4KB1A

Crystal structure of rnase t in complex with a bluge dna (two nucleotide insertion ct )
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 60
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kb1A00
1Z26A 4FJLA 4TSXA 4CEOA 4ZHRA 4DSLA 4DG1A 4E7KA 3V9SA 1BL3A 1GOBA 1LWEA 2GV9A 3TR8A 3DLHA 3VQAA 3TANA 1LWCA 3KTQA 4CF0A 3AO1A 5FDLA 3D45A 4IFVA 4CHZA 4CF9A 4FJ5A 3KLFA 1BIZA 5CYMA 4IFYA 4NCBA 4Z4EA 4B9SA 1DLOA 4B9MA 1NK8A 4BWMA 2ETJA 4CGGA 4DU3A 4CEFA 4Q0BA 4F3OA 2OPPA 2D0BA 1SKSA 3VQPA 2X6SA 3LALA 5C42A 4CGHA 3ITHA 4I2QA 4CJKA 1REVA 1WAJA 3LPTA 4DQPA 4E7LA 3DRSA 3ZSOA 3HJFA 4H8KA 3NGZA 3LAMA 3P1GA 1JLAA 4KV8A 3SV3A 3U3YA 4CJWA 4DS5A 1HNIA 2HHUA 1KFDA 3KKRA 3OYKA 3ZT3A 3OYJA 1NKCA 4FLXA 3BGRA 3LP1A 3KJVA 2WONA 1LW2A 1VSHA 3CG7A 4IKFA 3V6DA 1C0UA 5T7BA 4NYNA 3ZT1A 1SL2A 1TK0A 4O55A 3AO3A 4KI4A 4N56A 2PYLA 3L3VA 2BGGA 1S1TA 1S1UA 4CEBA 1HQEA 5E41A 4F8RA 4CK2A 1F21A 4AHTA 3LWMA 2DTUA 1RBRA 4OPKA 3TAGA 2KFNA 3ZT0A 3C94A 3NGIA 4CHYA 2YNGA 3G0ZA 1ASUA 1RTJA 1QHTA 3KLHA 2ATQA 2FBYA 3ZSYA 3QINA 4ID5A 4CEDA 5J2NA 1XI1A 2HMIA 2EHGA 2Z1GA 1L3TA 1S6PA 2IS3A 1IKVA 3NHGA 4CGDA 1GOAA 2F8TA 3LP0A 5I42A 2HVIA 3QNNA 4YNQA 3M8SA 4Q5VA 1X9SA 4OPJA 2RKIA 1KVBA 2PYJA 1D8YA 5D3GA 1BHLA 3DLEA 4OGEA 1A5XA 5CY4A 3V1OA 3ZSWA 5KTQA 3SYZA 3NF8A 4Z4HA 3DLKA 1RT4A 3LZIA 4DF4A 2FBTA 2DY4A 4FLWA 4DWIA 4Z0UA 2R7YA 1C1BA 2HB5A 4PUOA 1ASVA 1QTMA 1L3SA 3HPGA 1EETA 3IG1A 1CLQA 3SUNA 4ID1A 4B8CA 3AVAA 3IS9A 3C6UA 3VQDA 3HP6A 4EP4A 1KLMA 1UA0A 3SQ1A 3SUQA 2VG7A 3T19A 3AVKA 1HYSA 4NCGA 4DTOA 3SQ4A 4O44A 4Z4CA 3NFAA 4FJKA 4M3TA 3VQEA 5EU7A 4FLTA 1LV5A 4E1MA 1J9AA 1BQNA 3F9KA 1NK9A 1MU2A 1RT2A 4CCHA 1I3AA 1HQUA 3L2RA 3P5JA 3HP9A 3MEGA 1IKYA 3HXMA 1JL1A 3KLGA 3EY1A 2PY5A 4IG3A 4FLZA 4J2DA 5JS1A 3CQ8A 2QKBA 1T05A 2IC3A 1VSJA 2FBVA 4DU1A 3P83D 2KFZA 3V81A 2G8WA 1BI4A 5K14A 1SKRA 3OYCA 2KZZA 4AHSA 4KHQA 1NK4A 4CF2A 2IOCA 5HBMA 4DQIA 3QEWA 4LD0A 4DQSA 4I9QA 4PQUA 4EZ9A 3K57A 4MFBA 2Y1JA 4CJFA 4CEZA 2YHAA 4ZTJA 4I7FA 3ZT4A 1B92A 4AHRA 3SNNA 1TK5A 2IDOA 4FVMA 1ZBUA 3K59A 1Y97A 3B6PA 5J1EA 2O4IA 3SJJA 1RDCA 3QERA 3SUPA 4I2PA 4KTWA 4FJNA 3OS0A 3VQBA 5I3UA 4NYFA 3WNFA 3L8BA 2HNZA 3AV9A 3PX6A 3TAPA 2X6NA 1RTHA 4JLHA 4CF8A 3OYAA 3L2WA 4J2EA 3LP3A 4E19A 3NF7A 1G15A 4FK0A 1TK8A 4CHOA 2XY8A 2BANA 1RTDA 3AA2A 3S9HA 4F3TA 1HNVA 1X1PA 3I0SA 3RRHA 3T3FA 2VG5A 1VK0A 1RT7A 3NCIA 4B3OA 2D5RA 4QOZB 3HVTA 1ZBHA 1KTQA 1BI4B 3JYTA 4CK3A 3PX0A 3ZSVA 1U49A 3E01A 1RBVA 3THVA 4LY7A 3VQ7A 2DFEA 2E6LA 3KK3A 4M3XA 4CFBA 1NK6A 1JLFA 3DLGA 1D5AA 4CF1A 1TL3A 4O5BA 1Q9XA 5J2QA 1UOCA 3I0RA 1WSEA 3HO1A 4FW2A 1VSMA 4FJGA 1D9FA 1RDDA 1S6QA 3CM5A 1DTQA 3M8PA 5KI6A 3AVGA 3L2QA 4BE2A 4CIGA 3SUOA 3SPYA 2HHSA 3OYLA 2HHQA 2YNIA 2JGUA 3OYDA 1IH7A 3VA3A 4CIEA 3LAKA 4DTRA 2Z1HA 3RMAA 1U47A 4C8OA 4CJ5A 3CFPA 4XIUA 1WSJA 4N47A 1JLQA 5HRSA 2X74A 2HHWA 4E3SA 3MXIA 2LSNA 3OYIA 4DSEA 3TAQA 3CFRA 3TAFA 2HNDA 1SL0A 4Z4GA 5J2PA 3NBPA 3M8QA 4CJRA 3WNGA 3KD1E 1VSKA 1YTUA 3V9ZA 3OVNA 1ITGA 4DMNA 4DTUA 1ZBFA 1NKBA 5HRRA 4FLUA 3OYMA 1T03A 5KGWA 1KVAA 1W0HA 3QO9A 4DQQA 1KFSA 4M3WA 3TABA 3K5MA 1X9MA 1J5OA 2IGIA 2O4GA 4CJPA 4KHWA 2XHBA 3RR8A 1C0MA 1BCMA 4IG0A 2RPIA 3K5LA 3LP2A 3DOLA 1TL1A 4M42A 5CZ1A 3CYMA 4M45A 4CFAA 3AVCA 3VN5A 3TWHA 1TKXA 2FC0A 1WAFA 5J2MA 3ULDA 3RR7A 4FZZA 4ELUA 3AO2A 1S1WA 3VA0A 3CFOA 2P5OA 4FJ9A 1TKTA 4Y1CA 3U6FA 5KRTA 4FJJA 1IKWA 2Z1JA 3L2UA 3DM2A 1S9GA 2GUIA 3AA4A 3HM9A 4KO0A 5C24A 4M41A 4CJEA 3ZCMA 1RCHA 2VG6A 4KHSA 3MEEA 4CFCA 4RW8A 2BDPA 4Z4IA 4J2AA 4RW6A 3T1AA 1C6VA 2F8SA 3SPZA 1VRTA 3OJUA 3KK1A 2E4LA 3K5NA 4DFKA 3S3NA 4W5RA 2G8VA 1A5VA 3NF9A 4DF8A 3HPHA 4E7JA 1TAQA 1S5JA 4CJSA 4E89A 2QKKA 4CHPA 3IAYA 2HHTA 2EX3A 1FKOA 1NOYA 1QSSA 4CJUA 4R5PA 3PV8A 4OVLA 1SV5A 4GW6A 1TKDA 2G8FA 1BGXT 1RT3A 4AHCA 4CEAA 2VWJA 1RILA 3AVJA 3MXJA 3QNOA 3QEIA 1X9WA 1NJYA 2OZSA 4BWJA 4BACA 3NDKA 3VQQA 1B9DA 4OJRA 3OYGA 3AA3A 4ICLA 4E0DA 3NAEA 4W5NA 1YVUA 2OPQA 1QSYA 4E1NA 1B9FA 2HVHA 1U04A 1L3UA 4HCBA 4IDKA 4RW4A 4F4KA 4OLAA 1SUQA 2YKNA 4IBNA 2I5JA 3O3FA 3TAMA 1KVCA 4DSFA 1JLGA 4DTXA 3A2FA 4DS4A 4FW1A 1C0TA 3VQCA 2AJQA 2KQ2A 2OPRA 4RW9A 3TAEA 1RTIA 2HHVA 1TVRA 4FXDA 4DFPA 4BDPA 3MAQA 4K8ZA 3DOKA 1IG9A 3EZ5A 4DFMA 2YNFA 4KRFA 4G1QA 1N6QA 2ITGA 3IRXA 3OS2A 2YV0X 4OKKA 1HPZA 2DFFA 3ZSRA 3MXMA 5FROA 4KHNA 1VSEA 4C8NA 2FBXA 3FFIA 1UAXA 4E7HA 4DFJA 2RN2A 2WOMA 3HYFA 3VQ5A 1RBTA 2ZQBA 1EP4A 3ZSZA 1JXBA 4OKJA 1LWFA 3NH2A 3VQ4A 1TKZA 2HNYA 3ASMA 1C1CA 3VQ9A 1JXEA 4AH9A 3DRPA 3V9UA 2F96A 3O3GA 1ZBLA 3RMDA 1NK7A 4N76A 4HVJA 3OY9A 1ZBIA 1S1XA 4FK4A 3M8RA 4DU4A 1JL2A 1IKXA 4GVMA 3OS1A 5HROA 3AO4A 1SKWA 3DLRA 2G8HA 2G8KA 3KK2A 1DTTA 2ZD1A 3PUFA 3OYEA 4FCYA 2A1RA 1NK5A 4W5OA 3OYFA 1J54A 2OYQA 4JS4A 4B9UA 1CXUA 4KFBA 4FJMA 3PO4A 4CJLA 3C95A 3DMJA 4CEEA 3AVNA 5CYQA 5FRMA 4O0JA 4CECA 4FZXC 5CZ2A 3V1QA 3RMBA 3NF6A 4JS5A 4Y1DA 1UA1A 3SV4A 4DTPA 5SZTA 3JSMA 3RMCA 4FZYA 3G10A 3AO5A 1FXXA 1RT5A 4CK1A 4CERA 4M3ZA 2OPSA 1HJRA 1EXQA 3HSTB 4HHTA 2DFHA 4B08A 4AILC 4F2SA 4DSKA 2YNHA 3O4QA 4OKEA 3LDSA 2QK9A 1XHZA 3PO5A 4ZTFA 1XWLA 3ZSQA 3PX4A 1JKHA 3NH1A 3D0PA 4JRQA 3KIOA 4FJHA 3VQ6A 3QIPA 4CGFA 1XHXA 2B4JA 4FM0A 4UQGA 1NJXA 1GOCA 3QETA 3BDPA 4KTQA 3OYHA 4CE9A 1HMVA 4HCCA 4CHQA 2G8IA 1HYVA 5HRNA 2PZSA 1WSFA 1JLEA 1RDAA 4C8KA 1KSPA 3QEVA 1CZBA 3L2VA 1NK0A 1VSIA 4CFDA 3HPOA 1QE1A 1CZ9A 1FK9A 2X78A 4C8MA 4ELTA 2JLEA 3EYZA 2QXFA 1S9EA 3NE6A 3SQ0A 1CXQA 1QS4A 1EKEA 2W42A 2XY5A 4M3RA 3H08A 1K6YA 4CIFA 3OYNA 1VSFA 5SWMA 4W5TA 3V1RA 4DQRA 3AVHA 2P51A 4DLEA 1A5WA 3S3MA 1VSLA 5JS2A 4KREA 3LZJA 4CESA 4DLGA 2HHXA 1N5YA 4BDZA 1RT1A 4NCAA 4CJVA 4MQ3A 4YFUA 3HK2A 3ZT2A 3QESA 1KCFA 4CJ3A 1T8EA 4RG8A 1KRPA 4FJ8A 1EX4A 3AVFA 4GMJB 4I9LA 4FM1A 4B9LA 1BISA 2OZMA 4KHYA 4PA1A 4KB1A 4CGJA 4FK2A 1T7PA 4DSJA 1WNSA 4FJIA 4LSLA 4HTUA 4J2BA 4B9NA 2P5GA 3O3HA 3MECA 1I39A 4DSIA 4DTSA 5HLFA 2YHBA 3V4IA 4PY5A 4DTNA 4PWDA 3DI6A 4H4OA 3SI6A 3C6TA 4QAGA 1NJWA 4FYDA 3CM6A 1WSIA 3QEXA 4EZ6A 4E7IA 2BE2A 3LPUA 3LWLA 4HUGA 4DTMA 1RBSA 1Q9YA 2A1SA 3KLIA 3WNHA 4AHUA 4HUFA 4Z4FA 4B9TA 4KKOA 3V9WA 2XY7A 2NUBA 2OA8A 1HRHA 2YKMA 3B6OA 2P1JA 1NOZA 4LSNA 4FJ7A 4CJQA 4B9VA 2KZMA 3L3UA 3WNEA 4CGIA 5HP1A 1LW0A 4C8LA 1J53A 1JLCA 2B6AA 3ZSXA 3ISNC 3QLHA 1W9HA 5DK5A 1BQMA 3K5OA 1XC9A 3NGYA 1WLJA 1R0AA 1RDBA 1UWBA 3UIQA 4OLBA 5FRNA 4O0IA 1RBUA 1ASWA 1SL1A 4N5SA 4OGCA 4WE1A 1U4BA 3KLEA 4KPYA 3QIOA 1TGOA 4LH5A 1ZYQA 1RNHA 3ALYA 1QQCA 3VQ8A 4O4GA 3RRGA 4KAZA 4N41A 2G8UA 4M3YA 3SCXA 1VRUA 3HL8A 3DLBA 2XY6A 1U45A 5KRSA 3TI0A 1FKPA 1WSGA 2KW4A 1L3VA 2XO7A 2Q3SA 1S1VA 1HYZA 3LANA 3RWUA 2B5JA 1D9DA 1TV6A 4H4MA 1U48A 4KB0A 1C1AA 3I8DA 4BDYA 3DYAA 3U3GA 1LAWA 2VWKA 1BIUA 2D0CA 1O1WA 3SZ2A 4AHVA 5KGXA 1RT6A 4FJXA 3O4NA 4CJTA 1NKEA 1Q8IA 4CHNA 1Z25A 1YTAA 1VSDA 1L5UA 4HUEA 4F2RA 1JLBA 4W5QA 3AVMA 1TAUA 3KD5E 4CJ4A 2D0AA 3HVRA 5DMRA 4L8RB 2RF2A 2XRIA 2E6MA 2KTQA 3PY8A 3AVLA 2Z1IA 4KHUA 3DRRA 4CEQA 4JRPA 2Y1IA 3HT3A 1IO2A 4RW7A 4B8AB 1NJZA 3MEDA 1WSHA 3KKSA 4BE1A 4LH4A 1YT3A 4ELVA 1WN7A 2HW3A 1BCOA 1LAVA 3RTVA 3SQ2A 3F73A 3NH0A 4M3UA 4FLYA 3AA5X 4K8XA 4EP5A 4KTZA 4BE0A 1KLNA 3QEPA 3TARA 4KI6A 2ZE2A 1QSLA 3S3OA 5C25A 2IAJA 3AVBA 3AVIA 4FLVA 4QCLA 3K58A 3OJSA 3K2PA 5HRPA 4FM2A 3V9XA 4DTJA 2GBZA 3OYBA
chains in the Genus database with same CATH superfamily
3L4QA 2O8EA 1YJ9N 4ZHRA 2WTUA 4BQLA 4WCEL 5FDLA 4CF9A 4FJ5A 2D0OA 1BU6O 2ZM6K 4NCBA 1NK8A 4BWMA 2ETJA 5AQIA 3RSEB 4F3OA 2D0BA 1SKSA 3TSPA 3LALA 3LPTA 4DQPA 4BRAA 4WFAL 3ZSOA 3VEYA 3NGZA 4KV8A 1HNIA 2P9KA 2HHUA 3KKRA 3ZT3A 2KHOA 2F9WA 4FLXA 1U2VA 5LMNK 4IKFA 1C0UA 4NYNA 1C0GA 4O55A 4KI4A 2PYLA 4H0YB 1S1UA 1WUAA 3SK3A 1XUPO 3THXA 3TAGA 2KFNA 3ZT0A 5KQDA 2YNGA 3GG4A 3KWGA 2AP1A 3R9PA 1S6PA 2IS3A 5LJWA 3NHGA 4CGDA 1Q86O 2HVIA 5EX5A 3M8SA 4Q5VA 5JVHL 1X9SA 2RKIA 2HBLA 3ZSWA 3SYZA 3NF8A 3LZIA 2DY4A 3AGRA 4BRIA 4DWIA 1IG8A 5AQUA 2R7YA 1C1BA 3BZKA 3EL2A 4EP4A 1YIJN 3VTHA 2OANA 4DTOA 3SQ4A 4K42A 2YCHA 4EHTA 4FJKA 4CCHA 1HQUA 2YHYA 4CD1A 4BGAA 1WBDA 3EY1A 4JI4K 2Q97A 3VGKA 1D4XA 4YDUC 2D1KA 2HSTA 1VSJA 2FBVA 1GLAG 2KFZA 3Q7BA 2G8WA 1Z05A 1SKRA 3ENHA 4AHSA 4DQIA 4LD0A 3NMUA 3C7NB 1HR0K 4I7FA 1CZAN 3ZT4A 4OX9K 1B92A 1Z6RA 4H03B 1IJJA 3VERA 1Y97A 3SJJA 3QERA 3SUPA 4I2PA 4KTWA 2VGMA 3OS0A 3VQBA 1N33K 3PX6A 3TAPA 4JLHA 5M1QA 3L2WA 4IJAA 1J6ZA 4YHHK 1IBLK 4FWMA 1TK8A 2ZWHA 2XY8A 3VPZA 2O8BA 1HNVA 5AQRA 1P90A 3LDLA 1ZBHA 1BI4B 3R8EA 2J4RA 3THVA 3PLAA 2O8CA 2E6LA 3M8PA 3CCVN 3AVGA 4BE2A 4BC2A 2HHSA 2HHQA 2P9SB 2JGUA 1BA0A 3WQTA 1XNQK 2RE2A 2P9PA 5AQSA 3CFPA 1WSJA 4JKGB 1XMOK 2LSNA 4Z4GA 4CJRA 1YTUA 4DMNA 2QWRA 4DTUA 1T03A 3OW2M 1KFSA 3M5RA 3K5MA 1J5OA 2O4GA 5B8HA 3THWB 3IUCA 1BDGA 5JICA 1V4TA 3CC4N 3AVCA 2FC0A 1T6DA 3MWTA 1OKJA 1S1WA 3VA0A 4H5VA 5KRTA 1IKWA 3FGUA 5C24A 1RCHA 5M1FA 4KHSA 3EKUA 3FR0A 4RW8A 3CC7N 4WQ4C 3DLLL 3QICA 1C6VA 3VMFB 4X64K 2F8SA 2VWBA 3KK1A 4DFKA 3S3NA 4W5RA 2G8VA 3NF9A 5E84A 4Z94A 4E7JA 4E89A 1FKOA 1NOYA 1QSSA 4R5PA 3PV8A 1SV5A 1BGXT 1HUXA 3K9KA 3AVJA 3QEIA 1TUUA 4A62A 3ZX0A 2OZSA 4BWJA 1GLCG 3LDPA 4OJRA 5AQVA 3LL3A 3C65A 4E1NA 2FSJA 1WBBA 3BF3A 2YKNA 4IEIA 1XNRK 4DSFA 4DTXA 4FW1A 3VQCA 2AJQA 2KQ2A 3ATVA 3I56N 4DFPA 4BDPA 3DOKA 3KVGA 4FWRA 3EZ5A 2A3ZA 4U67L 4KRFA 3IRXA 2DFFA 4QS8A 3WEEB 3KZBA 3KHYA 1VSEA 4JKAA 2Q31A 3NVKA 4QS7A 4DFJA 1VQPN 2ZQBA 4ISFA 3CCSN 4C23A 4OO1J 1LWFA 3MN7A 3NH2A 2I7NA 2HNYA 1C1CA 3MN9A 5EVZA 1NK7A 3RMDA 2ASOA 4HVJA 3G6EN 4DU4A 5HROA 3KK2A 4FWPA 1VQON 3PUFA 4MO4A 3VESA 4OPHA 4BREA 1CXUA 4B9UA 1JCGA 3C0BA 3CMEN 1BA1A 3PO4A 4CEEA 5AZIA 2O8FA 3CCJN 2UUBK 1V4SA 4FZXC 1UA1A 3RMBA 3SV4A 3HOTA 4LF5K 3P4IA 3AO5A 1EWRA 3T69A 1EXQA 4KH6A 4AILC 2ZGYA 3LDSA 2QK9A 2V7ZA 4ZTFA 3NH1A 4JRQA 1XHXA 4CZLA 1ATSA 5H1SQ 3BDPA 3OYHA 4CE9A 2G8IA 1HYVA 5HRNA 3P38A 4OPAA 3L2VA 4BRFA 4RTFD 4H5TA 4BGBA 4M63C 4M3RA 3FZMA 3OYNA 5LY3A 4W5TA 3V1RA 4XH1A 3AVHA 3WT0A 1VSLA 3EEQA 1N5YA 1DGKN 1P8ZA 5JLFA 4MQ3A 1K8KB 1KCFA 5C0YA 1EX4A 4B9LA 2FLOA 2OZMA 4KB1A 4CGJA 4DSJA 4FJIA 3O1WA 4F9OA 3BY5A 2P5GA 3MECA 3DJCA 2GX9A 3N4QA 5KPTA 3DI6A 3C6TA 5ELZA 4EZ6A 3LPUA 3G71N 1RBSA 4HUFA 4JYAK 2RHKA 3ZEUB 4CJQA 4CGIA 4CD3A 3CC2N 3ISNC 3QLHA 1TYQA 3R6MA 4JKEA 1R0AA 3ENOA 4E1JA 4KBOA 4O0IA 3MN6A 1SL1A 3A5NC 4N5SA 4WE1A 3T7ZA 1U4BA 1VQNN 2W6KA 1QQCA 3E9OA 3VQ8A 4KAZA 1VRUA 3ZETB 1QZ6A 3DXMB 2VCPA 2Q3SA 1HYZA 4IJNA 3RWUA 2B5JA 3GBTA 1TV6A 4KB0A 1XMQK 1C1AA 2WC9A 5AQWA 3B8AX 3SZ2A 4AHVA 5KGXA 1NKEA 3CCQN 1YTAA 2CGJA 4JI8K 1JLBA 3AVMA 4JKHA 2D0AA 3QFUA 2HBJA 1ZC6A 3PY8A 2Z1IA 1JCFA 4RW7A 3MEDA 3KKSA 4DV6K 4ELVA 3EE9A 3RTVA 3SQ2A 3HSCA 4FLYA 4EFHA 4KI6A 3OA9A 3F9MA 5HRPA 1QQNA 3V9XA 4DG1A 3V9SA 2GV9A 1LWEA 3VQAA 3D45A 4IFVA 2V7YA 5CYMA 3VTIA 4IFYA 3ZX3A 4IO8A 1DLOA 4JD2A 4DU3A 3F2KA 5M1PA 3VQPA 4BQZA 4GY2B 4B1VA 4CGHA 4X62K 4I2QA 4A2AA 1M1KO 4H8KA 1X3MA 5AQJA 4H0OA 3SV3A 3U3YA 4EHUA 2JWLA 4MDAA 5AQYA 2VYPA 1QQOA 2QWLA 3BGRA 3KJVA 1VSHA 2O8EB 5T7BA 3ZT1A 3AO3A 4N56A 3L3VA 2YJEA 5E41A 4NO7A 4YDUA 4BRQA 4F8RA 1F21A 4AHTA 3O6WA 5KPRA 4OPKA 3NGIA 3E9PA 4CHYA 5BR8K 3G0ZA 3MDQA 2ATQA 3QINA 4ID5A 2HMIA 1XI1A 2Z1GA 5IWAK 4JK9A 2F8TA 3LP0A 3QNNA 3IKMA 4OPJA 1KVBA 5D3GA 2P9KB 5KTQA 4EAHD 4Z4HA 3DLKA 1RT4A 5FLXO 1U2VB 4FLWA 5JVGL 4PUOA 4DV5K 1CLQA 3LM2A 3AVAA 3IS9A 3C6UA 3CF5L 2BUPA 5AQKA 3VQDA 3HP6A 1KLMA 2VG7A 4L3QA 3O4WA 4NCGA 3CJCA 4O44A 4Z4CA 4IEEA 4M3TA 2F4VK 1BQNA 1RT2A 3FE1A 4WQ5A 3MEGA 4J2DA 2VQEK 3TU5A 3BZCA 4FLZA 1ZXOA 2QKBA 1QHAA 3H3OB 3ID8A 2E2NA 4AQYK 1U6ZA 3V81A 3MWPA 1RFQA 5EXWA 5K14A 1QVFM 2KZZA 1OVQA 4KHQA 4CF2A 4HWIA 4EZ9A 2QWQA 3LDOA 1I94K 5JLHA 4CJFA 3JXUA 4ZTJA 3VF2A 1T3VA 2IDOA 1W7AA 3T1HK 1ZBUA 5J1EA 1NGDA 5BPMA 3J8AA 3L8BA 2X6NA 1RTHA 3WXKA 4CHOA 1RGIA 2EWSA 3S9HA 3I0SA 4K41A 2VG5A 1VK0A 4CZIA 3CCRN 4QOZB 2D5RA 1KTQA 3JYTA 3DXKA 3E01A 1RBVA 4NB4A 3CCMN 1NGFA 1NK6A 1JLFA 3O9TA 3DLGA 4CF1A 1NGCA 4JKDA 1TL3A 5J2QA 4JHDB 2W40A 4A5AA 3HO1A 5AFUH 4WQ4A 3TTFA 1D9FA 1S6QA 5KI6A 1BWFO 4CIGA 3HRGA 5M1KA 3SPYA 2P9LA 3OYDA 1IH7A 3LAKA 4C8OA 5AQPA 4CJ5A 4UY8O 3O9SA 3BP8A 5HRSA 1JLQA 3MX2A 2X74A 4E3SA 3MXIA 4DSEA 3TSQA 2HNDA 3M8QA 5EOYA 1TUYA 1VSKA 2O8CB 3M1FA 4DQ8A 3ZYYX 5AQQA 4CJ7A 5C10A 1ZBFA 1NKBA 5HRRA 2GUPA 3EZWA 3OYMA 4JI7K 5KGWA 1KVAA 1W0HA 2D4WA 5BR9A 2NRWA 2IGIA 4DV2K 2XHBA 1VQ9N 3RR8A 2P9NA 4IG0A 2RPIA 3K5LA 3LP2A 3DOLA 3HI0A 1BUPA 5IT9O 5DM6L 4H0PA 1DKGD 4CFAA 1TKXA 4JK8A 3H45C 1WB9A 5FPEA 4ELUA 1WOQA 2Q36A 3CFOA 2P5OA 4Y1CA 4BRLA 4FJJA 1GLJO 3MN5A 4CZGA 2A6AA 2GUIA 3HM9A 4M41A 1NGAA 3ZCMA 3D2FA 5FPDA 1SAZA 4Z4IA 4J2AA 1W2BM 3OTOK 4JI0K 1VRTA 4BY9C 3K5NA 1NGIA 3SMPA 4GKKK 2QKKA 3P31A 3O1BA 3IAYA 3Q7CA 2EX3A 4IOXA 5GAEP 4OVLA 1TKDA 4AHCA 4B3TK 1X9WA 4JK7A 1NJYA 4BACA 3NDKA 1B9DA 3OYGA 4ILJA 3AA3A 4ICLA 2YJFA 3MMVA 1U04A 4HCBA 4IDKA 4OLAA 1SUQA 2I5JA 3O3FA 3TAMA 4H5NA 4FPBA 1C0TA 4RW9A 3TAEA 1TVRA 4LFCK 4FXDA 3O9QA 5AQZA 4G1QA 1BG3A 4GVEA 1HPZA 3FLCO 5FROA 1NGBA 1UAXA 4E7HA 4ILGB 4BR0A 2WOMA 3VQ5A 3JS6A 2FXUA 3CXCM 1EP4A 3ZSZA 3GDQA 4OKJA 3VQ4A 1TKZA 4AH9A 3ASMA 3VQ9A 1JXEA 3DRPA 3J81O 3K9JA 3OY9A 2F7TA 4FK4A 3M8RA 1GLEG 3AO4A 1SKWA 3CHWA 2G8HA 1E4GT 3OYEA 4LFBK 3MCPA 4W5OA 4JS4A 4DV1K 4KFBA 4FJMA 4CJLA 1ATNA 2E88A 3AVNA 5CYQA 4DV7K 4CECA 2VGNA 5CZ2A 3VEVA 1H1VA 4Y1DA 3JSMA 4DR5K 1FXXA 4CK1A 4M3ZA 2OPSA 4DSKA 3O4QA 4YOXA 3PO5A 4B1XB 3VF4A 3J7YP 1JKHA 2P9IB 2GEMA 3D0PA 4DUYK 3VQ6A 3QIPA 4KTQA 4UQGA 1KC8O 1KXPA 4HCCA 4A61A 4CZHA 1JLEA 3D6RA 1KSPA 1VHXA 3HPOA 2YHXA 1FK9A 3OHRA 2O8FB 1HX1A 2QXFA 1S9EA 5AZJA 1QS4A 2UUAK 1EKEA 2XY5A 5AQOA 4IDHA 4CIFA 5SWMA 1YVNA 2P51A 4IOCL 3S3MA 2ASMA 3LZJA 1S3XA 2WBNA 2YHWA 4B1ZA 3HK2A 3ZT2A 3O80A 3QESA 1YUWA 1T8EA 4RG8A 3GE1A 4FM1A 4KHYA 5LMUK 4FK2A 3CPWM 4I6MB 1WNSA 1HNXK 4J2BA 4B9NA 4B3SK 4BG9A 4PWDA 4DTNA 1KAYA 1Q9YA 4DTMA 4PL8A 4B9TA 4KKOA 2YKMA 1NOZA 3H6EA 2HBMA 4IXCA 4B9VA 3E66A 5HL7L 1GLLO 1LW0A 2Q0RA 2B6AA 3K5OA 4JAXA 3NGYA 2OCEA 1RDBA 4OLBA 1ATRA 1RBUA 3G25A 4KPYA 1BOTO 1TGOA 4HTLA 4O4GA 4N41A 2G8UA 4M3YA 3SCXA 1IBKK 1EQYA 1QQMA 2HOEA 3TI0A 1S1VA 5LJVA 4GV6A 3D2EA 3I8DA 4BDYA 1HJOA 2VWKA 4JKBA 3WXIA 2NRZA 3QBWA 4FJXA 3O4NA 1Q8IA 1TYQB 1N34K 3TTDA 4NLCA 1VSDA 1TAUA 4BVPA 1Q82O 4CJ4A 5AQHA 2RF2A 2E6MA 1QVGM 3DRRA 4B8AB 4FOEA 1NJZA 4BE1A 3SJHA 3DAWA 2HW3A 1BCOA 1MDUB 1LAVA 3LDNA 4BRPA 4BC3A 4BE0A 1YJWN 2ZGZA 3TARA 2ZE2A 1QSLA 3S3OA 3A5OC 3AVBA 3AVIA 3ULEB 4FLVA 3K58A 3VEWA 4FK0A 4K0KK 3OYBA 3KK7A 4TSXA 1GLFO 4CEOA 4H0VB 3VGLA 4E7KA 1BL3A 4DSLA 3QMLA 4K25A 3KTQA 3FZKA 4CF0A 4CHZA 4Z4EA 2NRXA 4CEFA 2WFBA 4Q0BA 4JKFA 2OPPA 4DR3K 2X6SA 2E2OA 2A42A 1XQSC 3ITHA 1WAJA 3AY9A 4E7LA 3HJFA 3JAMO 2O8DB 3LAMA 3VEZA 4U7BA 4CJWA 3S41A 3PIPL 3OYKA 3OYJA 2QWOA 2E2PA 3LP1A 2WONA 1LW2A 5BRDA 3V6DA 2IIRA 4NXMK 2BGGA 3A8YA 3W3DA 4CEBA 1HQEA 3ENBA 3TTCA 2HBKA 2DTUA 3CPEA 5C2DA 2NZTA 3C94A 4FOIA 1RTJA 3R1XA 3KLHA 2FBYA 3ZSYA 5AFUA 4NXNK 1HNWK 2EHGA 1IKVA 4DR1K 5CHIA 3L0QA 5I42A 3H1QA 3EN9A 4OGEA 3DLEA 1EWQA 3V1OA 3WXJA 4DF4A 3FZLA 2FBTA 3SBTA 2HB5A 1QTMA 4PKGA 5BN9A 3IG1A 3BF1A 4B8CA 1LCUA 4BRCA 4BR5A 5AQFA 2GTDA 1UA0A 1NLVA 3AVKA 3CJBA 1HYSA 5CR4A 2V52B 3VQEA 3SAGA 5BRHA 4FLTA 1LV5A 3F9KA 1NK9A 1MU2A 4FWSA 3ZX2A 1I3AA 3CD6N 3CQXA 3CQYA 3HP9A 3P5JA 3HXMA 3THYA 3VF6A 2PY5A 4O5FA 5JS1A 1T05A 4KHPK 2E20A 3I55N 1YXQA 3CCEN 4IWVA 3U8XA 3N4PA 4DUZK 2ZJQL 2Q2RA 2F9TA 3WXLA 3IDHA 3QEWA 4MLHA 4I9QA 4PQUA 4MFBA 2NRVA 4LF6K 5AQNA 1KAXA 2YHAA 3O8MA 4AHRA 4GV9A 4CBXA 3K59A 1JJ2M 1RDCA 4WFNL 4FJNA 3WNFA 3AV9A 5C2FA 1NWKA 3OYAA 3KWIA 4J2EA 3NF7A 1G15A 3OBYA 4FWLA 2BANA 1RTDA 3AA2A 4JEPA 3RRHA 1OH5A 2QWMA 3NCIA 3HVTA 1NJIO 4CK3A 3PX0A 3ZSVA 1HKBA 4BC4A 3CCLN 1DEJA 3KK3A 4M3XA 3R3LA 1D5AA 1Q9XA 4FPAA 3CJ1A 2PAVA 4FW2A 1VSMA 4FJGA 1RDDA 3CM5A 4ISEA 3WQUA 3L2QA 2IVNA 3SUOA 2BH1A 2YNIA 4CIEA 1U47A 2Z1HA 3MK6A 2QEXN 4XIUA 3M3ZA 4BC5A 3TAQA 2YI1A 3TAFA 1SL0A 3DXKB 5J2PA 1HKGA 2QA4N 4H5WA 3KD1E 4KH4A 3V9ZA 1N8RO 3OVNA 4O8KA 4FWQA 4FWNA 3QO9A 4DQQA 3TABA 4YOWA 2QTDA 3CIPA 3QDKA 1X9MA 4CJPA 4H5RA 5GINA 1BCMA 2GELA 3ZEUA 4M42A 3VETA 3D7EO 4MDBA 1HLUA 2P9LB 3CYMA 3TWHA 3VN5A 1WAFA 5J2MA 3ULDA 2UXDK 4FZZA 4DR7K 3EE8A 4FJ9A 1TKTA 3U6FA 4GV3A 2Z1JA 3L4IA 3DM2A 5E26A 3AA4A 4JKCA 5FPNA 4PKIA 2VG6A 5F1XA 3MEEA 4CFCA 2BDPA 3THXB 4JNEA 1NGHA 3DXMA 4RW6A 3SPZA 3OJUA 4LFAK 2P9NB 3CCUN 3HPHA 4CJSA 4CHPA 2IVOA 3U9ZA 4NLBA 5EY4A 4DR4K 1RT3A 3FZHA 4BR9A 3QNOA 2HF4A 4YOVA 3VENA 3VQQA 3NAEA 1YVUA 2HVHA 3A0IX 1B9FA 4CBUA 4RW4A 4IBNA 2CH6A 4M7XA 3GL1A 1JLGA 3TPQA 3A2FA 4DS4A 4BR4A 4XEIA 2OPRA 2YX6A 2HHVA 4JI1K 3MAQA 4K8ZA 2H3GX 4DFMA 3UKUA 2UUCK 5BREA 4PKHA 2ITGA 2E8AA 2YV0X 1MWMA 3ZSRA 2FBXA 1NNEA 2RN2A 4IFEA 3HYFA 1RBTA 2OTJN 1JXBA 2Q1NA 1QZ5A 2F96A 3O3GA 4N76A 1IKXA 2V51B 3NVMA 3M6GA 1VQ7N 2G8KA 4DCHA 4FO0A 3OYFA 4CZKA 4IZ9A 3DMJA 4O0JA 3V1QA 5AQLA 4MO5A 4DTPA 4YY3K 1NG9A 1VAZA 1SZ2A 4CERA 3HSTB 4QS9A 3HM8A 4HHTA 2DFHA 4B08A 2QWPA 4OKEA 4FWOA 2O8BB 1XWLA 3PX4A 1MWKA 3E1YA 2ZF5O 3KIOA 2ITMA 4LF7K 4FM0A 1NJXA 2B4JA 4BVOA 4R79A 4B1UB 4B3RK 3C6HA 4DKWA 1R59O 1YI2N 3G4SN 1WSFA 1HKCA 1CZBA 3CJ9A 3QEVA 1VSIA 1NK0A 4CFDA 1CZ9A 1XC3A 1Q7YO 4ELTA 2JLEA 3NE6A 2FSNA 3SQ0A 1CXQA 2W42A 1OH8A 1ILYA 1VSFA 2W41A 4CBWA 4DQRA 1A5WA 4M7YA 4AM6A 1NMDA 5JS2A 4CESA 4BG8A 4NCAA 4CJVA 4YFUA 2P9PB 4CJ3A 1DT9A 4JI3K 2GWKA 4BRKA 4BR7A 4GNIA 1T7PA 4B3MK 3DWLA 4LSLA 3FZFA 3HOSA 3I33A 3O3HA 4X66K 1I39A 3UKRA 4DTSA 5HLFA 2YHBA 3V4IA 1NJWA 4H4OA 3SI6A 4KH5A 1Q81O 4FYDA 5TKYA 3QEXA 5AZJB 1O13A 4E7IA 5LL6Z 3LWLA 2PFUA 2A1SA 3AAPA 3VGMA 4Z4FA 4A2BA 3V9WA 2NUBA 2OA8A 1HRHA 3B6OA 4FJ7A 3L3UA 3WNEA 2BTFA 4B1WB 5HP1A 3O08A 3ZSXA 4BR2A 3SAFA 3H46O 1XC9A 1J5EK 1WLJA 2WUSA 1UWBA 3RVCA 3UIQA 1VQKN 3J7ZO 4LC9B 3WUHA 3QIOA 1ZYQA 3A5MC 3ALYA 1NGGA 1E4FT 1NGEA 2E2QA 5F0XA 4WYBA 1FKPA 1WSGA 2KW4A 2A40A 2P9UA 1NM1A 4H4MA 1SS6A 5C12A 2NRTA 1LAWA 2D0CA 1O1WA 1SQKA 4CJTA 1NU0A 4HUEA 4F2RA 4CZFA 3KD5E 3HVRA 4L8RB 2XRIA 2KTQA 4KHUA 4CEQA 1GLDG 2Y1IA 3PIOL 3TSUA 3RSEA 4JHDA 2FSKA 2KLAA 3CI5A 1W97L 4H0XB 4M3UA 5M1OA 1VQ8N 5DM7L 1KLNA 3QEPA 5ADXH 3BUZB 3D2EB 5C25A 3CETA 2I7PA 2QI2A 4DTJA 2GBZA 3KLGA 1Z26A 4FJLA 1GOBA 3DLHA 3TR8A 3TANA 1LWCA 3AO1A 3HTVA 4O8UA 3KLFA 2HHHK 1BIZA 1VQMN 4B9SA 4B9MA 4WQ5C 4CGGA 5C42A 4YORA 4IO9L 4CJKA 1REVA 4DR2K 3DRSA 3CJAA 3IFRA 5AZIB 3O9UA 3P1GA 1JLAA 4DS5A 4FSVA 1KFDA 4G9ZA 1NKCA 4B1YB 3CG7A 1SL2A 1TK0A 4ISGA 1S1TA 4CK2A 3LWMA 1RBRA 4XH4A 2QXLA 4B9QA 3CJ7A 2QWNA 1ASUA 1QHTA 5J2NA 4CEDA 4ILHA 1L3TA 4JI5K 1GOAA 4YNQA 2UXCK 2PYJA 1D8YA 1BHLA 5CY4A 1A5XA 1NBWA 4BROA 4Z0UA 1ASVA 1L3SA 3HPGA 1EETA 3SUNA 4ID1A 5KPZA 4EIAA 3C7NA 2CGLA 1NGJA 3SQ1A 3SUQA 3T19A 1T6CA 3NFAA 5EU7A 5JMVA 4E1MA 1J9AA 3L2RA 1OH6A 1IKYA 1JL1A 4IG3A 3CQ8A 2IC3A 3O5BA 4IOAL 2E5LK 4DU1A 3P83D 3HZ6A 3MX5A 4A5BA 1BI4A 2NLXA 3IMXA 2D0PA 2NRHA 3OYCA 1NK4A 2IOCA 5HBMA 4DQSA 2AA4A 3K57A 2Y1JA 4A59A 4CEZA 3SNNA 1TK5A 3K0SA 4FVMA 1FW6A 3B6PA 5BPLA 1YITN 5FPMA 2O4IA 1RDUA 3AGKA 1T44A 4NYFA 5I3UA 5HOOA 2HNZA 2A41A 4CVNE 4DV4K 4CF8A 3THYB 1C0FA 3LP3A 3PSFA 4E19A 2P9SA 1OH7A 1VQ4N 4F3TA 2NRRA 1X1PA 3T3FA 4JKGA 1RT7A 4B3OA 2FF6A 2P9IA 4DV0K 4PHTX 1U49A 4BRDA 3QB0A 4BRHA 3SBGA 1G99A 4LY7A 3VQ7A 2DFEA 3SMSA 4A57A 2GWJA 4CFBA 3W0LA 2QM1A 3T1YK 5F2RA 4O5BA 3THWA 3J80O 1UOCA 3I0RA 5A2QO 1WSEA 5TKWA 1K73O 5KQ8A 1DTQA 1VQ5N 4J8FA 3OYLA 1OVYA 4DV3K 3VA3A 4DTRA 3OBWA 3RMAA 4JI6K 4N47A 2HHWA 3OYIA 3CFRA 4MLEA 3NBPA 3A5LC 3WNGA 3CERA 1HNZK 4JI2K 3J7AP 4I6MA 1YJNN 1ITGA 2ASPA 3MCAB 2OTLN 4C1NI 4FLUA 4M3WA 4JD2B 3E9LA 1YAGA 4KHWA 4XH5A 1C0MA 1Q18A 1TL1A 1S72N 4LF9K 5CZ1A 3UB5A 4M45A 3VEOA 4GKJK 3RR7A 3AO2A 1Y64A 3L6QA 5GIOA 3L2UA 3QBXA 1S9GA 1RDWX 4KO0A 4CJEA 3GOIA 4JN4A 3T1AA 2E4LA 1A5VA 3WXMB 4DF8A 4H0TB 1TAQA 1S5JA 2IVPA 2HHTA 3WEEA 3QFPA 4FWKA 4CJUA 1X9JA 2G8FA 4GW6A 2E1ZA 4CEAA 2VWJA 1RILA 3MXJA 4CI6A 5GAHP 4E0DA 4W5NA 2OPQA 2JWKA 3ID6A 1QSYA 4Y0WA 1L3UA 4F4KA 3AAQA 5I9EB 1KVCA 5AQTA 4FL9A 2UYTA 4X65K 1RTIA 2PBDA 1IG9A 2ZJPL 2YNFA 5C15A 2DPNA 3UE5A 1N6QA 3OS2A 4YOTA 4OKKA 5GIPA 3MXMA 4KHNA 1GLBG 4C8NA 3FFIA 3CMAN 3ULEA 2HF3A 4BRMA 1LOTB 3P39A 1VQ6N 4CZMA 3V9UA 1ZBLA 3O9RA 2Q0UA 3U4LA 1S1XA 1ZBIA 3U9DA 1JL2A 4GVMA 3OS1A 3H1VX 3DLRA 4WF9L 3F5TA 1DTTA 2ZD1A 4FCYA 5MLCQ 2A1RA 1NK5A 1J54A 2OYQA 3UKUB 1BO5O 3C95A 3SAHA 2O8DA 5FRMA 1FJGK 2CGKA 2A5XA 5GADP 3NF6A 2FF3B 2NNWA 4JS5A 1VQLN 3RMCA 3FFKB 4C1NK 5SZTA 4FZYA 1EO1A 3G10A 1RT5A 1HJRA 4LF4K 1ESVA 4RCHA 4CW7B 4F2SA 2YNHA 1KD1O 1XHZA 1K8KA 4V19S 5GAGP 3ZSQA 1KAZA 4FVUA 3I8BA 4FJHA 2W6LA 4CGFA 1GOCA 3QETA 1HMVA 4CHQA 5M1NA 2PZSA 1RDAA 1N36K 4C8KA 4JV5K 3H3NO 3ATUA 1QE1A 5ADXA 4C8MA 3ZLJA 2X78A 3EYZA 4YOUA 2HMPA 3C6AA 3H08A 1K6YA 3VEXA 1M90O 4DLEA 4KREA 4CZJA 4DLGA 2HHXA 4BDZA 1RT1A 2UU9K 2KKZA 4PL7A 4DB3A 1KRPA 4FJ8A 2QW9A 3AVFA 1HPMA 4GMJB 4I9LA 1BISA 4PA1A 3PSIA 1IBMK 1N32K 2ZJRL 1S22A 4HTUA 1K8AO 4DSIA 3ZETA 4PY5A 1K9MO 4K43A 4QAGA 3CM6A 1WSIA 2BE2A 4RWTA 4HUGA 3KLIA 3WNHA 4AHUA 2XY7A 4LSNA 5AR0A 5BN8A 2P1JA 3SLCA 2KZMA 5AJ3K 4AM7A 4C8LA 1J53A 1JLCA 1W9HA 5DK5A 5BRFA 1BQMA 4AF1A 5FRNA 1ASWA 4OGCA 3BEXA 3KLEA 3VOVA 1X3NA 4LH5A 1RNHA 3D2FB 3RRGA 4DR6K 4BRGA 1ZBSA 3HL8A 3UKRB 3DLBA 2XY6A 1U45A 5AQXA 1JCEA 5KRSA 1L3VA 1KQSM 2XO7A 3LANA 1IV0A 3AARA 1D9DA 3LDQA 1U48A 5BPNA 3DYAA 3U3GA 3EO3A 1BIUA 1RT6A 4BRNA 3HBTA 2E1YA 1NMNA 4CHNA 1Z25A 1L5UA 3LM9A 4W5QA 4YOYA 5AQGA 5DMRA 1YF5L 3EKSA 3AVLA 2UXBK 4DHYA 4JRPA 3HT3A 1IO2A 5CE3A 1WSHA 2CH5A 4LH4A 1YT3A 1WN7A 3F73A 3NH0A 3AA5X 4K8XA 1YHQN 4EP5A 1E3MA 4KTZA 4WFBL 2P9UB 1MA9B 2VQFK 2IAJA 5AQMA 4QCLA 3OJSA 3K2PA 4FM2A 4LF8K 4CZEA
chains in the Genus database with same CATH topology
1Z26A 4FJLA 4TSXA 4CEOA 4ZHRA 4DSLA 4DG1A 4E7KA 3V9SA 1BL3A 1GOBA 1LWEA 2GV9A 3TR8A 3DLHA 3VQAA 3TANA 1LWCA 3KTQA 4CF0A 3AO1A 5FDLA 3D45A 4IFVA 4CHZA 4CF9A 4FJ5A 3KLFA 1BIZA 5CYMA 4IFYA 4NCBA 4Z4EA 4B9SA 1DLOA 4B9MA 1NK8A 4BWMA 2ETJA 4CGGA 4DU3A 4CEFA 4Q0BA 4F3OA 2OPPA 2D0BA 1SKSA 3VQPA 2X6SA 3LALA 5C42A 4CGHA 3ITHA 4I2QA 4CJKA 1REVA 1WAJA 3LPTA 4DQPA 4E7LA 3DRSA 3ZSOA 3HJFA 4H8KA 3NGZA 3LAMA 3P1GA 1JLAA 4KV8A 3SV3A 3U3YA 4CJWA 4DS5A 1HNIA 2HHUA 1KFDA 3KKRA 3OYKA 3ZT3A 3OYJA 1NKCA 4FLXA 3BGRA 3LP1A 3KJVA 2WONA 1LW2A 1VSHA 3CG7A 4IKFA 3V6DA 1C0UA 5T7BA 4NYNA 3ZT1A 1SL2A 1TK0A 4O55A 3AO3A 4KI4A 4N56A 2PYLA 3L3VA 2BGGA 1S1TA 1S1UA 4CEBA 1HQEA 5E41A 4F8RA 4CK2A 1F21A 4AHTA 3LWMA 2DTUA 1RBRA 4OPKA 3TAGA 2KFNA 3ZT0A 3C94A 3NGIA 4CHYA 2YNGA 3G0ZA 1ASUA 1RTJA 1QHTA 3KLHA 2ATQA 2FBYA 3ZSYA 3QINA 4ID5A 4CEDA 5J2NA 1XI1A 2HMIA 2EHGA 2Z1GA 1L3TA 1S6PA 2IS3A 1IKVA 3NHGA 4CGDA 1GOAA 2F8TA 3LP0A 5I42A 2HVIA 3QNNA 4YNQA 3M8SA 4Q5VA 1X9SA 4OPJA 2RKIA 1KVBA 2PYJA 1D8YA 5D3GA 1BHLA 3DLEA 4OGEA 1A5XA 5CY4A 3V1OA 3ZSWA 5KTQA 3SYZA 3NF8A 4Z4HA 3DLKA 1RT4A 3LZIA 4DF4A 2FBTA 2DY4A 4FLWA 4DWIA 4Z0UA 2R7YA 1C1BA 2HB5A 4PUOA 1ASVA 1QTMA 1L3SA 3HPGA 1EETA 3IG1A 1CLQA 3SUNA 4ID1A 4B8CA 3AVAA 3IS9A 3C6UA 3VQDA 3HP6A 4EP4A 1KLMA 1UA0A 3SQ1A 3SUQA 2VG7A 3T19A 3AVKA 1HYSA 4NCGA 4DTOA 3SQ4A 4O44A 4Z4CA 3NFAA 4FJKA 4M3TA 3VQEA 5EU7A 4FLTA 1LV5A 4E1MA 1J9AA 1BQNA 3F9KA 1NK9A 1MU2A 1RT2A 4CCHA 1I3AA 1HQUA 3L2RA 3P5JA 3HP9A 3MEGA 1IKYA 3HXMA 1JL1A 3KLGA 3EY1A 2PY5A 4IG3A 4FLZA 4J2DA 5JS1A 3CQ8A 2QKBA 1T05A 2IC3A 1VSJA 2FBVA 4DU1A 3P83D 2KFZA 3V81A 2G8WA 1BI4A 5K14A 1SKRA 3OYCA 2KZZA 4AHSA 4KHQA 1NK4A 4CF2A 2IOCA 5HBMA 4DQIA 3QEWA 4LD0A 4DQSA 4I9QA 4PQUA 4EZ9A 3K57A 4MFBA 2Y1JA 4CJFA 4CEZA 2YHAA 4ZTJA 4I7FA 3ZT4A 1B92A 4AHRA 3SNNA 1TK5A 2IDOA 4FVMA 1ZBUA 3K59A 1Y97A 3B6PA 5J1EA 2O4IA 3SJJA 1RDCA 3QERA 3SUPA 4I2PA 4KTWA 4FJNA 3OS0A 3VQBA 5I3UA 4NYFA 3WNFA 3L8BA 2HNZA 3AV9A 3PX6A 3TAPA 2X6NA 1RTHA 4JLHA 4CF8A 3OYAA 3L2WA 4J2EA 3LP3A 4E19A 3NF7A 1G15A 4FK0A 1TK8A 4CHOA 2XY8A 2BANA 1RTDA 3AA2A 3S9HA 4F3TA 1HNVA 1X1PA 3I0SA 3RRHA 3T3FA 2VG5A 1VK0A 1RT7A 3NCIA 4B3OA 2D5RA 4QOZB 3HVTA 1ZBHA 1KTQA 1BI4B 3JYTA 4CK3A 3PX0A 3ZSVA 1U49A 3E01A 1RBVA 3THVA 4LY7A 3VQ7A 2DFEA 2E6LA 3KK3A 4M3XA 4CFBA 1NK6A 1JLFA 3DLGA 1D5AA 4CF1A 1TL3A 4O5BA 1Q9XA 5J2QA 1UOCA 3I0RA 1WSEA 3HO1A 4FW2A 1VSMA 4FJGA 1D9FA 1RDDA 1S6QA 3CM5A 1DTQA 3M8PA 5KI6A 3AVGA 3L2QA 4BE2A 4CIGA 3SUOA 3SPYA 2HHSA 3OYLA 2HHQA 2YNIA 2JGUA 3OYDA 1IH7A 3VA3A 4CIEA 3LAKA 4DTRA 2Z1HA 3RMAA 1U47A 4C8OA 4CJ5A 3CFPA 4XIUA 1WSJA 4N47A 1JLQA 5HRSA 2X74A 2HHWA 4E3SA 3MXIA 2LSNA 3OYIA 4DSEA 3TAQA 3CFRA 3TAFA 2HNDA 1SL0A 4Z4GA 5J2PA 3NBPA 3M8QA 4CJRA 3WNGA 3KD1E 1VSKA 1YTUA 3V9ZA 3OVNA 1ITGA 4DMNA 4DTUA 1ZBFA 1NKBA 5HRRA 4FLUA 3OYMA 1T03A 5KGWA 1KVAA 1W0HA 3QO9A 4DQQA 1KFSA 4M3WA 3TABA 3K5MA 1X9MA 1J5OA 2IGIA 2O4GA 4CJPA 4KHWA 2XHBA 3RR8A 1C0MA 1BCMA 4IG0A 2RPIA 3K5LA 3LP2A 3DOLA 1TL1A 4M42A 5CZ1A 3CYMA 4M45A 4CFAA 3AVCA 3VN5A 3TWHA 1TKXA 2FC0A 1WAFA 5J2MA 3ULDA 3RR7A 4FZZA 4ELUA 3AO2A 1S1WA 3VA0A 3CFOA 2P5OA 4FJ9A 1TKTA 4Y1CA 3U6FA 5KRTA 4FJJA 1IKWA 2Z1JA 3L2UA 3DM2A 1S9GA 2GUIA 3AA4A 3HM9A 4KO0A 5C24A 4M41A 4CJEA 3ZCMA 1RCHA 2VG6A 4KHSA 3MEEA 4CFCA 4RW8A 2BDPA 4Z4IA 4J2AA 4RW6A 3T1AA 1C6VA 2F8SA 3SPZA 1VRTA 3OJUA 3KK1A 2E4LA 3K5NA 4DFKA 3S3NA 4W5RA 2G8VA 1A5VA 3NF9A 4DF8A 3HPHA 4E7JA 1TAQA 1S5JA 4CJSA 4E89A 2QKKA 4CHPA 3IAYA 2HHTA 2EX3A 1FKOA 1NOYA 1QSSA 4CJUA 4R5PA 3PV8A 4OVLA 1SV5A 4GW6A 1TKDA 2G8FA 1BGXT 1RT3A 4AHCA 4CEAA 2VWJA 1RILA 3AVJA 3MXJA 3QNOA 3QEIA 1X9WA 1NJYA 2OZSA 4BWJA 4BACA 3NDKA 3VQQA 1B9DA 4OJRA 3OYGA 3AA3A 4ICLA 4E0DA 3NAEA 4W5NA 1YVUA 2OPQA 1QSYA 4E1NA 1B9FA 2HVHA 1U04A 1L3UA 4HCBA 4IDKA 4RW4A 4F4KA 4OLAA 1SUQA 2YKNA 4IBNA 2I5JA 3O3FA 3TAMA 1KVCA 4DSFA 1JLGA 4DTXA 3A2FA 4DS4A 4FW1A 1C0TA 3VQCA 2AJQA 2KQ2A 2OPRA 4RW9A 3TAEA 1RTIA 2HHVA 1TVRA 4FXDA 4DFPA 4BDPA 3MAQA 4K8ZA 3DOKA 1IG9A 3EZ5A 4DFMA 2YNFA 4KRFA 4G1QA 1N6QA 2ITGA 3IRXA 3OS2A 2YV0X 4OKKA 1HPZA 2DFFA 3ZSRA 3MXMA 5FROA 4KHNA 1VSEA 4C8NA 2FBXA 3FFIA 1UAXA 4E7HA 4DFJA 2RN2A 2WOMA 3HYFA 3VQ5A 1RBTA 2ZQBA 1EP4A 3ZSZA 1JXBA 4OKJA 1LWFA 3NH2A 3VQ4A 1TKZA 2HNYA 3ASMA 1C1CA 3VQ9A 1JXEA 4AH9A 3DRPA 3V9UA 2F96A 3O3GA 1ZBLA 3RMDA 1NK7A 4N76A 4HVJA 3OY9A 1ZBIA 1S1XA 4FK4A 3M8RA 4DU4A 1JL2A 1IKXA 4GVMA 3OS1A 5HROA 3AO4A 1SKWA 3DLRA 2G8HA 2G8KA 3KK2A 1DTTA 2ZD1A 3PUFA 3OYEA 4FCYA 2A1RA 1NK5A 4W5OA 3OYFA 1J54A 2OYQA 4JS4A 4B9UA 1CXUA 4KFBA 4FJMA 3PO4A 4CJLA 3C95A 3DMJA 4CEEA 3AVNA 5CYQA 5FRMA 4O0JA 4CECA 4FZXC 5CZ2A 3V1QA 3RMBA 3NF6A 4JS5A 4Y1DA 1UA1A 3SV4A 4DTPA 5SZTA 3JSMA 3RMCA 4FZYA 3G10A 3AO5A 1FXXA 1RT5A 4CK1A 4CERA 4M3ZA 2OPSA 1HJRA 1EXQA 3HSTB 4HHTA 2DFHA 4B08A 4AILC 4F2SA 4DSKA 2YNHA 3O4QA 4OKEA 3LDSA 2QK9A 1XHZA 3PO5A 4ZTFA 1XWLA 3ZSQA 3PX4A 1JKHA 3NH1A 3D0PA 4JRQA 3KIOA 4FJHA 3VQ6A 3QIPA 4CGFA 1XHXA 2B4JA 4FM0A 4UQGA 1NJXA 1GOCA 3QETA 3BDPA 4KTQA 3OYHA 4CE9A 1HMVA 4HCCA 4CHQA 2G8IA 1HYVA 5HRNA 2PZSA 1WSFA 1JLEA 1RDAA 4C8KA 1KSPA 3QEVA 1CZBA 3L2VA 1NK0A 1VSIA 4CFDA 3HPOA 1QE1A 1CZ9A 1FK9A 2X78A 4C8MA 4ELTA 2JLEA 3EYZA 2QXFA 1S9EA 3NE6A 3SQ0A 1CXQA 1QS4A 1EKEA 2W42A 2XY5A 4M3RA 3H08A 1K6YA 4CIFA 3OYNA 1VSFA 5SWMA 4W5TA 3V1RA 4DQRA 3AVHA 2P51A 4DLEA 1A5WA 3S3MA 1VSLA 5JS2A 4KREA 3LZJA 4CESA 4DLGA 2HHXA 1N5YA 4BDZA 1RT1A 4NCAA 4CJVA 4MQ3A 4YFUA 3HK2A 3ZT2A 3QESA 1KCFA 4CJ3A 1T8EA 4RG8A 1KRPA 4FJ8A 1EX4A 3AVFA 4GMJB 4I9LA 4FM1A 4B9LA 1BISA 2OZMA 4KHYA 4PA1A 4KB1A 4CGJA 4FK2A 1T7PA 4DSJA 1WNSA 4FJIA 4LSLA 4HTUA 4J2BA 4B9NA 2P5GA 3O3HA 3MECA 1I39A 4DSIA 4DTSA 5HLFA 2YHBA 3V4IA 4PY5A 4DTNA 4PWDA 3DI6A 4H4OA 3SI6A 3C6TA 4QAGA 1NJWA 4FYDA 3CM6A 1WSIA 3QEXA 4EZ6A 4E7IA 2BE2A 3LPUA 3LWLA 4HUGA 4DTMA 1RBSA 1Q9YA 2A1SA 3KLIA 3WNHA 4AHUA 4HUFA 4Z4FA 4B9TA 4KKOA 3V9WA 2XY7A 2NUBA 2OA8A 1HRHA 2YKMA 3B6OA 2P1JA 1NOZA 4LSNA 4FJ7A 4CJQA 4B9VA 2KZMA 3L3UA 3WNEA 4CGIA 5HP1A 1LW0A 4C8LA 1J53A 1JLCA 2B6AA 3ZSXA 3ISNC 3QLHA 1W9HA 5DK5A 1BQMA 3K5OA 1XC9A 3NGYA 1WLJA 1R0AA 1RDBA 1UWBA 3UIQA 4OLBA 5FRNA 4O0IA 1RBUA 1ASWA 1SL1A 4N5SA 4OGCA 4WE1A 1U4BA 3KLEA 4KPYA 3QIOA 1TGOA 4LH5A 1ZYQA 1RNHA 3ALYA 1QQCA 3VQ8A 4O4GA 3RRGA 4KAZA 4N41A 2G8UA 4M3YA 3SCXA 1VRUA 3HL8A 3DLBA 2XY6A 1U45A 5KRSA 3TI0A 1FKPA 1WSGA 2KW4A 1L3VA 2XO7A 2Q3SA 1S1VA 1HYZA 3LANA 3RWUA 2B5JA 1D9DA 1TV6A 4H4MA 1U48A 4KB0A 1C1AA 3I8DA 4BDYA 3DYAA 3U3GA 1LAWA 2VWKA 1BIUA 2D0CA 1O1WA 3SZ2A 4AHVA 5KGXA 1RT6A 4FJXA 3O4NA 4CJTA 1NKEA 1Q8IA 4CHNA 1Z25A 1YTAA 1VSDA 1L5UA 4HUEA 4F2RA 1JLBA 4W5QA 3AVMA 1TAUA 3KD5E 4CJ4A 2D0AA 3HVRA 5DMRA 4L8RB 2RF2A 2XRIA 2E6MA 2KTQA 3PY8A 3AVLA 2Z1IA 4KHUA 3DRRA 4CEQA 4JRPA 2Y1IA 3HT3A 1IO2A 4RW7A 4B8AB 1NJZA 3MEDA 1WSHA 3KKSA 4BE1A 4LH4A 1YT3A 4ELVA 1WN7A 2HW3A 1BCOA 1LAVA 3RTVA 3SQ2A 3F73A 3NH0A 4M3UA 4FLYA 3AA5X 4K8XA 4EP5A 4KTZA 4BE0A 1KLNA 3QEPA 3TARA 4KI6A 2ZE2A 1QSLA 3S3OA 5C25A 2IAJA 3AVBA 3AVIA 4FLVA 4QCLA 3K58A 3OJSA 3K2PA 5HRPA 4FM2A 3V9XA 4DTJA 2GBZA 3OYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z26 A;  4FJL A;  4TSX A;  4CEO A;  4ZHR A;  4DSL A;  4DG1 A;  4E7K A;  3V9S A;  1BL3 A;  1GOB A;  1LWE A;  2GV9 A;  3TR8 A;  3DLH A;  3VQA A;  3TAN A;  1LWC A;  3KTQ A;  4CF0 A;  3AO1 A;  5FDL A;  3D45 A;  4IFV A;  4CHZ A;  4CF9 A;  4FJ5 A;  3KLF A;  1BIZ A;  5CYM A;  4IFY A;  4NCB A;  4Z4E A;  4B9S A;  1DLO A;  4B9M A;  1NK8 A;  4BWM A;  2ETJ A;  4CGG A;  4DU3 A;  4CEF A;  4Q0B A;  4F3O A;  2OPP A;  2D0B A;  1SKS A;  3VQP A;  2X6S A;  3LAL A;  5C42 A;  4CGH A;  3ITH A;  4I2Q A;  4CJK A;  1REV A;  1WAJ A;  3LPT A;  4DQP A;  4E7L A;  3DRS A;  3ZSO A;  3HJF A;  4H8K A;  3NGZ A;  3LAM A;  3P1G A;  1JLA A;  4KV8 A;  3SV3 A;  3U3Y A;  4CJW A;  4DS5 A;  1HNI A;  2HHU A;  1KFD A;  3KKR A;  3OYK A;  3ZT3 A;  3OYJ A;  1NKC A;  4FLX A;  3BGR A;  3LP1 A;  3KJV A;  2WON A;  1LW2 A;  1VSH A;  3CG7 A;  4IKF A;  3V6D A;  1C0U A;  5T7B A;  4NYN A;  3ZT1 A;  1SL2 A;  1TK0 A;  4O55 A;  3AO3 A;  4KI4 A;  4N56 A;  2PYL A;  3L3V A;  2BGG A;  1S1T A;  1S1U A;  4CEB A;  1HQE A;  5E41 A;  4F8R A;  4CK2 A;  1F21 A;  4AHT A;  3LWM A;  2DTU A;  1RBR A;  4OPK A;  3TAG A;  2KFN A;  3ZT0 A;  3C94 A;  3NGI A;  4CHY A;  2YNG A;  3G0Z A;  1ASU A;  1RTJ A;  1QHT A;  3KLH A;  2ATQ A;  2FBY A;  3ZSY A;  3QIN A;  4ID5 A;  4CED A;  5J2N A;  1XI1 A;  2HMI A;  2EHG A;  2Z1G A;  1L3T A;  1S6P A;  2IS3 A;  1IKV A;  3NHG A;  4CGD A;  1GOA A;  2F8T A;  3LP0 A;  5I42 A;  2HVI A;  3QNN A;  4YNQ A;  3M8S A;  4Q5V A;  1X9S A;  4OPJ A;  2RKI A;  1KVB A;  2PYJ A;  1D8Y A;  5D3G A;  1BHL A;  3DLE A;  4OGE A;  1A5X A;  5CY4 A;  3V1O A;  3ZSW A;  5KTQ A;  3SYZ A;  3NF8 A;  4Z4H A;  3DLK A;  1RT4 A;  3LZI A;  4DF4 A;  2FBT A;  2DY4 A;  4FLW A;  4DWI A;  4Z0U A;  2R7Y A;  1C1B A;  2HB5 A;  4PUO A;  1ASV A;  1QTM A;  1L3S A;  3HPG A;  1EET A;  3IG1 A;  1CLQ A;  3SUN A;  4ID1 A;  4B8C A;  3AVA A;  3IS9 A;  3C6U A;  3VQD A;  3HP6 A;  4EP4 A;  1KLM A;  1UA0 A;  3SQ1 A;  3SUQ A;  2VG7 A;  3T19 A;  3AVK A;  1HYS A;  4NCG A;  4DTO A;  3SQ4 A;  4O44 A;  4Z4C A;  3NFA A;  4FJK A;  4M3T A;  3VQE A;  5EU7 A;  4FLT A;  1LV5 A;  4E1M A;  1J9A A;  1BQN A;  3F9K A;  1NK9 A;  1MU2 A;  1RT2 A;  4CCH A;  1I3A A;  1HQU A;  3L2R A;  3P5J A;  3HP9 A;  3MEG A;  1IKY A;  3HXM A;  1JL1 A;  3KLG A;  3EY1 A;  2PY5 A;  4IG3 A;  4FLZ A;  4J2D A;  5JS1 A;  3CQ8 A;  2QKB A;  1T05 A;  2IC3 A;  1VSJ A;  2FBV A;  4DU1 A;  3P83 D;  2KFZ A;  3V81 A;  2G8W A;  1BI4 A;  5K14 A;  1SKR A;  3OYC A;  2KZZ A;  4AHS A;  4KHQ A;  1NK4 A;  4CF2 A;  2IOC A;  5HBM A;  4DQI A;  3QEW A;  4LD0 A;  4DQS A;  4I9Q A;  4PQU A;  4EZ9 A;  3K57 A;  4MFB A;  2Y1J A;  4CJF A;  4CEZ A;  2YHA A;  4ZTJ A;  4I7F A;  3ZT4 A;  1B92 A;  4AHR A;  3SNN A;  1TK5 A;  2IDO A;  4FVM A;  1ZBU A;  3K59 A;  1Y97 A;  3B6P A;  5J1E A;  2O4I A;  3SJJ A;  1RDC A;  3QER A;  3SUP A;  4I2P A;  4KTW A;  4FJN A;  3OS0 A;  3VQB A;  5I3U A;  4NYF A;  3WNF A;  3L8B A;  2HNZ A;  3AV9 A;  3PX6 A;  3TAP A;  2X6N A;  1RTH A;  4JLH A;  4CF8 A;  3OYA A;  3L2W A;  4J2E A;  3LP3 A;  4E19 A;  3NF7 A;  1G15 A;  4FK0 A;  1TK8 A;  4CHO A;  2XY8 A;  2BAN A;  1RTD A;  3AA2 A;  3S9H A;  4F3T A;  1HNV A;  1X1P A;  3I0S A;  3RRH A;  3T3F A;  2VG5 A;  1VK0 A;  1RT7 A;  3NCI A;  4B3O A;  2D5R A;  4QOZ B;  3HVT A;  1ZBH A;  1KTQ A;  1BI4 B;  3JYT A;  4CK3 A;  3PX0 A;  3ZSV A;  1U49 A;  3E01 A;  1RBV A;  3THV A;  4LY7 A;  3VQ7 A;  2DFE A;  2E6L A;  3KK3 A;  4M3X A;  4CFB A;  1NK6 A;  1JLF A;  3DLG A;  1D5A A;  4CF1 A;  1TL3 A;  4O5B A;  1Q9X A;  5J2Q A;  1UOC A;  3I0R A;  1WSE A;  3HO1 A;  4FW2 A;  1VSM A;  4FJG A;  1D9F A;  1RDD A;  1S6Q A;  3CM5 A;  1DTQ A;  3M8P A;  5KI6 A;  3AVG A;  3L2Q A;  4BE2 A;  4CIG A;  3SUO A;  3SPY A;  2HHS A;  3OYL A;  2HHQ A;  2YNI A;  2JGU A;  3OYD A;  1IH7 A;  3VA3 A;  4CIE A;  3LAK A;  4DTR A;  2Z1H A;  3RMA A;  1U47 A;  4C8O A;  4CJ5 A;  3CFP A;  4XIU A;  1WSJ A;  4N47 A;  1JLQ A;  5HRS A;  2X74 A;  2HHW A;  4E3S A;  3MXI A;  2LSN A;  3OYI A;  4DSE A;  3TAQ A;  3CFR A;  3TAF A;  2HND A;  1SL0 A;  4Z4G A;  5J2P A;  3NBP A;  3M8Q A;  4CJR A;  3WNG A;  3KD1 E;  1VSK A;  1YTU A;  3V9Z A;  3OVN A;  1ITG A;  4DMN A;  4DTU A;  1ZBF A;  1NKB A;  5HRR A;  4FLU A;  3OYM A;  1T03 A;  5KGW A;  1KVA A;  1W0H A;  3QO9 A;  4DQQ A;  1KFS A;  4M3W A;  3TAB A;  3K5M A;  1X9M A;  1J5O A;  2IGI A;  2O4G A;  4CJP A;  4KHW A;  2XHB A;  3RR8 A;  1C0M A;  1BCM A;  4IG0 A;  2RPI A;  3K5L A;  3LP2 A;  3DOL A;  1TL1 A;  4M42 A;  5CZ1 A;  3CYM A;  4M45 A;  4CFA A;  3AVC A;  3VN5 A;  3TWH A;  1TKX A;  2FC0 A;  1WAF A;  5J2M A;  3ULD A;  3RR7 A;  4FZZ A;  4ELU A;  3AO2 A;  1S1W A;  3VA0 A;  3CFO A;  2P5O A;  4FJ9 A;  1TKT A;  4Y1C A;  3U6F A;  5KRT A;  4FJJ A;  1IKW A;  2Z1J A;  3L2U A;  3DM2 A;  1S9G A;  2GUI A;  3AA4 A;  3HM9 A;  4KO0 A;  5C24 A;  4M41 A;  4CJE A;  3ZCM A;  1RCH A;  2VG6 A;  4KHS A;  3MEE A;  4CFC A;  4RW8 A;  2BDP A;  4Z4I A;  4J2A A;  4RW6 A;  3T1A A;  1C6V A;  2F8S A;  3SPZ A;  1VRT A;  3OJU A;  3KK1 A;  2E4L A;  3K5N A;  4DFK A;  3S3N A;  4W5R A;  2G8V A;  1A5V A;  3NF9 A;  4DF8 A;  3HPH A;  4E7J A;  1TAQ A;  1S5J A;  4CJS A;  4E89 A;  2QKK A;  4CHP A;  3IAY A;  2HHT A;  2EX3 A;  1FKO A;  1NOY A;  1QSS A;  4CJU A;  4R5P A;  3PV8 A;  4OVL A;  1SV5 A;  4GW6 A;  1TKD A;  2G8F A;  1BGX T;  1RT3 A;  4AHC A;  4CEA A;  2VWJ A;  1RIL A;  3AVJ A;  3MXJ A;  3QNO A;  3QEI A;  1X9W A;  1NJY A;  2OZS A;  4BWJ A;  4BAC A;  3NDK A;  3VQQ A;  1B9D A;  4OJR A;  3OYG A;  3AA3 A;  4ICL A;  4E0D A;  3NAE A;  4W5N A;  1YVU A;  2OPQ A;  1QSY A;  4E1N A;  1B9F A;  2HVH A;  1U04 A;  1L3U A;  4HCB A;  4IDK A;  4RW4 A;  4F4K A;  4OLA A;  1SUQ A;  2YKN A;  4IBN A;  2I5J A;  3O3F A;  3TAM A;  1KVC A;  4DSF A;  1JLG A;  4DTX A;  3A2F A;  4DS4 A;  4FW1 A;  1C0T A;  3VQC A;  2AJQ A;  2KQ2 A;  2OPR A;  4RW9 A;  3TAE A;  1RTI A;  2HHV A;  1TVR A;  4FXD A;  4DFP A;  4BDP A;  3MAQ A;  4K8Z A;  3DOK A;  1IG9 A;  3EZ5 A;  4DFM A;  2YNF A;  4KRF A;  4G1Q A;  1N6Q A;  2ITG A;  3IRX A;  3OS2 A;  2YV0 X;  4OKK A;  1HPZ A;  2DFF A;  3ZSR A;  3MXM A;  5FRO A;  4KHN A;  1VSE A;  4C8N A;  2FBX A;  3FFI A;  1UAX A;  4E7H A;  4DFJ A;  2RN2 A;  2WOM A;  3HYF A;  3VQ5 A;  1RBT A;  2ZQB A;  1EP4 A;  3ZSZ A;  1JXB A;  4OKJ A;  1LWF A;  3NH2 A;  3VQ4 A;  1TKZ A;  2HNY A;  3ASM A;  1C1C A;  3VQ9 A;  1JXE A;  4AH9 A;  3DRP A;  3V9U A;  2F96 A;  3O3G A;  1ZBL A;  3RMD A;  1NK7 A;  4N76 A;  4HVJ A;  3OY9 A;  1ZBI A;  1S1X A;  4FK4 A;  3M8R A;  4DU4 A;  1JL2 A;  1IKX A;  4GVM A;  3OS1 A;  5HRO A;  3AO4 A;  1SKW A;  3DLR A;  2G8H A;  2G8K A;  3KK2 A;  1DTT A;  2ZD1 A;  3PUF A;  3OYE A;  4FCY A;  2A1R A;  1NK5 A;  4W5O A;  3OYF A;  1J54 A;  2OYQ A;  4JS4 A;  4B9U A;  1CXU A;  4KFB A;  4FJM A;  3PO4 A;  4CJL A;  3C95 A;  3DMJ A;  4CEE A;  3AVN A;  5CYQ A;  5FRM A;  4O0J A;  4CEC A;  4FZX C;  5CZ2 A;  3V1Q A;  3RMB A;  3NF6 A;  4JS5 A;  4Y1D A;  1UA1 A;  3SV4 A;  4DTP A;  5SZT A;  3JSM A;  3RMC A;  4FZY A;  3G10 A;  3AO5 A;  1FXX A;  1RT5 A;  4CK1 A;  4CER A;  4M3Z A;  2OPS A;  1HJR A;  1EXQ A;  3HST B;  4HHT A;  2DFH A;  4B08 A;  4AIL C;  4F2S A;  4DSK A;  2YNH A;  3O4Q A;  4OKE A;  3LDS A;  2QK9 A;  1XHZ A;  3PO5 A;  4ZTF A;  1XWL A;  3ZSQ A;  3PX4 A;  1JKH A;  3NH1 A;  3D0P A;  4JRQ A;  3KIO A;  4FJH A;  3VQ6 A;  3QIP A;  4CGF A;  1XHX A;  2B4J A;  4FM0 A;  4UQG A;  1NJX A;  1GOC A;  3QET A;  3BDP A;  4KTQ A;  3OYH A;  4CE9 A;  1HMV A;  4HCC A;  4CHQ A;  2G8I A;  1HYV A;  5HRN A;  2PZS A;  1WSF A;  1JLE A;  1RDA A;  4C8K A;  1KSP A;  3QEV A;  1CZB A;  3L2V A;  1NK0 A;  1VSI A;  4CFD A;  3HPO A;  1QE1 A;  1CZ9 A;  1FK9 A;  2X78 A;  4C8M A;  4ELT A;  2JLE A;  3EYZ A;  2QXF A;  1S9E A;  3NE6 A;  3SQ0 A;  1CXQ A;  1QS4 A;  1EKE A;  2W42 A;  2XY5 A;  4M3R A;  3H08 A;  1K6Y A;  4CIF A;  3OYN A;  1VSF A;  5SWM A;  4W5T A;  3V1R A;  4DQR A;  3AVH A;  2P51 A;  4DLE A;  1A5W A;  3S3M A;  1VSL A;  5JS2 A;  4KRE A;  3LZJ A;  4CES A;  4DLG A;  2HHX A;  1N5Y A;  4BDZ A;  1RT1 A;  4NCA A;  4CJV A;  4MQ3 A;  4YFU A;  3HK2 A;  3ZT2 A;  3QES A;  1KCF A;  4CJ3 A;  1T8E A;  4RG8 A;  1KRP A;  4FJ8 A;  1EX4 A;  3AVF A;  4GMJ B;  4I9L A;  4FM1 A;  4B9L A;  1BIS A;  2OZM A;  4KHY A;  4PA1 A;  4KB1 A;  4CGJ A;  4FK2 A;  1T7P A;  4DSJ A;  1WNS A;  4FJI A;  4LSL A;  4HTU A;  4J2B A;  4B9N A;  2P5G A;  3O3H A;  3MEC A;  1I39 A;  4DSI A;  4DTS A;  5HLF A;  2YHB A;  3V4I A;  4PY5 A;  4DTN A;  4PWD A;  3DI6 A;  4H4O A;  3SI6 A;  3C6T A;  4QAG A;  1NJW A;  4FYD A;  3CM6 A;  1WSI A;  3QEX A;  4EZ6 A;  4E7I A;  2BE2 A;  3LPU A;  3LWL A;  4HUG A;  4DTM A;  1RBS A;  1Q9Y A;  2A1S A;  3KLI A;  3WNH A;  4AHU A;  4HUF A;  4Z4F A;  4B9T A;  4KKO A;  3V9W A;  2XY7 A;  2NUB A;  2OA8 A;  1HRH A;  2YKM A;  3B6O A;  2P1J A;  1NOZ A;  4LSN A;  4FJ7 A;  4CJQ A;  4B9V A;  2KZM A;  3L3U A;  3WNE A;  4CGI A;  5HP1 A;  1LW0 A;  4C8L A;  1J53 A;  1JLC A;  2B6A A;  3ZSX A;  3ISN C;  3QLH A;  1W9H A;  5DK5 A;  1BQM A;  3K5O A;  1XC9 A;  3NGY A;  1WLJ A;  1R0A A;  1RDB A;  1UWB A;  3UIQ A;  4OLB A;  5FRN A;  4O0I A;  1RBU A;  1ASW A;  1SL1 A;  4N5S A;  4OGC A;  4WE1 A;  1U4B A;  3KLE A;  4KPY A;  3QIO A;  1TGO A;  4LH5 A;  1ZYQ A;  1RNH A;  3ALY A;  1QQC A;  3VQ8 A;  4O4G A;  3RRG A;  4KAZ A;  4N41 A;  2G8U A;  4M3Y A;  3SCX A;  1VRU A;  3HL8 A;  3DLB A;  2XY6 A;  1U45 A;  5KRS A;  3TI0 A;  1FKP A;  1WSG A;  2KW4 A;  1L3V A;  2XO7 A;  2Q3S A;  1S1V A;  1HYZ A;  3LAN A;  3RWU A;  2B5J A;  1D9D A;  1TV6 A;  4H4M A;  1U48 A;  4KB0 A;  1C1A A;  3I8D A;  4BDY A;  3DYA A;  3U3G A;  1LAW A;  2VWK A;  1BIU A;  2D0C A;  1O1W A;  3SZ2 A;  4AHV A;  5KGX A;  1RT6 A;  4FJX A;  3O4N A;  4CJT A;  1NKE A;  1Q8I A;  4CHN A;  1Z25 A;  1YTA A;  1VSD A;  1L5U A;  4HUE A;  4F2R A;  1JLB A;  4W5Q A;  3AVM A;  1TAU A;  3KD5 E;  4CJ4 A;  2D0A A;  3HVR A;  5DMR A;  4L8R B;  2RF2 A;  2XRI A;  2E6M A;  2KTQ A;  3PY8 A;  3AVL A;  2Z1I A;  4KHU A;  3DRR A;  4CEQ A;  4JRP A;  2Y1I A;  3HT3 A;  1IO2 A;  4RW7 A;  4B8A B;  1NJZ A;  3MED A;  1WSH A;  3KKS A;  4BE1 A;  4LH4 A;  1YT3 A;  4ELV A;  1WN7 A;  2HW3 A;  1BCO A;  1LAV A;  3RTV A;  3SQ2 A;  3F73 A;  3NH0 A;  4M3U A;  4FLY A;  3AA5 X;  4K8X A;  4EP5 A;  4KTZ A;  4BE0 A;  1KLN A;  3QEP A;  3TAR A;  4KI6 A;  2ZE2 A;  1QSL A;  3S3O A;  5C25 A;  2IAJ A;  3AVB A;  3AVI A;  4FLV A;  4QCL A;  3K58 A;  3OJS A;  3K2P A;  5HRP A;  4FM2 A;  3V9X A;  4DTJ A;  2GBZ A;  3OYB A; 
#chains in the Genus database with same CATH topology
 3L4Q A;  2O8E A;  1YJ9 N;  4ZHR A;  2WTU A;  4BQL A;  4WCE L;  5FDL A;  4CF9 A;  4FJ5 A;  2D0O A;  1BU6 O;  2ZM6 K;  4NCB A;  1NK8 A;  4BWM A;  2ETJ A;  5AQI A;  3RSE B;  4F3O A;  2D0B A;  1SKS A;  3TSP A;  3LAL A;  3LPT A;  4DQP A;  4BRA A;  4WFA L;  3ZSO A;  3VEY A;  3NGZ A;  4KV8 A;  1HNI A;  2P9K A;  2HHU A;  3KKR A;  3ZT3 A;  2KHO A;  2F9W A;  4FLX A;  1U2V A;  5LMN K;  4IKF A;  1C0U A;  4NYN A;  1C0G A;  4O55 A;  4KI4 A;  2PYL A;  4H0Y B;  1S1U A;  1WUA A;  3SK3 A;  1XUP O;  3THX A;  3TAG A;  2KFN A;  3ZT0 A;  5KQD A;  2YNG A;  3GG4 A;  3KWG A;  2AP1 A;  3R9P A;  1S6P A;  2IS3 A;  5LJW A;  3NHG A;  4CGD A;  1Q86 O;  2HVI A;  5EX5 A;  3M8S A;  4Q5V A;  5JVH L;  1X9S A;  2RKI A;  2HBL A;  3ZSW A;  3SYZ A;  3NF8 A;  3LZI A;  2DY4 A;  3AGR A;  4BRI A;  4DWI A;  1IG8 A;  5AQU A;  2R7Y A;  1C1B A;  3BZK A;  3EL2 A;  4EP4 A;  1YIJ N;  3VTH A;  2OAN A;  4DTO A;  3SQ4 A;  4K42 A;  2YCH A;  4EHT A;  4FJK A;  4CCH A;  1HQU A;  2YHY A;  4CD1 A;  4BGA A;  1WBD A;  3EY1 A;  4JI4 K;  2Q97 A;  3VGK A;  1D4X A;  4YDU C;  2D1K A;  2HST A;  1VSJ A;  2FBV A;  1GLA G;  2KFZ A;  3Q7B A;  2G8W A;  1Z05 A;  1SKR A;  3ENH A;  4AHS A;  4DQI A;  4LD0 A;  3NMU A;  3C7N B;  1HR0 K;  4I7F A;  1CZA N;  3ZT4 A;  4OX9 K;  1B92 A;  1Z6R A;  4H03 B;  1IJJ A;  3VER A;  1Y97 A;  3SJJ A;  3QER A;  3SUP A;  4I2P A;  4KTW A;  2VGM A;  3OS0 A;  3VQB A;  1N33 K;  3PX6 A;  3TAP A;  4JLH A;  5M1Q A;  3L2W A;  4IJA A;  1J6Z A;  4YHH K;  1IBL K;  4FWM A;  1TK8 A;  2ZWH A;  2XY8 A;  3VPZ A;  2O8B A;  1HNV A;  5AQR A;  1P90 A;  3LDL A;  1ZBH A;  1BI4 B;  3R8E A;  2J4R A;  3THV A;  3PLA A;  2O8C A;  2E6L A;  3M8P A;  3CCV N;  3AVG A;  4BE2 A;  4BC2 A;  2HHS A;  2HHQ A;  2P9S B;  2JGU A;  1BA0 A;  3WQT A;  1XNQ K;  2RE2 A;  2P9P A;  5AQS A;  3CFP A;  1WSJ A;  4JKG B;  1XMO K;  2LSN A;  4Z4G A;  4CJR A;  1YTU A;  4DMN A;  2QWR A;  4DTU A;  1T03 A;  3OW2 M;  1KFS A;  3M5R A;  3K5M A;  1J5O A;  2O4G A;  5B8H A;  3THW B;  3IUC A;  1BDG A;  5JIC A;  1V4T A;  3CC4 N;  3AVC A;  2FC0 A;  1T6D A;  3MWT A;  1OKJ A;  1S1W A;  3VA0 A;  4H5V A;  5KRT A;  1IKW A;  3FGU A;  5C24 A;  1RCH A;  5M1F A;  4KHS A;  3EKU A;  3FR0 A;  4RW8 A;  3CC7 N;  4WQ4 C;  3DLL L;  3QIC A;  1C6V A;  3VMF B;  4X64 K;  2F8S A;  2VWB A;  3KK1 A;  4DFK A;  3S3N A;  4W5R A;  2G8V A;  3NF9 A;  5E84 A;  4Z94 A;  4E7J A;  4E89 A;  1FKO A;  1NOY A;  1QSS A;  4R5P A;  3PV8 A;  1SV5 A;  1BGX T;  1HUX A;  3K9K A;  3AVJ A;  3QEI A;  1TUU A;  4A62 A;  3ZX0 A;  2OZS A;  4BWJ A;  1GLC G;  3LDP A;  4OJR A;  5AQV A;  3LL3 A;  3C65 A;  4E1N A;  2FSJ A;  1WBB A;  3BF3 A;  2YKN A;  4IEI A;  1XNR K;  4DSF A;  4DTX A;  4FW1 A;  3VQC A;  2AJQ A;  2KQ2 A;  3ATV A;  3I56 N;  4DFP A;  4BDP A;  3DOK A;  3KVG A;  4FWR A;  3EZ5 A;  2A3Z A;  4U67 L;  4KRF A;  3IRX A;  2DFF A;  4QS8 A;  3WEE B;  3KZB A;  3KHY A;  1VSE A;  4JKA A;  2Q31 A;  3NVK A;  4QS7 A;  4DFJ A;  1VQP N;  2ZQB A;  4ISF A;  3CCS N;  4C23 A;  4OO1 J;  1LWF A;  3MN7 A;  3NH2 A;  2I7N A;  2HNY A;  1C1C A;  3MN9 A;  5EVZ A;  1NK7 A;  3RMD A;  2ASO A;  4HVJ A;  3G6E N;  4DU4 A;  5HRO A;  3KK2 A;  4FWP A;  1VQO N;  3PUF A;  4MO4 A;  3VES A;  4OPH A;  4BRE A;  1CXU A;  4B9U A;  1JCG A;  3C0B A;  3CME N;  1BA1 A;  3PO4 A;  4CEE A;  5AZI A;  2O8F A;  3CCJ N;  2UUB K;  1V4S A;  4FZX C;  1UA1 A;  3RMB A;  3SV4 A;  3HOT A;  4LF5 K;  3P4I A;  3AO5 A;  1EWR A;  3T69 A;  1EXQ A;  4KH6 A;  4AIL C;  2ZGY A;  3LDS A;  2QK9 A;  2V7Z A;  4ZTF A;  3NH1 A;  4JRQ A;  1XHX A;  4CZL A;  1ATS A;  5H1S Q;  3BDP A;  3OYH A;  4CE9 A;  2G8I A;  1HYV A;  5HRN A;  3P38 A;  4OPA A;  3L2V A;  4BRF A;  4RTF D;  4H5T A;  4BGB A;  4M63 C;  4M3R A;  3FZM A;  3OYN A;  5LY3 A;  4W5T A;  3V1R A;  4XH1 A;  3AVH A;  3WT0 A;  1VSL A;  3EEQ A;  1N5Y A;  1DGK N;  1P8Z A;  5JLF A;  4MQ3 A;  1K8K B;  1KCF A;  5C0Y A;  1EX4 A;  4B9L A;  2FLO A;  2OZM A;  4KB1 A;  4CGJ A;  4DSJ A;  4FJI A;  3O1W A;  4F9O A;  3BY5 A;  2P5G A;  3MEC A;  3DJC A;  2GX9 A;  3N4Q A;  5KPT A;  3DI6 A;  3C6T A;  5ELZ A;  4EZ6 A;  3LPU A;  3G71 N;  1RBS A;  4HUF A;  4JYA K;  2RHK A;  3ZEU B;  4CJQ A;  4CGI A;  4CD3 A;  3CC2 N;  3ISN C;  3QLH A;  1TYQ A;  3R6M A;  4JKE A;  1R0A A;  3ENO A;  4E1J A;  4KBO A;  4O0I A;  3MN6 A;  1SL1 A;  3A5N C;  4N5S A;  4WE1 A;  3T7Z A;  1U4B A;  1VQN N;  2W6K A;  1QQC A;  3E9O A;  3VQ8 A;  4KAZ A;  1VRU A;  3ZET B;  1QZ6 A;  3DXM B;  2VCP A;  2Q3S A;  1HYZ A;  4IJN A;  3RWU A;  2B5J A;  3GBT A;  1TV6 A;  4KB0 A;  1XMQ K;  1C1A A;  2WC9 A;  5AQW A;  3B8A X;  3SZ2 A;  4AHV A;  5KGX A;  1NKE A;  3CCQ N;  1YTA A;  2CGJ A;  4JI8 K;  1JLB A;  3AVM A;  4JKH A;  2D0A A;  3QFU A;  2HBJ A;  1ZC6 A;  3PY8 A;  2Z1I A;  1JCF A;  4RW7 A;  3MED A;  3KKS A;  4DV6 K;  4ELV A;  3EE9 A;  3RTV A;  3SQ2 A;  3HSC A;  4FLY A;  4EFH A;  4KI6 A;  3OA9 A;  3F9M A;  5HRP A;  1QQN A;  3V9X A;  4DG1 A;  3V9S A;  2GV9 A;  1LWE A;  3VQA A;  3D45 A;  4IFV A;  2V7Y A;  5CYM A;  3VTI A;  4IFY A;  3ZX3 A;  4IO8 A;  1DLO A;  4JD2 A;  4DU3 A;  3F2K A;  5M1P A;  3VQP A;  4BQZ A;  4GY2 B;  4B1V A;  4CGH A;  4X62 K;  4I2Q A;  4A2A A;  1M1K O;  4H8K A;  1X3M A;  5AQJ A;  4H0O A;  3SV3 A;  3U3Y A;  4EHU A;  2JWL A;  4MDA A;  5AQY A;  2VYP A;  1QQO A;  2QWL A;  3BGR A;  3KJV A;  1VSH A;  2O8E B;  5T7B A;  3ZT1 A;  3AO3 A;  4N56 A;  3L3V A;  2YJE A;  5E41 A;  4NO7 A;  4YDU A;  4BRQ A;  4F8R A;  1F21 A;  4AHT A;  3O6W A;  5KPR A;  4OPK A;  3NGI A;  3E9P A;  4CHY A;  5BR8 K;  3G0Z A;  3MDQ A;  2ATQ A;  3QIN A;  4ID5 A;  2HMI A;  1XI1 A;  2Z1G A;  5IWA K;  4JK9 A;  2F8T A;  3LP0 A;  3QNN A;  3IKM A;  4OPJ A;  1KVB A;  5D3G A;  2P9K B;  5KTQ A;  4EAH D;  4Z4H A;  3DLK A;  1RT4 A;  5FLX O;  1U2V B;  4FLW A;  5JVG L;  4PUO A;  4DV5 K;  1CLQ A;  3LM2 A;  3AVA A;  3IS9 A;  3C6U A;  3CF5 L;  2BUP A;  5AQK A;  3VQD A;  3HP6 A;  1KLM A;  2VG7 A;  4L3Q A;  3O4W A;  4NCG A;  3CJC A;  4O44 A;  4Z4C A;  4IEE A;  4M3T A;  2F4V K;  1BQN A;  1RT2 A;  3FE1 A;  4WQ5 A;  3MEG A;  4J2D A;  2VQE K;  3TU5 A;  3BZC A;  4FLZ A;  1ZXO A;  2QKB A;  1QHA A;  3H3O B;  3ID8 A;  2E2N A;  4AQY K;  1U6Z A;  3V81 A;  3MWP A;  1RFQ A;  5EXW A;  5K14 A;  1QVF M;  2KZZ A;  1OVQ A;  4KHQ A;  4CF2 A;  4HWI A;  4EZ9 A;  2QWQ A;  3LDO A;  1I94 K;  5JLH A;  4CJF A;  3JXU A;  4ZTJ A;  3VF2 A;  1T3V A;  2IDO A;  1W7A A;  3T1H K;  1ZBU A;  5J1E A;  1NGD A;  5BPM A;  3J8A A;  3L8B A;  2X6N A;  1RTH A;  3WXK A;  4CHO A;  1RGI A;  2EWS A;  3S9H A;  3I0S A;  4K41 A;  2VG5 A;  1VK0 A;  4CZI A;  3CCR N;  4QOZ B;  2D5R A;  1KTQ A;  3JYT A;  3DXK A;  3E01 A;  1RBV A;  4NB4 A;  3CCM N;  1NGF A;  1NK6 A;  1JLF A;  3O9T A;  3DLG A;  4CF1 A;  1NGC A;  4JKD A;  1TL3 A;  5J2Q A;  4JHD B;  2W40 A;  4A5A A;  3HO1 A;  5AFU H;  4WQ4 A;  3TTF A;  1D9F A;  1S6Q A;  5KI6 A;  1BWF O;  4CIG A;  3HRG A;  5M1K A;  3SPY A;  2P9L A;  3OYD A;  1IH7 A;  3LAK A;  4C8O A;  5AQP A;  4CJ5 A;  4UY8 O;  3O9S A;  3BP8 A;  5HRS A;  1JLQ A;  3MX2 A;  2X74 A;  4E3S A;  3MXI A;  4DSE A;  3TSQ A;  2HND A;  3M8Q A;  5EOY A;  1TUY A;  1VSK A;  2O8C B;  3M1F A;  4DQ8 A;  3ZYY X;  5AQQ A;  4CJ7 A;  5C10 A;  1ZBF A;  1NKB A;  5HRR A;  2GUP A;  3EZW A;  3OYM A;  4JI7 K;  5KGW A;  1KVA A;  1W0H A;  2D4W A;  5BR9 A;  2NRW A;  2IGI A;  4DV2 K;  2XHB A;  1VQ9 N;  3RR8 A;  2P9N A;  4IG0 A;  2RPI A;  3K5L A;  3LP2 A;  3DOL A;  3HI0 A;  1BUP A;  5IT9 O;  5DM6 L;  4H0P A;  1DKG D;  4CFA A;  1TKX A;  4JK8 A;  3H45 C;  1WB9 A;  5FPE A;  4ELU A;  1WOQ A;  2Q36 A;  3CFO A;  2P5O A;  4Y1C A;  4BRL A;  4FJJ A;  1GLJ O;  3MN5 A;  4CZG A;  2A6A A;  2GUI A;  3HM9 A;  4M41 A;  1NGA A;  3ZCM A;  3D2F A;  5FPD A;  1SAZ A;  4Z4I A;  4J2A A;  1W2B M;  3OTO K;  4JI0 K;  1VRT A;  4BY9 C;  3K5N A;  1NGI A;  3SMP A;  4GKK K;  2QKK A;  3P31 A;  3O1B A;  3IAY A;  3Q7C A;  2EX3 A;  4IOX A;  5GAE P;  4OVL A;  1TKD A;  4AHC A;  4B3T K;  1X9W A;  4JK7 A;  1NJY A;  4BAC A;  3NDK A;  1B9D A;  3OYG A;  4ILJ A;  3AA3 A;  4ICL A;  2YJF A;  3MMV A;  1U04 A;  4HCB A;  4IDK A;  4OLA A;  1SUQ A;  2I5J A;  3O3F A;  3TAM A;  4H5N A;  4FPB A;  1C0T A;  4RW9 A;  3TAE A;  1TVR A;  4LFC K;  4FXD A;  3O9Q A;  5AQZ A;  4G1Q A;  1BG3 A;  4GVE A;  1HPZ A;  3FLC O;  5FRO A;  1NGB A;  1UAX A;  4E7H A;  4ILG B;  4BR0 A;  2WOM A;  3VQ5 A;  3JS6 A;  2FXU A;  3CXC M;  1EP4 A;  3ZSZ A;  3GDQ A;  4OKJ A;  3VQ4 A;  1TKZ A;  4AH9 A;  3ASM A;  3VQ9 A;  1JXE A;  3DRP A;  3J81 O;  3K9J A;  3OY9 A;  2F7T A;  4FK4 A;  3M8R A;  1GLE G;  3AO4 A;  1SKW A;  3CHW A;  2G8H A;  1E4G T;  3OYE A;  4LFB K;  3MCP A;  4W5O A;  4JS4 A;  4DV1 K;  4KFB A;  4FJM A;  4CJL A;  1ATN A;  2E88 A;  3AVN A;  5CYQ A;  4DV7 K;  4CEC A;  2VGN A;  5CZ2 A;  3VEV A;  1H1V A;  4Y1D A;  3JSM A;  4DR5 K;  1FXX A;  4CK1 A;  4M3Z A;  2OPS A;  4DSK A;  3O4Q A;  4YOX A;  3PO5 A;  4B1X B;  3VF4 A;  3J7Y P;  1JKH A;  2P9I B;  2GEM A;  3D0P A;  4DUY K;  3VQ6 A;  3QIP A;  4KTQ A;  4UQG A;  1KC8 O;  1KXP A;  4HCC A;  4A61 A;  4CZH A;  1JLE A;  3D6R A;  1KSP A;  1VHX A;  3HPO A;  2YHX A;  1FK9 A;  3OHR A;  2O8F B;  1HX1 A;  2QXF A;  1S9E A;  5AZJ A;  1QS4 A;  2UUA K;  1EKE A;  2XY5 A;  5AQO A;  4IDH A;  4CIF A;  5SWM A;  1YVN A;  2P51 A;  4IOC L;  3S3M A;  2ASM A;  3LZJ A;  1S3X A;  2WBN A;  2YHW A;  4B1Z A;  3HK2 A;  3ZT2 A;  3O80 A;  3QES A;  1YUW A;  1T8E A;  4RG8 A;  3GE1 A;  4FM1 A;  4KHY A;  5LMU K;  4FK2 A;  3CPW M;  4I6M B;  1WNS A;  1HNX K;  4J2B A;  4B9N A;  4B3S K;  4BG9 A;  4PWD A;  4DTN A;  1KAY A;  1Q9Y A;  4DTM A;  4PL8 A;  4B9T A;  4KKO A;  2YKM A;  1NOZ A;  3H6E A;  2HBM A;  4IXC A;  4B9V A;  3E66 A;  5HL7 L;  1GLL O;  1LW0 A;  2Q0R A;  2B6A A;  3K5O A;  4JAX A;  3NGY A;  2OCE A;  1RDB A;  4OLB A;  1ATR A;  1RBU A;  3G25 A;  4KPY A;  1BOT O;  1TGO A;  4HTL A;  4O4G A;  4N41 A;  2G8U A;  4M3Y A;  3SCX A;  1IBK K;  1EQY A;  1QQM A;  2HOE A;  3TI0 A;  1S1V A;  5LJV A;  4GV6 A;  3D2E A;  3I8D A;  4BDY A;  1HJO A;  2VWK A;  4JKB A;  3WXI A;  2NRZ A;  3QBW A;  4FJX A;  3O4N A;  1Q8I A;  1TYQ B;  1N34 K;  3TTD A;  4NLC A;  1VSD A;  1TAU A;  4BVP A;  1Q82 O;  4CJ4 A;  5AQH A;  2RF2 A;  2E6M A;  1QVG M;  3DRR A;  4B8A B;  4FOE A;  1NJZ A;  4BE1 A;  3SJH A;  3DAW A;  2HW3 A;  1BCO A;  1MDU B;  1LAV A;  3LDN A;  4BRP A;  4BC3 A;  4BE0 A;  1YJW N;  2ZGZ A;  3TAR A;  2ZE2 A;  1QSL A;  3S3O A;  3A5O C;  3AVB A;  3AVI A;  3ULE B;  4FLV A;  3K58 A;  3VEW A;  4FK0 A;  4K0K K;  3OYB A;  3KK7 A;  4TSX A;  1GLF O;  4CEO A;  4H0V B;  3VGL A;  4E7K A;  1BL3 A;  4DSL A;  3QML A;  4K25 A;  3KTQ A;  3FZK A;  4CF0 A;  4CHZ A;  4Z4E A;  2NRX A;  4CEF A;  2WFB A;  4Q0B A;  4JKF A;  2OPP A;  4DR3 K;  2X6S A;  2E2O A;  2A42 A;  1XQS C;  3ITH A;  1WAJ A;  3AY9 A;  4E7L A;  3HJF A;  3JAM O;  2O8D B;  3LAM A;  3VEZ A;  4U7B A;  4CJW A;  3S41 A;  3PIP L;  3OYK A;  3OYJ A;  2QWO A;  2E2P A;  3LP1 A;  2WON A;  1LW2 A;  5BRD A;  3V6D A;  2IIR A;  4NXM K;  2BGG A;  3A8Y A;  3W3D A;  4CEB A;  1HQE A;  3ENB A;  3TTC A;  2HBK A;  2DTU A;  3CPE A;  5C2D A;  2NZT A;  3C94 A;  4FOI A;  1RTJ A;  3R1X A;  3KLH A;  2FBY A;  3ZSY A;  5AFU A;  4NXN K;  1HNW K;  2EHG A;  1IKV A;  4DR1 K;  5CHI A;  3L0Q A;  5I42 A;  3H1Q A;  3EN9 A;  4OGE A;  3DLE A;  1EWQ A;  3V1O A;  3WXJ A;  4DF4 A;  3FZL A;  2FBT A;  3SBT A;  2HB5 A;  1QTM A;  4PKG A;  5BN9 A;  3IG1 A;  3BF1 A;  4B8C A;  1LCU A;  4BRC A;  4BR5 A;  5AQF A;  2GTD A;  1UA0 A;  1NLV A;  3AVK A;  3CJB A;  1HYS A;  5CR4 A;  2V52 B;  3VQE A;  3SAG A;  5BRH A;  4FLT A;  1LV5 A;  3F9K A;  1NK9 A;  1MU2 A;  4FWS A;  3ZX2 A;  1I3A A;  3CD6 N;  3CQX A;  3CQY A;  3HP9 A;  3P5J A;  3HXM A;  3THY A;  3VF6 A;  2PY5 A;  4O5F A;  5JS1 A;  1T05 A;  4KHP K;  2E20 A;  3I55 N;  1YXQ A;  3CCE N;  4IWV A;  3U8X A;  3N4P A;  4DUZ K;  2ZJQ L;  2Q2R A;  2F9T A;  3WXL A;  3IDH A;  3QEW A;  4MLH A;  4I9Q A;  4PQU A;  4MFB A;  2NRV A;  4LF6 K;  5AQN A;  1KAX A;  2YHA A;  3O8M A;  4AHR A;  4GV9 A;  4CBX A;  3K59 A;  1JJ2 M;  1RDC A;  4WFN L;  4FJN A;  3WNF A;  3AV9 A;  5C2F A;  1NWK A;  3OYA A;  3KWI A;  4J2E A;  3NF7 A;  1G15 A;  3OBY A;  4FWL A;  2BAN A;  1RTD A;  3AA2 A;  4JEP A;  3RRH A;  1OH5 A;  2QWM A;  3NCI A;  3HVT A;  1NJI O;  4CK3 A;  3PX0 A;  3ZSV A;  1HKB A;  4BC4 A;  3CCL N;  1DEJ A;  3KK3 A;  4M3X A;  3R3L A;  1D5A A;  1Q9X A;  4FPA A;  3CJ1 A;  2PAV A;  4FW2 A;  1VSM A;  4FJG A;  1RDD A;  3CM5 A;  4ISE A;  3WQU A;  3L2Q A;  2IVN A;  3SUO A;  2BH1 A;  2YNI A;  4CIE A;  1U47 A;  2Z1H A;  3MK6 A;  2QEX N;  4XIU A;  3M3Z A;  4BC5 A;  3TAQ A;  2YI1 A;  3TAF A;  1SL0 A;  3DXK B;  5J2P A;  1HKG A;  2QA4 N;  4H5W A;  3KD1 E;  4KH4 A;  3V9Z A;  1N8R O;  3OVN A;  4O8K A;  4FWQ A;  4FWN A;  3QO9 A;  4DQQ A;  3TAB A;  4YOW A;  2QTD A;  3CIP A;  3QDK A;  1X9M A;  4CJP A;  4H5R A;  5GIN A;  1BCM A;  2GEL A;  3ZEU A;  4M42 A;  3VET A;  3D7E O;  4MDB A;  1HLU A;  2P9L B;  3CYM A;  3TWH A;  3VN5 A;  1WAF A;  5J2M A;  3ULD A;  2UXD K;  4FZZ A;  4DR7 K;  3EE8 A;  4FJ9 A;  1TKT A;  3U6F A;  4GV3 A;  2Z1J A;  3L4I A;  3DM2 A;  5E26 A;  3AA4 A;  4JKC A;  5FPN A;  4PKI A;  2VG6 A;  5F1X A;  3MEE A;  4CFC A;  2BDP A;  3THX B;  4JNE A;  1NGH A;  3DXM A;  4RW6 A;  3SPZ A;  3OJU A;  4LFA K;  2P9N B;  3CCU N;  3HPH A;  4CJS A;  4CHP A;  2IVO A;  3U9Z A;  4NLB A;  5EY4 A;  4DR4 K;  1RT3 A;  3FZH A;  4BR9 A;  3QNO A;  2HF4 A;  4YOV A;  3VEN A;  3VQQ A;  3NAE A;  1YVU A;  2HVH A;  3A0I X;  1B9F A;  4CBU A;  4RW4 A;  4IBN A;  2CH6 A;  4M7X A;  3GL1 A;  1JLG A;  3TPQ A;  3A2F A;  4DS4 A;  4BR4 A;  4XEI A;  2OPR A;  2YX6 A;  2HHV A;  4JI1 K;  3MAQ A;  4K8Z A;  2H3G X;  4DFM A;  3UKU A;  2UUC K;  5BRE A;  4PKH A;  2ITG A;  2E8A A;  2YV0 X;  1MWM A;  3ZSR A;  2FBX A;  1NNE A;  2RN2 A;  4IFE A;  3HYF A;  1RBT A;  2OTJ N;  1JXB A;  2Q1N A;  1QZ5 A;  2F96 A;  3O3G A;  4N76 A;  1IKX A;  2V51 B;  3NVM A;  3M6G A;  1VQ7 N;  2G8K A;  4DCH A;  4FO0 A;  3OYF A;  4CZK A;  4IZ9 A;  3DMJ A;  4O0J A;  3V1Q A;  5AQL A;  4MO5 A;  4DTP A;  4YY3 K;  1NG9 A;  1VAZ A;  1SZ2 A;  4CER A;  3HST B;  4QS9 A;  3HM8 A;  4HHT A;  2DFH A;  4B08 A;  2QWP A;  4OKE A;  4FWO A;  2O8B B;  1XWL A;  3PX4 A;  1MWK A;  3E1Y A;  2ZF5 O;  3KIO A;  2ITM A;  4LF7 K;  4FM0 A;  1NJX A;  2B4J A;  4BVO A;  4R79 A;  4B1U B;  4B3R K;  3C6H A;  4DKW A;  1R59 O;  1YI2 N;  3G4S N;  1WSF A;  1HKC A;  1CZB A;  3CJ9 A;  3QEV A;  1VSI A;  1NK0 A;  4CFD A;  1CZ9 A;  1XC3 A;  1Q7Y O;  4ELT A;  2JLE A;  3NE6 A;  2FSN A;  3SQ0 A;  1CXQ A;  2W42 A;  1OH8 A;  1ILY A;  1VSF A;  2W41 A;  4CBW A;  4DQR A;  1A5W A;  4M7Y A;  4AM6 A;  1NMD A;  5JS2 A;  4CES A;  4BG8 A;  4NCA A;  4CJV A;  4YFU A;  2P9P B;  4CJ3 A;  1DT9 A;  4JI3 K;  2GWK A;  4BRK A;  4BR7 A;  4GNI A;  1T7P A;  4B3M K;  3DWL A;  4LSL A;  3FZF A;  3HOS A;  3I33 A;  3O3H A;  4X66 K;  1I39 A;  3UKR A;  4DTS A;  5HLF A;  2YHB A;  3V4I A;  1NJW A;  4H4O A;  3SI6 A;  4KH5 A;  1Q81 O;  4FYD A;  5TKY A;  3QEX A;  5AZJ B;  1O13 A;  4E7I A;  5LL6 Z;  3LWL A;  2PFU A;  2A1S A;  3AAP A;  3VGM A;  4Z4F A;  4A2B A;  3V9W A;  2NUB A;  2OA8 A;  1HRH A;  3B6O A;  4FJ7 A;  3L3U A;  3WNE A;  2BTF A;  4B1W B;  5HP1 A;  3O08 A;  3ZSX A;  4BR2 A;  3SAF A;  3H46 O;  1XC9 A;  1J5E K;  1WLJ A;  2WUS A;  1UWB A;  3RVC A;  3UIQ A;  1VQK N;  3J7Z O;  4LC9 B;  3WUH A;  3QIO A;  1ZYQ A;  3A5M C;  3ALY A;  1NGG A;  1E4F T;  1NGE A;  2E2Q A;  5F0X A;  4WYB A;  1FKP A;  1WSG A;  2KW4 A;  2A40 A;  2P9U A;  1NM1 A;  4H4M A;  1SS6 A;  5C12 A;  2NRT A;  1LAW A;  2D0C A;  1O1W A;  1SQK A;  4CJT A;  1NU0 A;  4HUE A;  4F2R A;  4CZF A;  3KD5 E;  3HVR A;  4L8R B;  2XRI A;  2KTQ A;  4KHU A;  4CEQ A;  1GLD G;  2Y1I A;  3PIO L;  3TSU A;  3RSE A;  4JHD A;  2FSK A;  2KLA A;  3CI5 A;  1W97 L;  4H0X B;  4M3U A;  5M1O A;  1VQ8 N;  5DM7 L;  1KLN A;  3QEP A;  5ADX H;  3BUZ B;  3D2E B;  5C25 A;  3CET A;  2I7P A;  2QI2 A;  4DTJ A;  2GBZ A;  3KLG A;  1Z26 A;  4FJL A;  1GOB A;  3DLH A;  3TR8 A;  3TAN A;  1LWC A;  3AO1 A;  3HTV A;  4O8U A;  3KLF A;  2HHH K;  1BIZ A;  1VQM N;  4B9S A;  4B9M A;  4WQ5 C;  4CGG A;  5C42 A;  4YOR A;  4IO9 L;  4CJK A;  1REV A;  4DR2 K;  3DRS A;  3CJA A;  3IFR A;  5AZI B;  3O9U A;  3P1G A;  1JLA A;  4DS5 A;  4FSV A;  1KFD A;  4G9Z A;  1NKC A;  4B1Y B;  3CG7 A;  1SL2 A;  1TK0 A;  4ISG A;  1S1T A;  4CK2 A;  3LWM A;  1RBR A;  4XH4 A;  2QXL A;  4B9Q A;  3CJ7 A;  2QWN A;  1ASU A;  1QHT A;  5J2N A;  4CED A;  4ILH A;  1L3T A;  4JI5 K;  1GOA A;  4YNQ A;  2UXC K;  2PYJ A;  1D8Y A;  1BHL A;  5CY4 A;  1A5X A;  1NBW A;  4BRO A;  4Z0U A;  1ASV A;  1L3S A;  3HPG A;  1EET A;  3SUN A;  4ID1 A;  5KPZ A;  4EIA A;  3C7N A;  2CGL A;  1NGJ A;  3SQ1 A;  3SUQ A;  3T19 A;  1T6C A;  3NFA A;  5EU7 A;  5JMV A;  4E1M A;  1J9A A;  3L2R A;  1OH6 A;  1IKY A;  1JL1 A;  4IG3 A;  3CQ8 A;  2IC3 A;  3O5B A;  4IOA L;  2E5L K;  4DU1 A;  3P83 D;  3HZ6 A;  3MX5 A;  4A5B A;  1BI4 A;  2NLX A;  3IMX A;  2D0P A;  2NRH A;  3OYC A;  1NK4 A;  2IOC A;  5HBM A;  4DQS A;  2AA4 A;  3K57 A;  2Y1J A;  4A59 A;  4CEZ A;  3SNN A;  1TK5 A;  3K0S A;  4FVM A;  1FW6 A;  3B6P A;  5BPL A;  1YIT N;  5FPM A;  2O4I A;  1RDU A;  3AGK A;  1T44 A;  4NYF A;  5I3U A;  5HOO A;  2HNZ A;  2A41 A;  4CVN E;  4DV4 K;  4CF8 A;  3THY B;  1C0F A;  3LP3 A;  3PSF A;  4E19 A;  2P9S A;  1OH7 A;  1VQ4 N;  4F3T A;  2NRR A;  1X1P A;  3T3F A;  4JKG A;  1RT7 A;  4B3O A;  2FF6 A;  2P9I A;  4DV0 K;  4PHT X;  1U49 A;  4BRD A;  3QB0 A;  4BRH A;  3SBG A;  1G99 A;  4LY7 A;  3VQ7 A;  2DFE A;  3SMS A;  4A57 A;  2GWJ A;  4CFB A;  3W0L A;  2QM1 A;  3T1Y K;  5F2R A;  4O5B A;  3THW A;  3J80 O;  1UOC A;  3I0R A;  5A2Q O;  1WSE A;  5TKW A;  1K73 O;  5KQ8 A;  1DTQ A;  1VQ5 N;  4J8F A;  3OYL A;  1OVY A;  4DV3 K;  3VA3 A;  4DTR A;  3OBW A;  3RMA A;  4JI6 K;  4N47 A;  2HHW A;  3OYI A;  3CFR A;  4MLE A;  3NBP A;  3A5L C;  3WNG A;  3CER A;  1HNZ K;  4JI2 K;  3J7A P;  4I6M A;  1YJN N;  1ITG A;  2ASP A;  3MCA B;  2OTL N;  4C1N I;  4FLU A;  4M3W A;  4JD2 B;  3E9L A;  1YAG A;  4KHW A;  4XH5 A;  1C0M A;  1Q18 A;  1TL1 A;  1S72 N;  4LF9 K;  5CZ1 A;  3UB5 A;  4M45 A;  3VEO A;  4GKJ K;  3RR7 A;  3AO2 A;  1Y64 A;  3L6Q A;  5GIO A;  3L2U A;  3QBX A;  1S9G A;  1RDW X;  4KO0 A;  4CJE A;  3GOI A;  4JN4 A;  3T1A A;  2E4L A;  1A5V A;  3WXM B;  4DF8 A;  4H0T B;  1TAQ A;  1S5J A;  2IVP A;  2HHT A;  3WEE A;  3QFP A;  4FWK A;  4CJU A;  1X9J A;  2G8F A;  4GW6 A;  2E1Z A;  4CEA A;  2VWJ A;  1RIL A;  3MXJ A;  4CI6 A;  5GAH P;  4E0D A;  4W5N A;  2OPQ A;  2JWK A;  3ID6 A;  1QSY A;  4Y0W A;  1L3U A;  4F4K A;  3AAQ A;  5I9E B;  1KVC A;  5AQT A;  4FL9 A;  2UYT A;  4X65 K;  1RTI A;  2PBD A;  1IG9 A;  2ZJP L;  2YNF A;  5C15 A;  2DPN A;  3UE5 A;  1N6Q A;  3OS2 A;  4YOT A;  4OKK A;  5GIP A;  3MXM A;  4KHN A;  1GLB G;  4C8N A;  3FFI A;  3CMA N;  3ULE A;  2HF3 A;  4BRM A;  1LOT B;  3P39 A;  1VQ6 N;  4CZM A;  3V9U A;  1ZBL A;  3O9R A;  2Q0U A;  3U4L A;  1S1X A;  1ZBI A;  3U9D A;  1JL2 A;  4GVM A;  3OS1 A;  3H1V X;  3DLR A;  4WF9 L;  3F5T A;  1DTT A;  2ZD1 A;  4FCY A;  5MLC Q;  2A1R A;  1NK5 A;  1J54 A;  2OYQ A;  3UKU B;  1BO5 O;  3C95 A;  3SAH A;  2O8D A;  5FRM A;  1FJG K;  2CGK A;  2A5X A;  5GAD P;  3NF6 A;  2FF3 B;  2NNW A;  4JS5 A;  1VQL N;  3RMC A;  3FFK B;  4C1N K;  5SZT A;  4FZY A;  1EO1 A;  3G10 A;  1RT5 A;  1HJR A;  4LF4 K;  1ESV A;  4RCH A;  4CW7 B;  4F2S A;  2YNH A;  1KD1 O;  1XHZ A;  1K8K A;  4V19 S;  5GAG P;  3ZSQ A;  1KAZ A;  4FVU A;  3I8B A;  4FJH A;  2W6L A;  4CGF A;  1GOC A;  3QET A;  1HMV A;  4CHQ A;  5M1N A;  2PZS A;  1RDA A;  1N36 K;  4C8K A;  4JV5 K;  3H3N O;  3ATU A;  1QE1 A;  5ADX A;  4C8M A;  3ZLJ A;  2X78 A;  3EYZ A;  4YOU A;  2HMP A;  3C6A A;  3H08 A;  1K6Y A;  3VEX A;  1M90 O;  4DLE A;  4KRE A;  4CZJ A;  4DLG A;  2HHX A;  4BDZ A;  1RT1 A;  2UU9 K;  2KKZ A;  4PL7 A;  4DB3 A;  1KRP A;  4FJ8 A;  2QW9 A;  3AVF A;  1HPM A;  4GMJ B;  4I9L A;  1BIS A;  4PA1 A;  3PSI A;  1IBM K;  1N32 K;  2ZJR L;  1S22 A;  4HTU A;  1K8A O;  4DSI A;  3ZET A;  4PY5 A;  1K9M O;  4K43 A;  4QAG A;  3CM6 A;  1WSI A;  2BE2 A;  4RWT A;  4HUG A;  3KLI A;  3WNH A;  4AHU A;  2XY7 A;  4LSN A;  5AR0 A;  5BN8 A;  2P1J A;  3SLC A;  2KZM A;  5AJ3 K;  4AM7 A;  4C8L A;  1J53 A;  1JLC A;  1W9H A;  5DK5 A;  5BRF A;  1BQM A;  4AF1 A;  5FRN A;  1ASW A;  4OGC A;  3BEX A;  3KLE A;  3VOV A;  1X3N A;  4LH5 A;  1RNH A;  3D2F B;  3RRG A;  4DR6 K;  4BRG A;  1ZBS A;  3HL8 A;  3UKR B;  3DLB A;  2XY6 A;  1U45 A;  5AQX A;  1JCE A;  5KRS A;  1L3V A;  1KQS M;  2XO7 A;  3LAN A;  1IV0 A;  3AAR A;  1D9D A;  3LDQ A;  1U48 A;  5BPN A;  3DYA A;  3U3G A;  3EO3 A;  1BIU A;  1RT6 A;  4BRN A;  3HBT A;  2E1Y A;  1NMN A;  4CHN A;  1Z25 A;  1L5U A;  3LM9 A;  4W5Q A;  4YOY A;  5AQG A;  5DMR A;  1YF5 L;  3EKS A;  3AVL A;  2UXB K;  4DHY A;  4JRP A;  3HT3 A;  1IO2 A;  5CE3 A;  1WSH A;  2CH5 A;  4LH4 A;  1YT3 A;  1WN7 A;  3F73 A;  3NH0 A;  3AA5 X;  4K8X A;  1YHQ N;  4EP5 A;  1E3M A;  4KTZ A;  4WFB L;  2P9U B;  1MA9 B;  2VQF K;  2IAJ A;  5AQM A;  4QCL A;  3OJS A;  3K2P A;  4FM2 A;  4LF8 K;  4CZE A; 
#chains in the Genus database with same CATH homology
 1Z26 A;  4FJL A;  4TSX A;  4CEO A;  4ZHR A;  4DSL A;  4DG1 A;  4E7K A;  3V9S A;  1BL3 A;  1GOB A;  1LWE A;  2GV9 A;  3TR8 A;  3DLH A;  3VQA A;  3TAN A;  1LWC A;  3KTQ A;  4CF0 A;  3AO1 A;  5FDL A;  3D45 A;  4IFV A;  4CHZ A;  4CF9 A;  4FJ5 A;  3KLF A;  1BIZ A;  5CYM A;  4IFY A;  4NCB A;  4Z4E A;  4B9S A;  1DLO A;  4B9M A;  1NK8 A;  4BWM A;  2ETJ A;  4CGG A;  4DU3 A;  4CEF A;  4Q0B A;  4F3O A;  2OPP A;  2D0B A;  1SKS A;  3VQP A;  2X6S A;  3LAL A;  5C42 A;  4CGH A;  3ITH A;  4I2Q A;  4CJK A;  1REV A;  1WAJ A;  3LPT A;  4DQP A;  4E7L A;  3DRS A;  3ZSO A;  3HJF A;  4H8K A;  3NGZ A;  3LAM A;  3P1G A;  1JLA A;  4KV8 A;  3SV3 A;  3U3Y A;  4CJW A;  4DS5 A;  1HNI A;  2HHU A;  1KFD A;  3KKR A;  3OYK A;  3ZT3 A;  3OYJ A;  1NKC A;  4FLX A;  3BGR A;  3LP1 A;  3KJV A;  2WON A;  1LW2 A;  1VSH A;  3CG7 A;  4IKF A;  3V6D A;  1C0U A;  5T7B A;  4NYN A;  3ZT1 A;  1SL2 A;  1TK0 A;  4O55 A;  3AO3 A;  4KI4 A;  4N56 A;  2PYL A;  3L3V A;  2BGG A;  1S1T A;  1S1U A;  4CEB A;  1HQE A;  5E41 A;  4F8R A;  4CK2 A;  1F21 A;  4AHT A;  3LWM A;  2DTU A;  1RBR A;  4OPK A;  3TAG A;  2KFN A;  3ZT0 A;  3C94 A;  3NGI A;  4CHY A;  2YNG A;  3G0Z A;  1ASU A;  1RTJ A;  1QHT A;  3KLH A;  2ATQ A;  2FBY A;  3ZSY A;  3QIN A;  4ID5 A;  4CED A;  5J2N A;  1XI1 A;  2HMI A;  2EHG A;  2Z1G A;  1L3T A;  1S6P A;  2IS3 A;  1IKV A;  3NHG A;  4CGD A;  1GOA A;  2F8T A;  3LP0 A;  5I42 A;  2HVI A;  3QNN A;  4YNQ A;  3M8S A;  4Q5V A;  1X9S A;  4OPJ A;  2RKI A;  1KVB A;  2PYJ A;  1D8Y A;  5D3G A;  1BHL A;  3DLE A;  4OGE A;  1A5X A;  5CY4 A;  3V1O A;  3ZSW A;  5KTQ A;  3SYZ A;  3NF8 A;  4Z4H A;  3DLK A;  1RT4 A;  3LZI A;  4DF4 A;  2FBT A;  2DY4 A;  4FLW A;  4DWI A;  4Z0U A;  2R7Y A;  1C1B A;  2HB5 A;  4PUO A;  1ASV A;  1QTM A;  1L3S A;  3HPG A;  1EET A;  3IG1 A;  1CLQ A;  3SUN A;  4ID1 A;  4B8C A;  3AVA A;  3IS9 A;  3C6U A;  3VQD A;  3HP6 A;  4EP4 A;  1KLM A;  1UA0 A;  3SQ1 A;  3SUQ A;  2VG7 A;  3T19 A;  3AVK A;  1HYS A;  4NCG A;  4DTO A;  3SQ4 A;  4O44 A;  4Z4C A;  3NFA A;  4FJK A;  4M3T A;  3VQE A;  5EU7 A;  4FLT A;  1LV5 A;  4E1M A;  1J9A A;  1BQN A;  3F9K A;  1NK9 A;  1MU2 A;  1RT2 A;  4CCH A;  1I3A A;  1HQU A;  3L2R A;  3P5J A;  3HP9 A;  3MEG A;  1IKY A;  3HXM A;  1JL1 A;  3KLG A;  3EY1 A;  2PY5 A;  4IG3 A;  4FLZ A;  4J2D A;  5JS1 A;  3CQ8 A;  2QKB A;  1T05 A;  2IC3 A;  1VSJ A;  2FBV A;  4DU1 A;  3P83 D;  2KFZ A;  3V81 A;  2G8W A;  1BI4 A;  5K14 A;  1SKR A;  3OYC A;  2KZZ A;  4AHS A;  4KHQ A;  1NK4 A;  4CF2 A;  2IOC A;  5HBM A;  4DQI A;  3QEW A;  4LD0 A;  4DQS A;  4I9Q A;  4PQU A;  4EZ9 A;  3K57 A;  4MFB A;  2Y1J A;  4CJF A;  4CEZ A;  2YHA A;  4ZTJ A;  4I7F A;  3ZT4 A;  1B92 A;  4AHR A;  3SNN A;  1TK5 A;  2IDO A;  4FVM A;  1ZBU A;  3K59 A;  1Y97 A;  3B6P A;  5J1E A;  2O4I A;  3SJJ A;  1RDC A;  3QER A;  3SUP A;  4I2P A;  4KTW A;  4FJN A;  3OS0 A;  3VQB A;  5I3U A;  4NYF A;  3WNF A;  3L8B A;  2HNZ A;  3AV9 A;  3PX6 A;  3TAP A;  2X6N A;  1RTH A;  4JLH A;  4CF8 A;  3OYA A;  3L2W A;  4J2E A;  3LP3 A;  4E19 A;  3NF7 A;  1G15 A;  4FK0 A;  1TK8 A;  4CHO A;  2XY8 A;  2BAN A;  1RTD A;  3AA2 A;  3S9H A;  4F3T A;  1HNV A;  1X1P A;  3I0S A;  3RRH A;  3T3F A;  2VG5 A;  1VK0 A;  1RT7 A;  3NCI A;  4B3O A;  2D5R A;  4QOZ B;  3HVT A;  1ZBH A;  1KTQ A;  1BI4 B;  3JYT A;  4CK3 A;  3PX0 A;  3ZSV A;  1U49 A;  3E01 A;  1RBV A;  3THV A;  4LY7 A;  3VQ7 A;  2DFE A;  2E6L A;  3KK3 A;  4M3X A;  4CFB A;  1NK6 A;  1JLF A;  3DLG A;  1D5A A;  4CF1 A;  1TL3 A;  4O5B A;  1Q9X A;  5J2Q A;  1UOC A;  3I0R A;  1WSE A;  3HO1 A;  4FW2 A;  1VSM A;  4FJG A;  1D9F A;  1RDD A;  1S6Q A;  3CM5 A;  1DTQ A;  3M8P A;  5KI6 A;  3AVG A;  3L2Q A;  4BE2 A;  4CIG A;  3SUO A;  3SPY A;  2HHS A;  3OYL A;  2HHQ A;  2YNI A;  2JGU A;  3OYD A;  1IH7 A;  3VA3 A;  4CIE A;  3LAK A;  4DTR A;  2Z1H A;  3RMA A;  1U47 A;  4C8O A;  4CJ5 A;  3CFP A;  4XIU A;  1WSJ A;  4N47 A;  1JLQ A;  5HRS A;  2X74 A;  2HHW A;  4E3S A;  3MXI A;  2LSN A;  3OYI A;  4DSE A;  3TAQ A;  3CFR A;  3TAF A;  2HND A;  1SL0 A;  4Z4G A;  5J2P A;  3NBP A;  3M8Q A;  4CJR A;  3WNG A;  3KD1 E;  1VSK A;  1YTU A;  3V9Z A;  3OVN A;  1ITG A;  4DMN A;  4DTU A;  1ZBF A;  1NKB A;  5HRR A;  4FLU A;  3OYM A;  1T03 A;  5KGW A;  1KVA A;  1W0H A;  3QO9 A;  4DQQ A;  1KFS A;  4M3W A;  3TAB A;  3K5M A;  1X9M A;  1J5O A;  2IGI A;  2O4G A;  4CJP A;  4KHW A;  2XHB A;  3RR8 A;  1C0M A;  1BCM A;  4IG0 A;  2RPI A;  3K5L A;  3LP2 A;  3DOL A;  1TL1 A;  4M42 A;  5CZ1 A;  3CYM A;  4M45 A;  4CFA A;  3AVC A;  3VN5 A;  3TWH A;  1TKX A;  2FC0 A;  1WAF A;  5J2M A;  3ULD A;  3RR7 A;  4FZZ A;  4ELU A;  3AO2 A;  1S1W A;  3VA0 A;  3CFO A;  2P5O A;  4FJ9 A;  1TKT A;  4Y1C A;  3U6F A;  5KRT A;  4FJJ A;  1IKW A;  2Z1J A;  3L2U A;  3DM2 A;  1S9G A;  2GUI A;  3AA4 A;  3HM9 A;  4KO0 A;  5C24 A;  4M41 A;  4CJE A;  3ZCM A;  1RCH A;  2VG6 A;  4KHS A;  3MEE A;  4CFC A;  4RW8 A;  2BDP A;  4Z4I A;  4J2A A;  4RW6 A;  3T1A A;  1C6V A;  2F8S A;  3SPZ A;  1VRT A;  3OJU A;  3KK1 A;  2E4L A;  3K5N A;  4DFK A;  3S3N A;  4W5R A;  2G8V A;  1A5V A;  3NF9 A;  4DF8 A;  3HPH A;  4E7J A;  1TAQ A;  1S5J A;  4CJS A;  4E89 A;  2QKK A;  4CHP A;  3IAY A;  2HHT A;  2EX3 A;  1FKO A;  1NOY A;  1QSS A;  4CJU A;  4R5P A;  3PV8 A;  4OVL A;  1SV5 A;  4GW6 A;  1TKD A;  2G8F A;  1BGX T;  1RT3 A;  4AHC A;  4CEA A;  2VWJ A;  1RIL A;  3AVJ A;  3MXJ A;  3QNO A;  3QEI A;  1X9W A;  1NJY A;  2OZS A;  4BWJ A;  4BAC A;  3NDK A;  3VQQ A;  1B9D A;  4OJR A;  3OYG A;  3AA3 A;  4ICL A;  4E0D A;  3NAE A;  4W5N A;  1YVU A;  2OPQ A;  1QSY A;  4E1N A;  1B9F A;  2HVH A;  1U04 A;  1L3U A;  4HCB A;  4IDK A;  4RW4 A;  4F4K A;  4OLA A;  1SUQ A;  2YKN A;  4IBN A;  2I5J A;  3O3F A;  3TAM A;  1KVC A;  4DSF A;  1JLG A;  4DTX A;  3A2F A;  4DS4 A;  4FW1 A;  1C0T A;  3VQC A;  2AJQ A;  2KQ2 A;  2OPR A;  4RW9 A;  3TAE A;  1RTI A;  2HHV A;  1TVR A;  4FXD A;  4DFP A;  4BDP A;  3MAQ A;  4K8Z A;  3DOK A;  1IG9 A;  3EZ5 A;  4DFM A;  2YNF A;  4KRF A;  4G1Q A;  1N6Q A;  2ITG A;  3IRX A;  3OS2 A;  2YV0 X;  4OKK A;  1HPZ A;  2DFF A;  3ZSR A;  3MXM A;  5FRO A;  4KHN A;  1VSE A;  4C8N A;  2FBX A;  3FFI A;  1UAX A;  4E7H A;  4DFJ A;  2RN2 A;  2WOM A;  3HYF A;  3VQ5 A;  1RBT A;  2ZQB A;  1EP4 A;  3ZSZ A;  1JXB A;  4OKJ A;  1LWF A;  3NH2 A;  3VQ4 A;  1TKZ A;  2HNY A;  3ASM A;  1C1C A;  3VQ9 A;  1JXE A;  4AH9 A;  3DRP A;  3V9U A;  2F96 A;  3O3G A;  1ZBL A;  3RMD A;  1NK7 A;  4N76 A;  4HVJ A;  3OY9 A;  1ZBI A;  1S1X A;  4FK4 A;  3M8R A;  4DU4 A;  1JL2 A;  1IKX A;  4GVM A;  3OS1 A;  5HRO A;  3AO4 A;  1SKW A;  3DLR A;  2G8H A;  2G8K A;  3KK2 A;  1DTT A;  2ZD1 A;  3PUF A;  3OYE A;  4FCY A;  2A1R A;  1NK5 A;  4W5O A;  3OYF A;  1J54 A;  2OYQ A;  4JS4 A;  4B9U A;  1CXU A;  4KFB A;  4FJM A;  3PO4 A;  4CJL A;  3C95 A;  3DMJ A;  4CEE A;  3AVN A;  5CYQ A;  5FRM A;  4O0J A;  4CEC A;  4FZX C;  5CZ2 A;  3V1Q A;  3RMB A;  3NF6 A;  4JS5 A;  4Y1D A;  1UA1 A;  3SV4 A;  4DTP A;  5SZT A;  3JSM A;  3RMC A;  4FZY A;  3G10 A;  3AO5 A;  1FXX A;  1RT5 A;  4CK1 A;  4CER A;  4M3Z A;  2OPS A;  1HJR A;  1EXQ A;  3HST B;  4HHT A;  2DFH A;  4B08 A;  4AIL C;  4F2S A;  4DSK A;  2YNH A;  3O4Q A;  4OKE A;  3LDS A;  2QK9 A;  1XHZ A;  3PO5 A;  4ZTF A;  1XWL A;  3ZSQ A;  3PX4 A;  1JKH A;  3NH1 A;  3D0P A;  4JRQ A;  3KIO A;  4FJH A;  3VQ6 A;  3QIP A;  4CGF A;  1XHX A;  2B4J A;  4FM0 A;  4UQG A;  1NJX A;  1GOC A;  3QET A;  3BDP A;  4KTQ A;  3OYH A;  4CE9 A;  1HMV A;  4HCC A;  4CHQ A;  2G8I A;  1HYV A;  5HRN A;  2PZS A;  1WSF A;  1JLE A;  1RDA A;  4C8K A;  1KSP A;  3QEV A;  1CZB A;  3L2V A;  1NK0 A;  1VSI A;  4CFD A;  3HPO A;  1QE1 A;  1CZ9 A;  1FK9 A;  2X78 A;  4C8M A;  4ELT A;  2JLE A;  3EYZ A;  2QXF A;  1S9E A;  3NE6 A;  3SQ0 A;  1CXQ A;  1QS4 A;  1EKE A;  2W42 A;  2XY5 A;  4M3R A;  3H08 A;  1K6Y A;  4CIF A;  3OYN A;  1VSF A;  5SWM A;  4W5T A;  3V1R A;  4DQR A;  3AVH A;  2P51 A;  4DLE A;  1A5W A;  3S3M A;  1VSL A;  5JS2 A;  4KRE A;  3LZJ A;  4CES A;  4DLG A;  2HHX A;  1N5Y A;  4BDZ A;  1RT1 A;  4NCA A;  4CJV A;  4MQ3 A;  4YFU A;  3HK2 A;  3ZT2 A;  3QES A;  1KCF A;  4CJ3 A;  1T8E A;  4RG8 A;  1KRP A;  4FJ8 A;  1EX4 A;  3AVF A;  4GMJ B;  4I9L A;  4FM1 A;  4B9L A;  1BIS A;  2OZM A;  4KHY A;  4PA1 A;  4KB1 A;  4CGJ A;  4FK2 A;  1T7P A;  4DSJ A;  1WNS A;  4FJI A;  4LSL A;  4HTU A;  4J2B A;  4B9N A;  2P5G A;  3O3H A;  3MEC A;  1I39 A;  4DSI A;  4DTS A;  5HLF A;  2YHB A;  3V4I A;  4PY5 A;  4DTN A;  4PWD A;  3DI6 A;  4H4O A;  3SI6 A;  3C6T A;  4QAG A;  1NJW A;  4FYD A;  3CM6 A;  1WSI A;  3QEX A;  4EZ6 A;  4E7I A;  2BE2 A;  3LPU A;  3LWL A;  4HUG A;  4DTM A;  1RBS A;  1Q9Y A;  2A1S A;  3KLI A;  3WNH A;  4AHU A;  4HUF A;  4Z4F A;  4B9T A;  4KKO A;  3V9W A;  2XY7 A;  2NUB A;  2OA8 A;  1HRH A;  2YKM A;  3B6O A;  2P1J A;  1NOZ A;  4LSN A;  4FJ7 A;  4CJQ A;  4B9V A;  2KZM A;  3L3U A;  3WNE A;  4CGI A;  5HP1 A;  1LW0 A;  4C8L A;  1J53 A;  1JLC A;  2B6A A;  3ZSX A;  3ISN C;  3QLH A;  1W9H A;  5DK5 A;  1BQM A;  3K5O A;  1XC9 A;  3NGY A;  1WLJ A;  1R0A A;  1RDB A;  1UWB A;  3UIQ A;  4OLB A;  5FRN A;  4O0I A;  1RBU A;  1ASW A;  1SL1 A;  4N5S A;  4OGC A;  4WE1 A;  1U4B A;  3KLE A;  4KPY A;  3QIO A;  1TGO A;  4LH5 A;  1ZYQ A;  1RNH A;  3ALY A;  1QQC A;  3VQ8 A;  4O4G A;  3RRG A;  4KAZ A;  4N41 A;  2G8U A;  4M3Y A;  3SCX A;  1VRU A;  3HL8 A;  3DLB A;  2XY6 A;  1U45 A;  5KRS A;  3TI0 A;  1FKP A;  1WSG A;  2KW4 A;  1L3V A;  2XO7 A;  2Q3S A;  1S1V A;  1HYZ A;  3LAN A;  3RWU A;  2B5J A;  1D9D A;  1TV6 A;  4H4M A;  1U48 A;  4KB0 A;  1C1A A;  3I8D A;  4BDY A;  3DYA A;  3U3G A;  1LAW A;  2VWK A;  1BIU A;  2D0C A;  1O1W A;  3SZ2 A;  4AHV A;  5KGX A;  1RT6 A;  4FJX A;  3O4N A;  4CJT A;  1NKE A;  1Q8I A;  4CHN A;  1Z25 A;  1YTA A;  1VSD A;  1L5U A;  4HUE A;  4F2R A;  1JLB A;  4W5Q A;  3AVM A;  1TAU A;  3KD5 E;  4CJ4 A;  2D0A A;  3HVR A;  5DMR A;  4L8R B;  2RF2 A;  2XRI A;  2E6M A;  2KTQ A;  3PY8 A;  3AVL A;  2Z1I A;  4KHU A;  3DRR A;  4CEQ A;  4JRP A;  2Y1I A;  3HT3 A;  1IO2 A;  4RW7 A;  4B8A B;  1NJZ A;  3MED A;  1WSH A;  3KKS A;  4BE1 A;  4LH4 A;  1YT3 A;  4ELV A;  1WN7 A;  2HW3 A;  1BCO A;  1LAV A;  3RTV A;  3SQ2 A;  3F73 A;  3NH0 A;  4M3U A;  4FLY A;  3AA5 X;  4K8X A;  4EP5 A;  4KTZ A;  4BE0 A;  1KLN A;  3QEP A;  3TAR A;  4KI6 A;  2ZE2 A;  1QSL A;  3S3O A;  5C25 A;  2IAJ A;  3AVB A;  3AVI A;  4FLV A;  4QCL A;  3K58 A;  3OJS A;  3K2P A;  5HRP A;  4FM2 A;  3V9X A;  4DTJ A;  2GBZ A;  3OYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...