4KB3A

Crystal structure of the mitochondrial peroxiredoxin from leishmania braziliensis in the decameric form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
ATVRDPAPQFSGKAVVDGAIKEINSNDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRYLEFEKLNTQVIAVSCDSEYSHLAWVNTPRKKGGLGEMKIPVLADKSMEIARDYGVLIESAGIALRGLFVIDKKGTLRHSTINDLPVGRNVDEVLRVVEAFQYADEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxidoxin
publication title Crystal structure of the mitochondrial peroxiredoxin from Leishmania braziliensis in the decameric form
rcsb
source organism Leishmania braziliensis
molecule tags Oxidoreductase
total genus 50
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kb3A00
4L0UA 1H4OA 2WCIA 4FIWA 2JACA 3NIVA 4ZILA 1M7TA 2FY6A 4XRDA 3H93A 5DCHA 4TRXA 1YJ6A 5CRHA 3ME7A 4PURA 5J5NA 2KUCA 3F3QA 4MH3A 3DXBA 5G5FA 2GSSA 3BBYA 2IJYA 2CA8A 3O6TA 4L5LA 4XS1A 3GKKA 5C04A 4DSSB 2R6KA 1GULA 5ECKB 2IIYA 2F51A 4MLYA 2CZ2A 4XS4B 5B8BA 4FYCA 3KM6A 1T8EB 2GS3A 2YJHA 2VL2A 4PQ1A 5L71A 1PMTA 3M0FA 1DBYA 5HFIA 3R2QA 2OA7A 4LA1A 2DJJA 2IN3A 2R2JA 1IYIA 4BVYA 3FKFA 1B9XC 4L8EA 4K7IA 3TGZA 5EY6A 3IOSA 5IPHA 3IR4A 2O8VB 3ERGA 4OO5A 3S9FA 3HVSA 5IMZA 4DSQA 1TKDB 2DMLA 2CVKA 2F8AA 4Q5QA 1Y25A 2LRNA 4ZBBA 5ECRB 1X0RA 1G7OA 3TOTA 2GZPA 3QAWA 5ELGA 3M9KA 1FOVA 1X5CA 4V1Ag 4E8HA 1K3YA 3QCPA 2LJKA 2VL2C 3ZMLA 1QMVA 5JWRB 1JFUA 12GSA 2TRXA 2PUKC 2O87A 2GT5A 4GF0A 4DEJA 2VCTA 4RI6A 1F6MC 2H6XA 5C00A 2HRNA 1PL2A 2LKUA 4ECBA 1HNCA 4PX1A 1J0FA 4IW9A 1MDIA 1TK8B 1PD21 2RLIA 2IPAA 2ZNMA 2HYXA 6GSVA 1GSFA 1NM3A 2FWFA 1Z5YE 3CMIA 3UBKA 4ZXGA 1VRSD 3TCOA 2LEGA 3C71A 4EO3A 2B1KA 2CQ9A 2L5LA 1NSWA 1GRXA 13GSA 2FWEA 5IMAA 4LMWA 2MBTA 3F9UA 1B4QA 4E8EA 5ECHB 4V1Ap 2ZUPA 3RPPA 5IMVA 5KN3A 3P2AA 1T4ZA 1OE7A 4XS4A 3CTGA 5FT3A 1R5PA 1WE0A 2RUEA 4YQMA 2EC4A 1ZYEA 5B6NA 1YKAA 3HVXA 1EV9A 3EU3A 4HJ2A 1JZDA 1GUHA 1S3DA 1RK4A 4XS6A 4PQIA 3MAKA 11GSA 5DVBA 1K3OA 3GUSA 1LJRA 5DBQA 1F2EA 2O7KA 2AYTA 2P0GA 4XIHA 4ZL7A 4F82A 4XCSA 2V32A 1Z7RA 4IKHA 2FLSA 3LORA 3HXSA 3EMXA 3LWAA 1QK8A 2HZFA 4AJ6A 1V40A 2HE3A 2C3QA 4HZ4A 4NHZA 3WT2A 4JU5A 2FD3A 2VLUA 1PA3A 1Z7PA 4XHMA 4ID0A 3WGDA 2YOIA 3F0IA 5CRGA 2L57A 4IHUA 1S3AA 4MJBA 5G31A 3JCML 2TRCP 2C3TA 2P31A 2R37A 5GSTA 1AC1A 5ECIB 4BWSA 2OE3A 1WP0A 3GX0A 1R5AA 1FG4A 1UVZA 4P3YB 2H1DA 5ECLB 3KZQA 5J9CA 1FAAA 1YEPA 3ME8A 5GAND 4EE0A 1TK5B 4POMA 1FVJA 3ZIVA 1XW6A 5IPGA 2I3YA 3MWHA 1VF1A 20GSA 2XBIA 2H6YA 1I5GA 1SKSB 1QQ2A 3CRTA 5IQYA 4X0XA 5CP1A 2FNOA 3D0ZA 1GNEA 1GTIA 3M3MA 1SK1A 1SK0A 1FB6A 2ES7A 3ERWA 3VWWA 5DAKA 5JCWA 5CRDA 1Y6EA 3H1NA 3KP8A 1M2BA 2L5OA 1E6BA 1G6YA 3CXGA 1CQGA 16GSA 4MPGA 5A4UA 2X8HA 1X5DA 4PUFC 1X9WB 2GT6A 3M1GA 4N30A 5HR2A 3IBHA 5LNKe 4MJAA 3NOFA 1GNWA 1ZYQB 1MDKA 2YN1A 1KNGA 1HD2A 3TDGA 3H8QA 2OBIA 1THOA 4WF5A 3F4RA 3E9JB 2L6CA 3L4NA 4TXVA 4F0BA 4MZCA 1XWGA 5HR0A 2VCZA 4KCAA 1F3BA 4GXZA 1TRUA 4EVMA 2H76A 3SBCA 5FWGA 2L59A 2G2QA 4JR6A 4DSRA 3HCZA 3C8EA 4MA9A 2HZEB 1TRWA 3UBLA 2LRTA 1O73A 1SKWB 2OKAA 2V2GA 1XWBA 3L0HA 1WRYA 2Z9SA 4TOPA 3TKSE 3CSHA 2GTUA 2LUSA 4CW9A 4KGIA 3W8JA 4O5RA 4ISDA 3EVIA 2FGXA 2ON7A 4FYBA 2E7PA 2GSTA 1FW1A 1U6TA 3IDVA 1YY7A 4KW6A 4HDEA 4NV2A 2V41A 3F3RA 1OKDA 4IELA 4TN8A 3ZFLA 3UAPA 2TIRA 3WYWA 4GQCA 3ZMKA 2X8GA 3F4SA 3I6AA 4NPBA 2E2MA 3UMAA 4EUYA 5J3RA 1SYRA 4Q5FA 1G7EA 2WGRA 4H86A 2H74A 3H79A 1AUCA 1GLQA 4POLA 2CV4A 3GURA 3ZLPA 2YP6A 2DIZA 18GSA 3QMXA 4OO4A 3W8SA 2K8SA 2R5GA 3Q74A 2XPEA 3QFBC 4KH7A 3TKPA 3EC3A 3HA9A 3UJ1A 2L4CA 5GZZB 2VL3A 1YZXA 2FWHA 4PGTA 2ALBA 4RQXA 4BVXA 5B8AA 1N8JA 2B6MA 4MABA 4DVCA 4IQ1A 3ZITA 2DMMA 1PL1A 2YWMA 3J7Yk 3V1WA 1SD9A 3GHAA 3L9VA 1O6JA 4G2EA 1BQ7A 3RHCA 1OE8A 3C73A 2A4VA 2AJQB 3ZL5A 4GSNA 4RQRA 1BAYA 3DKSA 3VLNA 4MCUA 2PBJA 1TRSA 5G1LA 3FZ9A 3G7YA 4OFTA 3IC4A 3LYPA 2HZEA 3LFLA 3L9UA 2ZCTA 3D4TA 2JSZA 1JLWA 3F63A 1K0CA 2H19A 5D8IA 4YAPA 1G0TA 4FYUA 2I9HA 3TOUA 2LJRA 2JZSA 2KOKA 4IQAA 2YANA 1BEDA 3D21A 4AGSA 3BJ5A 4J56E 3TRQA 4IN0A 4NHWA 2H0IA 2MZCA 3GH9A 4HQZA 4EKZA 4LLRA 2PVQA 4HZ2A 5E59A 1ABAA 1LU4A 1TU7A 2CX4A 2YV9A 3HJPA 3HZ4A 5F8BA 3RDWA 3WT1A 5H5QA 4OMVA 4EDZA 2O85A 4K8MA 2YV7A 2L4QA 2YWIA 3RPNA 3QFAC 1SL1B 3O3TA 4HU9A 5A4VA 3P8WA 2I1UA 1A0FA 4WBJA 2BTOT 4PNGA 2YZUA 2YZHA 5IO0A 1XBSA 1T3BA 5AIXA 1KEBA 4WKWA 2PERA 1ZCPA 4OCEA 2GQLA 2J23A 2H73A 4HJMA 1U87A 1MD3A 5G30A 4MP4A 2HXKA 4BA7A 4O92A 1KTEA 3GV1A 1FB0A 1GSYA 2DJ1A 4NMUA 3ZIJA 2C0EA 1FHEA 4GSSA 4PQHA 4OFMA 6GSSA 2CT6A 4HOJA 5AISA 3C1RA 4IJIA 3GL5A 5GSSA 1AIUA 3US3A 1M2DA 1Z6NA 3VPQA 1RQMA 2N5BA 1CQHA 6GSXA 2F3MA 1Q4JA 1TW9A 3DYRA 3APQA 1K0MA 3GFKA 4Q5RA 3TRXA 2JZTA 1XOAA 5F06A 1A2MA 2MMOA 2HSHA 3M9JA 1WWJA 1Z3EA 2X99A 1ST9A 2LRCA 2XHFA 2AHEA 3VPTA 3P7XA 3E3EA 5D73A 4KCEA 4OWYA 5HFKA 5E4WA 2H1BA 1SJIA 6GSWA 4HEA2 3HY2A 2FCHA 2MMNA 2X64A 4CDOA 1WOUA 2VCVA 3DIEA 1S3CA 1ERWA 1T1VA 1SKRB 5B7CA 4JEDA 3LXTA 1M0UA 4L0WA 1K0DA 2RIIA 3IE3A 1TOFA 1A2JA 3CSJA 1EOGA 2KLXA 4LL1B 1AQXA 1RW1A 1YF1A 3ZFBA 3QR6A 5A5KA 9GSSA 4MZWA 1PSQA 3QDNA 2YNXA 4X43A 2M80A 1WJKA 1W4VA 1FO5A 2D2ZA 3DGQA 3DVXA 5DJMA 1J08A 1W89A 1ZZYA 2WDUA 3HKRA 4K0NA 3ZVJA 5AN1A 2L6DA 3OR5A 4EF0A 5ELAA 2OE1A 4EC0A 4TXOB 4ECCA 5DAKB 2DSAA 4G9HA 2V6OA 4K2DA 3C7MA 2H66A 4MMMA 4PUAA 2VLTA 3VI7A 3HD5A 2B7JA 4OCFA 1EWXA 2V6KA 5INYA 1BX9A 1OC8A 1ERVA 4D73A 2M72A 5IO2A 5DQYA 1TRVA 1OC9B 1GH2A 3U6VA 1UN2A 2K9FA 4N10A 1T00A 2LQOA 2GZZA 2HSYA 5HR1A 4YAVA 1PX7A 3N9JA 2DIYA 3FRCA 1XPVA 1Z9HA 4TR1B 1HNAA 2XBQA 4HQSA 3EYTA 3KTLA 2LNSA 4HS1A 3UEMA 2PU9C 4EXJA 1U88A 3I69A 3Q18A 4I5QA 3HVVA 4Q5NA 4WEYA 4ZL9A 5IIZA 1JZRA 1GSDA 2P5QA 3VFIA 4GTUA 1UC7A 1B8XA 4YQVA 4NV5A 4IS0A 2C80A 4K7NA 3VI5A 2P5RA 3FW2A 1TJDA 3QOUA 2R4VA 1N2AA 3F8UA 4KB3A 3TUEA 5J41A 2H0GA 2NVLA 2VCWA 3DMLA 4LMVA 4KA0A 2OE0A 3FK8A 3IK9A 4QL7A 4L5OA 2E2GA 4Z7XA 4KDYA 5A4WA 3KH9A 4TXOA 1ACVA 4RUVA 3GX8A 3DD3A 2GSQA 4BPYA 2V1MA 2GVPA 1VGLA 1GUKA 2HLSA 1JHBA 2JU5A 1G6WA 3TJBA 3GIXA 4MJCA 4BL7A 3TRPA 3APSA 2LNTA 3KXOA 5IOXA 3VWXA 3F6FA 4KDXA 1TU8A 1OC9A 2RM5A 2FHEA 2H1AA 3DRNA 1PX6A 1GSSA 4KSMA 1X9SB 1MD4A 1OKTA 2MYGA 3LXZA 4TR1A 3GN3A 3VWUA 4EDYA 1VF4A 3D6IA 1F3AA 2VAFA 2PGTA 3EWLA 1A8YA 2VIMA 1EGOA 3LYKA 3KCMA 2CVBA 1OVNA 1K0BA 1A0RP 1Z6MA 3BD2A 4ZBAA 3TKSC 1ZL9A 3KIJA 2OADA 2H75A 1ERTA 1GTAA 2LTKA 4K6XA 1GSEA 2IMKA 3F6DA 4TKYA 2GGTA 5JWOB 3D5JA 2VOCA 2IWTA 4AJ8A 1O8WA 4WXTA 4I2TA 1XWKA 5J9BA 3UVTA 3GSTA 2JADA 4BWQA 1F37A 1M2AA 2IMEA 1TDIA 2B5XA 1OYJA 4MF6A 3C1SA 5CYYA 1K0NA 3IA1A 1XIYA 1YDKA 1XWCA 5EPFA 5G5EA 4O32A 3E0UA 5ECMB 2KHPA 3BOAA 3WD6A 3LSZA 1SD8A 4IGJA 3GKXA 1AQWA 3A5WA 5D9WA 4JRRA 1GLPA 3PH9A 5F07A 4WR5A 3NZNA 22GSA 1T7PB 3HJOA 2EIOA 4WBRD 2HI7A 4NAXA 3G7JA 2IMIA 19GSA 4LL4B 1J9BA 4PXOA 4IJ3A 3WGEA 1R4WA 4MJEA 3TB2A 1NW2A 3QAVA 4F9ZA 3AY8A 4IP6A 2YWNA 3APOA 5IMFA 7GSSA 4GWRA 4ZB6A 1C72A 3CSIA 4PNFA 5ECNB 4N11A 1XVWA 1JZOA 3IPZA 1PQNA 3UARA 1ZMAA 2DLXA 1QGVA 1X9MB 2A2RA 5D9VA 4IVFA 4NXIA 2LS5A 1EP7A 1EEJA 2VD1A 1XVQA 2H1GA 4KX4A 1ZOFA 2REMA 1TI1A 4XTSA 1A2LA 3FY7A 1JZWA 5D93A 2K6VA 2NBSA 4G10A 1A23A 1SJ6A 2OBKA 2DJ0A 1GWCA 3IHQA 4YH2A 5DDLA 2AV4A 2FWGA 4N0VA 5DQSA 1BJXA 3N5OA 1B4PA 1M99A 2VO4A 4ZB9A 2DJ2A 3CYNA 1Q98A 3ZRDA 3WGXA 3IRAA 3KEBA 1ILOA 1H75A 2PPTA 4ML1A 3CRUA 3FR6A 1AXDA 1M9BA 1SENA 3GSSA 1WIKA 1AAZA 2WS2A 3ZZXA 4J2FA 3EURA 4KAEA 2CVDA 2H30A 4I6XA 1TXXA 3LJRA 3HYPA 5F0GA 3FR3A 5IMCA 4MZBA 2VD0A 4I2UA 3GRXA 2EIRA 1T4YA 1MTCA 1TP9A 4JBBA 5CRWA 4ACSA 1K0AA 2CX3A 1TK0B 4QL9A 2JZRA 3I43A 1EP8A 2LSTA 1URMA 4D73B 3GTUB 3FEUA 5JCGA 2RUFA 4TR0A 1DUGA 3MSZA 5LD0A 2HFDA 4ZB8A 5DCGA 1JLVA 2GQMA 2H01A 3VK9A 5G1KA 4NWYA 1I9DA 1GL8A 3O76A 2CZ3A 2WRTA 3UIWA 1EZKA 3PGTA 5DALA 3QPMA 3PR8A 4GSTA 3CTFA 3IAS2 4K9ZA 2AAWA 3K8NA 5ECQB 3GH6A 1GSQA 3RHBA 1B9YC 2B7KA 2H0HA 3FZAA 1MEKA 1UA5A 2F9SA 1EV4A 1QXHA 3RBTA 3GMFA 1K0OA 2YCDA 5B6MA 1AW9A 2MMAA 1LBKA 1U3AA 4TR4A 4K1FA 2AUVA 1DE1A 5AGYA 4F0CA 3ISOA 4X1UA 2QKEA 4DSSA 2BMXA 2DJ3A 2VCQA 1GSUA 4KUNA 3LGCA 4MPFA 4V2MA 2G0FA 1EOHA 2H70A 2C3NA 1NHYA 1YF0A 1V57A 2C0DA 2QGVA 3I9V2 4O7HA 4IBPA 1OC3A 2C4JA 4G19A 2GZYA 2X8CA 1R26A 1XZOA 3QAGA 2HT9A 2RM6A 3W6GA 5ID2B 1HNBA 2J9HA 3A3TA 3UOMA 4XRAA 2C8UA 5EL8A 3Q6OA 3VURA 3FHKA 4V2LA 4AJ7A 3GTUA 4ML6A 3FYGA 4N0ZA 3J7Yb 3KGKA 3G9BA 5D9XA 1TI3A 3HDCA 3HJMA 4RI7A 5HR3A 2I81A 1A8LA 2B1LA 4TR3A 4GQFA 4ZL8A 4F2IA 4HI7A 3CBUA 2PN8A 4ULXA 1GTUA 1SL0B 1VF3A 4OFNA 1FVKA 1O81A 3GKNA 3G7IA 17GSA 5KN0A 2M46A 5DJLA 4TW5A 5HFGA 4GLTA 3TKRA 1XFLA 2XC2A 2N5AA 1NHOA 2WULA 3ZVJD 2DJKA 3P90A 4ZIJA 1XCCA 4MH2A 1GP1A 3ERFA 2R3XA 2QSIA 1YEXA 2IFQB 3HHVA 5IOWA 2NDOA 1U3IA 2PMTA 4KSOA 1KBNA 2VLVA 2OJLA 3M8NA 5G2ZA 3D4MA 4F03A 2LV3A 5D96A 4EL1A 2MBSA 2FA4A 1V2AA 3RAZA 1IYHA 2YJ7A 4K0GA 3A2VA 1WMJA 6GSYA 2KP1A 3ZREA 1ERUA 5KEJA 1EEMA 3GNJA 5CAXA 3FZ4A 3D22A 4GCIA 3MNGA 4MDCA 5ID2A 2GDRA 3U5RE 3EE2A 4GRFA 2FUG2 2VCXA 2IL3A 3GL3A 2JSYA 4KNDA 1QUWA 3LEFA 4POKA 3IK7A 4K7OA 3KD0A 3TKSA 2IMFA 2HRFA 6GSTA 2JL4A 3EMPA 1AQVA 1SJZA 3TJFA 3H4KA 4I97A 5KN2A 2KP2A 3TJGA 2HNLA 3FZ5A 1O85A 1B48A 5F05A 3DVWA 1XW5A 2H71A 3KTBA 5ABRA 2WZ9A 5COHA 1GTBA 2CAQA 2BJXA 2PWJA 1VF2A 5ECPB 3KMNA 2VUPA 1A24A 4ILFA 4HUAA 3VWVA 5CO3A 1PGTA 1V9WA 1M9AA 3GYKA 5IMDA 1EGRA 4FO5A 3DEXA 3GA4A 3UVHA 2QC7A 1XXUA 2H6ZA 4AF2A 3UL3A 2EIQA 2F8FA 3FR9A 1THXA 8GSSA 3BCIA 3KJYA 2IFQA 1SYXA 1GUMA 4IP1A 1SL2B 4ECJA 3MDKA 3PINA 4MF5A 1BYEA 2CAIA 2O89A 3LG6A 2ON5A 1XWAA 5ECSA 4CHSA 3KP9A 2VM1A 1PKZA 2C0FA 4TVEA 4FH8A 4JZQA 5AIVA 1BG5A 3TJJA 2GLRA 1R7HA 4V2NA 4ZBDA 2H8LA 3IXRA 1MDJA 3IV4A 2PVOC 2VM2A 4JE1A 1F9MA 5LCZA 3SWLA 5JWQB 1QFNA 2YWOA 3KH7A 1DE2A 1E2YA 5JCUA 5FHIA 1XW9A 2N5FA 4HU7A 2E0QA 5CREA 3GKMA 2VL9A 10GSA 2IMDA 3QD9A 2NTOA 4WR4A 2GQKA 2FA8A 1O8XA 1X5EA 2WB9A 3A2XA 1YQ1A 3TKQA 1K3LA 3L9SA 3IAM2 4KDUA 1ZGNA 4WF4A 1WPIA 2MMZA 5H5SA 2XPDA 2YPMA 1HQOA 2LQQA 1PN9A 5IM9A 2K8VA 5H5RA 2B5YA 3ZTLA 4JR4A 3BCKA 1SU9A 2GSRA 5J4UA 2I4AA 2K18A 2B5EA 2NPBA 1XOBA 4POBA 1O7UA 1V98A 3ZYWA 4I8BA 4YQUA 6GSUA 4MF7A 1HYUA 4KE3A 3LQ7A 4MK3A 1OAZA 2A2SA 2C1YA 5KN1A 3Q19A 3L78A 3ED3A 3TJKA 2AB6A 2OACA 4OD7A 5EVOA 2WJUA 1TTZA 14GSA 1YKCA 2H72A 2LJAA 2B3SA 5DALB 1USBA 1DSBA 5HQPA 3HZ8A 4QQ7A 1ML6A 5ECOB 1PRXA 3EU4A 1SK2A 2WFCA 3EINA 1V58A 1PKWA 2C0GA 5GAPD 3KMOA 5ENUA 4J57E 5D9TA 2DBCA 3F4TA 3DWVA 5CNWA 4ECIA 1ON4A 4WETA 3A2WA 2DC5A
chains in the Genus database with same CATH superfamily
4L0UA 1H4OA 2WCIA 4FIWA 2JACA 3NIVA 4ZILA 1M7TA 2FY6A 4XRDA 3H93A 5DCHA 4TRXA 1YJ6A 5CRHA 3ME7A 4PURA 4A5PA 5J5NA 2KUCA 3F3QA 4MH3A 3DXBA 5G5FA 2GSSA 3BBYA 2IJYA 2CA8A 3O6TA 4L5LA 4XS1A 3GKKA 5C04A 4DSSB 2R6KA 1GULA 5ECKB 2IIYA 2F51A 4MLYA 2CZ2A 4XS4B 5B8BA 4FYCA 3KM6A 1T8EB 2GS3A 2YJHA 2VL2A 4PQ1A 5L71A 1PMTA 3M0FA 1DBYA 5HFIA 3R2QA 2OA7A 4LA1A 2DJJA 4YKFA 2IN3A 2R2JA 1IYIA 4BVYA 3FKFA 1B9XC 2R0GA 4L8EA 4K7IA 3TGZA 5EY6A 3IOSA 5IPHA 3IR4A 2O8VB 3ERGA 4OO5A 3S9FA 3HVSA 5IMZA 4EIQA 4DSQA 1TKDB 2DMLA 2CVKA 2F8AA 4Q5QA 1Y25A 2LRNA 4ZBBA 5ECRB 1X0RA 1G7OA 3TOTA 2GZPA 3QAWA 5ELGA 3M9KA 1FOVA 4KF9A 1X5CA 4V1Ag 4E8HA 1K3YA 3QCPA 2LJKA 2X4AA 2VL2C 3ZMLA 1QMVA 5JWRB 1JFUA 12GSA 2TRXA 2PUKC 2O87A 2GT5A 4GF0A 4DEJA 2VCTA 4RI6A 1F6MC 2H6XA 5C00A 2HRNA 1PL2A 2LKUA 4ECBA 1HNCA 4PX1A 1J0FA 4IW9A 1MDIA 1TK8B 1PD21 2RLIA 2IPAA 2ZNMA 2HYXA 6GSVA 1GSFA 1NM3A 2FWFA 1Z5YE 3CMIA 3UBKA 4ZXGA 1VRSD 3TCOA 2LEGA 3C71A 4EO3A 2B1KA 5BMUA 2CQ9A 2L5LA 1NSWA 1GRXA 13GSA 2FWEA 5IMAA 4LMWA 2MBTA 3F9UA 4YKGA 1B4QA 4E8EA 5ECHB 4V1Ap 2ZUPA 3RPPA 5IMVA 5KN3A 3P2AA 1T4ZA 1OE7A 1ZYNA 4XS4A 3CTGA 5FT3A 1R5PA 1WE0A 2RUEA 4YQMA 2EC4A 1ZYEA 5B6NA 1YKAA 3HVXA 1EV9A 3EU3A 4HJ2A 1JZDA 1GUHA 1S3DA 1RK4A 4XS6A 4PQIA 3MAKA 11GSA 5DVBA 1K3OA 3GUSA 1LJRA 5DBQA 1F2EA 2O7KA 2AYTA 2P0GA 4XIHA 4ZL7A 4F82A 4XCSA 2V32A 1Z7RA 4IKHA 2FLSA 4O5UA 3LORA 3HXSA 3EMXA 3LWAA 1QK8A 2HZFA 4CY6A 4AJ6A 1V40A 2HE3A 2C3QA 4HZ4A 4NHZA 3WT2A 4JU5A 2FD3A 2VLUA 1PA3A 1Z7PA 4XHMA 4ID0A 3WGDA 2YOIA 3F0IA 5CRGA 2L57A 4IHUA 1S3AA 4MJBA 2A2PA 5G31A 3JCML 2TRCP 2C3TA 2P31A 2R37A 5GSTA 1AC1A 5KOXA 5ECIB 4BWSA 2OE3A 1WP0A 3GX0A 1R5AA 1FG4A 1UVZA 4P3YB 2H1DA 5ECLB 3KZQA 5J9CA 1FAAA 1YEPA 3ME8A 5GAND 4EE0A 1TK5B 4POMA 1FVJA 3ZIVA 1XW6A 5IPGA 2I3YA 3MWHA 1VF1A 20GSA 2XBIA 2H6YA 1I5GA 1SKSB 1QQ2A 3R3EA 3CRTA 5IQYA 4X0XA 5CP1A 2FNOA 3D0ZA 4O5QA 1GNEA 1GTIA 3M3MA 1SK1A 1SK0A 1FB6A 2ES7A 3ERWA 3VWWA 5DAKA 5JCWA 5CRDA 1Y6EA 3H1NA 3KP8A 1M2BA 2L5OA 1FOHA 1E6BA 1G6YA 3CXGA 1CQGA 16GSA 2UZ8A 4MPGA 3MIXA 5A4UA 2X8HA 1X5DA 4PUFC 1X9WB 2GT6A 3M1GA 4N30A 5HR2A 3IBHA 5LNKe 4MJAA 3NOFA 4BVXB 1GNWA 1ZYQB 1MDKA 2YN1A 1KNGA 1HD2A 3TDGA 3H8QA 2OBIA 1THOA 4WF5A 3F4RA 4K5RA 3E9JB 2L6CA 3L4NA 4TXVA 4F0BA 4MZCA 1XWGA 5HR0A 2VCZA 4KCAA 1F3BA 4GXZA 1TRUA 4EVMA 2H76A 3SBCA 5FWGA 2L59A 2G2QA 4JR6A 4DSRA 3HCZA 3C8EA 4MA9A 2HZEB 1TRWA 3UBLA 2LRTA 1O73A 1SKWB 2OKAA 2V2GA 1XWBA 3L0HA 1WRYA 2Z9SA 4TOPA 3TKSE 3CSHA 2GTUA 2LUSA 4CW9A 4KGIA 3W8JA 4O5RA 4ISDA 3EVIA 2FGXA 2ON7A 4FYBA 2E7PA 2GSTA 1FW1A 1U6TA 3IDVA 1YY7A 4KW6A 4HDEA 4NV2A 2V41A 3F3RA 1OKDA 4IELA 4TN8A 3ZFLA 3UAPA 2TIRA 3WYWA 4GQCA 3ZMKA 2X8GA 3F4SA 3I6AA 4NPBA 2E2MA 3UMAA 4EUYA 5J3RA 1SYRA 4Q5FA 1G7EA 2WGRA 4H86A 2H74A 3H79A 1AUCA 1GLQA 4POLA 2CV4A 3GURA 3ZLPA 2YP6A 2DIZA 18GSA 3QMXA 4OO4A 3W8SA 2K8SA 2R5GA 3Q74A 2XPEA 3QFBC 4KH7A 3TKPA 3EC3A 3HA9A 3UJ1A 2L4CA 5GZZB 2VL3A 1YZXA 2FWHA 4PGTA 2ALBA 4G0KA 4RQXA 4BVXA 5B8AA 1N8JA 2B6MA 4MABA 4DVCA 4IQ1A 3ZITA 2DMMA 2DKIA 1PL1A 2YWMA 3J7Yk 3V1WA 1SD9A 3GHAA 3L9VA 1O6JA 4G2EA 1BQ7A 3RHCA 1OE8A 3C73A 2A4VA 2AJQB 3ZL5A 4GSNA 4RQRA 1BAYA 3DKSA 3VLNA 4HSCX 4MCUA 2PBJA 1TRSA 5G1LA 3FZ9A 3G7YA 4OFTA 3IC4A 3LYPA 2HZEA 3LFLA 3L9UA 2ZCTA 3D4TA 2JSZA 1JLWA 3F63A 1K0CA 2H19A 5D8IA 4YAPA 1G0TA 4FYUA 2I9HA 3TOUA 2LJRA 2JZSA 2KOKA 4IQAA 2YANA 1BEDA 3D21A 4AGSA 3BJ5A 4J56E 3TRQA 4IN0A 4NHWA 2H0IA 2MZCA 3GH9A 4HQZA 4EKZA 4LLRA 2PVQA 4HZ2A 5E59A 1ABAA 1LU4A 1TU7A 2CX4A 2YV9A 3HJPA 3HZ4A 5F8BA 3RDWA 3WT1A 5H5QA 4OMVA 4EDZA 2O85A 4K8MA 2YV7A 2L4QA 2YWIA 3RPNA 3QFAC 1SL1B 3O3TA 4HU9A 5A4VA 3P8WA 2I1UA 1A0FA 4WBJA 2BTOT 4PNGA 2YZUA 2YZHA 5IO0A 2HRKA 1XBSA 1T3BA 5AIXA 1KEBA 4WKWA 2PERA 1ZCPA 4OCEA 2GQLA 2J23A 2H73A 4HJMA 1U87A 4ICYA 1MD3A 5G30A 4MP4A 2HXKA 4BA7A 4O92A 1KTEA 3GV1A 1FB0A 1GSYA 2DJ1A 4NMUA 3ZIJA 2C0EA 1FHEA 4GSSA 4G0LA 4PQHA 1ZYPA 4OFMA 6GSSA 2CT6A 4HOJA 5AISA 3C1RA 4IJIA 3GL5A 3LW9A 1AIUA 5GSSA 3US3A 1M2DA 1Z6NA 3VPQA 1RQMA 2N5BA 1CQHA 6GSXA 2F3MA 1Q4JA 1TW9A 3DYRA 3APQA 1K0MA 4MNNA 3GFKA 4Q5RA 3TRXA 2JZTA 3A5IA 1XOAA 5F06A 1A2MA 2MMOA 2HSHA 3M9JA 1WWJA 1Z3EA 2X99A 1ST9A 2LRCA 2XHFA 2AHEA 3VPTA 3P7XA 3E3EA 5D73A 4KCEA 4OWYA 5HFKA 5E4WA 2H1BA 1SJIA 6GSWA 4HEA2 3HY2A 2FCHA 2MMNA 2X64A 4CDOA 1WOUA 2VCVA 3DIEA 2HRAA 1S3CA 1ERWA 1T1VA 1SKRB 5B7CA 4JEDA 3LXTA 1M0UA 4L0WA 1K0DA 2RIIA 3IE3A 1TOFA 1A2JA 3CSJA 1EOGA 2KLXA 4LL1B 1AQXA 1RW1A 1YF1A 3ZFBA 3QR6A 5A5KA 9GSSA 2X49A 4BIKA 2QA1A 4MZWA 1PSQA 3QDNA 2YNXA 4X43A 2M80A 1WJKA 1W4VA 1FO5A 2D2ZA 3DGQA 3DVXA 5DJMA 1J08A 1W89A 1ZZYA 2WDUA 3HKRA 4K0NA 3ZVJA 5AN1A 2L6DA 3OR5A 4EF0A 5ELAA 2OE1A 3IHGA 4EC0A 4TXOB 4ECCA 5DAKB 2DSAA 4G9HA 2V6OA 4K2DA 3C7MA 2H66A 4MMMA 4PUAA 2VLTA 3VI7A 3HD5A 2B7JA 4OCFA 1EWXA 2V6KA 5INYA 1BX9A 1OC8A 4BL7B 1ERVA 4D73A 2M72A 5IO2A 5DQYA 1TRVA 1OC9B 1GH2A 3U6VA 1UN2A 2K9FA 4N10A 1T00A 2LQOA 2GZZA 2HSYA 5HR1A 4YAVA 1PX7A 3N9JA 2DIYA 3FRCA 1XPVA 1Z9HA 4TR1B 1HNAA 2XBQA 4HQSA 3EYTA 3KTLA 2LNSA 4HS1A 3UEMA 2PU9C 4EXJA 1U88A 3I69A 3Q18A 4I5QA 3HVVA 4Q5NA 4WEYA 4ZL9A 5IIZA 1JZRA 1GSDA 2P5QA 3VFIA 4GTUA 1UC7A 1B8XA 4YQVA 4NV5A 4IS0A 2C80A 4K7NA 3VI5A 2P5RA 3FW2A 1TJDA 3QOUA 2R4VA 1N2AA 2R0CA 3F8UA 4KB3A 3TUEA 5J41A 2H0GA 2NVLA 2A4HA 2VCWA 3DMLA 4LMVA 4KA0A 2OE0A 3FK8A 3IK9A 4QL7A 4L5OA 2E2GA 4Z7XA 4KDYA 5A4WA 3KH9A 4TXOA 1ACVA 4RUVA 3GX8A 3DD3A 2GSQA 4BPYA 2V1MA 4FQUA 2GVPA 1VGLA 1GUKA 2HLSA 1JHBA 2JU5A 1G6WA 5BRTA 3TJBA 3GIXA 4MJCA 4BL7A 3TRPA 3APSA 2LNTA 3KXOA 5IOXA 3VWXA 3F6FA 4KDXA 1TU8A 1OC9A 2RM5A 2FHEA 2H1AA 3DRNA 1PX6A 1GSSA 4KSMA 1X9SB 1MD4A 1OKTA 2MYGA 3LXZA 4TR1A 3GN3A 3VWUA 4EDYA 1VF4A 3D6IA 1F3AA 2VAFA 2PGTA 3EWLA 1A8YA 2VIMA 1EGOA 3LYKA 3KCMA 2CVBA 1OVNA 1K0BA 1A0RP 1Z6MA 3BD2A 4ZBAA 3TKSC 1ZL9A 3KIJA 2OADA 2H75A 1ERTA 1GTAA 2LTKA 4K6XA 1GSEA 2IMKA 3F6DA 4TKYA 2GGTA 5JWOB 3D5JA 2VOCA 2IWTA 4AJ8A 1O8WA 4WXTA 4I2TA 1XWKA 5J9BA 3UVTA 3GSTA 2JADA 4BWQA 1F37A 1M2AA 2IMEA 1TDIA 2B5XA 1OYJA 4MF6A 3C1SA 5CYYA 4Z2TA 1K0NA 3IA1A 1XIYA 1YDKA 1XWCA 5EPFA 1M3IA 5G5EA 4O32A 3E0UA 5ECMB 2KHPA 3BOAA 4K2XA 3WD6A 3LSZA 1SD8A 4IGJA 3GKXA 1AQWA 3A5WA 5D9WA 4JRRA 1GLPA 3PH9A 5F07A 4WR5A 3NZNA 22GSA 1T7PB 3HJOA 2EIOA 4WBRD 2HI7A 4NAXA 3G7JA 2IMIA 19GSA 4LL4B 1J9BA 4PXOA 4IJ3A 3WGEA 1R4WA 4MJEA 3TB2A 1NW2A 3QAVA 4F9ZA 3AY8A 4IP6A 2YWNA 3APOA 5IMFA 7GSSA 4GWRA 4ZB6A 1C72A 3CSIA 4PNFA 5ECNB 4N11A 1XVWA 1JZOA 3IPZA 1PQNA 3UARA 1ZMAA 2DLXA 1QGVA 1X9MB 2A2RA 5D9VA 4IVFA 4NXIA 2LS5A 1EP7A 1EEJA 2VD1A 1XVQA 2H1GA 4KX4A 1ZOFA 3IC8A 2REMA 1TI1A 4XTSA 1A2LA 3FY7A 4G0IA 1JZWA 5D93A 2K6VA 2NBSA 4G10A 1A23A 1SJ6A 2OBKA 4EIPA 2DJ0A 1GWCA 3IHQA 4YH2A 5DDLA 2AV4A 2FWGA 4N0VA 5DQSA 1BJXA 3N5OA 1B4PA 1M99A 2VO4A 4ZB9A 2DJ2A 3CYNA 1Q98A 3ZRDA 3WGXA 3IRAA 3KEBA 1ILOA 1H75A 2PPTA 4ML1A 3CRUA 4Z2RA 3FR6A 1AXDA 1M9BA 1SENA 3GSSA 1WIKA 1AAZA 2WS2A 3ZZXA 4J2FA 3EURA 4KAEA 2CVDA 2H30A 4I6XA 1TXXA 3LJRA 3HYPA 5F0GA 3FR3A 5IMCA 4MZBA 2VD0A 4I2UA 3GRXA 4CY8A 2EIRA 1T4YA 1MTCA 1TP9A 4JBBA 5CRWA 4ACSA 1K0AA 2CX3A 1TK0B 4QL9A 2JZRA 3I43A 1EP8A 2LSTA 1URMA 4D73B 3GTUB 3FEUA 5JCGA 2RUFA 4TR0A 1DUGA 3MSZA 5LD0A 2HFDA 4ZB8A 5DCGA 1JLVA 2GQMA 2H01A 3VK9A 5G1KA 4NWYA 1I9DA 1GL8A 3O76A 2CZ3A 2WRTA 3UIWA 1EZKA 1XG8A 3PGTA 5DALA 3QPMA 3PR8A 4GSTA 3CTFA 3IAS2 3CQFA 4K9ZA 2AAWA 3K8NA 5ECQB 2DKHA 3GH6A 1GSQA 3RHBA 1B9YC 2B7KA 2H0HA 3FZAA 1MEKA 1UA5A 2F9SA 1EV4A 1QXHA 3RBTA 3GMFA 4PTSA 1K0OA 2YCDA 5B6MA 1AW9A 2MMAA 1LBKA 1U3AA 4TR4A 4K1FA 2AUVA 1DE1A 5AGYA 4F0CA 3ISOA 3FMWA 2QKEA 4X1UA 4DSSA 2BMXA 2DJ3A 2VCQA 1GSUA 4KUNA 3LGCA 3HVNA 4MPFA 4K5SA 4V2MA 2G0FA 1EOHA 2H70A 2C3NA 1M3JA 1NHYA 1YF0A 1V57A 2C0DA 2QGVA 3I9V2 4O7HA 4Z2UA 4IBPA 1OC3A 2C4JA 4G19A 2GZYA 2X8CA 1R26A 1XZOA 3QAGA 2HT9A 2RM6A 3W6GA 5ID2B 1HNBA 2J9HA 3A3TA 3UOMA 4XRAA 2C8UA 5EL8A 3Q6OA 3VURA 3FHKA 4V2LA 4AJ7A 3GTUA 4ML6A 3FYGA 4N0ZA 3J7Yb 3KGKA 3G9BA 5D9XA 1TI3A 3HDCA 3HJMA 4RI7A 5HR3A 2I81A 1A8LA 2B1LA 4TR3A 4GQFA 4ZL8A 4F2IA 4HI7A 3CBUA 2PN8A 4ULXA 1GTUA 1SL0B 1VF3A 4OFNA 1FVKA 1O81A 3GKNA 3G7IA 17GSA 5KN0A 2M46A 5DJLA 4TW5A 5HFGA 4GLTA 3TKRA 1XFLA 2XC2A 2N5AA 1NHOA 2WULA 3ZVJD 2DJKA 3P90A 4ZIJA 1XCCA 4MH2A 1GP1A 3ERFA 2R3XA 2QSIA 1YEXA 2IFQB 3HHVA 5IOWA 2NDOA 1U3IA 2PMTA 4KSOA 1KBNA 2VLVA 2OJLA 3M8NA 5G2ZA 3D4MA 4F03A 2LV3A 5D96A 4EL1A 2MBSA 2FA4A 1V2AA 3RAZA 1IYHA 2YJ7A 4K0GA 3A2VA 1WMJA 6GSYA 2KP1A 3ZREA 1ERUA 5KEJA 1EEMA 3GNJA 5CAXA 3FZ4A 3D22A 4GCIA 3MNGA 4MDCA 5ID2A 2GDRA 3PPUA 3U5RE 3EE2A 4GRFA 2FUG2 2VCXA 2IL3A 3GL3A 2JSYA 4KNDA 1QUWA 3LEFA 2HSMA 4POKA 3IK7A 4K7OA 3KD0A 3TKSA 2IMFA 2HRFA 6GSTA 2JL4A 3EMPA 1AQVA 1SJZA 3TJFA 3H4KA 4I97A 5KN2A 2KP2A 3TJGA 2HNLA 3FZ5A 1O85A 1B48A 5F05A 3DVWA 1XW5A 2H71A 3KTBA 5ABRA 2WZ9A 5COHA 1GTBA 2CAQA 2R0PA 2BJXA 2PWJA 1VF2A 5ECPB 3KMNA 2VUPA 1A24A 4ILFA 4X4JA 4HUAA 3VWVA 5CO3A 1PGTA 1V9WA 1M9AA 3GYKA 5IMDA 1EGRA 4FO5A 3DEXA 3GA4A 3UVHA 2QC7A 1XXUA 2H6ZA 4AF2A 3UL3A 2EIQA 1PFOA 2F8FA 3FR9A 1THXA 4USSA 8GSSA 3BCIA 3KJYA 2IFQA 1SYXA 1GUMA 4IP1A 1SL2B 4ECJA 3MDKA 3PINA 4MF5A 1BYEA 2CAIA 2O89A 3LG6A 2ON5A 1XWAA 1PN0A 5ECSA 4CHSA 3KP9A 2VM1A 5KOWA 3MYDA 1PKZA 2C0FA 4TVEA 4FH8A 4JZQA 5AIVA 1BG5A 3TJJA 2GLRA 1R7HA 4V2NA 4ZBDA 2H8LA 3IXRA 2QA2A 1MDJA 3IV4A 2PVOC 2VM2A 4JE1A 1F9MA 5LCZA 3SWLA 5JWQB 1QFNA 2YWOA 3KH7A 1DE2A 1E2YA 5JCUA 5FHIA 1XW9A 2N5FA 4HU7A 2E0QA 5CREA 3GKMA 2VL9A 10GSA 2IMDA 3QD9A 2NTOA 4WR4A 2GQKA 2FA8A 1O8XA 1X5EA 2WB9A 3A2XA 1YQ1A 3TKQA 1K3LA 3L9SA 3IAM2 4KDUA 1ZGNA 4WF4A 1WPIA 2MMZA 3EPTA 5H5SA 2XPDA 2YPMA 1HQOA 1S3RA 2LQQA 1PN9A 5IM9A 2K8VA 5H5RA 2B5YA 3ZTLA 4JR4A 3BCKA 1SU9A 2GSRA 5J4UA 2I4AA 2K18A 4BVYB 2B5EA 2NPBA 1XOBA 4POBA 1O7UA 1V98A 3ZYWA 4I8BA 4YQUA 6GSUA 4MF7A 1HYUA 4KE3A 3LQ7A 4MK3A 1OAZA 2A2SA 2C1YA 5KN1A 3Q19A 3L78A 3ED3A 3TJKA 2AB6A 2OACA 4OD7A 5EVOA 2WJUA 1TTZA 14GSA 1YKCA 2H72A 2LJAA 2B3SA 5DALB 1USBA 1DSBA 5HQPA 3HZ8A 4QQ7A 1ML6A 5ECOB 1PRXA 3EU4A 1SK2A 2WFCA 3EINA 1V58A 1PKWA 2C0GA 5GAPD 3KMOA 5ENUA 4J57E 5D9TA 2DBCA 3F4TA 3DWVA 5CNWA 4ECIA 1ON4A 4WETA 3A2WA 2DC5A
chains in the Genus database with same CATH topology
4L0UA 1H4OA 2WCIA 4FIWA 2JACA 3NIVA 4ZILA 1M7TA 2FY6A 4XRDA 3H93A 5DCHA 4TRXA 1YJ6A 5CRHA 3ME7A 4PURA 4A5PA 5J5NA 2KUCA 3F3QA 4MH3A 3DXBA 5G5FA 2GSSA 3BBYA 2IJYA 2CA8A 3O6TA 4L5LA 4XS1A 3GKKA 5C04A 4DSSB 2R6KA 1GULA 5ECKB 2IIYA 2F51A 4MLYA 2CZ2A 4XS4B 5B8BA 4FYCA 3KM6A 1T8EB 2GS3A 2YJHA 2VL2A 4PQ1A 5L71A 1PMTA 3M0FA 1DBYA 5HFIA 3R2QA 2OA7A 4LA1A 2DJJA 4YKFA 2IN3A 2R2JA 1IYIA 4BVYA 3FKFA 1B9XC 2R0GA 4L8EA 4K7IA 3TGZA 5EY6A 3IOSA 5IPHA 3IR4A 2O8VB 3ERGA 4OO5A 3S9FA 3HVSA 5IMZA 4EIQA 4DSQA 1TKDB 2DMLA 2CVKA 2F8AA 4Q5QA 1Y25A 2LRNA 4ZBBA 5ECRB 1X0RA 1G7OA 3TOTA 2GZPA 3QAWA 5ELGA 3M9KA 1FOVA 4KF9A 1X5CA 4V1Ag 4E8HA 1K3YA 3QCPA 2LJKA 2X4AA 2VL2C 3ZMLA 1QMVA 5JWRB 1JFUA 12GSA 2TRXA 2PUKC 2O87A 2GT5A 4GF0A 4DEJA 2VCTA 4RI6A 1F6MC 2H6XA 5C00A 2HRNA 1PL2A 2LKUA 4ECBA 1HNCA 4PX1A 1J0FA 4IW9A 1MDIA 1TK8B 1PD21 2RLIA 2IPAA 2ZNMA 2HYXA 6GSVA 1GSFA 1NM3A 2FWFA 1Z5YE 3CMIA 3UBKA 4ZXGA 1VRSD 3TCOA 2LEGA 3C71A 4EO3A 2B1KA 5BMUA 2CQ9A 2L5LA 1NSWA 1GRXA 13GSA 2FWEA 5IMAA 4LMWA 2MBTA 3F9UA 4YKGA 1B4QA 4E8EA 5ECHB 4V1Ap 2ZUPA 3RPPA 5IMVA 5KN3A 3P2AA 1T4ZA 1OE7A 1ZYNA 4XS4A 3CTGA 5FT3A 1R5PA 1WE0A 2RUEA 4YQMA 2EC4A 1ZYEA 5B6NA 1YKAA 3HVXA 1EV9A 3EU3A 4HJ2A 1JZDA 1GUHA 1S3DA 1RK4A 4XS6A 4PQIA 3MAKA 11GSA 5DVBA 1K3OA 3GUSA 1LJRA 5DBQA 1F2EA 2O7KA 2AYTA 2P0GA 4XIHA 4ZL7A 4F82A 4XCSA 2V32A 1Z7RA 4IKHA 2FLSA 4O5UA 3LORA 3HXSA 3EMXA 3LWAA 1QK8A 2HZFA 4CY6A 4AJ6A 1V40A 2HE3A 2C3QA 4HZ4A 4NHZA 3WT2A 4JU5A 2FD3A 2VLUA 1PA3A 1Z7PA 4XHMA 4ID0A 3WGDA 2YOIA 3F0IA 5CRGA 2L57A 4IHUA 1S3AA 4MJBA 2A2PA 5G31A 3JCML 2TRCP 2C3TA 2P31A 2R37A 5GSTA 1AC1A 5KOXA 5ECIB 4BWSA 2OE3A 1WP0A 3GX0A 1R5AA 1FG4A 1UVZA 4P3YB 2H1DA 5ECLB 3KZQA 5J9CA 1FAAA 1YEPA 3ME8A 5GAND 4EE0A 1TK5B 4POMA 1FVJA 3ZIVA 1XW6A 5IPGA 2I3YA 3MWHA 1VF1A 20GSA 2XBIA 2H6YA 1I5GA 1SKSB 1QQ2A 3R3EA 3CRTA 5IQYA 4X0XA 5CP1A 2FNOA 3D0ZA 4O5QA 1GNEA 1GTIA 3M3MA 1SK1A 1SK0A 1FB6A 2ES7A 3ERWA 3VWWA 5DAKA 5JCWA 5CRDA 1Y6EA 3H1NA 3KP8A 1M2BA 2L5OA 1FOHA 1E6BA 1G6YA 3CXGA 1CQGA 16GSA 2UZ8A 4MPGA 3MIXA 5A4UA 2X8HA 1X5DA 4PUFC 1X9WB 2GT6A 3M1GA 4N30A 5HR2A 3IBHA 5LNKe 4MJAA 3NOFA 4BVXB 1GNWA 1ZYQB 1MDKA 2YN1A 1KNGA 1HD2A 3TDGA 3H8QA 2OBIA 1THOA 4WF5A 3F4RA 4K5RA 3E9JB 2L6CA 3L4NA 4TXVA 4F0BA 4MZCA 1XWGA 5HR0A 2VCZA 4KCAA 1F3BA 4GXZA 1TRUA 4EVMA 2H76A 3SBCA 5FWGA 2L59A 2G2QA 4JR6A 4DSRA 3HCZA 3C8EA 4MA9A 2HZEB 1TRWA 3UBLA 2LRTA 1O73A 1SKWB 2OKAA 2V2GA 1XWBA 3L0HA 1WRYA 2Z9SA 4TOPA 3TKSE 3CSHA 2GTUA 2LUSA 4CW9A 4KGIA 3W8JA 4O5RA 4ISDA 3EVIA 2FGXA 2ON7A 4FYBA 2E7PA 2GSTA 1FW1A 1U6TA 3IDVA 1YY7A 4KW6A 4HDEA 4NV2A 2V41A 3F3RA 1OKDA 4IELA 4TN8A 3ZFLA 3UAPA 2TIRA 3WYWA 4GQCA 3ZMKA 2X8GA 3F4SA 3I6AA 4NPBA 2E2MA 3UMAA 4EUYA 5J3RA 1SYRA 4Q5FA 1G7EA 2WGRA 4H86A 2H74A 3H79A 1AUCA 1GLQA 4POLA 2CV4A 3GURA 3ZLPA 2YP6A 2DIZA 18GSA 3QMXA 4OO4A 3W8SA 2K8SA 2R5GA 3Q74A 2XPEA 3QFBC 4KH7A 3TKPA 3EC3A 3HA9A 3UJ1A 2L4CA 5GZZB 2VL3A 1YZXA 2FWHA 4PGTA 2ALBA 4G0KA 4RQXA 4BVXA 5B8AA 1N8JA 2B6MA 4MABA 4DVCA 4IQ1A 3ZITA 2DMMA 2DKIA 1PL1A 2YWMA 3J7Yk 3V1WA 1SD9A 3GHAA 3L9VA 1O6JA 4G2EA 1BQ7A 3RHCA 1OE8A 3C73A 2A4VA 2AJQB 3ZL5A 4GSNA 4RQRA 1BAYA 3DKSA 3VLNA 4MCUA 2PBJA 1TRSA 5G1LA 3FZ9A 3G7YA 4OFTA 3IC4A 3LYPA 2HZEA 3LFLA 3L9UA 2ZCTA 3D4TA 2JSZA 1JLWA 3F63A 1K0CA 2H19A 5D8IA 4YAPA 1G0TA 4FYUA 2I9HA 3TOUA 2LJRA 2JZSA 2KOKA 4IQAA 2YANA 1BEDA 3D21A 4AGSA 3BJ5A 4J56E 3TRQA 4IN0A 4NHWA 2H0IA 2MZCA 3GH9A 4HQZA 4EKZA 4LLRA 2PVQA 4HZ2A 5E59A 1ABAA 1LU4A 1TU7A 2CX4A 2YV9A 3HJPA 3HZ4A 5F8BA 3RDWA 3WT1A 5H5QA 4OMVA 4EDZA 2O85A 4K8MA 2YV7A 2L4QA 2YWIA 3RPNA 3QFAC 1SL1B 3O3TA 4HU9A 5A4VA 3P8WA 2I1UA 1A0FA 4WBJA 2BTOT 4PNGA 2YZUA 2YZHA 5IO0A 2HRKA 1XBSA 1T3BA 5AIXA 1KEBA 4WKWA 2PERA 1ZCPA 4OCEA 2GQLA 2J23A 2H73A 4HJMA 1U87A 4ICYA 1MD3A 5G30A 4MP4A 2HXKA 4BA7A 4O92A 1KTEA 3GV1A 1FB0A 1GSYA 2DJ1A 4NMUA 3ZIJA 2C0EA 1FHEA 4GSSA 4G0LA 4PQHA 1ZYPA 4OFMA 6GSSA 2CT6A 4HOJA 5AISA 3C1RA 4IJIA 3GL5A 3LW9A 1AIUA 5GSSA 3US3A 1M2DA 1Z6NA 3VPQA 1RQMA 2N5BA 1CQHA 6GSXA 2F3MA 1Q4JA 1TW9A 3DYRA 3APQA 1K0MA 4MNNA 3GFKA 4Q5RA 3TRXA 2JZTA 3A5IA 1XOAA 5F06A 1A2MA 2MMOA 2HSHA 3M9JA 1WWJA 1Z3EA 2X99A 1ST9A 2LRCA 2XHFA 2AHEA 3VPTA 3P7XA 3E3EA 5D73A 4KCEA 4OWYA 5HFKA 5E4WA 2H1BA 1SJIA 6GSWA 4HEA2 3HY2A 2FCHA 2MMNA 2X64A 4CDOA 1WOUA 2VCVA 3DIEA 2HRAA 1S3CA 1ERWA 1T1VA 1SKRB 5B7CA 4JEDA 3LXTA 1M0UA 4L0WA 1K0DA 2RIIA 3IE3A 1TOFA 1A2JA 3CSJA 1EOGA 2KLXA 4LL1B 1AQXA 1RW1A 1YF1A 3ZFBA 3QR6A 5A5KA 9GSSA 2X49A 2QA1A 4MZWA 1PSQA 3QDNA 2YNXA 4X43A 2M80A 1WJKA 1W4VA 1FO5A 2D2ZA 3DGQA 3DVXA 5DJMA 1J08A 1W89A 1ZZYA 2WDUA 3HKRA 4K0NA 3ZVJA 5AN1A 2L6DA 3OR5A 4EF0A 5ELAA 2OE1A 3IHGA 4EC0A 4TXOB 4ECCA 5DAKB 2DSAA 4G9HA 2V6OA 4K2DA 3C7MA 2H66A 4MMMA 4PUAA 2VLTA 3VI7A 3HD5A 2B7JA 4OCFA 1EWXA 2V6KA 5INYA 1BX9A 1OC8A 4BL7B 1ERVA 4D73A 2M72A 5IO2A 5DQYA 1TRVA 1OC9B 1GH2A 3U6VA 1UN2A 2K9FA 4N10A 1T00A 2LQOA 2GZZA 2HSYA 5HR1A 4YAVA 1PX7A 3N9JA 2DIYA 3FRCA 1XPVA 1Z9HA 4TR1B 1HNAA 2XBQA 4HQSA 3EYTA 3KTLA 2LNSA 4HS1A 3UEMA 2PU9C 4EXJA 1U88A 3I69A 3Q18A 4I5QA 3HVVA 4Q5NA 4WEYA 4ZL9A 5IIZA 1JZRA 1GSDA 2P5QA 3VFIA 4GTUA 1UC7A 1B8XA 4YQVA 4NV5A 4IS0A 2C80A 4K7NA 3VI5A 2P5RA 3FW2A 1TJDA 3QOUA 2R4VA 1N2AA 2R0CA 3F8UA 4KB3A 3TUEA 5J41A 2H0GA 2NVLA 2A4HA 2VCWA 3DMLA 4LMVA 4KA0A 2OE0A 3FK8A 3IK9A 4QL7A 4L5OA 2E2GA 4Z7XA 4KDYA 5A4WA 3KH9A 4TXOA 1ACVA 4RUVA 3GX8A 3DD3A 2GSQA 4BPYA 2V1MA 4FQUA 2GVPA 1VGLA 1GUKA 2HLSA 1JHBA 2JU5A 1G6WA 5BRTA 3TJBA 3GIXA 4MJCA 4BL7A 3TRPA 3APSA 2LNTA 3KXOA 5IOXA 3VWXA 3F6FA 4KDXA 1TU8A 1OC9A 2RM5A 2FHEA 2H1AA 3DRNA 1PX6A 1GSSA 4KSMA 1X9SB 1MD4A 1OKTA 2MYGA 3LXZA 4TR1A 3GN3A 3VWUA 4EDYA 1VF4A 3D6IA 1F3AA 2VAFA 2PGTA 3EWLA 1A8YA 2VIMA 1EGOA 3LYKA 3KCMA 2CVBA 1OVNA 1K0BA 1A0RP 1Z6MA 3BD2A 4ZBAA 3TKSC 1ZL9A 3KIJA 2OADA 2H75A 1ERTA 1GTAA 2LTKA 4K6XA 1GSEA 2IMKA 3F6DA 4TKYA 2GGTA 5JWOB 3D5JA 2VOCA 2IWTA 4AJ8A 1O8WA 4WXTA 4I2TA 1XWKA 5J9BA 3UVTA 3GSTA 2JADA 4BWQA 1F37A 1M2AA 2IMEA 1TDIA 2B5XA 1OYJA 4MF6A 3C1SA 5CYYA 4Z2TA 1K0NA 3IA1A 1XIYA 1YDKA 1XWCA 5EPFA 5G5EA 4O32A 3E0UA 5ECMB 2KHPA 3BOAA 4K2XA 3WD6A 3LSZA 1SD8A 4IGJA 3GKXA 1AQWA 3A5WA 5D9WA 4JRRA 1GLPA 3PH9A 5F07A 4WR5A 3NZNA 22GSA 1T7PB 3HJOA 2EIOA 4WBRD 2HI7A 4NAXA 3G7JA 2IMIA 19GSA 4LL4B 1J9BA 4PXOA 4IJ3A 3WGEA 1R4WA 4MJEA 3TB2A 1NW2A 3QAVA 4F9ZA 3AY8A 4IP6A 2YWNA 3APOA 5IMFA 7GSSA 4GWRA 4ZB6A 1C72A 3CSIA 4PNFA 5ECNB 4N11A 1XVWA 1JZOA 3IPZA 1PQNA 3UARA 1ZMAA 2DLXA 1QGVA 1X9MB 2A2RA 5D9VA 4IVFA 4NXIA 2LS5A 1EP7A 1EEJA 2VD1A 1XVQA 2H1GA 4KX4A 1ZOFA 3IC8A 2REMA 1TI1A 4XTSA 1A2LA 3FY7A 4G0IA 1JZWA 5D93A 2K6VA 2NBSA 4G10A 1A23A 1SJ6A 2OBKA 4EIPA 2DJ0A 1GWCA 3IHQA 4YH2A 5DDLA 2AV4A 2FWGA 4N0VA 5DQSA 1BJXA 3N5OA 1B4PA 1M99A 2VO4A 4ZB9A 2DJ2A 3CYNA 1Q98A 3ZRDA 3WGXA 3IRAA 3KEBA 1ILOA 1H75A 2PPTA 4ML1A 3CRUA 4Z2RA 3FR6A 1AXDA 1M9BA 1SENA 3GSSA 1WIKA 1AAZA 2WS2A 3ZZXA 4J2FA 3EURA 4KAEA 2CVDA 2H30A 4I6XA 1TXXA 3LJRA 3HYPA 5F0GA 3FR3A 5IMCA 4MZBA 2VD0A 4I2UA 3GRXA 4CY8A 2EIRA 1T4YA 1MTCA 1TP9A 4JBBA 5CRWA 4ACSA 1K0AA 2CX3A 1TK0B 4QL9A 2JZRA 3I43A 1EP8A 2LSTA 1URMA 4D73B 3GTUB 3FEUA 5JCGA 2RUFA 4TR0A 1DUGA 3MSZA 5LD0A 2HFDA 4ZB8A 5DCGA 1JLVA 2GQMA 2H01A 3VK9A 5G1KA 4NWYA 1I9DA 1GL8A 3O76A 2CZ3A 2WRTA 3UIWA 1EZKA 3PGTA 5DALA 3QPMA 3PR8A 4GSTA 3CTFA 3IAS2 4K9ZA 2AAWA 3K8NA 5ECQB 2DKHA 3GH6A 1GSQA 3RHBA 1B9YC 2B7KA 2H0HA 3FZAA 1MEKA 1UA5A 2F9SA 1EV4A 1QXHA 3RBTA 3GMFA 4PTSA 1K0OA 2YCDA 5B6MA 1AW9A 2MMAA 1LBKA 1U3AA 4TR4A 4K1FA 2AUVA 1DE1A 5AGYA 4F0CA 3ISOA 3FMWA 2QKEA 4X1UA 4DSSA 2BMXA 2DJ3A 2VCQA 1GSUA 4KUNA 3LGCA 4MPFA 4V2MA 4K5SA 2G0FA 1EOHA 2H70A 2C3NA 1NHYA 1YF0A 1V57A 2C0DA 2QGVA 3I9V2 4O7HA 4Z2UA 4IBPA 1OC3A 2C4JA 4G19A 2GZYA 2X8CA 1R26A 1XZOA 3QAGA 2HT9A 2RM6A 3W6GA 5ID2B 1HNBA 2J9HA 3A3TA 3UOMA 4XRAA 2C8UA 5EL8A 3Q6OA 3VURA 3FHKA 4V2LA 4AJ7A 3GTUA 4ML6A 3FYGA 4N0ZA 3J7Yb 3KGKA 3G9BA 5D9XA 1TI3A 3HDCA 3HJMA 4RI7A 5HR3A 2I81A 1A8LA 2B1LA 4TR3A 4GQFA 4ZL8A 4F2IA 4HI7A 3CBUA 2PN8A 4ULXA 1GTUA 1SL0B 1VF3A 4OFNA 1FVKA 1O81A 3GKNA 3G7IA 17GSA 5KN0A 2M46A 5DJLA 4TW5A 5HFGA 4GLTA 3TKRA 1XFLA 2XC2A 2N5AA 1NHOA 2WULA 3ZVJD 2DJKA 3P90A 4ZIJA 1XCCA 4MH2A 1GP1A 3ERFA 2R3XA 2QSIA 1YEXA 2IFQB 3HHVA 5IOWA 2NDOA 1U3IA 2PMTA 4KSOA 1KBNA 2VLVA 2OJLA 3M8NA 5G2ZA 3D4MA 4F03A 2LV3A 5D96A 4EL1A 2MBSA 2FA4A 1V2AA 3RAZA 1IYHA 2YJ7A 4K0GA 3A2VA 1WMJA 6GSYA 2KP1A 3ZREA 1ERUA 5KEJA 1EEMA 3GNJA 5CAXA 3FZ4A 3D22A 4GCIA 3MNGA 4MDCA 5ID2A 2GDRA 3PPUA 3U5RE 3EE2A 4GRFA 2FUG2 2VCXA 2IL3A 3GL3A 2JSYA 4KNDA 1QUWA 3LEFA 2HSMA 4POKA 3IK7A 4K7OA 3KD0A 3TKSA 2IMFA 2HRFA 6GSTA 2JL4A 3EMPA 1AQVA 1SJZA 3TJFA 3H4KA 4I97A 5KN2A 2KP2A 3TJGA 2HNLA 3FZ5A 1O85A 1B48A 5F05A 3DVWA 1XW5A 2H71A 3KTBA 5ABRA 2WZ9A 5COHA 1GTBA 2CAQA 2R0PA 2BJXA 2PWJA 1VF2A 5ECPB 3KMNA 2VUPA 1A24A 4ILFA 4X4JA 4HUAA 3VWVA 5CO3A 1PGTA 1V9WA 1M9AA 3GYKA 5IMDA 1EGRA 4FO5A 3DEXA 3GA4A 3UVHA 2QC7A 1XXUA 2H6ZA 4AF2A 3UL3A 2EIQA 2F8FA 3FR9A 1THXA 4USSA 8GSSA 3BCIA 3KJYA 2IFQA 1SYXA 1GUMA 4IP1A 1SL2B 4ECJA 3MDKA 3PINA 4MF5A 1BYEA 2CAIA 2O89A 3LG6A 2ON5A 1XWAA 1PN0A 5ECSA 4CHSA 3KP9A 2VM1A 5KOWA 3MYDA 1PKZA 2C0FA 4TVEA 4FH8A 4JZQA 5AIVA 1BG5A 3TJJA 2GLRA 1R7HA 4V2NA 4ZBDA 2H8LA 3IXRA 2QA2A 1MDJA 3IV4A 2PVOC 2VM2A 4JE1A 1F9MA 5LCZA 3SWLA 5JWQB 1QFNA 2YWOA 3KH7A 1DE2A 1E2YA 5JCUA 5FHIA 1XW9A 2N5FA 4HU7A 2E0QA 5CREA 3GKMA 2VL9A 10GSA 2IMDA 3QD9A 2NTOA 4WR4A 2GQKA 2FA8A 1O8XA 1X5EA 2WB9A 3A2XA 1YQ1A 3TKQA 1K3LA 3L9SA 3IAM2 4KDUA 1ZGNA 4WF4A 1WPIA 2MMZA 3EPTA 5H5SA 2XPDA 2YPMA 1HQOA 2LQQA 1PN9A 5IM9A 2K8VA 5H5RA 2B5YA 3ZTLA 4JR4A 3BCKA 1SU9A 2GSRA 5J4UA 2I4AA 2K18A 4BVYB 2B5EA 2NPBA 1XOBA 4POBA 1O7UA 1V98A 3ZYWA 4I8BA 4YQUA 6GSUA 4MF7A 1HYUA 4KE3A 3LQ7A 4MK3A 1OAZA 2A2SA 2C1YA 5KN1A 3Q19A 3L78A 3ED3A 3TJKA 2AB6A 2OACA 4OD7A 5EVOA 2WJUA 1TTZA 14GSA 1YKCA 2H72A 2LJAA 2B3SA 5DALB 1USBA 1DSBA 5HQPA 3HZ8A 4QQ7A 1ML6A 5ECOB 1PRXA 3EU4A 1SK2A 2WFCA 3EINA 1V58A 1PKWA 2C0GA 5GAPD 3KMOA 5ENUA 4J57E 5D9TA 2DBCA 3F4TA 3DWVA 5CNWA 4ECIA 1ON4A 4WETA 3A2WA 2DC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L0U A;  1H4O A;  2WCI A;  4FIW A;  2JAC A;  3NIV A;  4ZIL A;  1M7T A;  2FY6 A;  4XRD A;  3H93 A;  5DCH A;  4TRX A;  1YJ6 A;  5CRH A;  3ME7 A;  4PUR A;  5J5N A;  2KUC A;  3F3Q A;  4MH3 A;  3DXB A;  5G5F A;  2GSS A;  3BBY A;  2IJY A;  2CA8 A;  3O6T A;  4L5L A;  4XS1 A;  3GKK A;  5C04 A;  4DSS B;  2R6K A;  1GUL A;  5ECK B;  2IIY A;  2F51 A;  4MLY A;  2CZ2 A;  4XS4 B;  5B8B A;  4FYC A;  3KM6 A;  1T8E B;  2GS3 A;  2YJH A;  2VL2 A;  4PQ1 A;  5L71 A;  1PMT A;  3M0F A;  1DBY A;  5HFI A;  3R2Q A;  2OA7 A;  4LA1 A;  2DJJ A;  2IN3 A;  2R2J A;  1IYI A;  4BVY A;  3FKF A;  1B9X C;  4L8E A;  4K7I A;  3TGZ A;  5EY6 A;  3IOS A;  5IPH A;  3IR4 A;  2O8V B;  3ERG A;  4OO5 A;  3S9F A;  3HVS A;  5IMZ A;  4DSQ A;  1TKD B;  2DML A;  2CVK A;  2F8A A;  4Q5Q A;  1Y25 A;  2LRN A;  4ZBB A;  5ECR B;  1X0R A;  1G7O A;  3TOT A;  2GZP A;  3QAW A;  5ELG A;  3M9K A;  1FOV A;  1X5C A;  4V1A g;  4E8H A;  1K3Y A;  3QCP A;  2LJK A;  2VL2 C;  3ZML A;  1QMV A;  5JWR B;  1JFU A;  12GS A;  2TRX A;  2PUK C;  2O87 A;  2GT5 A;  4GF0 A;  4DEJ A;  2VCT A;  4RI6 A;  1F6M C;  2H6X A;  5C00 A;  2HRN A;  1PL2 A;  2LKU A;  4ECB A;  1HNC A;  4PX1 A;  1J0F A;  4IW9 A;  1MDI A;  1TK8 B;  1PD2 1;  2RLI A;  2IPA A;  2ZNM A;  2HYX A;  6GSV A;  1GSF A;  1NM3 A;  2FWF A;  1Z5Y E;  3CMI A;  3UBK A;  4ZXG A;  1VRS D;  3TCO A;  2LEG A;  3C71 A;  4EO3 A;  2B1K A;  2CQ9 A;  2L5L A;  1NSW A;  1GRX A;  13GS A;  2FWE A;  5IMA A;  4LMW A;  2MBT A;  3F9U A;  1B4Q A;  4E8E A;  5ECH B;  4V1A p;  2ZUP A;  3RPP A;  5IMV A;  5KN3 A;  3P2A A;  1T4Z A;  1OE7 A;  4XS4 A;  3CTG A;  5FT3 A;  1R5P A;  1WE0 A;  2RUE A;  4YQM A;  2EC4 A;  1ZYE A;  5B6N A;  1YKA A;  3HVX A;  1EV9 A;  3EU3 A;  4HJ2 A;  1JZD A;  1GUH A;  1S3D A;  1RK4 A;  4XS6 A;  4PQI A;  3MAK A;  11GS A;  5DVB A;  1K3O A;  3GUS A;  1LJR A;  5DBQ A;  1F2E A;  2O7K A;  2AYT A;  2P0G A;  4XIH A;  4ZL7 A;  4F82 A;  4XCS A;  2V32 A;  1Z7R A;  4IKH A;  2FLS A;  3LOR A;  3HXS A;  3EMX A;  3LWA A;  1QK8 A;  2HZF A;  4AJ6 A;  1V40 A;  2HE3 A;  2C3Q A;  4HZ4 A;  4NHZ A;  3WT2 A;  4JU5 A;  2FD3 A;  2VLU A;  1PA3 A;  1Z7P A;  4XHM A;  4ID0 A;  3WGD A;  2YOI A;  3F0I A;  5CRG A;  2L57 A;  4IHU A;  1S3A A;  4MJB A;  5G31 A;  3JCM L;  2TRC P;  2C3T A;  2P31 A;  2R37 A;  5GST A;  1AC1 A;  5ECI B;  4BWS A;  2OE3 A;  1WP0 A;  3GX0 A;  1R5A A;  1FG4 A;  1UVZ A;  4P3Y B;  2H1D A;  5ECL B;  3KZQ A;  5J9C A;  1FAA A;  1YEP A;  3ME8 A;  5GAN D;  4EE0 A;  1TK5 B;  4POM A;  1FVJ A;  3ZIV A;  1XW6 A;  5IPG A;  2I3Y A;  3MWH A;  1VF1 A;  20GS A;  2XBI A;  2H6Y A;  1I5G A;  1SKS B;  1QQ2 A;  3CRT A;  5IQY A;  4X0X A;  5CP1 A;  2FNO A;  3D0Z A;  1GNE A;  1GTI A;  3M3M A;  1SK1 A;  1SK0 A;  1FB6 A;  2ES7 A;  3ERW A;  3VWW A;  5DAK A;  5JCW A;  5CRD A;  1Y6E A;  3H1N A;  3KP8 A;  1M2B A;  2L5O A;  1E6B A;  1G6Y A;  3CXG A;  1CQG A;  16GS A;  4MPG A;  5A4U A;  2X8H A;  1X5D A;  4PUF C;  1X9W B;  2GT6 A;  3M1G A;  4N30 A;  5HR2 A;  3IBH A;  5LNK e;  4MJA A;  3NOF A;  1GNW A;  1ZYQ B;  1MDK A;  2YN1 A;  1KNG A;  1HD2 A;  3TDG A;  3H8Q A;  2OBI A;  1THO A;  4WF5 A;  3F4R A;  3E9J B;  2L6C A;  3L4N A;  4TXV A;  4F0B A;  4MZC A;  1XWG A;  5HR0 A;  2VCZ A;  4KCA A;  1F3B A;  4GXZ A;  1TRU A;  4EVM A;  2H76 A;  3SBC A;  5FWG A;  2L59 A;  2G2Q A;  4JR6 A;  4DSR A;  3HCZ A;  3C8E A;  4MA9 A;  2HZE B;  1TRW A;  3UBL A;  2LRT A;  1O73 A;  1SKW B;  2OKA A;  2V2G A;  1XWB A;  3L0H A;  1WRY A;  2Z9S A;  4TOP A;  3TKS E;  3CSH A;  2GTU A;  2LUS A;  4CW9 A;  4KGI A;  3W8J A;  4O5R A;  4ISD A;  3EVI A;  2FGX A;  2ON7 A;  4FYB A;  2E7P A;  2GST A;  1FW1 A;  1U6T A;  3IDV A;  1YY7 A;  4KW6 A;  4HDE A;  4NV2 A;  2V41 A;  3F3R A;  1OKD A;  4IEL A;  4TN8 A;  3ZFL A;  3UAP A;  2TIR A;  3WYW A;  4GQC A;  3ZMK A;  2X8G A;  3F4S A;  3I6A A;  4NPB A;  2E2M A;  3UMA A;  4EUY A;  5J3R A;  1SYR A;  4Q5F A;  1G7E A;  2WGR A;  4H86 A;  2H74 A;  3H79 A;  1AUC A;  1GLQ A;  4POL A;  2CV4 A;  3GUR A;  3ZLP A;  2YP6 A;  2DIZ A;  18GS A;  3QMX A;  4OO4 A;  3W8S A;  2K8S A;  2R5G A;  3Q74 A;  2XPE A;  3QFB C;  4KH7 A;  3TKP A;  3EC3 A;  3HA9 A;  3UJ1 A;  2L4C A;  5GZZ B;  2VL3 A;  1YZX A;  2FWH A;  4PGT A;  2ALB A;  4RQX A;  4BVX A;  5B8A A;  1N8J A;  2B6M A;  4MAB A;  4DVC A;  4IQ1 A;  3ZIT A;  2DMM A;  1PL1 A;  2YWM A;  3J7Y k;  3V1W A;  1SD9 A;  3GHA A;  3L9V A;  1O6J A;  4G2E A;  1BQ7 A;  3RHC A;  1OE8 A;  3C73 A;  2A4V A;  2AJQ B;  3ZL5 A;  4GSN A;  4RQR A;  1BAY A;  3DKS A;  3VLN A;  4MCU A;  2PBJ A;  1TRS A;  5G1L A;  3FZ9 A;  3G7Y A;  4OFT A;  3IC4 A;  3LYP A;  2HZE A;  3LFL A;  3L9U A;  2ZCT A;  3D4T A;  2JSZ A;  1JLW A;  3F63 A;  1K0C A;  2H19 A;  5D8I A;  4YAP A;  1G0T A;  4FYU A;  2I9H A;  3TOU A;  2LJR A;  2JZS A;  2KOK A;  4IQA A;  2YAN A;  1BED A;  3D21 A;  4AGS A;  3BJ5 A;  4J56 E;  3TRQ A;  4IN0 A;  4NHW A;  2H0I A;  2MZC A;  3GH9 A;  4HQZ A;  4EKZ A;  4LLR A;  2PVQ A;  4HZ2 A;  5E59 A;  1ABA A;  1LU4 A;  1TU7 A;  2CX4 A;  2YV9 A;  3HJP A;  3HZ4 A;  5F8B A;  3RDW A;  3WT1 A;  5H5Q A;  4OMV A;  4EDZ A;  2O85 A;  4K8M A;  2YV7 A;  2L4Q A;  2YWI A;  3RPN A;  3QFA C;  1SL1 B;  3O3T A;  4HU9 A;  5A4V A;  3P8W A;  2I1U A;  1A0F A;  4WBJ A;  2BTO T;  4PNG A;  2YZU A;  2YZH A;  5IO0 A;  1XBS A;  1T3B A;  5AIX A;  1KEB A;  4WKW A;  2PER A;  1ZCP A;  4OCE A;  2GQL A;  2J23 A;  2H73 A;  4HJM A;  1U87 A;  1MD3 A;  5G30 A;  4MP4 A;  2HXK A;  4BA7 A;  4O92 A;  1KTE A;  3GV1 A;  1FB0 A;  1GSY A;  2DJ1 A;  4NMU A;  3ZIJ A;  2C0E A;  1FHE A;  4GSS A;  4PQH A;  4OFM A;  6GSS A;  2CT6 A;  4HOJ A;  5AIS A;  3C1R A;  4IJI A;  3GL5 A;  5GSS A;  1AIU A;  3US3 A;  1M2D A;  1Z6N A;  3VPQ A;  1RQM A;  2N5B A;  1CQH A;  6GSX A;  2F3M A;  1Q4J A;  1TW9 A;  3DYR A;  3APQ A;  1K0M A;  3GFK A;  4Q5R A;  3TRX A;  2JZT A;  1XOA A;  5F06 A;  1A2M A;  2MMO A;  2HSH A;  3M9J A;  1WWJ A;  1Z3E A;  2X99 A;  1ST9 A;  2LRC A;  2XHF A;  2AHE A;  3VPT A;  3P7X A;  3E3E A;  5D73 A;  4KCE A;  4OWY A;  5HFK A;  5E4W A;  2H1B A;  1SJI A;  6GSW A;  4HEA 2;  3HY2 A;  2FCH A;  2MMN A;  2X64 A;  4CDO A;  1WOU A;  2VCV A;  3DIE A;  1S3C A;  1ERW A;  1T1V A;  1SKR B;  5B7C A;  4JED A;  3LXT A;  1M0U A;  4L0W A;  1K0D A;  2RII A;  3IE3 A;  1TOF A;  1A2J A;  3CSJ A;  1EOG A;  2KLX A;  4LL1 B;  1AQX A;  1RW1 A;  1YF1 A;  3ZFB A;  3QR6 A;  5A5K A;  9GSS A;  4MZW A;  1PSQ A;  3QDN A;  2YNX A;  4X43 A;  2M80 A;  1WJK A;  1W4V A;  1FO5 A;  2D2Z A;  3DGQ A;  3DVX A;  5DJM A;  1J08 A;  1W89 A;  1ZZY A;  2WDU A;  3HKR A;  4K0N A;  3ZVJ A;  5AN1 A;  2L6D A;  3OR5 A;  4EF0 A;  5ELA A;  2OE1 A;  4EC0 A;  4TXO B;  4ECC A;  5DAK B;  2DSA A;  4G9H A;  2V6O A;  4K2D A;  3C7M A;  2H66 A;  4MMM A;  4PUA A;  2VLT A;  3VI7 A;  3HD5 A;  2B7J A;  4OCF A;  1EWX A;  2V6K A;  5INY A;  1BX9 A;  1OC8 A;  1ERV A;  4D73 A;  2M72 A;  5IO2 A;  5DQY A;  1TRV A;  1OC9 B;  1GH2 A;  3U6V A;  1UN2 A;  2K9F A;  4N10 A;  1T00 A;  2LQO A;  2GZZ A;  2HSY A;  5HR1 A;  4YAV A;  1PX7 A;  3N9J A;  2DIY A;  3FRC A;  1XPV A;  1Z9H A;  4TR1 B;  1HNA A;  2XBQ A;  4HQS A;  3EYT A;  3KTL A;  2LNS A;  4HS1 A;  3UEM A;  2PU9 C;  4EXJ A;  1U88 A;  3I69 A;  3Q18 A;  4I5Q A;  3HVV A;  4Q5N A;  4WEY A;  4ZL9 A;  5IIZ A;  1JZR A;  1GSD A;  2P5Q A;  3VFI A;  4GTU A;  1UC7 A;  1B8X A;  4YQV A;  4NV5 A;  4IS0 A;  2C80 A;  4K7N A;  3VI5 A;  2P5R A;  3FW2 A;  1TJD A;  3QOU A;  2R4V A;  1N2A A;  3F8U A;  4KB3 A;  3TUE A;  5J41 A;  2H0G A;  2NVL A;  2VCW A;  3DML A;  4LMV A;  4KA0 A;  2OE0 A;  3FK8 A;  3IK9 A;  4QL7 A;  4L5O A;  2E2G A;  4Z7X A;  4KDY A;  5A4W A;  3KH9 A;  4TXO A;  1ACV A;  4RUV A;  3GX8 A;  3DD3 A;  2GSQ A;  4BPY A;  2V1M A;  2GVP A;  1VGL A;  1GUK A;  2HLS A;  1JHB A;  2JU5 A;  1G6W A;  3TJB A;  3GIX A;  4MJC A;  4BL7 A;  3TRP A;  3APS A;  2LNT A;  3KXO A;  5IOX A;  3VWX A;  3F6F A;  4KDX A;  1TU8 A;  1OC9 A;  2RM5 A;  2FHE A;  2H1A A;  3DRN A;  1PX6 A;  1GSS A;  4KSM A;  1X9S B;  1MD4 A;  1OKT A;  2MYG A;  3LXZ A;  4TR1 A;  3GN3 A;  3VWU A;  4EDY A;  1VF4 A;  3D6I A;  1F3A A;  2VAF A;  2PGT A;  3EWL A;  1A8Y A;  2VIM A;  1EGO A;  3LYK A;  3KCM A;  2CVB A;  1OVN A;  1K0B A;  1A0R P;  1Z6M A;  3BD2 A;  4ZBA A;  3TKS C;  1ZL9 A;  3KIJ A;  2OAD A;  2H75 A;  1ERT A;  1GTA A;  2LTK A;  4K6X A;  1GSE A;  2IMK A;  3F6D A;  4TKY A;  2GGT A;  5JWO B;  3D5J A;  2VOC A;  2IWT A;  4AJ8 A;  1O8W A;  4WXT A;  4I2T A;  1XWK A;  5J9B A;  3UVT A;  3GST A;  2JAD A;  4BWQ A;  1F37 A;  1M2A A;  2IME A;  1TDI A;  2B5X A;  1OYJ A;  4MF6 A;  3C1S A;  5CYY A;  1K0N A;  3IA1 A;  1XIY A;  1YDK A;  1XWC A;  5EPF A;  5G5E A;  4O32 A;  3E0U A;  5ECM B;  2KHP A;  3BOA A;  3WD6 A;  3LSZ A;  1SD8 A;  4IGJ A;  3GKX A;  1AQW A;  3A5W A;  5D9W A;  4JRR A;  1GLP A;  3PH9 A;  5F07 A;  4WR5 A;  3NZN A;  22GS A;  1T7P B;  3HJO A;  2EIO A;  4WBR D;  2HI7 A;  4NAX A;  3G7J A;  2IMI A;  19GS A;  4LL4 B;  1J9B A;  4PXO A;  4IJ3 A;  3WGE A;  1R4W A;  4MJE A;  3TB2 A;  1NW2 A;  3QAV A;  4F9Z A;  3AY8 A;  4IP6 A;  2YWN A;  3APO A;  5IMF A;  7GSS A;  4GWR A;  4ZB6 A;  1C72 A;  3CSI A;  4PNF A;  5ECN B;  4N11 A;  1XVW A;  1JZO A;  3IPZ A;  1PQN A;  3UAR A;  1ZMA A;  2DLX A;  1QGV A;  1X9M B;  2A2R A;  5D9V A;  4IVF A;  4NXI A;  2LS5 A;  1EP7 A;  1EEJ A;  2VD1 A;  1XVQ A;  2H1G A;  4KX4 A;  1ZOF A;  2REM A;  1TI1 A;  4XTS A;  1A2L A;  3FY7 A;  1JZW A;  5D93 A;  2K6V A;  2NBS A;  4G10 A;  1A23 A;  1SJ6 A;  2OBK A;  2DJ0 A;  1GWC A;  3IHQ A;  4YH2 A;  5DDL A;  2AV4 A;  2FWG A;  4N0V A;  5DQS A;  1BJX A;  3N5O A;  1B4P A;  1M99 A;  2VO4 A;  4ZB9 A;  2DJ2 A;  3CYN A;  1Q98 A;  3ZRD A;  3WGX A;  3IRA A;  3KEB A;  1ILO A;  1H75 A;  2PPT A;  4ML1 A;  3CRU A;  3FR6 A;  1AXD A;  1M9B A;  1SEN A;  3GSS A;  1WIK A;  1AAZ A;  2WS2 A;  3ZZX A;  4J2F A;  3EUR A;  4KAE A;  2CVD A;  2H30 A;  4I6X A;  1TXX A;  3LJR A;  3HYP A;  5F0G A;  3FR3 A;  5IMC A;  4MZB A;  2VD0 A;  4I2U A;  3GRX A;  2EIR A;  1T4Y A;  1MTC A;  1TP9 A;  4JBB A;  5CRW A;  4ACS A;  1K0A A;  2CX3 A;  1TK0 B;  4QL9 A;  2JZR A;  3I43 A;  1EP8 A;  2LST A;  1URM A;  4D73 B;  3GTU B;  3FEU A;  5JCG A;  2RUF A;  4TR0 A;  1DUG A;  3MSZ A;  5LD0 A;  2HFD A;  4ZB8 A;  5DCG A;  1JLV A;  2GQM A;  2H01 A;  3VK9 A;  5G1K A;  4NWY A;  1I9D A;  1GL8 A;  3O76 A;  2CZ3 A;  2WRT A;  3UIW A;  1EZK A;  3PGT A;  5DAL A;  3QPM A;  3PR8 A;  4GST A;  3CTF A;  3IAS 2;  4K9Z A;  2AAW A;  3K8N A;  5ECQ B;  3GH6 A;  1GSQ A;  3RHB A;  1B9Y C;  2B7K A;  2H0H A;  3FZA A;  1MEK A;  1UA5 A;  2F9S A;  1EV4 A;  1QXH A;  3RBT A;  3GMF A;  1K0O A;  2YCD A;  5B6M A;  1AW9 A;  2MMA A;  1LBK A;  1U3A A;  4TR4 A;  4K1F A;  2AUV A;  1DE1 A;  5AGY A;  4F0C A;  3ISO A;  4X1U A;  2QKE A;  4DSS A;  2BMX A;  2DJ3 A;  2VCQ A;  1GSU A;  4KUN A;  3LGC A;  4MPF A;  4V2M A;  2G0F A;  1EOH A;  2H70 A;  2C3N A;  1NHY A;  1YF0 A;  1V57 A;  2C0D A;  2QGV A;  3I9V 2;  4O7H A;  4IBP A;  1OC3 A;  2C4J A;  4G19 A;  2GZY A;  2X8C A;  1R26 A;  1XZO A;  3QAG A;  2HT9 A;  2RM6 A;  3W6G A;  5ID2 B;  1HNB A;  2J9H A;  3A3T A;  3UOM A;  4XRA A;  2C8U A;  5EL8 A;  3Q6O A;  3VUR A;  3FHK A;  4V2L A;  4AJ7 A;  3GTU A;  4ML6 A;  3FYG A;  4N0Z A;  3J7Y b;  3KGK A;  3G9B A;  5D9X A;  1TI3 A;  3HDC A;  3HJM A;  4RI7 A;  5HR3 A;  2I81 A;  1A8L A;  2B1L A;  4TR3 A;  4GQF A;  4ZL8 A;  4F2I A;  4HI7 A;  3CBU A;  2PN8 A;  4ULX A;  1GTU A;  1SL0 B;  1VF3 A;  4OFN A;  1FVK A;  1O81 A;  3GKN A;  3G7I A;  17GS A;  5KN0 A;  2M46 A;  5DJL A;  4TW5 A;  5HFG A;  4GLT A;  3TKR A;  1XFL A;  2XC2 A;  2N5A A;  1NHO A;  2WUL A;  3ZVJ D;  2DJK A;  3P90 A;  4ZIJ A;  1XCC A;  4MH2 A;  1GP1 A;  3ERF A;  2R3X A;  2QSI A;  1YEX A;  2IFQ B;  3HHV A;  5IOW A;  2NDO A;  1U3I A;  2PMT A;  4KSO A;  1KBN A;  2VLV A;  2OJL A;  3M8N A;  5G2Z A;  3D4M A;  4F03 A;  2LV3 A;  5D96 A;  4EL1 A;  2MBS A;  2FA4 A;  1V2A A;  3RAZ A;  1IYH A;  2YJ7 A;  4K0G A;  3A2V A;  1WMJ A;  6GSY A;  2KP1 A;  3ZRE A;  1ERU A;  5KEJ A;  1EEM A;  3GNJ A;  5CAX A;  3FZ4 A;  3D22 A;  4GCI A;  3MNG A;  4MDC A;  5ID2 A;  2GDR A;  3U5R E;  3EE2 A;  4GRF A;  2FUG 2;  2VCX A;  2IL3 A;  3GL3 A;  2JSY A;  4KND A;  1QUW A;  3LEF A;  4POK A;  3IK7 A;  4K7O A;  3KD0 A;  3TKS A;  2IMF A;  2HRF A;  6GST A;  2JL4 A;  3EMP A;  1AQV A;  1SJZ A;  3TJF A;  3H4K A;  4I97 A;  5KN2 A;  2KP2 A;  3TJG A;  2HNL A;  3FZ5 A;  1O85 A;  1B48 A;  5F05 A;  3DVW A;  1XW5 A;  2H71 A;  3KTB A;  5ABR A;  2WZ9 A;  5COH A;  1GTB A;  2CAQ A;  2BJX A;  2PWJ A;  1VF2 A;  5ECP B;  3KMN A;  2VUP A;  1A24 A;  4ILF A;  4HUA A;  3VWV A;  5CO3 A;  1PGT A;  1V9W A;  1M9A A;  3GYK A;  5IMD A;  1EGR A;  4FO5 A;  3DEX A;  3GA4 A;  3UVH A;  2QC7 A;  1XXU A;  2H6Z A;  4AF2 A;  3UL3 A;  2EIQ A;  2F8F A;  3FR9 A;  1THX A;  8GSS A;  3BCI A;  3KJY A;  2IFQ A;  1SYX A;  1GUM A;  4IP1 A;  1SL2 B;  4ECJ A;  3MDK A;  3PIN A;  4MF5 A;  1BYE A;  2CAI A;  2O89 A;  3LG6 A;  2ON5 A;  1XWA A;  5ECS A;  4CHS A;  3KP9 A;  2VM1 A;  1PKZ A;  2C0F A;  4TVE A;  4FH8 A;  4JZQ A;  5AIV A;  1BG5 A;  3TJJ A;  2GLR A;  1R7H A;  4V2N A;  4ZBD A;  2H8L A;  3IXR A;  1MDJ A;  3IV4 A;  2PVO C;  2VM2 A;  4JE1 A;  1F9M A;  5LCZ A;  3SWL A;  5JWQ B;  1QFN A;  2YWO A;  3KH7 A;  1DE2 A;  1E2Y A;  5JCU A;  5FHI A;  1XW9 A;  2N5F A;  4HU7 A;  2E0Q A;  5CRE A;  3GKM A;  2VL9 A;  10GS A;  2IMD A;  3QD9 A;  2NTO A;  4WR4 A;  2GQK A;  2FA8 A;  1O8X A;  1X5E A;  2WB9 A;  3A2X A;  1YQ1 A;  3TKQ A;  1K3L A;  3L9S A;  3IAM 2;  4KDU A;  1ZGN A;  4WF4 A;  1WPI A;  2MMZ A;  5H5S A;  2XPD A;  2YPM A;  1HQO A;  2LQQ A;  1PN9 A;  5IM9 A;  2K8V A;  5H5R A;  2B5Y A;  3ZTL A;  4JR4 A;  3BCK A;  1SU9 A;  2GSR A;  5J4U A;  2I4A A;  2K18 A;  2B5E A;  2NPB A;  1XOB A;  4POB A;  1O7U A;  1V98 A;  3ZYW A;  4I8B A;  4YQU A;  6GSU A;  4MF7 A;  1HYU A;  4KE3 A;  3LQ7 A;  4MK3 A;  1OAZ A;  2A2S A;  2C1Y A;  5KN1 A;  3Q19 A;  3L78 A;  3ED3 A;  3TJK A;  2AB6 A;  2OAC A;  4OD7 A;  5EVO A;  2WJU A;  1TTZ A;  14GS A;  1YKC A;  2H72 A;  2LJA A;  2B3S A;  5DAL B;  1USB A;  1DSB A;  5HQP A;  3HZ8 A;  4QQ7 A;  1ML6 A;  5ECO B;  1PRX A;  3EU4 A;  1SK2 A;  2WFC A;  3EIN A;  1V58 A;  1PKW A;  2C0G A;  5GAP D;  3KMO A;  5ENU A;  4J57 E;  5D9T A;  2DBC A;  3F4T A;  3DWV A;  5CNW A;  4ECI A;  1ON4 A;  4WET A;  3A2W A;  2DC5 A; 
#chains in the Genus database with same CATH topology
 4L0U A;  1H4O A;  2WCI A;  4FIW A;  2JAC A;  3NIV A;  4ZIL A;  1M7T A;  2FY6 A;  4XRD A;  3H93 A;  5DCH A;  4TRX A;  1YJ6 A;  5CRH A;  3ME7 A;  4PUR A;  4A5P A;  5J5N A;  2KUC A;  3F3Q A;  4MH3 A;  3DXB A;  5G5F A;  2GSS A;  3BBY A;  2IJY A;  2CA8 A;  3O6T A;  4L5L A;  4XS1 A;  3GKK A;  5C04 A;  4DSS B;  2R6K A;  1GUL A;  5ECK B;  2IIY A;  2F51 A;  4MLY A;  2CZ2 A;  4XS4 B;  5B8B A;  4FYC A;  3KM6 A;  1T8E B;  2GS3 A;  2YJH A;  2VL2 A;  4PQ1 A;  5L71 A;  1PMT A;  3M0F A;  1DBY A;  5HFI A;  3R2Q A;  2OA7 A;  4LA1 A;  2DJJ A;  4YKF A;  2IN3 A;  2R2J A;  1IYI A;  4BVY A;  3FKF A;  1B9X C;  2R0G A;  4L8E A;  4K7I A;  3TGZ A;  5EY6 A;  3IOS A;  5IPH A;  3IR4 A;  2O8V B;  3ERG A;  4OO5 A;  3S9F A;  3HVS A;  5IMZ A;  4EIQ A;  4DSQ A;  1TKD B;  2DML A;  2CVK A;  2F8A A;  4Q5Q A;  1Y25 A;  2LRN A;  4ZBB A;  5ECR B;  1X0R A;  1G7O A;  3TOT A;  2GZP A;  3QAW A;  5ELG A;  3M9K A;  1FOV A;  4KF9 A;  1X5C A;  4V1A g;  4E8H A;  1K3Y A;  3QCP A;  2LJK A;  2X4A A;  2VL2 C;  3ZML A;  1QMV A;  5JWR B;  1JFU A;  12GS A;  2TRX A;  2PUK C;  2O87 A;  2GT5 A;  4GF0 A;  4DEJ A;  2VCT A;  4RI6 A;  1F6M C;  2H6X A;  5C00 A;  2HRN A;  1PL2 A;  2LKU A;  4ECB A;  1HNC A;  4PX1 A;  1J0F A;  4IW9 A;  1MDI A;  1TK8 B;  1PD2 1;  2RLI A;  2IPA A;  2ZNM A;  2HYX A;  6GSV A;  1GSF A;  1NM3 A;  2FWF A;  1Z5Y E;  3CMI A;  3UBK A;  4ZXG A;  1VRS D;  3TCO A;  2LEG A;  3C71 A;  4EO3 A;  2B1K A;  5BMU A;  2CQ9 A;  2L5L A;  1NSW A;  1GRX A;  13GS A;  2FWE A;  5IMA A;  4LMW A;  2MBT A;  3F9U A;  4YKG A;  1B4Q A;  4E8E A;  5ECH B;  4V1A p;  2ZUP A;  3RPP A;  5IMV A;  5KN3 A;  3P2A A;  1T4Z A;  1OE7 A;  1ZYN A;  4XS4 A;  3CTG A;  5FT3 A;  1R5P A;  1WE0 A;  2RUE A;  4YQM A;  2EC4 A;  1ZYE A;  5B6N A;  1YKA A;  3HVX A;  1EV9 A;  3EU3 A;  4HJ2 A;  1JZD A;  1GUH A;  1S3D A;  1RK4 A;  4XS6 A;  4PQI A;  3MAK A;  11GS A;  5DVB A;  1K3O A;  3GUS A;  1LJR A;  5DBQ A;  1F2E A;  2O7K A;  2AYT A;  2P0G A;  4XIH A;  4ZL7 A;  4F82 A;  4XCS A;  2V32 A;  1Z7R A;  4IKH A;  2FLS A;  4O5U A;  3LOR A;  3HXS A;  3EMX A;  3LWA A;  1QK8 A;  2HZF A;  4CY6 A;  4AJ6 A;  1V40 A;  2HE3 A;  2C3Q A;  4HZ4 A;  4NHZ A;  3WT2 A;  4JU5 A;  2FD3 A;  2VLU A;  1PA3 A;  1Z7P A;  4XHM A;  4ID0 A;  3WGD A;  2YOI A;  3F0I A;  5CRG A;  2L57 A;  4IHU A;  1S3A A;  4MJB A;  2A2P A;  5G31 A;  3JCM L;  2TRC P;  2C3T A;  2P31 A;  2R37 A;  5GST A;  1AC1 A;  5KOX A;  5ECI B;  4BWS A;  2OE3 A;  1WP0 A;  3GX0 A;  1R5A A;  1FG4 A;  1UVZ A;  4P3Y B;  2H1D A;  5ECL B;  3KZQ A;  5J9C A;  1FAA A;  1YEP A;  3ME8 A;  5GAN D;  4EE0 A;  1TK5 B;  4POM A;  1FVJ A;  3ZIV A;  1XW6 A;  5IPG A;  2I3Y A;  3MWH A;  1VF1 A;  20GS A;  2XBI A;  2H6Y A;  1I5G A;  1SKS B;  1QQ2 A;  3R3E A;  3CRT A;  5IQY A;  4X0X A;  5CP1 A;  2FNO A;  3D0Z A;  4O5Q A;  1GNE A;  1GTI A;  3M3M A;  1SK1 A;  1SK0 A;  1FB6 A;  2ES7 A;  3ERW A;  3VWW A;  5DAK A;  5JCW A;  5CRD A;  1Y6E A;  3H1N A;  3KP8 A;  1M2B A;  2L5O A;  1FOH A;  1E6B A;  1G6Y A;  3CXG A;  1CQG A;  16GS A;  2UZ8 A;  4MPG A;  3MIX A;  5A4U A;  2X8H A;  1X5D A;  4PUF C;  1X9W B;  2GT6 A;  3M1G A;  4N30 A;  5HR2 A;  3IBH A;  5LNK e;  4MJA A;  3NOF A;  4BVX B;  1GNW A;  1ZYQ B;  1MDK A;  2YN1 A;  1KNG A;  1HD2 A;  3TDG A;  3H8Q A;  2OBI A;  1THO A;  4WF5 A;  3F4R A;  4K5R A;  3E9J B;  2L6C A;  3L4N A;  4TXV A;  4F0B A;  4MZC A;  1XWG A;  5HR0 A;  2VCZ A;  4KCA A;  1F3B A;  4GXZ A;  1TRU A;  4EVM A;  2H76 A;  3SBC A;  5FWG A;  2L59 A;  2G2Q A;  4JR6 A;  4DSR A;  3HCZ A;  3C8E A;  4MA9 A;  2HZE B;  1TRW A;  3UBL A;  2LRT A;  1O73 A;  1SKW B;  2OKA A;  2V2G A;  1XWB A;  3L0H A;  1WRY A;  2Z9S A;  4TOP A;  3TKS E;  3CSH A;  2GTU A;  2LUS A;  4CW9 A;  4KGI A;  3W8J A;  4O5R A;  4ISD A;  3EVI A;  2FGX A;  2ON7 A;  4FYB A;  2E7P A;  2GST A;  1FW1 A;  1U6T A;  3IDV A;  1YY7 A;  4KW6 A;  4HDE A;  4NV2 A;  2V41 A;  3F3R A;  1OKD A;  4IEL A;  4TN8 A;  3ZFL A;  3UAP A;  2TIR A;  3WYW A;  4GQC A;  3ZMK A;  2X8G A;  3F4S A;  3I6A A;  4NPB A;  2E2M A;  3UMA A;  4EUY A;  5J3R A;  1SYR A;  4Q5F A;  1G7E A;  2WGR A;  4H86 A;  2H74 A;  3H79 A;  1AUC A;  1GLQ A;  4POL A;  2CV4 A;  3GUR A;  3ZLP A;  2YP6 A;  2DIZ A;  18GS A;  3QMX A;  4OO4 A;  3W8S A;  2K8S A;  2R5G A;  3Q74 A;  2XPE A;  3QFB C;  4KH7 A;  3TKP A;  3EC3 A;  3HA9 A;  3UJ1 A;  2L4C A;  5GZZ B;  2VL3 A;  1YZX A;  2FWH A;  4PGT A;  2ALB A;  4G0K A;  4RQX A;  4BVX A;  5B8A A;  1N8J A;  2B6M A;  4MAB A;  4DVC A;  4IQ1 A;  3ZIT A;  2DMM A;  2DKI A;  1PL1 A;  2YWM A;  3J7Y k;  3V1W A;  1SD9 A;  3GHA A;  3L9V A;  1O6J A;  4G2E A;  1BQ7 A;  3RHC A;  1OE8 A;  3C73 A;  2A4V A;  2AJQ B;  3ZL5 A;  4GSN A;  4RQR A;  1BAY A;  3DKS A;  3VLN A;  4HSC X;  4MCU A;  2PBJ A;  1TRS A;  5G1L A;  3FZ9 A;  3G7Y A;  4OFT A;  3IC4 A;  3LYP A;  2HZE A;  3LFL A;  3L9U A;  2ZCT A;  3D4T A;  2JSZ A;  1JLW A;  3F63 A;  1K0C A;  2H19 A;  5D8I A;  4YAP A;  1G0T A;  4FYU A;  2I9H A;  3TOU A;  2LJR A;  2JZS A;  2KOK A;  4IQA A;  2YAN A;  1BED A;  3D21 A;  4AGS A;  3BJ5 A;  4J56 E;  3TRQ A;  4IN0 A;  4NHW A;  2H0I A;  2MZC A;  3GH9 A;  4HQZ A;  4EKZ A;  4LLR A;  2PVQ A;  4HZ2 A;  5E59 A;  1ABA A;  1LU4 A;  1TU7 A;  2CX4 A;  2YV9 A;  3HJP A;  3HZ4 A;  5F8B A;  3RDW A;  3WT1 A;  5H5Q A;  4OMV A;  4EDZ A;  2O85 A;  4K8M A;  2YV7 A;  2L4Q A;  2YWI A;  3RPN A;  3QFA C;  1SL1 B;  3O3T A;  4HU9 A;  5A4V A;  3P8W A;  2I1U A;  1A0F A;  4WBJ A;  2BTO T;  4PNG A;  2YZU A;  2YZH A;  5IO0 A;  2HRK A;  1XBS A;  1T3B A;  5AIX A;  1KEB A;  4WKW A;  2PER A;  1ZCP A;  4OCE A;  2GQL A;  2J23 A;  2H73 A;  4HJM A;  1U87 A;  4ICY A;  1MD3 A;  5G30 A;  4MP4 A;  2HXK A;  4BA7 A;  4O92 A;  1KTE A;  3GV1 A;  1FB0 A;  1GSY A;  2DJ1 A;  4NMU A;  3ZIJ A;  2C0E A;  1FHE A;  4GSS A;  4G0L A;  4PQH A;  1ZYP A;  4OFM A;  6GSS A;  2CT6 A;  4HOJ A;  5AIS A;  3C1R A;  4IJI A;  3GL5 A;  3LW9 A;  1AIU A;  5GSS A;  3US3 A;  1M2D A;  1Z6N A;  3VPQ A;  1RQM A;  2N5B A;  1CQH A;  6GSX A;  2F3M A;  1Q4J A;  1TW9 A;  3DYR A;  3APQ A;  1K0M A;  4MNN A;  3GFK A;  4Q5R A;  3TRX A;  2JZT A;  3A5I A;  1XOA A;  5F06 A;  1A2M A;  2MMO A;  2HSH A;  3M9J A;  1WWJ A;  1Z3E A;  2X99 A;  1ST9 A;  2LRC A;  2XHF A;  2AHE A;  3VPT A;  3P7X A;  3E3E A;  5D73 A;  4KCE A;  4OWY A;  5HFK A;  5E4W A;  2H1B A;  1SJI A;  6GSW A;  4HEA 2;  3HY2 A;  2FCH A;  2MMN A;  2X64 A;  4CDO A;  1WOU A;  2VCV A;  3DIE A;  2HRA A;  1S3C A;  1ERW A;  1T1V A;  1SKR B;  5B7C A;  4JED A;  3LXT A;  1M0U A;  4L0W A;  1K0D A;  2RII A;  3IE3 A;  1TOF A;  1A2J A;  3CSJ A;  1EOG A;  2KLX A;  4LL1 B;  1AQX A;  1RW1 A;  1YF1 A;  3ZFB A;  3QR6 A;  5A5K A;  9GSS A;  2X49 A;  4BIK A;  2QA1 A;  4MZW A;  1PSQ A;  3QDN A;  2YNX A;  4X43 A;  2M80 A;  1WJK A;  1W4V A;  1FO5 A;  2D2Z A;  3DGQ A;  3DVX A;  5DJM A;  1J08 A;  1W89 A;  1ZZY A;  2WDU A;  3HKR A;  4K0N A;  3ZVJ A;  5AN1 A;  2L6D A;  3OR5 A;  4EF0 A;  5ELA A;  2OE1 A;  3IHG A;  4EC0 A;  4TXO B;  4ECC A;  5DAK B;  2DSA A;  4G9H A;  2V6O A;  4K2D A;  3C7M A;  2H66 A;  4MMM A;  4PUA A;  2VLT A;  3VI7 A;  3HD5 A;  2B7J A;  4OCF A;  1EWX A;  2V6K A;  5INY A;  1BX9 A;  1OC8 A;  4BL7 B;  1ERV A;  4D73 A;  2M72 A;  5IO2 A;  5DQY A;  1TRV A;  1OC9 B;  1GH2 A;  3U6V A;  1UN2 A;  2K9F A;  4N10 A;  1T00 A;  2LQO A;  2GZZ A;  2HSY A;  5HR1 A;  4YAV A;  1PX7 A;  3N9J A;  2DIY A;  3FRC A;  1XPV A;  1Z9H A;  4TR1 B;  1HNA A;  2XBQ A;  4HQS A;  3EYT A;  3KTL A;  2LNS A;  4HS1 A;  3UEM A;  2PU9 C;  4EXJ A;  1U88 A;  3I69 A;  3Q18 A;  4I5Q A;  3HVV A;  4Q5N A;  4WEY A;  4ZL9 A;  5IIZ A;  1JZR A;  1GSD A;  2P5Q A;  3VFI A;  4GTU A;  1UC7 A;  1B8X A;  4YQV A;  4NV5 A;  4IS0 A;  2C80 A;  4K7N A;  3VI5 A;  2P5R A;  3FW2 A;  1TJD A;  3QOU A;  2R4V A;  1N2A A;  2R0C A;  3F8U A;  4KB3 A;  3TUE A;  5J41 A;  2H0G A;  2NVL A;  2A4H A;  2VCW A;  3DML A;  4LMV A;  4KA0 A;  2OE0 A;  3FK8 A;  3IK9 A;  4QL7 A;  4L5O A;  2E2G A;  4Z7X A;  4KDY A;  5A4W A;  3KH9 A;  4TXO A;  1ACV A;  4RUV A;  3GX8 A;  3DD3 A;  2GSQ A;  4BPY A;  2V1M A;  4FQU A;  2GVP A;  1VGL A;  1GUK A;  2HLS A;  1JHB A;  2JU5 A;  1G6W A;  5BRT A;  3TJB A;  3GIX A;  4MJC A;  4BL7 A;  3TRP A;  3APS A;  2LNT A;  3KXO A;  5IOX A;  3VWX A;  3F6F A;  4KDX A;  1TU8 A;  1OC9 A;  2RM5 A;  2FHE A;  2H1A A;  3DRN A;  1PX6 A;  1GSS A;  4KSM A;  1X9S B;  1MD4 A;  1OKT A;  2MYG A;  3LXZ A;  4TR1 A;  3GN3 A;  3VWU A;  4EDY A;  1VF4 A;  3D6I A;  1F3A A;  2VAF A;  2PGT A;  3EWL A;  1A8Y A;  2VIM A;  1EGO A;  3LYK A;  3KCM A;  2CVB A;  1OVN A;  1K0B A;  1A0R P;  1Z6M A;  3BD2 A;  4ZBA A;  3TKS C;  1ZL9 A;  3KIJ A;  2OAD A;  2H75 A;  1ERT A;  1GTA A;  2LTK A;  4K6X A;  1GSE A;  2IMK A;  3F6D A;  4TKY A;  2GGT A;  5JWO B;  3D5J A;  2VOC A;  2IWT A;  4AJ8 A;  1O8W A;  4WXT A;  4I2T A;  1XWK A;  5J9B A;  3UVT A;  3GST A;  2JAD A;  4BWQ A;  1F37 A;  1M2A A;  2IME A;  1TDI A;  2B5X A;  1OYJ A;  4MF6 A;  3C1S A;  5CYY A;  4Z2T A;  1K0N A;  3IA1 A;  1XIY A;  1YDK A;  1XWC A;  5EPF A;  1M3I A;  5G5E A;  4O32 A;  3E0U A;  5ECM B;  2KHP A;  3BOA A;  4K2X A;  3WD6 A;  3LSZ A;  1SD8 A;  4IGJ A;  3GKX A;  1AQW A;  3A5W A;  5D9W A;  4JRR A;  1GLP A;  3PH9 A;  5F07 A;  4WR5 A;  3NZN A;  22GS A;  1T7P B;  3HJO A;  2EIO A;  4WBR D;  2HI7 A;  4NAX A;  3G7J A;  2IMI A;  19GS A;  4LL4 B;  1J9B A;  4PXO A;  4IJ3 A;  3WGE A;  1R4W A;  4MJE A;  3TB2 A;  1NW2 A;  3QAV A;  4F9Z A;  3AY8 A;  4IP6 A;  2YWN A;  3APO A;  5IMF A;  7GSS A;  4GWR A;  4ZB6 A;  1C72 A;  3CSI A;  4PNF A;  5ECN B;  4N11 A;  1XVW A;  1JZO A;  3IPZ A;  1PQN A;  3UAR A;  1ZMA A;  2DLX A;  1QGV A;  1X9M B;  2A2R A;  5D9V A;  4IVF A;  4NXI A;  2LS5 A;  1EP7 A;  1EEJ A;  2VD1 A;  1XVQ A;  2H1G A;  4KX4 A;  1ZOF A;  3IC8 A;  2REM A;  1TI1 A;  4XTS A;  1A2L A;  3FY7 A;  4G0I A;  1JZW A;  5D93 A;  2K6V A;  2NBS A;  4G10 A;  1A23 A;  1SJ6 A;  2OBK A;  4EIP A;  2DJ0 A;  1GWC A;  3IHQ A;  4YH2 A;  5DDL A;  2AV4 A;  2FWG A;  4N0V A;  5DQS A;  1BJX A;  3N5O A;  1B4P A;  1M99 A;  2VO4 A;  4ZB9 A;  2DJ2 A;  3CYN A;  1Q98 A;  3ZRD A;  3WGX A;  3IRA A;  3KEB A;  1ILO A;  1H75 A;  2PPT A;  4ML1 A;  3CRU A;  4Z2R A;  3FR6 A;  1AXD A;  1M9B A;  1SEN A;  3GSS A;  1WIK A;  1AAZ A;  2WS2 A;  3ZZX A;  4J2F A;  3EUR A;  4KAE A;  2CVD A;  2H30 A;  4I6X A;  1TXX A;  3LJR A;  3HYP A;  5F0G A;  3FR3 A;  5IMC A;  4MZB A;  2VD0 A;  4I2U A;  3GRX A;  4CY8 A;  2EIR A;  1T4Y A;  1MTC A;  1TP9 A;  4JBB A;  5CRW A;  4ACS A;  1K0A A;  2CX3 A;  1TK0 B;  4QL9 A;  2JZR A;  3I43 A;  1EP8 A;  2LST A;  1URM A;  4D73 B;  3GTU B;  3FEU A;  5JCG A;  2RUF A;  4TR0 A;  1DUG A;  3MSZ A;  5LD0 A;  2HFD A;  4ZB8 A;  5DCG A;  1JLV A;  2GQM A;  2H01 A;  3VK9 A;  5G1K A;  4NWY A;  1I9D A;  1GL8 A;  3O76 A;  2CZ3 A;  2WRT A;  3UIW A;  1EZK A;  1XG8 A;  3PGT A;  5DAL A;  3QPM A;  3PR8 A;  4GST A;  3CTF A;  3IAS 2;  3CQF A;  4K9Z A;  2AAW A;  3K8N A;  5ECQ B;  2DKH A;  3GH6 A;  1GSQ A;  3RHB A;  1B9Y C;  2B7K A;  2H0H A;  3FZA A;  1MEK A;  1UA5 A;  2F9S A;  1EV4 A;  1QXH A;  3RBT A;  3GMF A;  4PTS A;  1K0O A;  2YCD A;  5B6M A;  1AW9 A;  2MMA A;  1LBK A;  1U3A A;  4TR4 A;  4K1F A;  2AUV A;  1DE1 A;  5AGY A;  4F0C A;  3ISO A;  3FMW A;  2QKE A;  4X1U A;  4DSS A;  2BMX A;  2DJ3 A;  2VCQ A;  1GSU A;  4KUN A;  3LGC A;  3HVN A;  4MPF A;  4K5S A;  4V2M A;  2G0F A;  1EOH A;  2H70 A;  2C3N A;  1M3J A;  1NHY A;  1YF0 A;  1V57 A;  2C0D A;  2QGV A;  3I9V 2;  4O7H A;  4Z2U A;  4IBP A;  1OC3 A;  2C4J A;  4G19 A;  2GZY A;  2X8C A;  1R26 A;  1XZO A;  3QAG A;  2HT9 A;  2RM6 A;  3W6G A;  5ID2 B;  1HNB A;  2J9H A;  3A3T A;  3UOM A;  4XRA A;  2C8U A;  5EL8 A;  3Q6O A;  3VUR A;  3FHK A;  4V2L A;  4AJ7 A;  3GTU A;  4ML6 A;  3FYG A;  4N0Z A;  3J7Y b;  3KGK A;  3G9B A;  5D9X A;  1TI3 A;  3HDC A;  3HJM A;  4RI7 A;  5HR3 A;  2I81 A;  1A8L A;  2B1L A;  4TR3 A;  4GQF A;  4ZL8 A;  4F2I A;  4HI7 A;  3CBU A;  2PN8 A;  4ULX A;  1GTU A;  1SL0 B;  1VF3 A;  4OFN A;  1FVK A;  1O81 A;  3GKN A;  3G7I A;  17GS A;  5KN0 A;  2M46 A;  5DJL A;  4TW5 A;  5HFG A;  4GLT A;  3TKR A;  1XFL A;  2XC2 A;  2N5A A;  1NHO A;  2WUL A;  3ZVJ D;  2DJK A;  3P90 A;  4ZIJ A;  1XCC A;  4MH2 A;  1GP1 A;  3ERF A;  2R3X A;  2QSI A;  1YEX A;  2IFQ B;  3HHV A;  5IOW A;  2NDO A;  1U3I A;  2PMT A;  4KSO A;  1KBN A;  2VLV A;  2OJL A;  3M8N A;  5G2Z A;  3D4M A;  4F03 A;  2LV3 A;  5D96 A;  4EL1 A;  2MBS A;  2FA4 A;  1V2A A;  3RAZ A;  1IYH A;  2YJ7 A;  4K0G A;  3A2V A;  1WMJ A;  6GSY A;  2KP1 A;  3ZRE A;  1ERU A;  5KEJ A;  1EEM A;  3GNJ A;  5CAX A;  3FZ4 A;  3D22 A;  4GCI A;  3MNG A;  4MDC A;  5ID2 A;  2GDR A;  3PPU A;  3U5R E;  3EE2 A;  4GRF A;  2FUG 2;  2VCX A;  2IL3 A;  3GL3 A;  2JSY A;  4KND A;  1QUW A;  3LEF A;  2HSM A;  4POK A;  3IK7 A;  4K7O A;  3KD0 A;  3TKS A;  2IMF A;  2HRF A;  6GST A;  2JL4 A;  3EMP A;  1AQV A;  1SJZ A;  3TJF A;  3H4K A;  4I97 A;  5KN2 A;  2KP2 A;  3TJG A;  2HNL A;  3FZ5 A;  1O85 A;  1B48 A;  5F05 A;  3DVW A;  1XW5 A;  2H71 A;  3KTB A;  5ABR A;  2WZ9 A;  5COH A;  1GTB A;  2CAQ A;  2R0P A;  2BJX A;  2PWJ A;  1VF2 A;  5ECP B;  3KMN A;  2VUP A;  1A24 A;  4ILF A;  4X4J A;  4HUA A;  3VWV A;  5CO3 A;  1PGT A;  1V9W A;  1M9A A;  3GYK A;  5IMD A;  1EGR A;  4FO5 A;  3DEX A;  3GA4 A;  3UVH A;  2QC7 A;  1XXU A;  2H6Z A;  4AF2 A;  3UL3 A;  2EIQ A;  1PFO A;  2F8F A;  3FR9 A;  1THX A;  4USS A;  8GSS A;  3BCI A;  3KJY A;  2IFQ A;  1SYX A;  1GUM A;  4IP1 A;  1SL2 B;  4ECJ A;  3MDK A;  3PIN A;  4MF5 A;  1BYE A;  2CAI A;  2O89 A;  3LG6 A;  2ON5 A;  1XWA A;  1PN0 A;  5ECS A;  4CHS A;  3KP9 A;  2VM1 A;  5KOW A;  3MYD A;  1PKZ A;  2C0F A;  4TVE A;  4FH8 A;  4JZQ A;  5AIV A;  1BG5 A;  3TJJ A;  2GLR A;  1R7H A;  4V2N A;  4ZBD A;  2H8L A;  3IXR A;  2QA2 A;  1MDJ A;  3IV4 A;  2PVO C;  2VM2 A;  4JE1 A;  1F9M A;  5LCZ A;  3SWL A;  5JWQ B;  1QFN A;  2YWO A;  3KH7 A;  1DE2 A;  1E2Y A;  5JCU A;  5FHI A;  1XW9 A;  2N5F A;  4HU7 A;  2E0Q A;  5CRE A;  3GKM A;  2VL9 A;  10GS A;  2IMD A;  3QD9 A;  2NTO A;  4WR4 A;  2GQK A;  2FA8 A;  1O8X A;  1X5E A;  2WB9 A;  3A2X A;  1YQ1 A;  3TKQ A;  1K3L A;  3L9S A;  3IAM 2;  4KDU A;  1ZGN A;  4WF4 A;  1WPI A;  2MMZ A;  3EPT A;  5H5S A;  2XPD A;  2YPM A;  1HQO A;  1S3R A;  2LQQ A;  1PN9 A;  5IM9 A;  2K8V A;  5H5R A;  2B5Y A;  3ZTL A;  4JR4 A;  3BCK A;  1SU9 A;  2GSR A;  5J4U A;  2I4A A;  2K18 A;  4BVY B;  2B5E A;  2NPB A;  1XOB A;  4POB A;  1O7U A;  1V98 A;  3ZYW A;  4I8B A;  4YQU A;  6GSU A;  4MF7 A;  1HYU A;  4KE3 A;  3LQ7 A;  4MK3 A;  1OAZ A;  2A2S A;  2C1Y A;  5KN1 A;  3Q19 A;  3L78 A;  3ED3 A;  3TJK A;  2AB6 A;  2OAC A;  4OD7 A;  5EVO A;  2WJU A;  1TTZ A;  14GS A;  1YKC A;  2H72 A;  2LJA A;  2B3S A;  5DAL B;  1USB A;  1DSB A;  5HQP A;  3HZ8 A;  4QQ7 A;  1ML6 A;  5ECO B;  1PRX A;  3EU4 A;  1SK2 A;  2WFC A;  3EIN A;  1V58 A;  1PKW A;  2C0G A;  5GAP D;  3KMO A;  5ENU A;  4J57 E;  5D9T A;  2DBC A;  3F4T A;  3DWV A;  5CNW A;  4ECI A;  1ON4 A;  4WET A;  3A2W A;  2DC5 A; 
#chains in the Genus database with same CATH homology
 4L0U A;  1H4O A;  2WCI A;  4FIW A;  2JAC A;  3NIV A;  4ZIL A;  1M7T A;  2FY6 A;  4XRD A;  3H93 A;  5DCH A;  4TRX A;  1YJ6 A;  5CRH A;  3ME7 A;  4PUR A;  4A5P A;  5J5N A;  2KUC A;  3F3Q A;  4MH3 A;  3DXB A;  5G5F A;  2GSS A;  3BBY A;  2IJY A;  2CA8 A;  3O6T A;  4L5L A;  4XS1 A;  3GKK A;  5C04 A;  4DSS B;  2R6K A;  1GUL A;  5ECK B;  2IIY A;  2F51 A;  4MLY A;  2CZ2 A;  4XS4 B;  5B8B A;  4FYC A;  3KM6 A;  1T8E B;  2GS3 A;  2YJH A;  2VL2 A;  4PQ1 A;  5L71 A;  1PMT A;  3M0F A;  1DBY A;  5HFI A;  3R2Q A;  2OA7 A;  4LA1 A;  2DJJ A;  4YKF A;  2IN3 A;  2R2J A;  1IYI A;  4BVY A;  3FKF A;  1B9X C;  2R0G A;  4L8E A;  4K7I A;  3TGZ A;  5EY6 A;  3IOS A;  5IPH A;  3IR4 A;  2O8V B;  3ERG A;  4OO5 A;  3S9F A;  3HVS A;  5IMZ A;  4EIQ A;  4DSQ A;  1TKD B;  2DML A;  2CVK A;  2F8A A;  4Q5Q A;  1Y25 A;  2LRN A;  4ZBB A;  5ECR B;  1X0R A;  1G7O A;  3TOT A;  2GZP A;  3QAW A;  5ELG A;  3M9K A;  1FOV A;  4KF9 A;  1X5C A;  4V1A g;  4E8H A;  1K3Y A;  3QCP A;  2LJK A;  2X4A A;  2VL2 C;  3ZML A;  1QMV A;  5JWR B;  1JFU A;  12GS A;  2TRX A;  2PUK C;  2O87 A;  2GT5 A;  4GF0 A;  4DEJ A;  2VCT A;  4RI6 A;  1F6M C;  2H6X A;  5C00 A;  2HRN A;  1PL2 A;  2LKU A;  4ECB A;  1HNC A;  4PX1 A;  1J0F A;  4IW9 A;  1MDI A;  1TK8 B;  1PD2 1;  2RLI A;  2IPA A;  2ZNM A;  2HYX A;  6GSV A;  1GSF A;  1NM3 A;  2FWF A;  1Z5Y E;  3CMI A;  3UBK A;  4ZXG A;  1VRS D;  3TCO A;  2LEG A;  3C71 A;  4EO3 A;  2B1K A;  5BMU A;  2CQ9 A;  2L5L A;  1NSW A;  1GRX A;  13GS A;  2FWE A;  5IMA A;  4LMW A;  2MBT A;  3F9U A;  4YKG A;  1B4Q A;  4E8E A;  5ECH B;  4V1A p;  2ZUP A;  3RPP A;  5IMV A;  5KN3 A;  3P2A A;  1T4Z A;  1OE7 A;  1ZYN A;  4XS4 A;  3CTG A;  5FT3 A;  1R5P A;  1WE0 A;  2RUE A;  4YQM A;  2EC4 A;  1ZYE A;  5B6N A;  1YKA A;  3HVX A;  1EV9 A;  3EU3 A;  4HJ2 A;  1JZD A;  1GUH A;  1S3D A;  1RK4 A;  4XS6 A;  4PQI A;  3MAK A;  11GS A;  5DVB A;  1K3O A;  3GUS A;  1LJR A;  5DBQ A;  1F2E A;  2O7K A;  2AYT A;  2P0G A;  4XIH A;  4ZL7 A;  4F82 A;  4XCS A;  2V32 A;  1Z7R A;  4IKH A;  2FLS A;  4O5U A;  3LOR A;  3HXS A;  3EMX A;  3LWA A;  1QK8 A;  2HZF A;  4CY6 A;  4AJ6 A;  1V40 A;  2HE3 A;  2C3Q A;  4HZ4 A;  4NHZ A;  3WT2 A;  4JU5 A;  2FD3 A;  2VLU A;  1PA3 A;  1Z7P A;  4XHM A;  4ID0 A;  3WGD A;  2YOI A;  3F0I A;  5CRG A;  2L57 A;  4IHU A;  1S3A A;  4MJB A;  2A2P A;  5G31 A;  3JCM L;  2TRC P;  2C3T A;  2P31 A;  2R37 A;  5GST A;  1AC1 A;  5KOX A;  5ECI B;  4BWS A;  2OE3 A;  1WP0 A;  3GX0 A;  1R5A A;  1FG4 A;  1UVZ A;  4P3Y B;  2H1D A;  5ECL B;  3KZQ A;  5J9C A;  1FAA A;  1YEP A;  3ME8 A;  5GAN D;  4EE0 A;  1TK5 B;  4POM A;  1FVJ A;  3ZIV A;  1XW6 A;  5IPG A;  2I3Y A;  3MWH A;  1VF1 A;  20GS A;  2XBI A;  2H6Y A;  1I5G A;  1SKS B;  1QQ2 A;  3R3E A;  3CRT A;  5IQY A;  4X0X A;  5CP1 A;  2FNO A;  3D0Z A;  4O5Q A;  1GNE A;  1GTI A;  3M3M A;  1SK1 A;  1SK0 A;  1FB6 A;  2ES7 A;  3ERW A;  3VWW A;  5DAK A;  5JCW A;  5CRD A;  1Y6E A;  3H1N A;  3KP8 A;  1M2B A;  2L5O A;  1FOH A;  1E6B A;  1G6Y A;  3CXG A;  1CQG A;  16GS A;  2UZ8 A;  4MPG A;  3MIX A;  5A4U A;  2X8H A;  1X5D A;  4PUF C;  1X9W B;  2GT6 A;  3M1G A;  4N30 A;  5HR2 A;  3IBH A;  5LNK e;  4MJA A;  3NOF A;  4BVX B;  1GNW A;  1ZYQ B;  1MDK A;  2YN1 A;  1KNG A;  1HD2 A;  3TDG A;  3H8Q A;  2OBI A;  1THO A;  4WF5 A;  3F4R A;  4K5R A;  3E9J B;  2L6C A;  3L4N A;  4TXV A;  4F0B A;  4MZC A;  1XWG A;  5HR0 A;  2VCZ A;  4KCA A;  1F3B A;  4GXZ A;  1TRU A;  4EVM A;  2H76 A;  3SBC A;  5FWG A;  2L59 A;  2G2Q A;  4JR6 A;  4DSR A;  3HCZ A;  3C8E A;  4MA9 A;  2HZE B;  1TRW A;  3UBL A;  2LRT A;  1O73 A;  1SKW B;  2OKA A;  2V2G A;  1XWB A;  3L0H A;  1WRY A;  2Z9S A;  4TOP A;  3TKS E;  3CSH A;  2GTU A;  2LUS A;  4CW9 A;  4KGI A;  3W8J A;  4O5R A;  4ISD A;  3EVI A;  2FGX A;  2ON7 A;  4FYB A;  2E7P A;  2GST A;  1FW1 A;  1U6T A;  3IDV A;  1YY7 A;  4KW6 A;  4HDE A;  4NV2 A;  2V41 A;  3F3R A;  1OKD A;  4IEL A;  4TN8 A;  3ZFL A;  3UAP A;  2TIR A;  3WYW A;  4GQC A;  3ZMK A;  2X8G A;  3F4S A;  3I6A A;  4NPB A;  2E2M A;  3UMA A;  4EUY A;  5J3R A;  1SYR A;  4Q5F A;  1G7E A;  2WGR A;  4H86 A;  2H74 A;  3H79 A;  1AUC A;  1GLQ A;  4POL A;  2CV4 A;  3GUR A;  3ZLP A;  2YP6 A;  2DIZ A;  18GS A;  3QMX A;  4OO4 A;  3W8S A;  2K8S A;  2R5G A;  3Q74 A;  2XPE A;  3QFB C;  4KH7 A;  3TKP A;  3EC3 A;  3HA9 A;  3UJ1 A;  2L4C A;  5GZZ B;  2VL3 A;  1YZX A;  2FWH A;  4PGT A;  2ALB A;  4G0K A;  4RQX A;  4BVX A;  5B8A A;  1N8J A;  2B6M A;  4MAB A;  4DVC A;  4IQ1 A;  3ZIT A;  2DMM A;  2DKI A;  1PL1 A;  2YWM A;  3J7Y k;  3V1W A;  1SD9 A;  3GHA A;  3L9V A;  1O6J A;  4G2E A;  1BQ7 A;  3RHC A;  1OE8 A;  3C73 A;  2A4V A;  2AJQ B;  3ZL5 A;  4GSN A;  4RQR A;  1BAY A;  3DKS A;  3VLN A;  4MCU A;  2PBJ A;  1TRS A;  5G1L A;  3FZ9 A;  3G7Y A;  4OFT A;  3IC4 A;  3LYP A;  2HZE A;  3LFL A;  3L9U A;  2ZCT A;  3D4T A;  2JSZ A;  1JLW A;  3F63 A;  1K0C A;  2H19 A;  5D8I A;  4YAP A;  1G0T A;  4FYU A;  2I9H A;  3TOU A;  2LJR A;  2JZS A;  2KOK A;  4IQA A;  2YAN A;  1BED A;  3D21 A;  4AGS A;  3BJ5 A;  4J56 E;  3TRQ A;  4IN0 A;  4NHW A;  2H0I A;  2MZC A;  3GH9 A;  4HQZ A;  4EKZ A;  4LLR A;  2PVQ A;  4HZ2 A;  5E59 A;  1ABA A;  1LU4 A;  1TU7 A;  2CX4 A;  2YV9 A;  3HJP A;  3HZ4 A;  5F8B A;  3RDW A;  3WT1 A;  5H5Q A;  4OMV A;  4EDZ A;  2O85 A;  4K8M A;  2YV7 A;  2L4Q A;  2YWI A;  3RPN A;  3QFA C;  1SL1 B;  3O3T A;  4HU9 A;  5A4V A;  3P8W A;  2I1U A;  1A0F A;  4WBJ A;  2BTO T;  4PNG A;  2YZU A;  2YZH A;  5IO0 A;  2HRK A;  1XBS A;  1T3B A;  5AIX A;  1KEB A;  4WKW A;  2PER A;  1ZCP A;  4OCE A;  2GQL A;  2J23 A;  2H73 A;  4HJM A;  1U87 A;  4ICY A;  1MD3 A;  5G30 A;  4MP4 A;  2HXK A;  4BA7 A;  4O92 A;  1KTE A;  3GV1 A;  1FB0 A;  1GSY A;  2DJ1 A;  4NMU A;  3ZIJ A;  2C0E A;  1FHE A;  4GSS A;  4G0L A;  4PQH A;  1ZYP A;  4OFM A;  6GSS A;  2CT6 A;  4HOJ A;  5AIS A;  3C1R A;  4IJI A;  3GL5 A;  3LW9 A;  1AIU A;  5GSS A;  3US3 A;  1M2D A;  1Z6N A;  3VPQ A;  1RQM A;  2N5B A;  1CQH A;  6GSX A;  2F3M A;  1Q4J A;  1TW9 A;  3DYR A;  3APQ A;  1K0M A;  4MNN A;  3GFK A;  4Q5R A;  3TRX A;  2JZT A;  3A5I A;  1XOA A;  5F06 A;  1A2M A;  2MMO A;  2HSH A;  3M9J A;  1WWJ A;  1Z3E A;  2X99 A;  1ST9 A;  2LRC A;  2XHF A;  2AHE A;  3VPT A;  3P7X A;  3E3E A;  5D73 A;  4KCE A;  4OWY A;  5HFK A;  5E4W A;  2H1B A;  1SJI A;  6GSW A;  4HEA 2;  3HY2 A;  2FCH A;  2MMN A;  2X64 A;  4CDO A;  1WOU A;  2VCV A;  3DIE A;  2HRA A;  1S3C A;  1ERW A;  1T1V A;  1SKR B;  5B7C A;  4JED A;  3LXT A;  1M0U A;  4L0W A;  1K0D A;  2RII A;  3IE3 A;  1TOF A;  1A2J A;  3CSJ A;  1EOG A;  2KLX A;  4LL1 B;  1AQX A;  1RW1 A;  1YF1 A;  3ZFB A;  3QR6 A;  5A5K A;  9GSS A;  2X49 A;  2QA1 A;  4MZW A;  1PSQ A;  3QDN A;  2YNX A;  4X43 A;  2M80 A;  1WJK A;  1W4V A;  1FO5 A;  2D2Z A;  3DGQ A;  3DVX A;  5DJM A;  1J08 A;  1W89 A;  1ZZY A;  2WDU A;  3HKR A;  4K0N A;  3ZVJ A;  5AN1 A;  2L6D A;  3OR5 A;  4EF0 A;  5ELA A;  2OE1 A;  3IHG A;  4EC0 A;  4TXO B;  4ECC A;  5DAK B;  2DSA A;  4G9H A;  2V6O A;  4K2D A;  3C7M A;  2H66 A;  4MMM A;  4PUA A;  2VLT A;  3VI7 A;  3HD5 A;  2B7J A;  4OCF A;  1EWX A;  2V6K A;  5INY A;  1BX9 A;  1OC8 A;  4BL7 B;  1ERV A;  4D73 A;  2M72 A;  5IO2 A;  5DQY A;  1TRV A;  1OC9 B;  1GH2 A;  3U6V A;  1UN2 A;  2K9F A;  4N10 A;  1T00 A;  2LQO A;  2GZZ A;  2HSY A;  5HR1 A;  4YAV A;  1PX7 A;  3N9J A;  2DIY A;  3FRC A;  1XPV A;  1Z9H A;  4TR1 B;  1HNA A;  2XBQ A;  4HQS A;  3EYT A;  3KTL A;  2LNS A;  4HS1 A;  3UEM A;  2PU9 C;  4EXJ A;  1U88 A;  3I69 A;  3Q18 A;  4I5Q A;  3HVV A;  4Q5N A;  4WEY A;  4ZL9 A;  5IIZ A;  1JZR A;  1GSD A;  2P5Q A;  3VFI A;  4GTU A;  1UC7 A;  1B8X A;  4YQV A;  4NV5 A;  4IS0 A;  2C80 A;  4K7N A;  3VI5 A;  2P5R A;  3FW2 A;  1TJD A;  3QOU A;  2R4V A;  1N2A A;  2R0C A;  3F8U A;  4KB3 A;  3TUE A;  5J41 A;  2H0G A;  2NVL A;  2A4H A;  2VCW A;  3DML A;  4LMV A;  4KA0 A;  2OE0 A;  3FK8 A;  3IK9 A;  4QL7 A;  4L5O A;  2E2G A;  4Z7X A;  4KDY A;  5A4W A;  3KH9 A;  4TXO A;  1ACV A;  4RUV A;  3GX8 A;  3DD3 A;  2GSQ A;  4BPY A;  2V1M A;  4FQU A;  2GVP A;  1VGL A;  1GUK A;  2HLS A;  1JHB A;  2JU5 A;  1G6W A;  5BRT A;  3TJB A;  3GIX A;  4MJC A;  4BL7 A;  3TRP A;  3APS A;  2LNT A;  3KXO A;  5IOX A;  3VWX A;  3F6F A;  4KDX A;  1TU8 A;  1OC9 A;  2RM5 A;  2FHE A;  2H1A A;  3DRN A;  1PX6 A;  1GSS A;  4KSM A;  1X9S B;  1MD4 A;  1OKT A;  2MYG A;  3LXZ A;  4TR1 A;  3GN3 A;  3VWU A;  4EDY A;  1VF4 A;  3D6I A;  1F3A A;  2VAF A;  2PGT A;  3EWL A;  1A8Y A;  2VIM A;  1EGO A;  3LYK A;  3KCM A;  2CVB A;  1OVN A;  1K0B A;  1A0R P;  1Z6M A;  3BD2 A;  4ZBA A;  3TKS C;  1ZL9 A;  3KIJ A;  2OAD A;  2H75 A;  1ERT A;  1GTA A;  2LTK A;  4K6X A;  1GSE A;  2IMK A;  3F6D A;  4TKY A;  2GGT A;  5JWO B;  3D5J A;  2VOC A;  2IWT A;  4AJ8 A;  1O8W A;  4WXT A;  4I2T A;  1XWK A;  5J9B A;  3UVT A;  3GST A;  2JAD A;  4BWQ A;  1F37 A;  1M2A A;  2IME A;  1TDI A;  2B5X A;  1OYJ A;  4MF6 A;  3C1S A;  5CYY A;  4Z2T A;  1K0N A;  3IA1 A;  1XIY A;  1YDK A;  1XWC A;  5EPF A;  5G5E A;  4O32 A;  3E0U A;  5ECM B;  2KHP A;  3BOA A;  4K2X A;  3WD6 A;  3LSZ A;  1SD8 A;  4IGJ A;  3GKX A;  1AQW A;  3A5W A;  5D9W A;  4JRR A;  1GLP A;  3PH9 A;  5F07 A;  4WR5 A;  3NZN A;  22GS A;  1T7P B;  3HJO A;  2EIO A;  4WBR D;  2HI7 A;  4NAX A;  3G7J A;  2IMI A;  19GS A;  4LL4 B;  1J9B A;  4PXO A;  4IJ3 A;  3WGE A;  1R4W A;  4MJE A;  3TB2 A;  1NW2 A;  3QAV A;  4F9Z A;  3AY8 A;  4IP6 A;  2YWN A;  3APO A;  5IMF A;  7GSS A;  4GWR A;  4ZB6 A;  1C72 A;  3CSI A;  4PNF A;  5ECN B;  4N11 A;  1XVW A;  1JZO A;  3IPZ A;  1PQN A;  3UAR A;  1ZMA A;  2DLX A;  1QGV A;  1X9M B;  2A2R A;  5D9V A;  4IVF A;  4NXI A;  2LS5 A;  1EP7 A;  1EEJ A;  2VD1 A;  1XVQ A;  2H1G A;  4KX4 A;  1ZOF A;  3IC8 A;  2REM A;  1TI1 A;  4XTS A;  1A2L A;  3FY7 A;  4G0I A;  1JZW A;  5D93 A;  2K6V A;  2NBS A;  4G10 A;  1A23 A;  1SJ6 A;  2OBK A;  4EIP A;  2DJ0 A;  1GWC A;  3IHQ A;  4YH2 A;  5DDL A;  2AV4 A;  2FWG A;  4N0V A;  5DQS A;  1BJX A;  3N5O A;  1B4P A;  1M99 A;  2VO4 A;  4ZB9 A;  2DJ2 A;  3CYN A;  1Q98 A;  3ZRD A;  3WGX A;  3IRA A;  3KEB A;  1ILO A;  1H75 A;  2PPT A;  4ML1 A;  3CRU A;  4Z2R A;  3FR6 A;  1AXD A;  1M9B A;  1SEN A;  3GSS A;  1WIK A;  1AAZ A;  2WS2 A;  3ZZX A;  4J2F A;  3EUR A;  4KAE A;  2CVD A;  2H30 A;  4I6X A;  1TXX A;  3LJR A;  3HYP A;  5F0G A;  3FR3 A;  5IMC A;  4MZB A;  2VD0 A;  4I2U A;  3GRX A;  4CY8 A;  2EIR A;  1T4Y A;  1MTC A;  1TP9 A;  4JBB A;  5CRW A;  4ACS A;  1K0A A;  2CX3 A;  1TK0 B;  4QL9 A;  2JZR A;  3I43 A;  1EP8 A;  2LST A;  1URM A;  4D73 B;  3GTU B;  3FEU A;  5JCG A;  2RUF A;  4TR0 A;  1DUG A;  3MSZ A;  5LD0 A;  2HFD A;  4ZB8 A;  5DCG A;  1JLV A;  2GQM A;  2H01 A;  3VK9 A;  5G1K A;  4NWY A;  1I9D A;  1GL8 A;  3O76 A;  2CZ3 A;  2WRT A;  3UIW A;  1EZK A;  3PGT A;  5DAL A;  3QPM A;  3PR8 A;  4GST A;  3CTF A;  3IAS 2;  4K9Z A;  2AAW A;  3K8N A;  5ECQ B;  2DKH A;  3GH6 A;  1GSQ A;  3RHB A;  1B9Y C;  2B7K A;  2H0H A;  3FZA A;  1MEK A;  1UA5 A;  2F9S A;  1EV4 A;  1QXH A;  3RBT A;  3GMF A;  4PTS A;  1K0O A;  2YCD A;  5B6M A;  1AW9 A;  2MMA A;  1LBK A;  1U3A A;  4TR4 A;  4K1F A;  2AUV A;  1DE1 A;  5AGY A;  4F0C A;  3ISO A;  3FMW A;  2QKE A;  4X1U A;  4DSS A;  2BMX A;  2DJ3 A;  2VCQ A;  1GSU A;  4KUN A;  3LGC A;  4MPF A;  4V2M A;  4K5S A;  2G0F A;  1EOH A;  2H70 A;  2C3N A;  1NHY A;  1YF0 A;  1V57 A;  2C0D A;  2QGV A;  3I9V 2;  4O7H A;  4Z2U A;  4IBP A;  1OC3 A;  2C4J A;  4G19 A;  2GZY A;  2X8C A;  1R26 A;  1XZO A;  3QAG A;  2HT9 A;  2RM6 A;  3W6G A;  5ID2 B;  1HNB A;  2J9H A;  3A3T A;  3UOM A;  4XRA A;  2C8U A;  5EL8 A;  3Q6O A;  3VUR A;  3FHK A;  4V2L A;  4AJ7 A;  3GTU A;  4ML6 A;  3FYG A;  4N0Z A;  3J7Y b;  3KGK A;  3G9B A;  5D9X A;  1TI3 A;  3HDC A;  3HJM A;  4RI7 A;  5HR3 A;  2I81 A;  1A8L A;  2B1L A;  4TR3 A;  4GQF A;  4ZL8 A;  4F2I A;  4HI7 A;  3CBU A;  2PN8 A;  4ULX A;  1GTU A;  1SL0 B;  1VF3 A;  4OFN A;  1FVK A;  1O81 A;  3GKN A;  3G7I A;  17GS A;  5KN0 A;  2M46 A;  5DJL A;  4TW5 A;  5HFG A;  4GLT A;  3TKR A;  1XFL A;  2XC2 A;  2N5A A;  1NHO A;  2WUL A;  3ZVJ D;  2DJK A;  3P90 A;  4ZIJ A;  1XCC A;  4MH2 A;  1GP1 A;  3ERF A;  2R3X A;  2QSI A;  1YEX A;  2IFQ B;  3HHV A;  5IOW A;  2NDO A;  1U3I A;  2PMT A;  4KSO A;  1KBN A;  2VLV A;  2OJL A;  3M8N A;  5G2Z A;  3D4M A;  4F03 A;  2LV3 A;  5D96 A;  4EL1 A;  2MBS A;  2FA4 A;  1V2A A;  3RAZ A;  1IYH A;  2YJ7 A;  4K0G A;  3A2V A;  1WMJ A;  6GSY A;  2KP1 A;  3ZRE A;  1ERU A;  5KEJ A;  1EEM A;  3GNJ A;  5CAX A;  3FZ4 A;  3D22 A;  4GCI A;  3MNG A;  4MDC A;  5ID2 A;  2GDR A;  3PPU A;  3U5R E;  3EE2 A;  4GRF A;  2FUG 2;  2VCX A;  2IL3 A;  3GL3 A;  2JSY A;  4KND A;  1QUW A;  3LEF A;  2HSM A;  4POK A;  3IK7 A;  4K7O A;  3KD0 A;  3TKS A;  2IMF A;  2HRF A;  6GST A;  2JL4 A;  3EMP A;  1AQV A;  1SJZ A;  3TJF A;  3H4K A;  4I97 A;  5KN2 A;  2KP2 A;  3TJG A;  2HNL A;  3FZ5 A;  1O85 A;  1B48 A;  5F05 A;  3DVW A;  1XW5 A;  2H71 A;  3KTB A;  5ABR A;  2WZ9 A;  5COH A;  1GTB A;  2CAQ A;  2R0P A;  2BJX A;  2PWJ A;  1VF2 A;  5ECP B;  3KMN A;  2VUP A;  1A24 A;  4ILF A;  4X4J A;  4HUA A;  3VWV A;  5CO3 A;  1PGT A;  1V9W A;  1M9A A;  3GYK A;  5IMD A;  1EGR A;  4FO5 A;  3DEX A;  3GA4 A;  3UVH A;  2QC7 A;  1XXU A;  2H6Z A;  4AF2 A;  3UL3 A;  2EIQ A;  2F8F A;  3FR9 A;  1THX A;  4USS A;  8GSS A;  3BCI A;  3KJY A;  2IFQ A;  1SYX A;  1GUM A;  4IP1 A;  1SL2 B;  4ECJ A;  3MDK A;  3PIN A;  4MF5 A;  1BYE A;  2CAI A;  2O89 A;  3LG6 A;  2ON5 A;  1XWA A;  1PN0 A;  5ECS A;  4CHS A;  3KP9 A;  2VM1 A;  5KOW A;  3MYD A;  1PKZ A;  2C0F A;  4TVE A;  4FH8 A;  4JZQ A;  5AIV A;  1BG5 A;  3TJJ A;  2GLR A;  1R7H A;  4V2N A;  4ZBD A;  2H8L A;  3IXR A;  2QA2 A;  1MDJ A;  3IV4 A;  2PVO C;  2VM2 A;  4JE1 A;  1F9M A;  5LCZ A;  3SWL A;  5JWQ B;  1QFN A;  2YWO A;  3KH7 A;  1DE2 A;  1E2Y A;  5JCU A;  5FHI A;  1XW9 A;  2N5F A;  4HU7 A;  2E0Q A;  5CRE A;  3GKM A;  2VL9 A;  10GS A;  2IMD A;  3QD9 A;  2NTO A;  4WR4 A;  2GQK A;  2FA8 A;  1O8X A;  1X5E A;  2WB9 A;  3A2X A;  1YQ1 A;  3TKQ A;  1K3L A;  3L9S A;  3IAM 2;  4KDU A;  1ZGN A;  4WF4 A;  1WPI A;  2MMZ A;  3EPT A;  5H5S A;  2XPD A;  2YPM A;  1HQO A;  2LQQ A;  1PN9 A;  5IM9 A;  2K8V A;  5H5R A;  2B5Y A;  3ZTL A;  4JR4 A;  3BCK A;  1SU9 A;  2GSR A;  5J4U A;  2I4A A;  2K18 A;  4BVY B;  2B5E A;  2NPB A;  1XOB A;  4POB A;  1O7U A;  1V98 A;  3ZYW A;  4I8B A;  4YQU A;  6GSU A;  4MF7 A;  1HYU A;  4KE3 A;  3LQ7 A;  4MK3 A;  1OAZ A;  2A2S A;  2C1Y A;  5KN1 A;  3Q19 A;  3L78 A;  3ED3 A;  3TJK A;  2AB6 A;  2OAC A;  4OD7 A;  5EVO A;  2WJU A;  1TTZ A;  14GS A;  1YKC A;  2H72 A;  2LJA A;  2B3S A;  5DAL B;  1USB A;  1DSB A;  5HQP A;  3HZ8 A;  4QQ7 A;  1ML6 A;  5ECO B;  1PRX A;  3EU4 A;  1SK2 A;  2WFC A;  3EIN A;  1V58 A;  1PKW A;  2C0G A;  5GAP D;  3KMO A;  5ENU A;  4J57 E;  5D9T A;  2DBC A;  3F4T A;  3DWV A;  5CNW A;  4ECI A;  1ON4 A;  4WET A;  3A2W A;  2DC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...