4KBQA

Structure of the chip-tpr domain in complex with the hsc70 lid-tail domains
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
130
structure length
130
Chain Sequence
PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase CHIP
publication title A Bipartite Interaction between Hsp70 and CHIP Regulates Ubiquitination of Chaperoned Client Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein binding
total genus 52
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kbqA00
1ELRA 3LY9A 4UQZA 3OXLA 4N3AA 2I6HA 5FZQA 1NA0A 3UQ3A 3S7BA 2Y4TA 2XGMA 5HQ8A 4H7XA 5DIZA 3ASDA 1TJCA 2KC7A 3O48A 4YVQC 4H7YA 2UWJG 4NRHB 2IF4A 3FWVA 1ZBPA 3GZ1A 4AM9A 3VTXA 2YHCA 2E2EA 3OXGA 4I2WA 4J8EA 2NC9A 2XPIA 5CCMA 1PC2A 3FFLA 3TAXA 1KLXA 4BTAA 5A7DB 3ESKA 5G04C 4XI0A 2KCKA 4GYOA 3UUXA 2LNIA 3ZPJA 4WNFA 4N2QA 2Q7FA 2OOEA 4G2VA 2PZIA 2FEZA 3RJVA 3WXXA 4EQFA 2VQ2A 2KATA 4GA1A 4ME2A 2HYZA 2LSVA 2VGXA 4WUYA 3GYZA 2XCBA 3NF1A 3Q5MA 3IEGA 3QDNA 3ULQA 2FI7A 2PL2A 2VGYA 4I1AA 2C0LA 4G26A 4BT9A 3CVNA 4GCOA 2FF4A 2LSUA 3BEEA 3Q15A 4UI9C 3EDTB 4BT8A 4G1TA 5KJMA 5KJLA 3CVLA 3CK9A 3CKBA 4Y6CA 5M72A 3LY7A 2R5SA 4WNGA 2UY1B 5FJYA 4G25A 3ZHEB 5AYWD 5DBKA 3AS8A 5BT1A 3PDNA 4HOSA 3MKRA 3HYMB 2XCCA 5FZSA 3FP3A 2PQNA 4GA2A 3MV2B 3ASGA 3RKVA 4I9EA 4KBQA 2IFUA 3URZA 1P5QA 2VYIA 4CGWA 2C2LA 5G05J 5EX0A 4CGVA 3VTYA 2MHKA 4GCNA 4KYOB 2V5FA 4KXKB 4UQYA 4GZ3A 1WAO1 3TG5A 4APOA 3CVQA 4N2SA 1ELWA 4J8DA 3QWPA 2J9QA 3LKUA 3TG4A 1QQEA 4RG9A 1HXIA 3CKCA 4J8FA 1IHGA 4J0UA 2UY1A 2WPVA 3RU0A 1ZU2A 3ZHEA 1HZ4A 3S7DA 5CHEE 4GA0A 3CK7A 5KJNA 4XIFA 1E96B 2KCLA 2GW1A 4G23A 1NZNA 4WNDA 4N39A 5C1DA 3AS4A 1NA3A 2JLBA 4RG6A 3GW4A 2VSYA 2HO1A 3JYSA 4GZ6A 2C0MA 4GYYA 4Y6WA 4UQXA 3ZFWA 4A1SA 1HH8A 5LCWC 5G04J 2VSNA 3CK8A 3ASHA 2WQHA 4CDRA 1QZ2A 5FTPA 3KS2A 4G24A 1KT0A 3Q47B 5KJKA 4IN3B 4U0UA 3OXFA 3S7JA 3E4BA 3TGOA 4I9CA 4N3BA 2XEVA 1W3BA 4I2ZA 3U3WA 1OUVA 3AS5A 4LEUA 4UI9J 2BUGA 3CEQA 5D0QD 2PQRA 4GYWA 3S7FA 3ZN3A 2ONDA 4HORA 3QOUA 3CVPA 3CV0A 3MEKA 4W9RA 4JA7A 5FZRA 3KAEA 4N3CA 3QWVA 4N5CA 5FT9A 3Q4AB 4YNDA 4AIFA 4U07A 3GZ2A 5CCLA 5HI7A 2VGXB 2FBNA 3UPVA 4U04A 4XI9A 1WM5A 3R9AB 2QFCA 3RO3A 2FO7A 4B94A 5JJ7A 3ASFA 5JJTA 5JJ6A 4GPKA 1XNFA 1KT1A 4UI9K 1Y8MA 5A6CA 1YA0A 3MA5A 5EKQD 4AY5A 4JA9A 2L6JA 3PE4A 3SF4A 4BTBA 1IYGA 4BWRA 3N71A 3U4TA 3MV3B 4NQ0A 4JL0A 5BW8C 3LCAA 2P58C 3K9IA 5ARFA 4YVOA 1B89A 5ARGA 3Q49B 2AVPA 3LPZA 3ZGQA 2KCVA 2Y4UA 5D0OD 3QKYA 2YQ8A 5EX3A 2DBAA 5BNWA 4U0ZA 1A17A 2XGOA 3KD7A 4U0SA 3PE3A 2XGSA 4O6FA 3LYAA 4I17A 2HR2A 3RO2A 4AY6A 4HOTA 4HOQA 4ABNA 5G05C 4JHRA 4F3VA 3RIBA 5LCWJ 4HOUA 4GZ5A 3SZ7A 1FCHA 3QWWA 3LY8A 4WNEA
chains in the Genus database with same CATH superfamily
2R02A 3MZLB 1S64A 1BI8B 4UQZA 3OXLA 3VLFA 3CHSA 3UQ3A 2WXJA 4TUUA 4GTPA 3IBEA 2I1KA 2L0TB 4F1SA 1PY1A 3NB2A 3NQPA 2P9SG 5HQ8A 4GB9A 3ASDA 1OWOA 1MHQA 3FHEA 3ZYLA 2UWJG 5ITZF 3AAAC 4LNGA 2IF4A 2R03A 3VTXA 1V55E 2E2EA 4WWPA 4I2WA 2PNNA 2F8YA 2KM4A 3NOCD 4MS6A 3C3QA 5JMND 2OCCE 3APCA 5E75A 3QC1A 3TWXA 3EHNA 2ZU6B 3CHOA 1S70B 4N2QA 2Q7FA 5AQAA 4LRZA 1HG5A 4IYPA 2KATA 1PAQA 1K3ZD 3FU3A 4DX7D 3NOGD 3GYZA 3PZ1A 3G2SA 3JXIA 2WMNA 1TJFA 3IEGA 4ANUA 2A5UA 2FI7A 2V5QC 3JCKC 2GRRB 1OCCE 2IQCA 3CVNA 2KXPC 5CBOA 2FF4A 2LSUA 2VTBB 4JD2G 4P29A 3V31A 1TN6A 5KJMA 4XE0A 2DIWA 3MCXA 2X6IA 2YNQA 3G2VA 2IEJA 3CK9A 3CKBA 3LY7A 4WNGA 3AG4E 3FUFA 4GTTA 3ZHEB 3Q78A 3D9JA 5DBKA 2DZNA 2L0IA 3RK6A 3PDNA 1WDYA 1EF1C 3MV2B 1TR4A 3ASGA 4FJYA 5CRVA 3PEVB 4GMJA 3FH8A 3SBSA 2GROB 3MKQA 4DX2A 5G05J 1K8KG 4ACLA 3V79K 4NURA 4GCNA 4KYOB 1Q2ZA 4HRLA 5EILA 3W9GA 3TG5A 1EYHA 5E76A 3CVQA 1HF8A 4MKTA 4PUCA 4XEIG 5FQ8A 4DLQA 4BX8A 4N2SA 5AAOA 3EIQC 4TRQA 4RG9A 4GTSA 5HRYA 1IHGA 2BKGA 3DPDA 3QB2A 3UKUG 3EU5A 5CRUA 4GZCA 2P2CP 1Y6IA 1SA5A 2BTDA 4GA0A 1SZ9A 4EBAA 2KCLA 3SFXA 4BETA 1NZNA 1YYHA 5C1DA 4JEUA 1E8YA 2JLBA 3TWSA 1TYQG 2VSYA 3JYSA 2VSXE 4GZ6A 2C0MA 1OWMA 1UN8A 1HH8A 4AJWA 4URKA 1BPOA 4XKBA 3DPYA 5FTPA 2ZISA 3Q47B 1LTXA 5FQ6A 5KJKA 2IOSA 4HRNA 4R7LA 4DUIA 3HXEA 4O60A 4BEPA 3TGOA 4N3BA 3VLEA 1JCRA 3UKRG 3LDZA 2IOLA 3T5VA 1NL4A 3KEAA 4F53A 3U3WA 1OUVA 1JUQA 4U63A 3CEQA 4PS3A 5JHBA 2BEDA 3ZN3A 2RKKA 1E8ZA 4ZHBA 3SFZA 4W9RA 4JA7A 1H6KA 1DCQA 3KAEA 4I43A 3I4GA 3QWVA 4GMLA 1TN8A 2LO6A 3HXBA 4UWFA 5HI7A 5T4YA 2GRQB 2PM6A 3ASFA 4AVXA 4GPKA 1KZOA 3FUEA 1X5BA 1Y8MA 2X6HA 5A6CA 4TXRA 5B3SE 4K5BA 2CFUA 3DBSA 1YA0A 1O5MA 4FA6A 2MYOA 2IU1A 5BPPA 3B7UX 3LVQE 5KBAA 2P9LG 3PE4A 4M7CA 5AENA 1IYGA 1OXJA 4BWRA 2F37A 3DWLG 3L9TA 3MV3B 4NQ0A 1S63A 5EIDA 1SVXA 3LCAA 3SNXA 4JPSA 4YVOA 1N4RA 4UWLA 3IHYA 3LPZA 3ZGQA 3PNTB 2J07A 1OWNA 4JEHA 4Q69A 3Q7AA 4U8HA 1N54A 5AJDA 1E7UA 1MZCA 3PS6A 1QYMA 3CSFA 3UM2A 4OYSA 2AW6A 5FINA 3KD7A 3ENEA 4APFA 2DCPA 2PM7A 2XGSA 2EIME 4UWGA 3PEUB 3PZ3A 4HFGA 4JVSA 1E7VA 2WXOA 4L9PA 4HOTA 1NP7A 4LSZE 4HOQA 2WM9A 2P9KG 5G05C 3FH5A 3TXNA 2YINA 4TV3A 4F3VA 3RIBA 4KT6B 3SZ7A 3OTNA 1AWCB 1H6PA 1FCHA 4XX5A 1KZPA 4ILIA 4WNEA 3L54A 3FUJA 1SZAA 3DXMG 2ETAA 3RRUA 1D8EA 4GTMA 5FZQA 4DJAA 1NA0A 4DI4A 3L6AA 2P9IG 2IY0C 3ZYQA 2XZTG 4K5AB 1TJCA 5ENOD 4YVQC 4H7YA 3FWVA 1H0AA 2L9BA 3OXGA 2NC9A 3C3OA 4ANWA 2OV8A 3ASNE 4XZ4A 1PC2A 4OVVA 3TAXA 1N4SA 1KLXA 2RG8A 2XPYA 2CHWA 2WXRA 3ESKA 3MJWA 4OAVB 4K0RA 2NXPA 4ZFHA 4C9BB 4XI0A 3ONKA 4CT4A 2LNIA 3ZPJA 4G2VA 2GRMA 2PZIA 2FEZA 3RJVA 4EQFA 5T3RA 2VQ2A 4I6JA 3ESLA 3JXJA 3UT7A 2VGXA 1LF8A 3CQCB 2L6BA 3QDNA 5CEAA 4RVBA 3FTUA 2VGYA 2P9UG 3D3MA 3D9IA 2FO1E 2C0LA 4RQIA 4U95D 3LVRE 4BT8A 2IONA 3BG0B 2ETBA 3ABME 2JEKA 3CVLA 4EBAG 3SY2A 3EIJA 3HVEA 2R5SA 5JHAA 1E8WA 2IJGX 1Z3YA 2UY1B 4YDOA 4BESA 4D10C 4G25A 3UIOC 5AYWD 3E37A 4B89A 5LOZA 3FTXA 3MKRA 3CVXA 4WWNA 3LJNA 5FZSA 3G2WA 5EN5D 4I9EA 4ANXA 3URZA 2VYIA 4GTVA 2C2LA 4CGWA 1FVHA 5B1AE 3W9FA 3AG3E 3VTYA 4UWHA 2MHKA 1H2TC 1U3DA 4KXKB 4UQYA 1WAO1 2WVIA 2AXVA 3F6QA 2XENA 1HU3A 4I1OB 2WXHA 3TWWA 4AOFA 3DSWA 4J7WA 4CDNA 4FC8A 4J8FA 4J0UA 4DX1A 3BU8A 3RU0A 5BV1A 1ZU2A 1HZ4A 1BLXB 1O1RA 1MQSA 2WQ6A 2XPZA 2AWIA 3ULEG 1JWGA 3FUHA 3E33A 2HM8A 3IV0A 3AS4A 3LS8A 5FIOA 2P9PG 4V3IA 2V8SE 2R2LA 3D9KA 4JB8P 4GYYA 1JCQA 4A1SA 1BU9A 3UXGA 4JW1A 4CDRA 3JQ0A 3FTWA 3B95A 1DVPA 3UT4A 4GTOA 4AV7A 2WXLA 4GZDA 1KT0A 2EQXA 1GW6A 5KNGA 4HRMB 1N52A 4OAUC 2Y69E 3E4BA 4A63B 2B6CA 3FUKA 1AP7A 3CHPA 3TWUA 4I9CA 3NAWA 2J8SD 3ONLA 3HRAA 1N94A 3KSLA 3J5QB 3Q7FA 3AS5A 4UI9J 1MX6A 2BUGA 2PQRA 3S7FA 4U8YD 5BXOA 3QOUA 2VGEA 3CVVA 4GTRA 3FUNA 4N5CA 4YNDA 4U07A 4L2YA 3ZRHA 4NIKA 2WXFA 5CCLA 2VGXB 3PZDA 2FBNA 1YCSB 4XI9A 3T8KA 3R9AB 3U9WA 3P2BA 5AQ9A 2GRLA 1OCRE 4C48B 5JJ7A 5JJTA 2X6JA 4AEZC 3Q9NC 3J5PA 3I5PA 1TNUA 3AU4A 5EKQD 1UJJA 3SO8A 4JA9A 1JWFA 4EZLA 3V2XA 2A5EA 3APDA 3L17A 3N71A 1MX2A 1IKND 3FTVA 3UM3A 2WXNA 4Q96A 1H2VC 2P58C 3CVWA 4FU3A 4IULA 3Q49B 3ZYKA 2WXMA 2DZOA 3FU6A 5ENQD 1BD8A 3JQ1A 4Q94A 4A55A 5D0OD 3RRMB 4F1PA 5ANLA 3DXKG 4G11A 2KZTA 2YQ8A 5EX3A 3R7RA 2DBAA 1NFIE 5BNWA 2EILE 3G2TA 4L23A 2I1JA 4FHJA 4U0ZA 1A17A 4U96D 3L82A 4JC8A 1LD7A 1WY6A 5AQ7A 4LNBA 3UT8A 4MBGA 1H19A 3RO2A 5LP0A 3EJNA 4ABNA 4YDWA 1N11A 5BUZA 1FT2A 5CBNA 2QC9A 3SQVA 2WXIA 1G3NB 5LCWJ 5JA4D 2QY7A 3C5RA 4HOUA 4GZ5A 4J6IA 3CVUA 3ZNGA 5KWDA 3NBNB 5AQBA 4EZJA 5J90A 1ELRA 3SD5A 4B8CB 1EPUA 4N3AA 4CT0A 2ZIRA 3RRNB 3IHVA 1ZB1A 3S7BA 2Y4TA 2V4LA 2Y3AA 2XGMA 4L2LA 1D9SA 5FWQA 3PZ2A 2V0PA 5DIZA 2YHEA 4HQDA 3O48A 1UJKA 2EINE 3UTMA 3T8MA 4NRHB 5FQ4A 3GZ1A 4AM9A 2YHCA 4RLYA 4J8EA 2RD0A 2XPIA 5CCMA 3FFLA 3U66A 3D9HA 3HXCA 3FEXA 4DX5D 2GRNB 1IXVA 2BF0X 3DEPA 3HDXA 3TL5A 1DCEA 2OVFA 4ACKA 3WG7E 2KCKA 3UUXA 4WNFA 3Q75A 3ZUVB 2J49A 5G2NA 3WXXA 4KVMA 1OCOE 1E8XA 2E0IA 5EYPF 4GA1A 1MJ0A 1ELKA 4FLBA 2HYZA 4BX9A 2OEVA 2XCBA 3NF1A 3ML9A 2CG2A 3MKQB 2XQ0A 3DSSA 3T9KA 3Q5MA 4BSXA 2ILRA 3RSEG 2RFMA 5D2MC 3HXDA 2B0OE 3PREA 1SA4A 2EIKE 3AJIA 5C2YA 4A3VA 1N95A 4GCOA 4UI9C 3Q15A 4G1TA 5CMYA 4L7TA 1RZ4A 3FDHA 3UM1A 4Y6CA 1BI7B 4HNAD 1Z5SC 1NI1A 5ENRD 4JZYA 5G55A 4EPZA 3D9NA 5BT1A 2ZGDA 2OVBA 1D8DA 2Y0BG 4K03A 4HOSA 2XEEA 2XCCA 1N0QA 3FP3A 5H7PA 2X3MA 4KBQA 2IFUA 3HG0D 1P5QA 2LXMA 1RW2A 5T8IA 3UIPC 3BUAA 2HE0A 2H6IA 4K5CA 5EX0A 4E85A 3MX3A 1S0PA 4CGVA 4FP7A 4DPRA 4HI9A 3D9PA 2V5FA 2XHEA 1HG2A 2LAHA 4GZ3A 2VTBA 2KZTB 2MRIA 4APOA 3EUVA 3KEZA 1ELWA 4G8KA 4CDMA 3LKUA 4QQIA 2XRZA 1QQEA 3B7SA 2AXZA 4CYMD 4BY6A 3FTZA 4C0EA 4YDYA 2WPVA 1OWLA 1WG0A 2DYSE 3ZHEA 3TJPA 4LG6A 3UM0A 4XKCA 5CHEE 1OY3D 1O1SA 5KJNA 4XIFA 3E34A 1E96B 4G23A 4WNDA 5HS0A 4GTQA 4X8QA 5EYLA 3ZXPA 2R05A 4BFRA 3UINC 4HVBA 3IXEA 5LCWC 1MX4A 5G04J 2VSNA 1N4QA 4QFVA 3CK8A 3L08A 3ASHA 2H6GA 2WQHA 4PS8A 1QZ2A 4GMRA 3CHMA 3AG2E 3D9LA 4G24A 5IY5E 4EZKA 3ZW3A 3CIAA 1QNFA 4IN3B 2OEWA 4DK5A 3UMVA 3OXFA 3ZKJA 1TNBA 1HX8A 1KPSB 2QYUA 3DSXA 2QZAA 1W3BA 3CGHA 2A4ZA 2WXKA 3CQGB 3CHQA 2J08A 3D9OA 3CV0A 3MEKA 4N5QA 3QJZA 3SI5A 3GZ2A 4HS2A 2DVWA 1UW4B 3FY4A 3I3NA 3UPVA 1HE8A 4ATZD 3G2UA 3ZU7B 1WM5A 3FU5A 2ETCA 3LJ3A 3KSQA 4B94A 4JXTA 4B93B 2MOWA 1UN9A 4LUNU 1OT8A 1KT1A 1U3CA 3FH7A 5BV0A 2CHZA 2CHXA 4O1PA 3AU5A 3FULA 4EHMA 2L6JA 4GPMA 3SF4A 3EHMA 4WAFA 3SHFA 2ZGGA 2XEHA 3C3RA 5BW8C 3CLJA 4ANVA 3BQOA 3K9IA 5ARFA 1B89A 4KZCA 5ANRA 2F0YA 3ZYMA 1SQMA 2Y4UA 1TNZA 3B7RL 2WMOA 2R17C 4A1GA 3QKYA 2H6FA 3FTSA 3SBTB 4MRUA 1N4PA 4KZ0A 3C72A 2XGOA 4U0SA 4U7EB 3HIZA 4FJZA 1X81A 4C0MA 4OVUA 4I17A 4DX6D 3DSTA 3EHRA 3ZXSA 4AY6A 3UI2A 2DWZA 4IRUA 2J4DA 2NYJA 4TUMA 3ZIMA 3QWWA 3R9MA 1JCSA 3LY8A 3I4RB 2FULA 3LY9A 4J8YA 2I6HA 1YMPA 4I6EA 4HLLA 3IKOB 3C98A 4H7XA 1FVFA 2KC7A 3GZSA 3FUMA 4CEMA 1ZBPA 4FULA 5AARA 3R7QA 2F8XK 1K1AA 5FQ7A 2VSOE 5BXUA 1QBQA 3EHQA 4BTAA 2P9NG 3HVEB 5A7DB 3NZUA 3T5XA 2XRYA 1UOHA 3P1UA 3Q9UC 5G04C 4JHJA 3V2OA 4GYOA 2QYJA 4L1BA 4M3OA 2OOEA 4TXQA 4J8SA 4DRXE 3U64A 3DRAA 1U2VG 2EIJE 3FTYA 4AXHA 5EDSA 5KCMA 4PDXA 1A5EA 4ME2A 3HHMA 3LXUX 2LSVA 4WUYA 3TWRA 2ZXWE 3S2AA 4KVOA 3ULQA 4FHKA 2PL2A 3SGHA 5J08A 1Z3XA 4I1AA 3X2QE 3QARA 4G26A 3PVLA 4BT9A 3BEEA 3EDTB 5A23A 3PNLB 1K1BA 1HO8A 4U8VD 4HBDA 1Z6TA 5KJLA 4CCAA 5ENSD 2WQ7A 3TXMA 4DLOA 3HXFA 3ISMC 3SFYA 2CFZA 5M72A 1INZA 5FJYA 1OCZE 4GAAA 3Q73A 1N9AA 2LUHA 2R59A 3AS8A 4CRWA 2XZDG 2H6HA 2I9CA 3HYMB 2VJ8A 4E6HA 5CECB 4F7AA 2GRPB 3O4ZA 2PQNA 4GA2A 4ILHB 1SW6A 3RKVA 3APFA 5CERB 1FPPA 4B0ZA 3CR3A 1IHBA 2AJAA 4FLHA 4B8AA 5KNHD 3EU9A 4HXIA 3ZEFA 2X6KA 4J8DA 3QWPA 5CMWA 2J9QA 3TG4A 3UX4A 1HXIA 3CKCA 4Z68A 1VDYA 2UY1A 3JUIA 3OAWA 3ASOE 3QAQA 3TWQA 2Y1LE 3MGBA 5AIJA 3S7DA 3ULYA 3CK7A 4F6RD 2GW1A 2WB2A 3CVYA 4N39A 3ABLE 2WXQA 1NA3A 4RG6A 3GW4A 2HO1A 4Y6WA 4UQXA 3ZFWA 1V54E 4UUCA 3B7BA 1HS6A 4A3TA 4YDEA 4BSZB 2I2OA 4G8LA 2XS8A 3FUDA 4HB5A 4NACA 3KS2A 5LX8A 3ABKE 1TEZA 2KBXA 4MLPA 5AN8A 4AP2A 4U0UA 1E90A 3S7JA 1LD8A 2M63A 4UWKA 3RAUA 3L22A 2J4BA 4RSYA 1MYOA 1TN7A 4ATGA 2J09A 4CZ2D 2XEVA 1DNPA 4I2ZA 3PRZA 4LEUA 3L16A 4I1MA 3B13A 5D0QD 4O1OA 4GYWA 4HORA 2ONDA 3VLDA 3CVPA 3DSUA 3TWVA 5FZRA 5D66A 5HKPA 4N3CA 3QNKA 5FT9A 3Q4AB 4AIFA 3PZ4A 3FUIA 4EECA 3AG1E 2IO3C 1XGWA 3L13A 1FT1A 3Q79A 5AJLA 2X38A 4U04A 2QFCA 2X6FA 4LNUD 3RO3A 2FO7A 4ILGA 3JUEA 5JJ6A 3ZVVA 4WWOA 1XNFA 3NZSA 2LAIA 1JPLA 4UI9K 4HI8A 4LCTA 1DC2A 3PH0C 1TNYA 4I6GA 4HLEA 3MA5A 4AY5A 3CSTA 3FEYA 1IQUA 4BTBA 2DYRE 4DI3A 3MYVA 2WXGA 1OWPA 3U4TA 3BG1B 4JL0A 4FADA 4JHKA 5ENPD 5CEDB 4BERA 5ARGA 3ML8A 2AVPA 2GGFA 4PH4B 2IO2C 2KCVA 3CHRA 3B7TA 3LEWA 3V30A 2NSZA 2XS1A 1HFAA 4TXPA 5EIBE 2CG3A 1TNOA 5ENTD 3FU0A 3PUKA 5ENNA 1H2UA 1N0RA 3DEOA 5B1BE 4LERA 4GU5A 2JABA 3PE3A 2V4HC 4O6FA 2WXPA 3LYAA 3QK0A 2LXLA 2HR2A 1H6OA 3E30A 1IQRA 1EDUA 3D9MA 4JHRA 3DSVA 1L5JA 5LFAA 1UG3A 2BKKB 4KMOA 3E32A 3TWTA 3PUJA 2AXUA 2RFAA 4PS7A 1O1TA
chains in the Genus database with same CATH topology
3FUJA 1ELRA 3MZLB 3I4RB 3SD5A 1SZAA 2FULA 3RRUA 4B8CB 3LY9A 4UQZA 3OXLA 1EPUA 4N3AA 3VLFA 4CT0A 2I6HA 5FZQA 4DJAA 1NA0A 3CHSA 4I6EA 3UQ3A 2WXJA 4TUUA 3RRNB 3IHVA 4DI4A 3IBEA 2I1KA 3S7BA 2Y4TA 3IKOB 3L6AA 2V4LA 2L0TB 2Y3AA 4F1SA 1PY1A 3C98A 2XGMA 3NQPA 4L2LA 3ZYQA 5FWQA 5HQ8A 2V0PA 4GB9A 2YHEA 3ASDA 4H7XA 5DIZA 1FVFA 1TJCA 2KC7A 3GZSA 1OWOA 3O48A 1MHQA 1UJKA 3FUMA 4YVQC 3FHEA 4H7YA 2UWJG 3ZYLA 4CEMA 3T8MA 4NRHB 2IF4A 3FWVA 5FQ4A 1H0AA 1ZBPA 3GZ1A 2L9BA 4AM9A 3VTXA 2YHCA 2E2EA 3OXGA 4FULA 4WWPA 4I2WA 4J8EA 2NC9A 2RD0A 4ANWA 2XPIA 2OV8A 3R7QA 5CCMA 2KM4A 4XZ4A 5FQ7A 1PC2A 2VSOE 4OVVA 3FFLA 3TAXA 3U66A 4MS6A 1KLXA 3FEXA 2RG8A 2XPYA 4BTAA 3APCA 3HVEB 2CHWA 2WXRA 5A7DB 2BF0X 3ESKA 3MJWA 5E75A 3QC1A 4K0RA 3HDXA 3TL5A 2NXPA 4C9BB 3EHNA 3NZUA 3T5XA 2XRYA 2OVFA 3P1UA 4ACKA 5G04C 4JHJA 2ZU6B 4XI0A 2KCKA 3ONKA 4GYOA 4L1BA 3UUXA 4CT4A 4M3OA 3CHOA 2LNIA 3ZPJA 4WNFA 4N2QA 2Q7FA 2OOEA 4J8SA 3U64A 4G2VA 2GRMA 2J49A 2PZIA 5G2NA 2FEZA 3RJVA 3WXXA 4KVMA 4EQFA 5T3RA 1E8XA 4LRZA 1HG5A 2E0IA 3FTYA 2VQ2A 2KATA 4IYPA 1PAQA 4I6JA 4AXHA 5EDSA 3FU3A 4GA1A 4PDXA 5KCMA 1ELKA 3ESLA 4FLBA 4ME2A 3HHMA 2HYZA 3LXUX 4BX9A 2LSVA 2VGXA 4WUYA 3GYZA 3UT7A 2XCBA 3NF1A 3ML9A 1LF8A 2CG2A 3G2SA 3CQCB 2WMNA 3MKQB 2XQ0A 1TJFA 3Q5MA 3S2AA 3IEGA 4KVOA 3QDNA 4ANUA 3ULQA 4FHKA 4RVBA 3FTUA 4BSXA 2A5UA 2FI7A 2PL2A 2VGYA 2ILRA 3D3MA 3JCKC 3SGHA 3D9IA 2IQCA 5J08A 1Z3XA 4I1AA 3QARA 2C0LA 3PREA 4G26A 3PVLA 5C2YA 4A3VA 4BT9A 3CVNA 4GCOA 2FF4A 2LSUA 2VTBB 3BEEA 3Q15A 4UI9C 3EDTB 4P29A 5A23A 3LVRE 3PNLB 4BT8A 1HO8A 2IONA 3BG0B 4G1TA 5KJMA 4XE0A 1Z6TA 2DIWA 5KJLA 4CCAA 3MCXA 2X6IA 2YNQA 3G2VA 5CMYA 4L7TA 2JEKA 3CVLA 2WQ7A 3TXMA 3CK9A 4DLOA 4EBAG 3FDHA 3EIJA 3HVEA 3CKBA 4Y6CA 2CFZA 3LY7A 2R5SA 5M72A 5JHAA 1INZA 1E8WA 4WNGA 2IJGX 1Z3YA 2UY1B 5FJYA 3FUFA 4D10C 4G25A 4JZYA 4GAAA 5G55A 3ZHEB 3D9JA 5AYWD 4B89A 5DBKA 2R59A 3AS8A 4EPZA 5LOZA 3D9NA 4CRWA 2L0IA 5BT1A 2OVBA 3RK6A 3PDNA 4K03A 3FTXA 2I9CA 4HOSA 3MKRA 3CVXA 3HYMB 2VJ8A 2XCCA 4WWNA 4E6HA 4F7AA 1EF1C 3O4ZA 5FZSA 3FP3A 2PQNA 4GA2A 3G2WA 4ILHB 2X3MA 3MV2B 3ASGA 3RKVA 4I9EA 4FJYA 4KBQA 3APFA 2IFUA 4ANXA 3URZA 1P5QA 3PEVB 2VYIA 4GMJA 5T8IA 3FH8A 3SBSA 4B0ZA 4CGWA 2C2LA 3MKQA 3CR3A 5G05J 1FVHA 5EX0A 4ACLA 4E85A 3MX3A 1S0PA 4CGVA 4FP7A 3VTYA 4UWHA 4NURA 2MHKA 4DPRA 4GCNA 3D9PA 4KYOB 2V5FA 1H2TC 4FLHA 1U3DA 4KXKB 4B8AA 2XHEA 4UQYA 1HG2A 2LAHA 1WAO1 4GZ3A 2VTBA 2WVIA 2AXVA 3TG5A 2KZTB 2MRIA 1EYHA 5E76A 4APOA 3CVQA 4HXIA 1HF8A 4MKTA 4PUCA 3ZEFA 1HU3A 4I1OB 5FQ8A 4DLQA 4BX8A 4N2SA 2WXHA 3KEZA 2X6KA 1ELWA 4CDMA 4J8DA 3QWPA 5CMWA 2J9QA 3LKUA 2XRZA 3TG4A 3EIQC 1QQEA 3B7SA 4TRQA 2AXZA 3UX4A 4AOFA 4RG9A 4CDNA 4FC8A 1HXIA 4BY6A 3CKCA 3FTZA 4J8FA 4C0EA 1IHGA 4J0UA 3DPDA 1VDYA 2UY1A 2WPVA 3QB2A 3RU0A 5BV1A 3JUIA 1ZU2A 1OWLA 3OAWA 3QAQA 3TJPA 3ZHEA 1HZ4A 3MGBA 4GZCA 1Y6IA 5AIJA 3S7DA 4XKCA 5CHEE 1MQSA 2BTDA 4GA0A 2WQ6A 3CK7A 1SZ9A 5KJNA 2XPZA 4XIFA 2AWIA 1E96B 1JWGA 4EBAA 2KCLA 3FUHA 2HM8A 2GW1A 2WB2A 4G23A 1NZNA 3CVYA 4WNDA 3IV0A 4N39A 5C1DA 3AS4A 4JEUA 1E8YA 2WXQA 1NA3A 3LS8A 2JLBA 4V3IA 4RG6A 2V8SE 3GW4A 2VSYA 4BFRA 2HO1A 3D9KA 3JYSA 2VSXE 4GZ6A 2C0MA 4GYYA 4Y6WA 4UQXA 3ZFWA 1OWMA 4A1SA 1UN8A 4HVBA 1HH8A 5LCWC 1HS6A 5G04J 2VSNA 4A3TA 4QFVA 4AJWA 3CK8A 3L08A 3ASHA 4URKA 4JW1A 1BPOA 4XKBA 2WQHA 4PS8A 4CDRA 2I2OA 3JQ0A 1QZ2A 3FTWA 5FTPA 3FUDA 1DVPA 4NACA 3CHMA 3KS2A 3UT4A 3D9LA 5LX8A 4AV7A 2WXLA 4G24A 4GZDA 1KT0A 3Q47B 1TEZA 4EZKA 3ZW3A 5FQ6A 2EQXA 5KJKA 1GW6A 2IOSA 3CIAA 1QNFA 4MLPA 4IN3B 4AP2A 4R7LA 4DK5A 4U0UA 1N52A 1E90A 3OXFA 3UMVA 3S7JA 3E4BA 2M63A 3FUKA 4UWKA 3TGOA 3L22A 2J4BA 4RSYA 3CHPA 1HX8A 4I9CA 4N3BA 3VLEA 3LDZA 3ONLA 2IOLA 4ATGA 2J09A 2XEVA 3T5VA 1W3BA 3CGHA 4F53A 1DNPA 4I2ZA 3U3WA 1OUVA 1JUQA 3AS5A 3PRZA 4LEUA 3L16A 4UI9J 4I1MA 2BUGA 4U63A 3CEQA 4PS3A 5JHBA 3B13A 2A4ZA 5D0QD 2WXKA 3CQGB 3CHQA 2PQRA 4GYWA 3S7FA 3ZN3A 2ONDA 4HORA 2J08A 1E8ZA 3QOUA 3D9OA 3CVVA 3VLDA 3CVPA 3CV0A 3SFZA 3MEKA 4W9RA 4JA7A 1H6KA 5FZRA 3KAEA 3FUNA 4N3CA 4I43A 3I4GA 3QNKA 3QWVA 3Q4AB 2LO6A 4GMLA 4N5CA 4YNDA 5FT9A 3FUIA 4U07A 4EECA 4L2YA 3ZRHA 3QJZA 2WXFA 4UWFA 3SI5A 3GZ2A 5CCLA 5HI7A 4HS2A 2VGXB 1UW4B 5T4YA 1XGWA 3L13A 3PZDA 3FY4A 2FBNA 3I3NA 3UPVA 5AJLA 1HE8A 2X38A 3G2UA 4U04A 4XI9A 1WM5A 3R9AB 2QFCA 2X6FA 3U9WA 3FU5A 3P2BA 3RO3A 3LJ3A 2FO7A 2GRLA 2PM6A 4ILGA 4B94A 4JXTA 5JJ7A 3ASFA 2MOWA 5JJTA 1UN9A 4AVXA 4LUNU 5JJ6A 2X6JA 3ZVVA 4WWOA 4GPKA 1XNFA 3NZSA 2LAIA 3FUEA 1JPLA 1KT1A 4UI9K 4AEZC 1U3CA 4LCTA 1X5BA 1Y8MA 3FH7A 3I5PA 2X6HA 3PH0C 5A6CA 5BV0A 2CHZA 2CFUA 2CHXA 3DBSA 1YA0A 4FA6A 4I6GA 4HLEA 3AU5A 2IU1A 3AU4A 5BPPA 3MA5A 3B7UX 5EKQD 4AY5A 3FULA 3CSTA 1UJJA 3LVQE 3FEYA 4JA9A 1JWFA 2L6JA 4EZLA 1IQUA 3PE4A 3SF4A 4BTBA 3EHMA 4WAFA 5AENA 1IYGA 3APDA 4DI3A 4BWRA 3L17A 3MYVA 3SHFA 3N71A 2WXGA 3FTVA 1OWPA 3U4TA 3MV3B 4NQ0A 3BG1B 4JL0A 5BW8C 3CLJA 2WXNA 4Q96A 1H2VC 4FADA 3LCAA 4ANVA 2P58C 3K9IA 4JHKA 4JPSA 5ARFA 3SNXA 4YVOA 3CVWA 1B89A 4KZCA 4UWLA 5ARGA 4FU3A 4IULA 3Q49B 3IHYA 3ML8A 2AVPA 5ANRA 3ZYKA 2GGFA 4PH4B 3LPZA 2WXMA 3ZGQA 3ZYMA 1SQMA 2KCVA 2Y4UA 3PNTB 2J07A 3FU6A 3CHRA 3JQ1A 4Q94A 1OWNA 4JEHA 5D0OD 4A55A 3B7RL 3RRMB 3B7TA 3LEWA 4Q69A 2WMOA 2NSZA 4U8HA 2R17C 4A1GA 1HFAA 3QKYA 1N54A 5AJDA 5ANLA 2CG3A 1E7UA 3FTSA 4G11A 3PS6A 3FU0A 2KZTA 2YQ8A 5EX3A 3R7RA 3PUKA 3SBTB 5ENNA 2DBAA 3CSFA 1H2UA 4MRUA 5BNWA 4KZ0A 3G2TA 4L23A 2I1JA 4FHJA 4OYSA 1A17A 2AW6A 2XGOA 4LERA 3KD7A 4U0ZA 4U0SA 4GU5A 4JC8A 3HIZA 3ENEA 3PE3A 4FJZA 4APFA 2DCPA 2PM7A 2XGSA 4O6FA 1WY6A 4UWGA 2WXPA 3LYAA 3QK0A 3PEUB 4HFGA 4JVSA 4C0MA 1E7VA 2WXOA 4I17A 4OVUA 3UT8A 2HR2A 1H19A 3RO2A 4AY6A 3ZXSA 4HOTA 1NP7A 5LP0A 1IQRA 3EJNA 4HOQA 2WM9A 4ABNA 5BUZA 5G05C 1EDUA 3FH5A 3D9MA 3TXNA 4IRUA 2YINA 4JHRA 4TV3A 2WXIA 1L5JA 4F3VA 3RIBA 5LCWJ 4KT6B 2QY7A 4AIFA 5LFAA 1UG3A 2J4DA 4KMOA 4HOUA 4GZ5A 3OTNA 4J6IA 3SZ7A 3CVUA 3ZIMA 1FCHA 3PUJA 2AXUA 3QWWA 4XX5A 4PS7A 4ILIA 4EZJA 5J90A 3LY8A 4WNEA 3L54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELR A;  3LY9 A;  4UQZ A;  3OXL A;  4N3A A;  2I6H A;  5FZQ A;  1NA0 A;  3UQ3 A;  3S7B A;  2Y4T A;  2XGM A;  5HQ8 A;  4H7X A;  5DIZ A;  3ASD A;  1TJC A;  2KC7 A;  3O48 A;  4YVQ C;  4H7Y A;  2UWJ G;  4NRH B;  2IF4 A;  3FWV A;  1ZBP A;  3GZ1 A;  4AM9 A;  3VTX A;  2YHC A;  2E2E A;  3OXG A;  4I2W A;  4J8E A;  2NC9 A;  2XPI A;  5CCM A;  1PC2 A;  3FFL A;  3TAX A;  1KLX A;  4BTA A;  5A7D B;  3ESK A;  5G04 C;  4XI0 A;  2KCK A;  4GYO A;  3UUX A;  2LNI A;  3ZPJ A;  4WNF A;  4N2Q A;  2Q7F A;  2OOE A;  4G2V A;  2PZI A;  2FEZ A;  3RJV A;  3WXX A;  4EQF A;  2VQ2 A;  2KAT A;  4GA1 A;  4ME2 A;  2HYZ A;  2LSV A;  2VGX A;  4WUY A;  3GYZ A;  2XCB A;  3NF1 A;  3Q5M A;  3IEG A;  3QDN A;  3ULQ A;  2FI7 A;  2PL2 A;  2VGY A;  4I1A A;  2C0L A;  4G26 A;  4BT9 A;  3CVN A;  4GCO A;  2FF4 A;  2LSU A;  3BEE A;  3Q15 A;  4UI9 C;  3EDT B;  4BT8 A;  4G1T A;  5KJM A;  5KJL A;  3CVL A;  3CK9 A;  3CKB A;  4Y6C A;  5M72 A;  3LY7 A;  2R5S A;  4WNG A;  2UY1 B;  5FJY A;  4G25 A;  3ZHE B;  5AYW D;  5DBK A;  3AS8 A;  5BT1 A;  3PDN A;  4HOS A;  3MKR A;  3HYM B;  2XCC A;  5FZS A;  3FP3 A;  2PQN A;  4GA2 A;  3MV2 B;  3ASG A;  3RKV A;  4I9E A;  4KBQ A;  2IFU A;  3URZ A;  1P5Q A;  2VYI A;  4CGW A;  2C2L A;  5G05 J;  5EX0 A;  4CGV A;  3VTY A;  2MHK A;  4GCN A;  4KYO B;  2V5F A;  4KXK B;  4UQY A;  4GZ3 A;  1WAO 1;  3TG5 A;  4APO A;  3CVQ A;  4N2S A;  1ELW A;  4J8D A;  3QWP A;  2J9Q A;  3LKU A;  3TG4 A;  1QQE A;  4RG9 A;  1HXI A;  3CKC A;  4J8F A;  1IHG A;  4J0U A;  2UY1 A;  2WPV A;  3RU0 A;  1ZU2 A;  3ZHE A;  1HZ4 A;  3S7D A;  5CHE E;  4GA0 A;  3CK7 A;  5KJN A;  4XIF A;  1E96 B;  2KCL A;  2GW1 A;  4G23 A;  1NZN A;  4WND A;  4N39 A;  5C1D A;  3AS4 A;  1NA3 A;  2JLB A;  4RG6 A;  3GW4 A;  2VSY A;  2HO1 A;  3JYS A;  4GZ6 A;  2C0M A;  4GYY A;  4Y6W A;  4UQX A;  3ZFW A;  4A1S A;  1HH8 A;  5LCW C;  5G04 J;  2VSN A;  3CK8 A;  3ASH A;  2WQH A;  4CDR A;  1QZ2 A;  5FTP A;  3KS2 A;  4G24 A;  1KT0 A;  3Q47 B;  5KJK A;  4IN3 B;  4U0U A;  3OXF A;  3S7J A;  3E4B A;  3TGO A;  4I9C A;  4N3B A;  2XEV A;  1W3B A;  4I2Z A;  3U3W A;  1OUV A;  3AS5 A;  4LEU A;  4UI9 J;  2BUG A;  3CEQ A;  5D0Q D;  2PQR A;  4GYW A;  3S7F A;  3ZN3 A;  2OND A;  4HOR A;  3QOU A;  3CVP A;  3CV0 A;  3MEK A;  4W9R A;  4JA7 A;  5FZR A;  3KAE A;  4N3C A;  3QWV A;  4N5C A;  5FT9 A;  3Q4A B;  4YND A;  4AIF A;  4U07 A;  3GZ2 A;  5CCL A;  5HI7 A;  2VGX B;  2FBN A;  3UPV A;  4U04 A;  4XI9 A;  1WM5 A;  3R9A B;  2QFC A;  3RO3 A;  2FO7 A;  4B94 A;  5JJ7 A;  3ASF A;  5JJT A;  5JJ6 A;  4GPK A;  1XNF A;  1KT1 A;  4UI9 K;  1Y8M A;  5A6C A;  1YA0 A;  3MA5 A;  5EKQ D;  4AY5 A;  4JA9 A;  2L6J A;  3PE4 A;  3SF4 A;  4BTB A;  1IYG A;  4BWR A;  3N71 A;  3U4T A;  3MV3 B;  4NQ0 A;  4JL0 A;  5BW8 C;  3LCA A;  2P58 C;  3K9I A;  5ARF A;  4YVO A;  1B89 A;  5ARG A;  3Q49 B;  2AVP A;  3LPZ A;  3ZGQ A;  2KCV A;  2Y4U A;  5D0O D;  3QKY A;  2YQ8 A;  5EX3 A;  2DBA A;  5BNW A;  4U0Z A;  1A17 A;  2XGO A;  3KD7 A;  4U0S A;  3PE3 A;  2XGS A;  4O6F A;  3LYA A;  4I17 A;  2HR2 A;  3RO2 A;  4AY6 A;  4HOT A;  4HOQ A;  4ABN A;  5G05 C;  4JHR A;  4F3V A;  3RIB A;  5LCW J;  4HOU A;  4GZ5 A;  3SZ7 A;  1FCH A;  3QWW A;  3LY8 A;  4WNE A; 
#chains in the Genus database with same CATH topology
 2R02 A;  3MZL B;  1S64 A;  1BI8 B;  4UQZ A;  3OXL A;  3VLF A;  3CHS A;  3UQ3 A;  2WXJ A;  4TUU A;  4GTP A;  3IBE A;  2I1K A;  2L0T B;  4F1S A;  1PY1 A;  3NB2 A;  3NQP A;  2P9S G;  5HQ8 A;  4GB9 A;  3ASD A;  1OWO A;  1MHQ A;  3FHE A;  3ZYL A;  2UWJ G;  5ITZ F;  3AAA C;  4LNG A;  2IF4 A;  2R03 A;  3VTX A;  1V55 E;  2E2E A;  4WWP A;  4I2W A;  2PNN A;  2F8Y A;  2KM4 A;  3NOC D;  4MS6 A;  3C3Q A;  5JMN D;  2OCC E;  3APC A;  5E75 A;  3QC1 A;  3TWX A;  3EHN A;  2ZU6 B;  3CHO A;  1S70 B;  4N2Q A;  2Q7F A;  5AQA A;  4LRZ A;  1HG5 A;  4IYP A;  2KAT A;  1PAQ A;  1K3Z D;  3FU3 A;  4DX7 D;  3NOG D;  3GYZ A;  3PZ1 A;  3G2S A;  3JXI A;  2WMN A;  1TJF A;  3IEG A;  4ANU A;  2A5U A;  2FI7 A;  2V5Q C;  3JCK C;  2GRR B;  1OCC E;  2IQC A;  3CVN A;  2KXP C;  5CBO A;  2FF4 A;  2LSU A;  2VTB B;  4JD2 G;  4P29 A;  3V31 A;  1TN6 A;  5KJM A;  4XE0 A;  2DIW A;  3MCX A;  2X6I A;  2YNQ A;  3G2V A;  2IEJ A;  3CK9 A;  3CKB A;  3LY7 A;  4WNG A;  3AG4 E;  3FUF A;  4GTT A;  3ZHE B;  3Q78 A;  3D9J A;  5DBK A;  2DZN A;  2L0I A;  3RK6 A;  3PDN A;  1WDY A;  1EF1 C;  3MV2 B;  1TR4 A;  3ASG A;  4FJY A;  5CRV A;  3PEV B;  4GMJ A;  3FH8 A;  3SBS A;  2GRO B;  3MKQ A;  4DX2 A;  5G05 J;  1K8K G;  4ACL A;  3V79 K;  4NUR A;  4GCN A;  4KYO B;  1Q2Z A;  4HRL A;  5EIL A;  3W9G A;  3TG5 A;  1EYH A;  5E76 A;  3CVQ A;  1HF8 A;  4MKT A;  4PUC A;  4XEI G;  5FQ8 A;  4DLQ A;  4BX8 A;  4N2S A;  5AAO A;  3EIQ C;  4TRQ A;  4RG9 A;  4GTS A;  5HRY A;  1IHG A;  2BKG A;  3DPD A;  3QB2 A;  3UKU G;  3EU5 A;  5CRU A;  4GZC A;  2P2C P;  1Y6I A;  1SA5 A;  2BTD A;  4GA0 A;  1SZ9 A;  4EBA A;  2KCL A;  3SFX A;  4BET A;  1NZN A;  1YYH A;  5C1D A;  4JEU A;  1E8Y A;  2JLB A;  3TWS A;  1TYQ G;  2VSY A;  3JYS A;  2VSX E;  4GZ6 A;  2C0M A;  1OWM A;  1UN8 A;  1HH8 A;  4AJW A;  4URK A;  1BPO A;  4XKB A;  3DPY A;  5FTP A;  2ZIS A;  3Q47 B;  1LTX A;  5FQ6 A;  5KJK A;  2IOS A;  4HRN A;  4R7L A;  4DUI A;  3HXE A;  4O60 A;  4BEP A;  3TGO A;  4N3B A;  3VLE A;  1JCR A;  3UKR G;  3LDZ A;  2IOL A;  3T5V A;  1NL4 A;  3KEA A;  4F53 A;  3U3W A;  1OUV A;  1JUQ A;  4U63 A;  3CEQ A;  4PS3 A;  5JHB A;  2BED A;  3ZN3 A;  2RKK A;  1E8Z A;  4ZHB A;  3SFZ A;  4W9R A;  4JA7 A;  1H6K A;  1DCQ A;  3KAE A;  4I43 A;  3I4G A;  3QWV A;  4GML A;  1TN8 A;  2LO6 A;  3HXB A;  4UWF A;  5HI7 A;  5T4Y A;  2GRQ B;  2PM6 A;  3ASF A;  4AVX A;  4GPK A;  1KZO A;  3FUE A;  1X5B A;  1Y8M A;  2X6H A;  5A6C A;  4TXR A;  5B3S E;  4K5B A;  2CFU A;  3DBS A;  1YA0 A;  1O5M A;  4FA6 A;  2MYO A;  2IU1 A;  5BPP A;  3B7U X;  3LVQ E;  5KBA A;  2P9L G;  3PE4 A;  4M7C A;  5AEN A;  1IYG A;  1OXJ A;  4BWR A;  2F37 A;  3DWL G;  3L9T A;  3MV3 B;  4NQ0 A;  1S63 A;  5EID A;  1SVX A;  3LCA A;  3SNX A;  4JPS A;  4YVO A;  1N4R A;  4UWL A;  3IHY A;  3LPZ A;  3ZGQ A;  3PNT B;  2J07 A;  1OWN A;  4JEH A;  4Q69 A;  3Q7A A;  4U8H A;  1N54 A;  5AJD A;  1E7U A;  1MZC A;  3PS6 A;  1QYM A;  3CSF A;  3UM2 A;  4OYS A;  2AW6 A;  5FIN A;  3KD7 A;  3ENE A;  4APF A;  2DCP A;  2PM7 A;  2XGS A;  2EIM E;  4UWG A;  3PEU B;  3PZ3 A;  4HFG A;  4JVS A;  1E7V A;  2WXO A;  4L9P A;  4HOT A;  1NP7 A;  4LSZ E;  4HOQ A;  2WM9 A;  2P9K G;  5G05 C;  3FH5 A;  3TXN A;  2YIN A;  4TV3 A;  4F3V A;  3RIB A;  4KT6 B;  3SZ7 A;  3OTN A;  1AWC B;  1H6P A;  1FCH A;  4XX5 A;  1KZP A;  4ILI A;  4WNE A;  3L54 A;  3FUJ A;  1SZA A;  3DXM G;  2ETA A;  3RRU A;  1D8E A;  4GTM A;  5FZQ A;  4DJA A;  1NA0 A;  4DI4 A;  3L6A A;  2P9I G;  2IY0 C;  3ZYQ A;  2XZT G;  4K5A B;  1TJC A;  5ENO D;  4YVQ C;  4H7Y A;  3FWV A;  1H0A A;  2L9B A;  3OXG A;  2NC9 A;  3C3O A;  4ANW A;  2OV8 A;  3ASN E;  4XZ4 A;  1PC2 A;  4OVV A;  3TAX A;  1N4S A;  1KLX A;  2RG8 A;  2XPY A;  2CHW A;  2WXR A;  3ESK A;  3MJW A;  4OAV B;  4K0R A;  2NXP A;  4ZFH A;  4C9B B;  4XI0 A;  3ONK A;  4CT4 A;  2LNI A;  3ZPJ A;  4G2V A;  2GRM A;  2PZI A;  2FEZ A;  3RJV A;  4EQF A;  5T3R A;  2VQ2 A;  4I6J A;  3ESL A;  3JXJ A;  3UT7 A;  2VGX A;  1LF8 A;  3CQC B;  2L6B A;  3QDN A;  5CEA A;  4RVB A;  3FTU A;  2VGY A;  2P9U G;  3D3M A;  3D9I A;  2FO1 E;  2C0L A;  4RQI A;  4U95 D;  3LVR E;  4BT8 A;  2ION A;  3BG0 B;  2ETB A;  3ABM E;  2JEK A;  3CVL A;  4EBA G;  3SY2 A;  3EIJ A;  3HVE A;  2R5S A;  5JHA A;  1E8W A;  2IJG X;  1Z3Y A;  2UY1 B;  4YDO A;  4BES A;  4D10 C;  4G25 A;  3UIO C;  5AYW D;  3E37 A;  4B89 A;  5LOZ A;  3FTX A;  3MKR A;  3CVX A;  4WWN A;  3LJN A;  5FZS A;  3G2W A;  5EN5 D;  4I9E A;  4ANX A;  3URZ A;  2VYI A;  4GTV A;  2C2L A;  4CGW A;  1FVH A;  5B1A E;  3W9F A;  3AG3 E;  3VTY A;  4UWH A;  2MHK A;  1H2T C;  1U3D A;  4KXK B;  4UQY A;  1WAO 1;  2WVI A;  2AXV A;  3F6Q A;  2XEN A;  1HU3 A;  4I1O B;  2WXH A;  3TWW A;  4AOF A;  3DSW A;  4J7W A;  4CDN A;  4FC8 A;  4J8F A;  4J0U A;  4DX1 A;  3BU8 A;  3RU0 A;  5BV1 A;  1ZU2 A;  1HZ4 A;  1BLX B;  1O1R A;  1MQS A;  2WQ6 A;  2XPZ A;  2AWI A;  3ULE G;  1JWG A;  3FUH A;  3E33 A;  2HM8 A;  3IV0 A;  3AS4 A;  3LS8 A;  5FIO A;  2P9P G;  4V3I A;  2V8S E;  2R2L A;  3D9K A;  4JB8 P;  4GYY A;  1JCQ A;  4A1S A;  1BU9 A;  3UXG A;  4JW1 A;  4CDR A;  3JQ0 A;  3FTW A;  3B95 A;  1DVP A;  3UT4 A;  4GTO A;  4AV7 A;  2WXL A;  4GZD A;  1KT0 A;  2EQX A;  1GW6 A;  5KNG A;  4HRM B;  1N52 A;  4OAU C;  2Y69 E;  3E4B A;  4A63 B;  2B6C A;  3FUK A;  1AP7 A;  3CHP A;  3TWU A;  4I9C A;  3NAW A;  2J8S D;  3ONL A;  3HRA A;  1N94 A;  3KSL A;  3J5Q B;  3Q7F A;  3AS5 A;  4UI9 J;  1MX6 A;  2BUG A;  2PQR A;  3S7F A;  4U8Y D;  5BXO A;  3QOU A;  2VGE A;  3CVV A;  4GTR A;  3FUN A;  4N5C A;  4YND A;  4U07 A;  4L2Y A;  3ZRH A;  4NIK A;  2WXF A;  5CCL A;  2VGX B;  3PZD A;  2FBN A;  1YCS B;  4XI9 A;  3T8K A;  3R9A B;  3U9W A;  3P2B A;  5AQ9 A;  2GRL A;  1OCR E;  4C48 B;  5JJ7 A;  5JJT A;  2X6J A;  4AEZ C;  3Q9N C;  3J5P A;  3I5P A;  1TNU A;  3AU4 A;  5EKQ D;  1UJJ A;  3SO8 A;  4JA9 A;  1JWF A;  4EZL A;  3V2X A;  2A5E A;  3APD A;  3L17 A;  3N71 A;  1MX2 A;  1IKN D;  3FTV A;  3UM3 A;  2WXN A;  4Q96 A;  1H2V C;  2P58 C;  3CVW A;  4FU3 A;  4IUL A;  3Q49 B;  3ZYK A;  2WXM A;  2DZO A;  3FU6 A;  5ENQ D;  1BD8 A;  3JQ1 A;  4Q94 A;  4A55 A;  5D0O D;  3RRM B;  4F1P A;  5ANL A;  3DXK G;  4G11 A;  2KZT A;  2YQ8 A;  5EX3 A;  3R7R A;  2DBA A;  1NFI E;  5BNW A;  2EIL E;  3G2T A;  4L23 A;  2I1J A;  4FHJ A;  4U0Z A;  1A17 A;  4U96 D;  3L82 A;  4JC8 A;  1LD7 A;  1WY6 A;  5AQ7 A;  4LNB A;  3UT8 A;  4MBG A;  1H19 A;  3RO2 A;  5LP0 A;  3EJN A;  4ABN A;  4YDW A;  1N11 A;  5BUZ A;  1FT2 A;  5CBN A;  2QC9 A;  3SQV A;  2WXI A;  1G3N B;  5LCW J;  5JA4 D;  2QY7 A;  3C5R A;  4HOU A;  4GZ5 A;  4J6I A;  3CVU A;  3ZNG A;  5KWD A;  3NBN B;  5AQB A;  4EZJ A;  5J90 A;  1ELR A;  3SD5 A;  4B8C B;  1EPU A;  4N3A A;  4CT0 A;  2ZIR A;  3RRN B;  3IHV A;  1ZB1 A;  3S7B A;  2Y4T A;  2V4L A;  2Y3A A;  2XGM A;  4L2L A;  1D9S A;  5FWQ A;  3PZ2 A;  2V0P A;  5DIZ A;  2YHE A;  4HQD A;  3O48 A;  1UJK A;  2EIN E;  3UTM A;  3T8M A;  4NRH B;  5FQ4 A;  3GZ1 A;  4AM9 A;  2YHC A;  4RLY A;  4J8E A;  2RD0 A;  2XPI A;  5CCM A;  3FFL A;  3U66 A;  3D9H A;  3HXC A;  3FEX A;  4DX5 D;  2GRN B;  1IXV A;  2BF0 X;  3DEP A;  3HDX A;  3TL5 A;  1DCE A;  2OVF A;  4ACK A;  3WG7 E;  2KCK A;  3UUX A;  4WNF A;  3Q75 A;  3ZUV B;  2J49 A;  5G2N A;  3WXX A;  4KVM A;  1OCO E;  1E8X A;  2E0I A;  5EYP F;  4GA1 A;  1MJ0 A;  1ELK A;  4FLB A;  2HYZ A;  4BX9 A;  2OEV A;  2XCB A;  3NF1 A;  3ML9 A;  2CG2 A;  3MKQ B;  2XQ0 A;  3DSS A;  3T9K A;  3Q5M A;  4BSX A;  2ILR A;  3RSE G;  2RFM A;  5D2M C;  3HXD A;  2B0O E;  3PRE A;  1SA4 A;  2EIK E;  3AJI A;  5C2Y A;  4A3V A;  1N95 A;  4GCO A;  4UI9 C;  3Q15 A;  4G1T A;  5CMY A;  4L7T A;  1RZ4 A;  3FDH A;  3UM1 A;  4Y6C A;  1BI7 B;  4HNA D;  1Z5S C;  1NI1 A;  5ENR D;  4JZY A;  5G55 A;  4EPZ A;  3D9N A;  5BT1 A;  2ZGD A;  2OVB A;  1D8D A;  2Y0B G;  4K03 A;  4HOS A;  2XEE A;  2XCC A;  1N0Q A;  3FP3 A;  5H7P A;  2X3M A;  4KBQ A;  2IFU A;  3HG0 D;  1P5Q A;  2LXM A;  1RW2 A;  5T8I A;  3UIP C;  3BUA A;  2HE0 A;  2H6I A;  4K5C A;  5EX0 A;  4E85 A;  3MX3 A;  1S0P A;  4CGV A;  4FP7 A;  4DPR A;  4HI9 A;  3D9P A;  2V5F A;  2XHE A;  1HG2 A;  2LAH A;  4GZ3 A;  2VTB A;  2KZT B;  2MRI A;  4APO A;  3EUV A;  3KEZ A;  1ELW A;  4G8K A;  4CDM A;  3LKU A;  4QQI A;  2XRZ A;  1QQE A;  3B7S A;  2AXZ A;  4CYM D;  4BY6 A;  3FTZ A;  4C0E A;  4YDY A;  2WPV A;  1OWL A;  1WG0 A;  2DYS E;  3ZHE A;  3TJP A;  4LG6 A;  3UM0 A;  4XKC A;  5CHE E;  1OY3 D;  1O1S A;  5KJN A;  4XIF A;  3E34 A;  1E96 B;  4G23 A;  4WND A;  5HS0 A;  4GTQ A;  4X8Q A;  5EYL A;  3ZXP A;  2R05 A;  4BFR A;  3UIN C;  4HVB A;  3IXE A;  5LCW C;  1MX4 A;  5G04 J;  2VSN A;  1N4Q A;  4QFV A;  3CK8 A;  3L08 A;  3ASH A;  2H6G A;  2WQH A;  4PS8 A;  1QZ2 A;  4GMR A;  3CHM A;  3AG2 E;  3D9L A;  4G24 A;  5IY5 E;  4EZK A;  3ZW3 A;  3CIA A;  1QNF A;  4IN3 B;  2OEW A;  4DK5 A;  3UMV A;  3OXF A;  3ZKJ A;  1TNB A;  1HX8 A;  1KPS B;  2QYU A;  3DSX A;  2QZA A;  1W3B A;  3CGH A;  2A4Z A;  2WXK A;  3CQG B;  3CHQ A;  2J08 A;  3D9O A;  3CV0 A;  3MEK A;  4N5Q A;  3QJZ A;  3SI5 A;  3GZ2 A;  4HS2 A;  2DVW A;  1UW4 B;  3FY4 A;  3I3N A;  3UPV A;  1HE8 A;  4ATZ D;  3G2U A;  3ZU7 B;  1WM5 A;  3FU5 A;  2ETC A;  3LJ3 A;  3KSQ A;  4B94 A;  4JXT A;  4B93 B;  2MOW A;  1UN9 A;  4LUN U;  1OT8 A;  1KT1 A;  1U3C A;  3FH7 A;  5BV0 A;  2CHZ A;  2CHX A;  4O1P A;  3AU5 A;  3FUL A;  4EHM A;  2L6J A;  4GPM A;  3SF4 A;  3EHM A;  4WAF A;  3SHF A;  2ZGG A;  2XEH A;  3C3R A;  5BW8 C;  3CLJ A;  4ANV A;  3BQO A;  3K9I A;  5ARF A;  1B89 A;  4KZC A;  5ANR A;  2F0Y A;  3ZYM A;  1SQM A;  2Y4U A;  1TNZ A;  3B7R L;  2WMO A;  2R17 C;  4A1G A;  3QKY A;  2H6F A;  3FTS A;  3SBT B;  4MRU A;  1N4P A;  4KZ0 A;  3C72 A;  2XGO A;  4U0S A;  4U7E B;  3HIZ A;  4FJZ A;  1X81 A;  4C0M A;  4OVU A;  4I17 A;  4DX6 D;  3DST A;  3EHR A;  3ZXS A;  4AY6 A;  3UI2 A;  2DWZ A;  4IRU A;  2J4D A;  2NYJ A;  4TUM A;  3ZIM A;  3QWW A;  3R9M A;  1JCS A;  3LY8 A;  3I4R B;  2FUL A;  3LY9 A;  4J8Y A;  2I6H A;  1YMP A;  4I6E A;  4HLL A;  3IKO B;  3C98 A;  4H7X A;  1FVF A;  2KC7 A;  3GZS A;  3FUM A;  4CEM A;  1ZBP A;  4FUL A;  5AAR A;  3R7Q A;  2F8X K;  1K1A A;  5FQ7 A;  2VSO E;  5BXU A;  1QBQ A;  3EHQ A;  4BTA A;  2P9N G;  3HVE B;  5A7D B;  3NZU A;  3T5X A;  2XRY A;  1UOH A;  3P1U A;  3Q9U C;  5G04 C;  4JHJ A;  3V2O A;  4GYO A;  2QYJ A;  4L1B A;  4M3O A;  2OOE A;  4TXQ A;  4J8S A;  4DRX E;  3U64 A;  3DRA A;  1U2V G;  2EIJ E;  3FTY A;  4AXH A;  5EDS A;  5KCM A;  4PDX A;  1A5E A;  4ME2 A;  3HHM A;  3LXU X;  2LSV A;  4WUY A;  3TWR A;  2ZXW E;  3S2A A;  4KVO A;  3ULQ A;  4FHK A;  2PL2 A;  3SGH A;  5J08 A;  1Z3X A;  4I1A A;  3X2Q E;  3QAR A;  4G26 A;  3PVL A;  4BT9 A;  3BEE A;  3EDT B;  5A23 A;  3PNL B;  1K1B A;  1HO8 A;  4U8V D;  4HBD A;  1Z6T A;  5KJL A;  4CCA A;  5ENS D;  2WQ7 A;  3TXM A;  4DLO A;  3HXF A;  3ISM C;  3SFY A;  2CFZ A;  5M72 A;  1INZ A;  5FJY A;  1OCZ E;  4GAA A;  3Q73 A;  1N9A A;  2LUH A;  2R59 A;  3AS8 A;  4CRW A;  2XZD G;  2H6H A;  2I9C A;  3HYM B;  2VJ8 A;  4E6H A;  5CEC B;  4F7A A;  2GRP B;  3O4Z A;  2PQN A;  4GA2 A;  4ILH B;  1SW6 A;  3RKV A;  3APF A;  5CER B;  1FPP A;  4B0Z A;  3CR3 A;  1IHB A;  2AJA A;  4FLH A;  4B8A A;  5KNH D;  3EU9 A;  4HXI A;  3ZEF A;  2X6K A;  4J8D A;  3QWP A;  5CMW A;  2J9Q A;  3TG4 A;  3UX4 A;  1HXI A;  3CKC A;  4Z68 A;  1VDY A;  2UY1 A;  3JUI A;  3OAW A;  3ASO E;  3QAQ A;  3TWQ A;  2Y1L E;  3MGB A;  5AIJ A;  3S7D A;  3ULY A;  3CK7 A;  4F6R D;  2GW1 A;  2WB2 A;  3CVY A;  4N39 A;  3ABL E;  2WXQ A;  1NA3 A;  4RG6 A;  3GW4 A;  2HO1 A;  4Y6W A;  4UQX A;  3ZFW A;  1V54 E;  4UUC A;  3B7B A;  1HS6 A;  4A3T A;  4YDE A;  4BSZ B;  2I2O A;  4G8L A;  2XS8 A;  3FUD A;  4HB5 A;  4NAC A;  3KS2 A;  5LX8 A;  3ABK E;  1TEZ A;  2KBX A;  4MLP A;  5AN8 A;  4AP2 A;  4U0U A;  1E90 A;  3S7J A;  1LD8 A;  2M63 A;  4UWK A;  3RAU A;  3L22 A;  2J4B A;  4RSY A;  1MYO A;  1TN7 A;  4ATG A;  2J09 A;  4CZ2 D;  2XEV A;  1DNP A;  4I2Z A;  3PRZ A;  4LEU A;  3L16 A;  4I1M A;  3B13 A;  5D0Q D;  4O1O A;  4GYW A;  4HOR A;  2OND A;  3VLD A;  3CVP A;  3DSU A;  3TWV A;  5FZR A;  5D66 A;  5HKP A;  4N3C A;  3QNK A;  5FT9 A;  3Q4A B;  4AIF A;  3PZ4 A;  3FUI A;  4EEC A;  3AG1 E;  2IO3 C;  1XGW A;  3L13 A;  1FT1 A;  3Q79 A;  5AJL A;  2X38 A;  4U04 A;  2QFC A;  2X6F A;  4LNU D;  3RO3 A;  2FO7 A;  4ILG A;  3JUE A;  5JJ6 A;  3ZVV A;  4WWO A;  1XNF A;  3NZS A;  2LAI A;  1JPL A;  4UI9 K;  4HI8 A;  4LCT A;  1DC2 A;  3PH0 C;  1TNY A;  4I6G A;  4HLE A;  3MA5 A;  4AY5 A;  3CST A;  3FEY A;  1IQU A;  4BTB A;  2DYR E;  4DI3 A;  3MYV A;  2WXG A;  1OWP A;  3U4T A;  3BG1 B;  4JL0 A;  4FAD A;  4JHK A;  5ENP D;  5CED B;  4BER A;  5ARG A;  3ML8 A;  2AVP A;  2GGF A;  4PH4 B;  2IO2 C;  2KCV A;  3CHR A;  3B7T A;  3LEW A;  3V30 A;  2NSZ A;  2XS1 A;  1HFA A;  4TXP A;  5EIB E;  2CG3 A;  1TNO A;  5ENT D;  3FU0 A;  3PUK A;  5ENN A;  1H2U A;  1N0R A;  3DEO A;  5B1B E;  4LER A;  4GU5 A;  2JAB A;  3PE3 A;  2V4H C;  4O6F A;  2WXP A;  3LYA A;  3QK0 A;  2LXL A;  2HR2 A;  1H6O A;  3E30 A;  1IQR A;  1EDU A;  3D9M A;  4JHR A;  3DSV A;  1L5J A;  5LFA A;  1UG3 A;  2BKK B;  4KMO A;  3E32 A;  3TWT A;  3PUJ A;  2AXU A;  2RFA A;  4PS7 A;  1O1T A; 
#chains in the Genus database with same CATH homology
 3FUJ A;  1ELR A;  3MZL B;  3I4R B;  3SD5 A;  1SZA A;  2FUL A;  3RRU A;  4B8C B;  3LY9 A;  4UQZ A;  3OXL A;  1EPU A;  4N3A A;  3VLF A;  4CT0 A;  2I6H A;  5FZQ A;  4DJA A;  1NA0 A;  3CHS A;  4I6E A;  3UQ3 A;  2WXJ A;  4TUU A;  3RRN B;  3IHV A;  4DI4 A;  3IBE A;  2I1K A;  3S7B A;  2Y4T A;  3IKO B;  3L6A A;  2V4L A;  2L0T B;  2Y3A A;  4F1S A;  1PY1 A;  3C98 A;  2XGM A;  3NQP A;  4L2L A;  3ZYQ A;  5FWQ A;  5HQ8 A;  2V0P A;  4GB9 A;  2YHE A;  3ASD A;  4H7X A;  5DIZ A;  1FVF A;  1TJC A;  2KC7 A;  3GZS A;  1OWO A;  3O48 A;  1MHQ A;  1UJK A;  3FUM A;  4YVQ C;  3FHE A;  4H7Y A;  2UWJ G;  3ZYL A;  4CEM A;  3T8M A;  4NRH B;  2IF4 A;  3FWV A;  5FQ4 A;  1H0A A;  1ZBP A;  3GZ1 A;  2L9B A;  4AM9 A;  3VTX A;  2YHC A;  2E2E A;  3OXG A;  4FUL A;  4WWP A;  4I2W A;  4J8E A;  2NC9 A;  2RD0 A;  4ANW A;  2XPI A;  2OV8 A;  3R7Q A;  5CCM A;  2KM4 A;  4XZ4 A;  5FQ7 A;  1PC2 A;  2VSO E;  4OVV A;  3FFL A;  3TAX A;  3U66 A;  4MS6 A;  1KLX A;  3FEX A;  2RG8 A;  2XPY A;  4BTA A;  3APC A;  3HVE B;  2CHW A;  2WXR A;  5A7D B;  2BF0 X;  3ESK A;  3MJW A;  5E75 A;  3QC1 A;  4K0R A;  3HDX A;  3TL5 A;  2NXP A;  4C9B B;  3EHN A;  3NZU A;  3T5X A;  2XRY A;  2OVF A;  3P1U A;  4ACK A;  5G04 C;  4JHJ A;  2ZU6 B;  4XI0 A;  2KCK A;  3ONK A;  4GYO A;  4L1B A;  3UUX A;  4CT4 A;  4M3O A;  3CHO A;  2LNI A;  3ZPJ A;  4WNF A;  4N2Q A;  2Q7F A;  2OOE A;  4J8S A;  3U64 A;  4G2V A;  2GRM A;  2J49 A;  2PZI A;  5G2N A;  2FEZ A;  3RJV A;  3WXX A;  4KVM A;  4EQF A;  5T3R A;  1E8X A;  4LRZ A;  1HG5 A;  2E0I A;  3FTY A;  2VQ2 A;  2KAT A;  4IYP A;  1PAQ A;  4I6J A;  4AXH A;  5EDS A;  3FU3 A;  4GA1 A;  4PDX A;  5KCM A;  1ELK A;  3ESL A;  4FLB A;  4ME2 A;  3HHM A;  2HYZ A;  3LXU X;  4BX9 A;  2LSV A;  2VGX A;  4WUY A;  3GYZ A;  3UT7 A;  2XCB A;  3NF1 A;  3ML9 A;  1LF8 A;  2CG2 A;  3G2S A;  3CQC B;  2WMN A;  3MKQ B;  2XQ0 A;  1TJF A;  3Q5M A;  3S2A A;  3IEG A;  4KVO A;  3QDN A;  4ANU A;  3ULQ A;  4FHK A;  4RVB A;  3FTU A;  4BSX A;  2A5U A;  2FI7 A;  2PL2 A;  2VGY A;  2ILR A;  3D3M A;  3JCK C;  3SGH A;  3D9I A;  2IQC A;  5J08 A;  1Z3X A;  4I1A A;  3QAR A;  2C0L A;  3PRE A;  4G26 A;  3PVL A;  5C2Y A;  4A3V A;  4BT9 A;  3CVN A;  4GCO A;  2FF4 A;  2LSU A;  2VTB B;  3BEE A;  3Q15 A;  4UI9 C;  3EDT B;  4P29 A;  5A23 A;  3LVR E;  3PNL B;  4BT8 A;  1HO8 A;  2ION A;  3BG0 B;  4G1T A;  5KJM A;  4XE0 A;  1Z6T A;  2DIW A;  5KJL A;  4CCA A;  3MCX A;  2X6I A;  2YNQ A;  3G2V A;  5CMY A;  4L7T A;  2JEK A;  3CVL A;  2WQ7 A;  3TXM A;  3CK9 A;  4DLO A;  4EBA G;  3FDH A;  3EIJ A;  3HVE A;  3CKB A;  4Y6C A;  2CFZ A;  3LY7 A;  2R5S A;  5M72 A;  5JHA A;  1INZ A;  1E8W A;  4WNG A;  2IJG X;  1Z3Y A;  2UY1 B;  5FJY A;  3FUF A;  4D10 C;  4G25 A;  4JZY A;  4GAA A;  5G55 A;  3ZHE B;  3D9J A;  5AYW D;  4B89 A;  5DBK A;  2R59 A;  3AS8 A;  4EPZ A;  5LOZ A;  3D9N A;  4CRW A;  2L0I A;  5BT1 A;  2OVB A;  3RK6 A;  3PDN A;  4K03 A;  3FTX A;  2I9C A;  4HOS A;  3MKR A;  3CVX A;  3HYM B;  2VJ8 A;  2XCC A;  4WWN A;  4E6H A;  4F7A A;  1EF1 C;  3O4Z A;  5FZS A;  3FP3 A;  2PQN A;  4GA2 A;  3G2W A;  4ILH B;  2X3M A;  3MV2 B;  3ASG A;  3RKV A;  4I9E A;  4FJY A;  4KBQ A;  3APF A;  2IFU A;  4ANX A;  3URZ A;  1P5Q A;  3PEV B;  2VYI A;  4GMJ A;  5T8I A;  3FH8 A;  3SBS A;  4B0Z A;  4CGW A;  2C2L A;  3MKQ A;  3CR3 A;  5G05 J;  1FVH A;  5EX0 A;  4ACL A;  4E85 A;  3MX3 A;  1S0P A;  4CGV A;  4FP7 A;  3VTY A;  4UWH A;  4NUR A;  2MHK A;  4DPR A;  4GCN A;  3D9P A;  4KYO B;  2V5F A;  1H2T C;  4FLH A;  1U3D A;  4KXK B;  4B8A A;  2XHE A;  4UQY A;  1HG2 A;  2LAH A;  1WAO 1;  4GZ3 A;  2VTB A;  2WVI A;  2AXV A;  3TG5 A;  2KZT B;  2MRI A;  1EYH A;  5E76 A;  4APO A;  3CVQ A;  4HXI A;  1HF8 A;  4MKT A;  4PUC A;  3ZEF A;  1HU3 A;  4I1O B;  5FQ8 A;  4DLQ A;  4BX8 A;  4N2S A;  2WXH A;  3KEZ A;  2X6K A;  1ELW A;  4CDM A;  4J8D A;  3QWP A;  5CMW A;  2J9Q A;  3LKU A;  2XRZ A;  3TG4 A;  3EIQ C;  1QQE A;  3B7S A;  4TRQ A;  2AXZ A;  3UX4 A;  4AOF A;  4RG9 A;  4CDN A;  4FC8 A;  1HXI A;  4BY6 A;  3CKC A;  3FTZ A;  4J8F A;  4C0E A;  1IHG A;  4J0U A;  3DPD A;  1VDY A;  2UY1 A;  2WPV A;  3QB2 A;  3RU0 A;  5BV1 A;  3JUI A;  1ZU2 A;  1OWL A;  3OAW A;  3QAQ A;  3TJP A;  3ZHE A;  1HZ4 A;  3MGB A;  4GZC A;  1Y6I A;  5AIJ A;  3S7D A;  4XKC A;  5CHE E;  1MQS A;  2BTD A;  4GA0 A;  2WQ6 A;  3CK7 A;  1SZ9 A;  5KJN A;  2XPZ A;  4XIF A;  2AWI A;  1E96 B;  1JWG A;  4EBA A;  2KCL A;  3FUH A;  2HM8 A;  2GW1 A;  2WB2 A;  4G23 A;  1NZN A;  3CVY A;  4WND A;  3IV0 A;  4N39 A;  5C1D A;  3AS4 A;  4JEU A;  1E8Y A;  2WXQ A;  1NA3 A;  3LS8 A;  2JLB A;  4V3I A;  4RG6 A;  2V8S E;  3GW4 A;  2VSY A;  4BFR A;  2HO1 A;  3D9K A;  3JYS A;  2VSX E;  4GZ6 A;  2C0M A;  4GYY A;  4Y6W A;  4UQX A;  3ZFW A;  1OWM A;  4A1S A;  1UN8 A;  4HVB A;  1HH8 A;  5LCW C;  1HS6 A;  5G04 J;  2VSN A;  4A3T A;  4QFV A;  4AJW A;  3CK8 A;  3L08 A;  3ASH A;  4URK A;  4JW1 A;  1BPO A;  4XKB A;  2WQH A;  4PS8 A;  4CDR A;  2I2O A;  3JQ0 A;  1QZ2 A;  3FTW A;  5FTP A;  3FUD A;  1DVP A;  4NAC A;  3CHM A;  3KS2 A;  3UT4 A;  3D9L A;  5LX8 A;  4AV7 A;  2WXL A;  4G24 A;  4GZD A;  1KT0 A;  3Q47 B;  1TEZ A;  4EZK A;  3ZW3 A;  5FQ6 A;  2EQX A;  5KJK A;  1GW6 A;  2IOS A;  3CIA A;  1QNF A;  4MLP A;  4IN3 B;  4AP2 A;  4R7L A;  4DK5 A;  4U0U A;  1N52 A;  1E90 A;  3OXF A;  3UMV A;  3S7J A;  3E4B A;  2M63 A;  3FUK A;  4UWK A;  3TGO A;  3L22 A;  2J4B A;  4RSY A;  3CHP A;  1HX8 A;  4I9C A;  4N3B A;  3VLE A;  3LDZ A;  3ONL A;  2IOL A;  4ATG A;  2J09 A;  2XEV A;  3T5V A;  1W3B A;  3CGH A;  4F53 A;  1DNP A;  4I2Z A;  3U3W A;  1OUV A;  1JUQ A;  3AS5 A;  3PRZ A;  4LEU A;  3L16 A;  4UI9 J;  4I1M A;  2BUG A;  4U63 A;  3CEQ A;  4PS3 A;  5JHB A;  3B13 A;  2A4Z A;  5D0Q D;  2WXK A;  3CQG B;  3CHQ A;  2PQR A;  4GYW A;  3S7F A;  3ZN3 A;  2OND A;  4HOR A;  2J08 A;  1E8Z A;  3QOU A;  3D9O A;  3CVV A;  3VLD A;  3CVP A;  3CV0 A;  3SFZ A;  3MEK A;  4W9R A;  4JA7 A;  1H6K A;  5FZR A;  3KAE A;  3FUN A;  4N3C A;  4I43 A;  3I4G A;  3QNK A;  3QWV A;  3Q4A B;  2LO6 A;  4GML A;  4N5C A;  4YND A;  5FT9 A;  3FUI A;  4U07 A;  4EEC A;  4L2Y A;  3ZRH A;  3QJZ A;  2WXF A;  4UWF A;  3SI5 A;  3GZ2 A;  5CCL A;  5HI7 A;  4HS2 A;  2VGX B;  1UW4 B;  5T4Y A;  1XGW A;  3L13 A;  3PZD A;  3FY4 A;  2FBN A;  3I3N A;  3UPV A;  5AJL A;  1HE8 A;  2X38 A;  3G2U A;  4U04 A;  4XI9 A;  1WM5 A;  3R9A B;  2QFC A;  2X6F A;  3U9W A;  3FU5 A;  3P2B A;  3RO3 A;  3LJ3 A;  2FO7 A;  2GRL A;  2PM6 A;  4ILG A;  4B94 A;  4JXT A;  5JJ7 A;  3ASF A;  2MOW A;  5JJT A;  1UN9 A;  4AVX A;  4LUN U;  5JJ6 A;  2X6J A;  3ZVV A;  4WWO A;  4GPK A;  1XNF A;  3NZS A;  2LAI A;  3FUE A;  1JPL A;  1KT1 A;  4UI9 K;  4AEZ C;  1U3C A;  4LCT A;  1X5B A;  1Y8M A;  3FH7 A;  3I5P A;  2X6H A;  3PH0 C;  5A6C A;  5BV0 A;  2CHZ A;  2CFU A;  2CHX A;  3DBS A;  1YA0 A;  4FA6 A;  4I6G A;  4HLE A;  3AU5 A;  2IU1 A;  3AU4 A;  5BPP A;  3MA5 A;  3B7U X;  5EKQ D;  4AY5 A;  3FUL A;  3CST A;  1UJJ A;  3LVQ E;  3FEY A;  4JA9 A;  1JWF A;  2L6J A;  4EZL A;  1IQU A;  3PE4 A;  3SF4 A;  4BTB A;  3EHM A;  4WAF A;  5AEN A;  1IYG A;  3APD A;  4DI3 A;  4BWR A;  3L17 A;  3MYV A;  3SHF A;  3N71 A;  2WXG A;  3FTV A;  1OWP A;  3U4T A;  3MV3 B;  4NQ0 A;  3BG1 B;  4JL0 A;  5BW8 C;  3CLJ A;  2WXN A;  4Q96 A;  1H2V C;  4FAD A;  3LCA A;  4ANV A;  2P58 C;  3K9I A;  4JHK A;  4JPS A;  5ARF A;  3SNX A;  4YVO A;  3CVW A;  1B89 A;  4KZC A;  4UWL A;  5ARG A;  4FU3 A;  4IUL A;  3Q49 B;  3IHY A;  3ML8 A;  2AVP A;  5ANR A;  3ZYK A;  2GGF A;  4PH4 B;  3LPZ A;  2WXM A;  3ZGQ A;  3ZYM A;  1SQM A;  2KCV A;  2Y4U A;  3PNT B;  2J07 A;  3FU6 A;  3CHR A;  3JQ1 A;  4Q94 A;  1OWN A;  4JEH A;  5D0O D;  4A55 A;  3B7R L;  3RRM B;  3B7T A;  3LEW A;  4Q69 A;  2WMO A;  2NSZ A;  4U8H A;  2R17 C;  4A1G A;  1HFA A;  3QKY A;  1N54 A;  5AJD A;  5ANL A;  2CG3 A;  1E7U A;  3FTS A;  4G11 A;  3PS6 A;  3FU0 A;  2KZT A;  2YQ8 A;  5EX3 A;  3R7R A;  3PUK A;  3SBT B;  5ENN A;  2DBA A;  3CSF A;  1H2U A;  4MRU A;  5BNW A;  4KZ0 A;  3G2T A;  4L23 A;  2I1J A;  4FHJ A;  4OYS A;  1A17 A;  2AW6 A;  2XGO A;  4LER A;  3KD7 A;  4U0Z A;  4U0S A;  4GU5 A;  4JC8 A;  3HIZ A;  3ENE A;  3PE3 A;  4FJZ A;  4APF A;  2DCP A;  2PM7 A;  2XGS A;  4O6F A;  1WY6 A;  4UWG A;  2WXP A;  3LYA A;  3QK0 A;  3PEU B;  4HFG A;  4JVS A;  4C0M A;  1E7V A;  2WXO A;  4I17 A;  4OVU A;  3UT8 A;  2HR2 A;  1H19 A;  3RO2 A;  4AY6 A;  3ZXS A;  4HOT A;  1NP7 A;  5LP0 A;  1IQR A;  3EJN A;  4HOQ A;  2WM9 A;  4ABN A;  5BUZ A;  5G05 C;  1EDU A;  3FH5 A;  3D9M A;  3TXN A;  4IRU A;  2YIN A;  4JHR A;  4TV3 A;  2WXI A;  1L5J A;  4F3V A;  3RIB A;  5LCW J;  4KT6 B;  2QY7 A;  4AIF A;  5LFA A;  1UG3 A;  2J4D A;  4KMO A;  4HOU A;  4GZ5 A;  3OTN A;  4J6I A;  3SZ7 A;  3CVU A;  3ZIM A;  1FCH A;  3PUJ A;  2AXU A;  3QWW A;  4XX5 A;  4PS7 A;  4ILI A;  4EZJ A;  5J90 A;  3LY8 A;  4WNE A;  3L54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...