJR A;  4BR2 A;  4Q0B A;  4FWP A;  3H08 A;  1FJG K;  2F9T A;  1NMN A;  1NGB A;  3P31 A;  1VQK N;  4N41 A;  3NF6 A;  2ZJP L;  2O8E A;  3PX6 A;  3WNF A;  5BR9 A;  1QVG M;  2OPQ A;  1Y64 A;  4DTP A;  1IV0 A;  1S1V A;  1C0T A;  4OLB A;  4H5W A;  4FJ9 A;  2E20 A;  3ULE A;  1X3M A;  2HNZ A;  4EP5 A;  1HKB A;  1JLB A;  3NF7 A;  1BG3 A;  3DLR A;  3G10 A;  4DV1 K;  4BR0 A;  3VET A;  4BAC A;  3KD1 E;  3U4L A;  4B1Y B;  4WFA L;  4MLE A;  3HYF A;  1X9S A;  5GIO A;  4M42 A;  1X3N A;  3VQD A;  1NK5 A;  3DOK A;  3VQE A;  3OYH A;  4EZ6 A;  3K58 A;  4IDK A;  5SZT A;  4CJW A;  3KVG A;  2HVI A;  1VQ4 N;  5EVZ A;  1SV5 A;  3VQ9 A;  3ATU A;  4CGF A;  5HRN A;  4DV2 K;  4E7H A;  3ASM A;  1IKW A;  2R7Y A;  3L3U A;  1RDD A;  3DRS A;  2QWR A;  1HNV A;  3VQP A;  3L4Q A;  3ZT3 A;  3NGY A;  4CJK A;  1T6C A;  3AVK A;  3P4I A;  2HHX A;  3TPQ A;  4O4G A;  3EYZ A;  3NH1 A;  1YIJ N;  2D0O A;  3OYL A;  3HST B;  2D1K A;  1ATR A;  4B08 A;  3O9U A;  4ISG A;  2GEL A;  1X9W A;  1IO2 A;  3C65 A;  3OYN A;  3S3N A;  5AQM A;  1A5W A;  5C24 A;  5GAH P;  3ZT1 A;  2O8D B;  4C8M A;  5AJ3 K;  3NCI A;  3CQX A;  4CZE A;  3VF4 A;  4K0K K;  4HTU A;  5I42 A;  1BIS A;  1VK0 A;  5J2M A;  3CC4 N;  1BCM A;  3CET A;  4IO9 L;  5C25 A;  3L2U A;  1VSF A;  4DR5 K;  3A5L C;  3ULD A;  1I3A A;  1IJJ A;  4DR2 K;  4BQL A;  2F96 A;  3O4Q A;  5GAD P;  1X9J A;  3AY9 A;  3V9X A;  1SL2 A;  3EL2 A;  5LMN K;  3J8A A;  4OPA A;  4JI6 K;  3AVC A;  4A62 A;  3SUO A;  4JKG B;  3S9H A;  3OA9 A;  1YAG A;  4LF7 K;  3FZK A;  5HOO A;  2PFU A;  4A5A A;  3V81 A;  1L3T A;  4XH1 A;  2NRW A;  5ELZ A;  4DB3 A;  2WUS A;  1VQM N;  3AVG A;  3IFR A;  3S41 A;  4DTJ A;  4DTN A;  4KPY A;  1S22 A;  5D3G A;  3C6A A;  3VQB A;  3TAB A;  1NOY A;  4I2P A;  3JS6 A;  1HKC A;  3SQ1 A;  3AVB A;  2FBV A;  4B1U B;  5ADX H;  1WBD A;  1M1K O;  4O8K A;  4CIF A;  4CJ7 A;  1D9D A;  3VQC A;  4FWM A;  3SZ2 A;  5AQP A;  4PKH A;  1J5E K;  4KHY A;  4R5P A;  5C2D A;  2P9S B;  1DLO A;  4BRH A;  4X65 K;  4Z0U A;  4C1N K;  3F2K A;  1VQ7 N;  3ITH A;  3O9R A;  5AQX A;  4H5N A;  3CFP A;  4IOA L;  2FC0 A;  3NGI A;  4DTM A;  1JLG A;  2O8C B;  1EET A;  3VQQ A;  3SCX A;  1VSM A;  4DHY A;  4ZTJ A;  2VCP A;  3UB5 A;  3CCL N;  3DXK B;  4IFY A;  3SV4 A;  1LW2 A;  3KLE A;  1FW6 A;  4FPB A;  2VQF K;  4CED A;  3M5R A;  4YOR A;  1MWM A;  2P9I A;  3H46 O;  4FM2 A;  3OJS A;  2JWL A;  2ATQ A;  4LY7 A;  5BRE A;  4CJQ A;  4DQR A;  2W40 A;  2BTF A;  3RSE A;  1K8K A;  4M7X A;  3CM5 A;  3OYI A;  1HR0 K;  1ATS A;  4FK2 A;  4BDP A;  5I3U A;  1VSI A;  3HZ6 A;  4KTZ A;  3CCJ N;  1RTD A;  3U8X A;  5BPN A;  3MK6 A;  5B8H A;  4DQ8 A;  4CEF A;  2WOM A;  2P9K B;  4HWI A;  5AQI A;  3SV3 A;  2X6S A;  1NGA A;  2IVN A;  1TK5 A;  1NMD A;  4I6M B;  1HNZ K;  1LWC A;  1ZBH A;  1Z6R A;  4CFB A;  4CZK A;  4UY8 O;  5M1F A;  3M1F A;  4AQY K;  3CF5 L;  3ISN C;  2UXB K;  3SUQ A;  5KRT A;  5CHI A;  5E84 A;  4IG3 A;  5KI6 A;  3IMX A;  3FFK B;  4Y1C A;  4E3S A;  4FOI A;  1VQP N;  2EHG A;  3ZT0 A;  3O6W A;  1NK8 A;  3SBG A;  3O80 A;  4C8K A;  3DXM B;  1HNX K;  3ULE B;  4NCB A;  3EZ5 A;  4FJL A;  2I7N A;  1IH7 A;  4QCL A;  3SNN A;  4KO0 A;  1NK9 A;  2IC3 A;  2YHA A;  1KAZ A;  5J1E A;  4KTW A;  4B3S K;  1IG8 A;  4DTR A;  5AZI B;  4CFD A;  3AAP A;  5ADX A;  1QQN A;  3BF3 A;  1IKY A;  4E7L A;  3VQ7 A;  4CFC A;  4CEB A;  4IJN A;  1HYS A;  2GWK A;  3MWP A;  3O1W A;  2OAN A;  1WUA A;  4JAX A;  1UAX A;  2HHU A;  3VMF B;  2CH5 A;  3B6P A;  5EY4 A;  4CHZ A;  3QEW A;  4FWK A;  3ZCM A;  3TI0 A;  3DLG A;  1RTH A;  2QKK A;  1KSP A;  2QWQ A;  4MO4 A;  1TKT A;  1SS6 A;  3KIO A;  1GLE G;  2WBN A;  3RMA A;  2PYJ A;  4BGB A;  1RBT A;  1RCH A;  3VEW A;  3MCP A;  4MDB A;  4J2B A;  3CME N;  5AZJ B;  3K9K A;  3PX4 A;  1VQL N;  1KCF A;  4B9Q A;  4NB4 A;  1VQ9 N;  3K5L A;  5GIN A;  4GNI A;  1REV A;  3HOS A;  2HHV A;  2HBL A;  5K14 A;  4BC3 A;  1JKH A;  1MDU B;  4X64 K;  1W2B M;  4FXD A;  3JSM A;  5J2P A;  2HMP A;  4FZX C;  4DFJ A;  4JI1 K;  2E2O A;  3MN5 A;  3O4W A;  4RW7 A;  3K59 A;  3TAR A;  4E7J A;  4CJE A;  4K8Z A;  3EKU A;  3WNG A;  4B1V A;  4Z4G A;  3MX2 A;  3EKS A;  4CBX A;  4B9V A;  2D0P A;  3ENB A;  3A8Y A;  4BG8 A;  5CZ1 A;  1WLJ A;  4FWN A;  2CH6 A;  3DMJ A;  5LMU K;  1L3V A;  3ZYY X;  2NZT A;  3U3G A;  2Z1G A;  4IXC A;  5DMR A;  4CJR A;  2E2P A;  4CFA A;  3NHG A;  1JLQ A;  1XQS C;  2DFE A;  4CZL A;  1LCU A;  4E1J A;  3OYC A;  4DUY K;  3OVN A;  4KHP K;  1KLN A;  3WXM B;  1NK6 A;  3KHY A;  1IBK K;  3J7Y P;  4F3T A;  1UWB A;  3BP8 A;  3OYA A;  3K5M A;  3SAG A;  3HO1 A;  2NRV A;  3FZL A;  4HUF A;  1V4T A;  1NJX A;  3F9M A;  1JL1 A;  2G8F A;  1NK7 A;  1TYQ A;  3CHW A;  4LF4 K;  4EZ9 A;  1VSL A;  1HQE A;  4PQU A;  1EXQ A;  1OH6 A;  2HB5 A;  4EFH A;  1IKV A;  1BQN A;  3V9U A;  3LZI A;  3C7N A;  1IBL K;  4JV5 K;  4WFB L;  2V52 B;  4AHV A;  1V4S A;  1YTU A;  5M1K A;  4H0V B;  1DKG D;  3THX B;  4DKW A;  2HVH A;  1BI4 A;  3EE9 A;  3THW B;  5DM6 L;  2O4G A;  4FVM A;  3AVL A;  1VQN N;  5T7B A;  4B9S A;  1NLV A;  4Z4E A;  3C7N B;  3KK3 A;  4AHU A;  4FOE A;  4HUE A;  3EN9 A;  3PV8 A;  1VSK A;  4FLZ A;  1D9F A;  5EXW A;  4CD3 A;  1P90 A;  4AM7 A;  1X1P A;  3AVF A;  4YDU C;  4CIG A;  5FPM A;  1U6Z A;  3FZH A;  1LW0 A;  2Y1I A;  1HNI A;  5BPM A;  3CJ7 A;  4I7F A;  3THY B;  2NRX A;  3A2F A;  1KQS M;  4CHQ A;  4ZHR A;  3J7Z O;  1YXQ A;  2YNG A;  3P5J A;  1DTT A;  1U04 A;  3AV9 A;  3CIP A;  3VQ5 A;  3L8B A;  3HSC A;  3IG1 A;  3KWG A;  3D2F B;  1W0H A;  2YX6 A;  1EP4 A;  5H1S Q;  3ENO A;  3UKR B;  4EP4 A;  4JHD A;  1CXU A;  2FF3 B;  4N56 A;  2PAV A;  4U7B A;  3IAY A;  4PHT X;  4EHU A;  1S1X A;  1VSH A;  4DS5 A;  2E6L A;  3BDP A;  2E2Q A;  2FLO A;  3V1Q A;  2G8H A;  2HNY A;  4DF4 A;  4DU1 A;  3CCR N;  3HVT A;  3RTV A;  4NLB A;  4L3Q A;  2UUC K;  3K5O A;  3TTD A;  4JS4 A;  1D4X A;  3L6Q A;  4FLX A;  2QWN A;  1TGO A;  4H5V A;  3LM2 A;  3NF9 A;  4DV7 K;  2Q36 A;  2QEX N;  1W7A A;  3AO3 A;  5M1P A;  3RRG A;  1ASW A;  3QB0 A;  5J2N A;  4DTO A;  1RDU A;  2G8W A;  4DSE A;  3WXI A;  1Q82 O;  4FW1 A;  2A40 A;  1SQK A;  3S3O A;  2P9N B;  1ZC6 A;  1QHA A;  2HBJ A;  4FWL A;  3KLG A;  1YHQ N;  1YJW N;  1KFS A;  3CJC A;  3HPG A;  4CHY A;  5IT9 O;  4M3Y A;  3QET A;  4CEO A;  4JHD B;  1GLJ O;  1WB9 A;  2P9U A;  4BRG A;  4OGC A;  2DY4 A;  1ZYQ A;  4JLH A;  4EIA A;  3WT0 A;  5AQQ A;  2KFN A;  1D5A A;  2Z1J A;  3D45 A;  4NXM K;  1HYV A;  4DV5 K;  1RBS A;  4YOT A;  4HHT A;  1S1U A;  1YJ9 N;  5JLF A;  4BE2 A;  1XMO K;  4H03 B;  3HP6 A;  2XY7 A;  4X66 K;  1RDC A;  1RTI A;  3HBT A;  1MWK A;  3LP1 A;  4BRP A;  4JI3 K;  3O9T A;  3LP0 A;  4CEA A;  4BRF A;  1L3S A;  4IWV A;  3LP3 A;  1Q18 A;  4TSX A;  4BG9 A;  5CYM A;  2PYL A;  3ID6 A;  1HKG A;  1HQU A;  2W41 A;  5I9E B;  3JXU A;  5CYQ A;  4C1N I;  2D0A A;  2VWK A;  4K41 A;  4KHQ A;  4DR7 K;  3RMC A;  3LWM A;  4BRK A;  4RCH A;  1WAF A;  3OS2 A;  4DQP A;  1J6Z A;  3DXM A;  4F3O A;  2RHK A;  3EO3 A;  5C12 A;  3H3O B;  4CJU A;  2DFF A;  3TU5 A;  2YHW A;  5FRN A;  3AGK A;  4FYD A;  1EWR A;  3DOL A;  4DMN A;  3CD6 N;  1NK4 A;  1NBW A;  3C0B A;  2ZF5 O;  1ZBS A;  3SPY A;  4KB1 A;  4DF8 A;  2ZD1 A;  5HLF A;  4YOU A;  4KH6 A;  1ITG A;  5JVH L;  2ZGY A;  2OPP A;  3AAR A;  3HL8 A;  4H5T A;  2P5O A;  4I6M A;  3CJ9 A;  4KRE A;  1NGG A;  3OYE A;  1FKP A;  4LF8 K;  2NUB A;  1NJI O;  4FJ5 A;  4CK1 A;  3VA3 A;  3M8P A;  4H0P A;  3G71 N;  3TAM A;  1WSG A;  3SQ2 A;  1KD1 O;  2QK9 A;  1DGK N;  4JI7 K;  3QIC A;  4M7Y A;  3UKR A;  1U47 A;  4AHR A;  3QO9 A;  2PZS A;  3VN5 A;  4BWJ A;  3QFP A;  2OTL N;  1VQ8 N;  3AGR A;  4BRE A;  1BCO A;  3TSQ A;  3THX A;  3R9P A;  4BY9 C;  1NGJ A;  3ZSQ A;  3QLH A;  1SL0 A;  2QA4 N;  5HRR A;  5KRS A;  1VSJ A;  3K5N A;  1RT4 A;  1QQM A;  4DTS A;  3CC7 N;  4A59 A;  4DFP A;  1RT3 A;  1SKR A;  3TAE A;  1MA9 B;  3JAM O;  4DR6 K;  3I8B A;  3CCE N;  3CFR A;  4LF6 K;  5HRP A;  1XHX A;  4N5S A;  2F8S A;  3NF8 A;  2YCH A;  1KC8 O;  2HHW A;  2Q3S A;  4OKE A;  1TV6 A;  5A2Q O;  1TAU A;  3ENH A;  4ISF A;  5AFU A;  2J4R A;  4BC2 A;  2OA8 A;  1EWQ A;  2ZE2 A;  3QIN A;  3OY9 A;  5AZJ A;  3MEG A;  3J80 O;  4OO1 J;  4NYN A;  5AQF A;  1XMQ K;  3IDH A;  3OYB A;  1ATN A;  3E66 A;  3K0S A;  3ZSY A;  4BRL A;  4FJM A;  3CG7 A;  1RT6 A;  2E1Z A;  3SMP A;  2JLE A;  4BE1 A;  3MN6 A;  1NKB A;  3D0P A;  2UUB K;  1KVB A;  3P83 D;  2HST A;  2VQE K;  3QEI A;  3E9L A;  1GLB G;  3T1A A;  4BRQ A;  3QNN A;  3C6U A;  4DV4 K;  3C6T A;  3UIQ A;  2P9P B;  3T3F A;  1I94 K;  2E88 A;  2QWP A;  4KKO A;  3GG4 A;  4DS4 A;  3SJJ A;  1ZBU A;  2Q1N A;  4DWI A;  4FM1 A;  4FJ7 A;  4KRF A;  1HPZ A;  5JVG L;  3NVM A;  5GAG P;  4CI6 A;  4LFA K;  2P9U B;  1RBU A;  2V51 B;  1VRT A;  1S6P A;  1ASV A;  1UOC A;  4KFB A;  1WOQ A;  1NGE A;  4YOX A;  1T05 A;  1Q86 O;  2FSJ A;  3VTH A;  2OPS A;  1NKC A;  2ZM6 K;  3V1O A;  1TAQ A;  2P51 A;  3NFA A;  2KHO A;  4BR7 A;  4W5R A;  3BF1 A;  3L2R A;  2ETJ A;  4FZY A;  1BQM A;  3GE1 A;  1QVF M;  2E8A A;  2E6M A;  4BRM A;  3OYK A;  1BA0 A;  1KLM A;  4C23 A;  4CGG A;  3O08 A;  3TAF A;  3PO4 A;  4FJX A;  3ZT2 A;  2VWB A;  1S72 N;  4PY5 A;  5BN9 A;  3PIP L;  4C8L A;  1KAY A;  3VEY A;  3KJV A;  4FJG A;  2LSN A;  3O4N A;  1RTJ A;  3R1X A;  4JKA A;  4M63 C;  3ZSR A;  3QBW A;  2ITM A;  3AO2 A;  4C8N A;  2ZWH A;  4MFB A;  3PY8 A;  2WTU A;  3QEV A;  2FBX A;  4IO8 A;  2QXF A;  1LV5 A;  1Q9Y A;  1K9M O;  3MWT A;  1QSS A;  5F1X A;  4FLW A;  2D4W A;  4LH4 A;  1J54 A;  4LD0 A;  2VGM A;  3V9W A;  2FBT A;  1B9D A;  4AHT A;  2P9L A;  3LPT A;  3MED A;  3VOV A;  1KRP A;  5C0Y A;  4FPA A;  1Q81 O;  4KHU A;  3BZC A;  1TKZ A;  2XY6 A;  4DQQ A;  4AHS A;  3CJ1 A;  5F2R A;  1NM1 A;  4FLT A;  3I0S A;  3NBP A;  1WAJ A;  3ALY A;  4WYB A;  4GKK K;  1WSF A;  3MCA B;  3PSI A;  1YVU A;  4DSL A;  3AAQ A;  4HVJ A;  2E4L A;  2A1S A;  1NGC A;  2RN2 A;  1J5O A;  3GBT A;  3QEP A;  2FF6 A;  4DSF A;  4JKF A;  4CGI A;  4IJA A;  3TTC A;  3HM8 A;  5AQJ A;  1YTA A;  4DLG A;  1TK8 A;  3HK2 A;  4CHP A;  2HF3 A;  4OGE A;  3OYG A;  2XY5 A;  3DAW A;  4W5O A;  3VA0 A;  4KH5 A;  1LWE A;  4I9L A;  5FPE A;  2ZJR L;  3CMA N;  4CF9 A;  4RW9 A;  3DLL L;  4FK4 A;  3HJF A;  2O8E B;  4BRO A;  4V19 S;  2G8V A;  3LPU A;  1BGX T;  1BI4 B;  3C6H A;  3R6M A;  2I5J A;  3KLH A;  3WNE A;  2HHT A;  2GEM A;  3C95 A;  3N4P A;  1XUP O;  4E1N A;  3H45 C;  4WQ4 C;  1FKO A;  4CK2 A;  4JRP A;  5AQN A;  1K73 O;  1SKW A;  3U6F A;  4M3U A;  4YFU A;  4IEE A;  1U45 A;  3ZSW A;  2HMI A;  1QZ6 A;  5BRF A;  3VEO A;  3PSF A;  4RW6 A;  4M3Z A;  5BRH A;  2HF4 A;  4M41 A;  4EAH D;  1YUW A;  4O5B A;  3RSE B;  5C42 A;  3LAL A;  2CGK A;  4JD2 A;  3VGM A;  2KZM A;  1C6V A;  4JI8 K;  4ID1 A;  2E2N A;  3EY1 A;  3CM6 A;  1JLE A;  4ILH A;  3W3D A;  4Z94 A;  3SBT A;  2E5L K;  4BRC A;  1RT1 A;  4B1X B;  4G9Z A;  3FZM A;  1L5U A;  3FFI A;  4RG8 A;  4ID5 A;  1JLC A;  1FK9 A;  5TKW A;  2BDP A;  3HTV A;  4KHS A;  4CF8 A;  3I55 N;  4NYF A;  4HTL A;  2Q31 A;  1KAX A;  4FWR A;  4FCY A;  3SLC A;  3OYF A;  4CGJ A;  5JIC A;  1BL3 A;  1CZ9 A;  1NGD A;  3DJC A;  4J2A A;  1XHZ A;  4FLU A;  5CY4 A;  1RFQ A;  2KQ2 A;  3PX0 A;  4JI0 K;  1QSL A;  5BRD A;  2F4V K;  2QTD A;  1HMV A;  4BC5 A;  4XIU A;  4JKC A;  4FLY A;  4JK9 A;  1C1B A;  3KK2 A;  4HUG A;  1WSE A;  3ZSV A;  1T3V A;  2OZS A;  4H4M A;  1S1T A;  3CCU N;  4JD2 B;  3CC2 N;  2YJF A;  3M8S A;  1U2V A;  3ZLJ A;  4CBU A;  2OYQ A;  2QWL A;  4NCG A;  1QS4 A;  4GKJ K;  2A5X A;  3H3N O;  4KHW A;  4MQ3 A;  4KH4 A;  3KK1 A;  5KPT A;  4OLA A;  1NOZ A;  3VF2 A;  4BRI A;  3LAM A;  4FW2 A;  3J81 O;  3B8A X;  3OJU A;  1KTQ A;  1K8K B;  4AF1 A;  4PWD A;  3NMU A;  2HHH K;  2IVO A;  3F5T A;  1TUY A;  3EEQ A;  3DRP A;  4BVP A;  3L4I A;  3ZSO A;  1WSI A;  1R59 O;  4BDZ A;  1QSY A;  2X74 A;  3RWU A;  4H4O A;  4YNQ A;  4CZF A;  1KXP A;  4CEZ A;  2IGI A;  3DRR A;  2X6N A;  3LAN A;  4WQ5 C;  2NRT A;  2UXC K;  5EOY A;  3V1R A;  3AA3 A;  4OPK A;  4IKF A;  3MMV A;  3KWI A;  2OZM A;  4FJJ A;  4BC4 A;  4K43 A;  3SUN A;  4K42 A;  3HPH A;  3T1Y K;  3MDQ A;  2QXL A;  1TKD A;  2RE2 A;  4U67 L;  4FWO A;  1HYZ A;  1XC3 A;  2YHX A;  1SAZ A;  5JMV A;  2W6K A;  2Q97 A;  5AQG A;  5JS1 A;  4O8U A;  4B3R K;  1CXQ A;  3MAQ A;  2UU9 K;  4CEC A;  3P38 A;  4RWT A;  2YV0 X;  4J8F A;  4X62 K;  4LSL A;  2A41 A;  3JYT A;  4OPJ A;  3DYA A;  3O9S A;  4CGH A;  1IG9 A;  1WBB A;  1GOA A;  4O0I A;  3VEX A;  3M8Q A;  3LL3 A;  2QWM A;  5KPZ A;  3OS1 A;  3PO5 A;  3TR8 A;  3ZT4 A;  4BR5 A;  1KVC A;  2PBD A;  1U49 A;  2X78 A;  3IKM A;  4CZI A;  1I39 A;  4H8K A;  3HPO A;  4PL7 A;  5HP1 A;  3O3H A;  4IFE A;  2A3Z A;  5AR0 A;  2A1R A;  3WUH A;  4A57 A;  3LM9 A;  2EWS A;  1J53 A;  4CF1 A;  3IS9 A;  4B3O A;  3BUZ B;  4DG1 A;  1XNQ K;  3OYJ A;  1C0F A;  1NG9 A;  5FDL A;  3LWL A;  4DR4 K;  4DSK A;  2B6A A;  4CBW A;  4K25 A;  1W9H A;  2YKM A;  2VWJ A;  4CEE A;  1CLQ A;  4RTF D;  4ZTF A;  4OKJ A;  5JS2 A;  1M90 O;  4KAZ A;  3MN9 A;  5AQO A;  3SJH A;  2CGJ A;  2YNH A;  4LH5 A;  4CJ5 A;  5AQH A;  3NE6 A;  2ZJQ L;  4LSN A;  3ATV A;  4CE9 A;  2P9I B;  3MXI A;  1BIZ A;  1VHX A;  4JKD A;  5BPL A;  3THV A;  4I2Q A;  2FBY A;  3SQ0 A;  3KK7 A;  4WCE L;  3VQ4 A;  3A0I X;  5AQL A;  3VTI A;  3V4I A;  3A5M C;  3O5B A;  4LC9 B;  4CK3 A;  2XRI A;  3KKS A;  5FPN A;  1U4B A;  2IIR A;  4Y1D A;  1DT9 A;  4IFV A;  4M3W A;  3LDS A;  1YIT N;  1RDB A;  3IUC A;  4PL8 A;  1S1W A;  4AIL C;  1ILY A;  3O3F A;  2QM1 A;  4FVU A;  4KTQ A;  4JI5 K;  3N4Q A;  4O44 A;  3WXJ A;  3AA2 A;  3VQ6 A;  4YOY A;  5AQW A;  1N36 K;  4JI2 K;  1WNS A;  3MX5 A;  1A5X A;  1DEJ A;  2KFZ A;  3LP2 A;  1JXE A;  3D7E O;  4HCB A;  4DR3 K;  1GOC A;  3VER A;  3TWH A;  2ZQB A;  1HUX A;  4FWS A;  3CCQ N;  2XO7 A;  4IG0 A;  3T69 A;  1KFD A;  4MLH A;  3Q7B A;  3D2F A;  3CYM A;  5KQD A;  4WFN L;  4B8A B;  3AVI A;  4BRA A;  5KQ8 A;  3HXM A;  4KHN A;  2RKI A;  4WQ5 A;  1L3U A;  5LL6 Z;  4MDA A;  1KVA A;  3T1H K;  3D6R A;  3QES A;  4DSJ A;  1ZBF A;  4E1M A;  1CZB A;  2HOE A;  3GDQ A;  1C1A A;  4ELV A;  1CZA N;  2NRZ A;  2RPI A;  1EO1 A;  4G1Q A;  1T8E A;  4FJK A;  2O8B B;  4BGA A;  2IAJ A;  2O8F B;  4JKH A;  1S6Q A;  1TL1 A;  4CCH A;  4OKK A;  4ICL A;  3MEC A;  1BHL A;  3A5N C;  2D0C A;  2HHS A;  3HOT A;  4JYA K;  5EU7 A;  4DCH A;  2CGL A;  2O4I A;  1D8Y A;  2DTU A;  3AO1 A;  3FR0 A;  2YJE A;  3ZX0 A;  3MN7 A;  3CQY A;  4AHC A;  4FJN A;  4GV6 A;  3O9Q A;  3KZB A;  3G4S N;  2AA4 A;  5AZI A;  1YJN N;  3LDP A;  2HW3 A;  3NH2 A;  4XH5 A;  4IOX A;  4YY3 K;  3S3M A;  1WSH A;  3ID8 A;  5LJW A;  3W0L A;  4DR1 K;  4Y0W A;  1ZBI A;  1WN7 A;  4QS9 A;  1JCF A;  1C0G A;  4CD1 A;  2IDO A;  3R8E A;  1NK0 A;  2DFH A;  4M3T A;  5FRO A;  2H3G X;  5FPD A;  4E7I A;  3CJB A;  1Z25 A;  2NNW A;  1RNH A;  1NGF A;  5AQR A;  4CF0 A;  3T19 A;  2YNF A;  3LDL A;  4LFB K;  3QER A;  4PUO A;  5AQY A;  1S5J A;  2F8T A;  3VEZ A;  3THY A;  1IBM K;  4LF9 K;  1NJZ A;  3OS0 A;  1N6Q A;  5DM7 L;  2OCE A;  1WSJ A;  2ITG A;  4BRD A;  1GLA G;  2F9W A;  4CGD A;  2B4J A;  1FXX A;  3H6E A;  3ZET A;  3TAG A;  4R79 A;  3PIO L;  5CR4 A;  2DPN A;  5E41 A;  4JK8 A;  1BOT O;  1RDA A;  2OTJ N;  1NJW A;  2FSK A;  1BU6 O;  1VQ5 N;  4B3M K;  1Q9X A;  4BQZ A;  4DV0 K;  2BGG A;  3FLC O;  5HRO A;  2P1J A;  1B92 A;  3DLK A;  3I56 N;  4CIE A;  4HCC A;  2NLX A;  2O8B A;  2YNI A;  3PUF A;  3TSU A;  3CQ8 A;  1JLF A;  3DXK A;  4B9M A;  1SUQ A;  3I33 A;  3ZSZ A;  4CHN A;  3NDK A;  4FJH A;  4A2A A;  1RBV A;  2P9P A;  3UKU A;  4W5N A;  5HL7 L;  3AVJ A;  2O8C A;  1TVR A;  3SAH A;  1HPM A;  3QNO A;  3L2Q A;  4WQ4 A;  1ESV A;  3NGZ A;  1EQY A;  3DLH A;  4ELT A;  4E89 A;  4KB0 A;  3K2P A;  4CJL A;  4CJ4 A;  2XY8 A;  3R3L A;  4FWQ A;  4OPH A;  1C0M A;  4BDY A;  2VG6 A;  4B9T A;  2KW4 A;  4NLC A;  2KLA A;  4OVL A;  1LAW A;  2WON A;  3V9Z A;  4FZZ A;  1OVQ A;  3WXL A;  5LJV A;  4CVN E;  3WQU A;  4CJ3 A;  4OX9 K;  3EE8 A;  3TTF A;  1W97 L;  5C2F A;  5KPR A;  3QEX A;  4ISE A;  2V7Y A;  1JCE A;  5AQV A;  2AP1 A;  4IZ9 A;  1OH7 A;  4YDU A;  3J7A P;  1SL1 A;  1N5Y A;  3U3Y A;  2OPR A;  4B1Z A;  3WEE A;  3ZEU B;  1BDG A;  4BWM A;  3RMB A;  4WE1 A;  4Z4C A;  4CF2 A;  2QI2 A;  4AH9 A;  1NGH A;  4QOZ B;  4E19 A;  2BAN A;  2Z1H A;  1JL2 A;  3NVK A;  1X9M A;  1BO5 O;  2G8K A;  3GL1 A;  1GOB A;  3TAN A;  3RMD A;  1N34 K;  2KKZ A;  1XC9 A;  1UA0 A;  4F4K A;  3F9K A;  1QQO A;  1LAV A;  1TL3 A;  1N33 K;  2HHQ A;  1HJO A;  4IDH A;  4JKB A;  2GTD A;  1U48 A;  3ZSX A;  4Q5V A;  3V9S A;  1JXB A;  5AQU A;  4O55 A;  1TUU A;  5AFU H;  5TKY A;  5HBM A;  3GOI A;  4RW4 A;  1XNR K;  4B8C A;  5CE3 A;  1OH5 A;  1Y97 A;  2VGN A;  5AQZ A;  3EZW A;  3HRG A;  1HRH A;  3QFU A;  4DFK A;  4FSV A;  4XH4 A;  2ASO A;  4BVO A;  3FGU A;  4BR9 A;  1T6D A;  1GLC G;  4BRN A;  3NH0 A;  4IBN A;  1K6Y A;  3TAP A;  3ZX2 A;  4DFM A;  1NU0 A;  2P9K A;  4GV9 A;  4DQI A;  3E1Y A;  1RT5 A; 
#chains in the Genus database with same CATH homology
 3L2V A;  2B5J A;  3QIP A;  4C8M A;  5CZ2 A;  4CHO A;  3KLG A;  3L3V A;  4KHW A;  4MQ3 A;  3NCI A;  3KK1 A;  2P5G A;  4OLA A;  1NOZ A;  1KFS A;  3HPG A;  3LAM A;  4FW2 A;  4CHY A;  4HTU A;  5DK5 A;  2VG5 A;  4M3Y A;  3QET A;  5I42 A;  1BIS A;  4CEO A;  3OJU A;  1VK0 A;  1KTQ A;  5J2M A;  3V6D A;  1BCM A;  1S9E A;  4J2D A;  3AO5 A;  5C25 A;  3L2U A;  4PWD A;  1VSF A;  1RBR A;  3ULD A;  1I3A A;  4OGC A;  4KV8 A;  2DY4 A;  1ZYQ A;  2F96 A;  3O4Q A;  3DRP A;  4JLH A;  3SQ4 A;  2D0B A;  3V9X A;  3L2W A;  2KFN A;  1SL2 A;  1D5A A;  3ZSO A;  2Z1J A;  1WSI A;  1B9F A;  4BDZ A;  3D45 A;  4F8R A;  4L8R B;  1QSY A;  1HYV A;  2X74 A;  3RWU A;  4H4O A;  4YNQ A;  3AVC A;  2G8H A;  1RBS A;  4CEZ A;  3AVM A;  2IGI A;  3DRR A;  3SYZ A;  3SUO A;  2X6N A;  4I9Q A;  3S9H A;  3LAN A;  1QS4 A;  4HHT A;  3V1R A;  1XWL A;  3AA3 A;  4OPK A;  3SUP A;  3MXM A;  4IKF A;  2XHB A;  1S1U A;  3F73 A;  2OZM A;  3V81 A;  1L3T A;  4BE2 A;  4FJJ A;  3HP6 A;  3SUN A;  2XY7 A;  1RDC A;  1RTI A;  3HPH A;  2KTQ A;  3AVG A;  3LP1 A;  4DTJ A;  4DTN A;  1TKD A;  3LP0 A;  4CEA A;  1L3S A;  4DU3 A;  4KPY A;  5D3G A;  1MU2 A;  3LP3 A;  3VQB A;  3TAB A;  1NOY A;  4TSX A;  4I2P A;  5CYM A;  1HYZ A;  2PYL A;  2Y1J A;  3SQ1 A;  3AVB A;  2FBV A;  1HQU A;  5JS1 A;  4CIF A;  1CXQ A;  3O3G A;  1D9D A;  3VQC A;  4CJV A;  3MAQ A;  5CYQ A;  5HRS A;  3SZ2 A;  4CEC A;  2D0A A;  2VWK A;  4KHQ A;  4JS5 A;  2YV0 X;  3RMC A;  1VRU A;  1QQC A;  3LWM A;  4KHY A;  4GMJ B;  4R5P A;  4LSL A;  1WAF A;  3OS2 A;  1DLO A;  4OJR A;  3JYT A;  4Z0U A;  4OPJ A;  4DU4 A;  4DQP A;  3DYA A;  2JGU A;  3ITH A;  4W5Q A;  3CFP A;  4CGH A;  4F3O A;  4CJT A;  1IG9 A;  4CJU A;  2DFF A;  2FC0 A;  3VQ8 A;  1TK0 A;  1GOA A;  3NGI A;  4DTM A;  5FRN A;  1JLG A;  4O0I A;  3M8Q A;  1NJY A;  4FYD A;  1RIL A;  3DOL A;  4DMN A;  3OS1 A;  3PO5 A;  1EET A;  3VQQ A;  3TR8 A;  3SCX A;  1VSM A;  3ZT4 A;  1NK4 A;  4ZTJ A;  3C94 A;  1KVC A;  1SKS A;  1U49 A;  4IFY A;  3VQA A;  4UQG A;  3SV4 A;  2X78 A;  3SPY A;  4KB1 A;  1I39 A;  1LW2 A;  3KLE A;  3M8R A;  2ZD1 A;  3HM9 A;  4H8K A;  3HPO A;  4DF8 A;  5HP1 A;  3O3H A;  5HLF A;  4Z4I A;  4B9N A;  1ITG A;  2D5R A;  4CED A;  2OPP A;  2A1R A;  1ASU A;  4Z4H A;  1EX4 A;  3HL8 A;  2P5O A;  4FM2 A;  3OJS A;  1J53 A;  4CF1 A;  3I0R A;  4KRE A;  3IS9 A;  4B3O A;  3OYE A;  1FKP A;  2ATQ A;  2NUB A;  4LY7 A;  4CJQ A;  4FJ5 A;  4DG1 A;  4DQR A;  3OYJ A;  4CK1 A;  3VA3 A;  3CM5 A;  3OYI A;  4FM0 A;  3M8P A;  2BE2 A;  5FDL A;  4FK2 A;  3LWL A;  3TAM A;  4BDP A;  5I3U A;  3IRX A;  4DSK A;  1VSI A;  1WSG A;  2B6A A;  4KTZ A;  1S9G A;  1W9H A;  3SQ2 A;  1RTD A;  2YKM A;  2QK9 A;  2VWJ A;  4CEE A;  1CLQ A;  4M3R A;  4ZTF A;  4OKJ A;  5JS2 A;  4RW8 A;  4CEF A;  4KAZ A;  4CEQ A;  1U47 A;  4E0D A;  4AHR A;  3QO9 A;  2PZS A;  4CJ5 A;  4LH5 A;  2YNH A;  2WOM A;  3VN5 A;  3NE6 A;  4FJI A;  4LSN A;  4BWJ A;  3SV3 A;  2X6S A;  1LWF A;  1TK5 A;  1BCO A;  3BGR A;  4GW6 A;  4CE9 A;  3MXI A;  1BIZ A;  1LWC A;  1ZBH A;  4CFB A;  4KI4 A;  3ZSQ A;  1RT2 A;  3THV A;  4I2Q A;  3ISN C;  3QLH A;  5KRT A;  3SUQ A;  1SL0 A;  2FBY A;  2Z1I A;  3SQ0 A;  5KI6 A;  4IG3 A;  3VQ4 A;  2EX3 A;  2IOC A;  4Y1C A;  5HRR A;  3KLF A;  5KRS A;  1VSJ A;  3V4I A;  3K5N A;  1RT4 A;  4CK3 A;  4E3S A;  1XI1 A;  2XRI A;  3KKS A;  4DTS A;  1U4B A;  3KTQ A;  1VSD A;  4Y1D A;  4GVM A;  3KLI A;  3P1G A;  5J2Q A;  3RR7 A;  2EHG A;  3ZT0 A;  1NK8 A;  4DFP A;  4IFV A;  1RT3 A;  1SKR A;  4M3W A;  3LDS A;  3TAE A;  4C8O A;  4C8K A;  1RT7 A;  1RDB A;  3CFR A;  1S1W A;  1T03 A;  4AIL C;  4NCB A;  3EZ5 A;  3O3F A;  5HRP A;  1XHX A;  4N5S A;  4FJL A;  2F8S A;  1IH7 A;  3NF8 A;  4KTQ A;  4QCL A;  4CJS A;  2KZZ A;  4O44 A;  2HHW A;  2Q3S A;  4OKE A;  3AA2 A;  1TV6 A;  3VQ6 A;  3SNN A;  4KO0 A;  1NK9 A;  2VG7 A;  3AA4 A;  2IC3 A;  3K57 A;  2YHA A;  3DLB A;  5J1E A;  1TAU A;  1WNS A;  4KTW A;  1A5X A;  4DTR A;  3RRH A;  4Z4F A;  2KFZ A;  3LP2 A;  1JXE A;  3AA5 X;  1F21 A;  3AVA A;  2OA8 A;  4CFD A;  4HCB A;  1GOC A;  3TWH A;  3SPZ A;  2ZQB A;  1IKY A;  4E7L A;  5KGW A;  2ZE2 A;  3VQ7 A;  4CFC A;  2YHB A;  3QIN A;  4CEB A;  2G8I A;  3OY9 A;  2AJQ A;  2PYJ A;  3MEG A;  1HYS A;  1T7P A;  3KD5 E;  2XO7 A;  4IG0 A;  1KFD A;  4NYN A;  3CYM A;  4B8A B;  3LZJ A;  2YKN A;  3AVI A;  3OYB A;  3HXM A;  4KHN A;  1UAX A;  2RKI A;  2HHU A;  3ZSY A;  1L3U A;  3B6P A;  4B9L A;  1KVA A;  3CG7 A;  4CHZ A;  3QEW A;  2PY5 A;  4FJM A;  1RT6 A;  3QES A;  5SWM A;  4DSJ A;  1ZBF A;  3ZCM A;  4DLE A;  3TI0 A;  2GV9 A;  2JLE A;  1CZB A;  1RTH A;  3DLG A;  4E1M A;  4BE1 A;  3D0P A;  1NKB A;  2QKK A;  1KVB A;  1C1A A;  1KSP A;  4ELV A;  4ELU A;  1O1W A;  4F2R A;  3P83 D;  5KGX A;  2RPI A;  3QEI A;  3T1A A;  4DTU A;  4G1Q A;  3QNN A;  1T8E A;  3C6U A;  4N47 A;  1TKT A;  4FJK A;  2IAJ A;  3KIO A;  3C6T A;  3UIQ A;  1C0U A;  3TAQ A;  2W42 A;  3RMA A;  1S6Q A;  1TL1 A;  3AO4 A;  4ICL A;  4OKK A;  3MEC A;  1BHL A;  1RBT A;  1RCH A;  3T3F A;  4CCH A;  4KKO A;  3OYD A;  2D0C A;  2QKB A;  2HHS A;  4DS4 A;  3SI6 A;  3SJJ A;  1ZBU A;  4DWI A;  4J2B A;  4FM1 A;  1QTM A;  5EU7 A;  1HPZ A;  4FJ7 A;  4KRF A;  2O4I A;  3PX4 A;  1RBU A;  1KCF A;  1Z26 A;  2HND A;  3AO1 A;  1D8Y A;  4E7K A;  2DTU A;  1VRT A;  1S6P A;  4FJN A;  4AHC A;  1ASV A;  1UOC A;  1G15 A;  4KFB A;  1T05 A;  2HW3 A;  3NH2 A;  3K5L A;  3S3M A;  2OPS A;  1WSH A;  4DTX A;  1NKC A;  1REV A;  3V1O A;  1TAQ A;  2P51 A;  1NKE A;  3B6O A;  3WNH A;  3NFA A;  2HHV A;  4FK0 A;  4W5R A;  5K14 A;  1ZBI A;  1WN7 A;  3MXJ A;  1JKH A;  3I8D A;  3L2R A;  2ETJ A;  4CJF A;  4FZY A;  1BQM A;  4FXD A;  3JSM A;  2E6M A;  3OYK A;  2IDO A;  1KLM A;  1NK0 A;  5J2P A;  2DFH A;  4N76 A;  4CGG A;  3TAF A;  3PO4 A;  4FZX C;  4DFJ A;  5FRO A;  3ZT2 A;  3HT3 A;  4FJX A;  4NCA A;  4KI6 A;  4M3T A;  4PY5 A;  4C8L A;  4RW7 A;  1YT3 A;  4E7I A;  3K59 A;  1Z25 A;  3TAR A;  1RNH A;  5FRM A;  3HP9 A;  3KJV A;  4E7J A;  4CF0 A;  4CJE A;  4FJG A;  3T19 A;  2LSN A;  4K8Z A;  2YNF A;  1Q8I A;  3O4N A;  1RTJ A;  3WNG A;  3CFO A;  3QER A;  4PUO A;  3ZSR A;  4DSI A;  3AO2 A;  1BIU A;  1S5J A;  4C8N A;  4Z4G A;  2F8T A;  4MFB A;  3PY8 A;  4B9V A;  3QEV A;  2FBX A;  2QXF A;  1LV5 A;  1JLA A;  3NAE A;  1Q9Y A;  3AVH A;  5CZ1 A;  2RF2 A;  3OS0 A;  1WLJ A;  1NJZ A;  1QHT A;  1N6Q A;  1QSS A;  3DMJ A;  4FLW A;  1TKX A;  4LH4 A;  1L3V A;  2G8U A;  1J54 A;  1WSJ A;  4M45 A;  1R0A A;  2IS3 A;  2ITG A;  4PA1 A;  3U3G A;  4LD0 A;  2Z1G A;  3V9W A;  5DMR A;  4CJR A;  1IKX A;  3E01 A;  4CGD A;  4J2E A;  4CFA A;  2B4J A;  3NHG A;  1FXX A;  1JLQ A;  4B9U A;  3DM2 A;  4CES A;  1J9A A;  2FBT A;  1B9D A;  3G0Z A;  3KKR A;  4AHT A;  4FJ8 A;  3TAG A;  3LPT A;  3MED A;  2DFE A;  1QE1 A;  1KRP A;  3DI6 A;  5E41 A;  4KHU A;  1TKZ A;  2XY6 A;  4DQQ A;  4AHS A;  3OYC A;  4FLT A;  1RDA A;  3I0S A;  3NBP A;  3OVN A;  3OYM A;  4QAG A;  1WAJ A;  3ALY A;  1NJW A;  4W5T A;  1KLN A;  1ZBL A;  1C1C A;  4FLV A;  1WSF A;  1NK6 A;  1Q9X A;  1YVU A;  1VSE A;  2GUI A;  4F3T A;  1UWB A;  2BGG A;  3OYA A;  1UA1 A;  4DSL A;  3K5M A;  5HRO A;  4HVJ A;  2P1J A;  2E4L A;  3HO1 A;  1B92 A;  1A5V A;  2A1S A;  4HUF A;  4JRQ A;  2RN2 A;  3DLK A;  1J5O A;  4M3X A;  3QEP A;  4DSF A;  3AVN A;  4CIE A;  4CGI A;  4BE0 A;  4HCC A;  2YNI A;  3PUF A;  3HVR A;  1NJX A;  4K8X A;  1YTA A;  3CQ8 A;  1JLF A;  4O0J A;  4CER A;  2GBZ A;  4DLG A;  1TK8 A;  4B9M A;  3QIO A;  1JL1 A;  1SUQ A;  4CHP A;  3ZSZ A;  4CHN A;  3NDK A;  2G8F A;  4FJH A;  1NK7 A;  1RBV A;  4OGE A;  4W5N A;  3LAK A;  1EKE A;  3DLE A;  3OYG A;  3AVJ A;  3RR8 A;  5KTQ A;  4F2S A;  4EZ9 A;  1TVR A;  2XY5 A;  4W5O A;  1DTQ A;  3MEE A;  3VA0 A;  3QNO A;  3L2Q A;  1VSL A;  1LWE A;  4I9L A;  3NGZ A;  4CJP A;  1HQE A;  4DQS A;  3DLH A;  4ELT A;  1HJR A;  4E89 A;  4PQU A;  1EXQ A;  3K2P A;  2HB5 A;  4RW9 A;  4CF9 A;  4KB0 A;  4CJL A;  4FK4 A;  3HJF A;  4Q0B A;  4CJ4 A;  2XY8 A;  1IKV A;  1BQN A;  3V9U A;  3LZI A;  3H08 A;  2G8V A;  4AHV A;  1YTU A;  3LPU A;  1C0M A;  1BGX T;  4BDY A;  2VG6 A;  4B9T A;  2KW4 A;  2HVH A;  1BI4 B;  1BI4 A;  4OVL A;  3V9Z A;  1LAW A;  2WON A;  2I5J A;  4FZZ A;  3KLH A;  3WNE A;  2O4G A;  4FVM A;  3AVL A;  2HHT A;  5T7B A;  4B9S A;  4N41 A;  3C95 A;  4CJ3 A;  4Z4E A;  3KK3 A;  3NF6 A;  4AHU A;  4E1N A;  4CK2 A;  1FKO A;  4JRP A;  4HUE A;  3PV8 A;  3QEX A;  3U6F A;  1SKW A;  1VSK A;  4M3U A;  4YFU A;  4FLZ A;  3PX6 A;  1U45 A;  1SL1 A;  3WNF A;  3ZSW A;  2HMI A;  1D9F A;  1N5Y A;  2OPQ A;  3U3Y A;  2OPR A;  4RW6 A;  1X1P A;  3AVF A;  4DTP A;  4M3Z A;  1S1V A;  4CIG A;  4M41 A;  1C0T A;  4OLB A;  4BWM A;  4O5B A;  5C42 A;  4FJ9 A;  3RMB A;  1LW0 A;  4WE1 A;  2HNZ A;  4Z4C A;  1HNI A;  2Y1I A;  4EP5 A;  4CF2 A;  3LAL A;  4I7F A;  2KZM A;  1C6V A;  3NF7 A;  1JLB A;  4ID1 A;  4AH9 A;  3A2F A;  3EY1 A;  3DLR A;  4CHQ A;  4QOZ B;  3CM6 A;  1JLE A;  3G10 A;  4E19 A;  2BAN A;  4ZHR A;  2Z1H A;  1JL2 A;  4BAC A;  2YNG A;  1RT1 A;  3P5J A;  1X9M A;  1DTT A;  1U04 A;  3AV9 A;  3VQ5 A;  3KD1 E;  2G8K A;  1L5U A;  3L8B A;  1GOB A;  3IG1 A;  3FFI A;  4RG8 A;  1W0H A;  3TAN A;  1X9S A;  3HYF A;  4ID5 A;  4M42 A;  1JLC A;  3RMD A;  1EP4 A;  3VQD A;  1FK9 A;  1XC9 A;  1UA0 A;  4EP4 A;  1NK5 A;  2BDP A;  4KHS A;  4CF8 A;  4F4K A;  3F9K A;  4NYF A;  1CXU A;  3DOK A;  3VQE A;  4N56 A;  3OYH A;  1LAV A;  1TL3 A;  3K58 A;  4IDK A;  5SZT A;  3IAY A;  4EZ6 A;  4CJW A;  1S1X A;  2HHQ A;  2HVI A;  1VSH A;  4DS5 A;  2E6L A;  4FCY A;  3BDP A;  1SV5 A;  3OYF A;  4CGJ A;  3V1Q A;  1U48 A;  3ZSX A;  3VQ9 A;  1BL3 A;  4CGF A;  5HRN A;  4Q5V A;  1CZ9 A;  2HNY A;  1JXB A;  3ASM A;  3V9S A;  4E7H A;  1IKW A;  2R7Y A;  3L3U A;  4O55 A;  4DF4 A;  1RDD A;  4DU1 A;  4J2A A;  5HBM A;  1XHZ A;  4RW4 A;  3HVT A;  4FLU A;  3RTV A;  4B8C A;  5CY4 A;  3DRS A;  3VQP A;  1HNV A;  3ZT3 A;  2KQ2 A;  3K5O A;  3PX0 A;  4JS4 A;  3NGY A;  1QSL A;  4FLX A;  1Y97 A;  4CJK A;  1HMV A;  1TGO A;  3AVK A;  1HRH A;  3NF9 A;  4XIU A;  4DFK A;  4FLY A;  2HHX A;  1C1B A;  3KK2 A;  3AO3 A;  4O4G A;  3NH1 A;  3EYZ A;  4HUG A;  1WSE A;  3ZSV A;  3RRG A;  1ASW A;  5J2N A;  3NH0 A;  4DTO A;  2OZS A;  3OYL A;  4H4M A;  3HK2 A;  1S1T A;  2G8W A;  3HST B;  4IBN A;  1K6Y A;  4B08 A;  4DSE A;  3TAP A;  4DFM A;  4FW1 A;  3M8S A;  1X9W A;  1IO2 A;  3OYN A;  3S3N A;  3S3O A;  4DQI A;  1A5W A;  5C24 A;  2OYQ A;  3ZT1 A;  4NCG A;  1RT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...