4KBQA

Structure of the chip-tpr domain in complex with the hsc70 lid-tail domains
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
130
structure length
130
Chain Sequence
PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase CHIP
publication title A Bipartite Interaction between Hsp70 and CHIP Regulates Ubiquitination of Chaperoned Client Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein binding
total genus 52
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kbqA00
3LY7A 5G05C 2VGYA 4GA0A 2YQ8A 1W3BA 3ZN3A 2FF4A 5FZRA 3AS4A 3OXFA 4A1SA 3R9AB 1FCHA 5M72A 3RIBA 3GZ2A 2PQRA 4HOUA 3QWPA 3FWVA 2FI7A 3CKBA 4G24A 4I1AA 4U07A 4N2QA 3UUXA 3LYAA 3KAEA 3MV2B 4WNGA 3ULQA 3URZA 2XCCA 3ESKA 4JL0A 3QDNA 1E96B 5BW8C 4BTBA 2FO7A 4YNDA 2HYZA 5G04J 3AS8A 4WNFA 4KYOB 4WUYA 3TGOA 4U0UA 3S7JA 2KCKA 3SZ7A 4ME2A 2P58C 4JHRA 3Q15A 4IN3B 4APOA 1NA3A 3FP3A 5LCWC 3MKRA 1YA0A 1WAO1 2XEVA 5EX0A 3CV0A 2I6HA 3PE4A 3ASFA 4WNEA 2DBAA 3CVNA 5FTPA 3EDTB 5A7DB 4I9CA 3CVPA 4J0UA 3Q4AB 3GW4A 3RJVA 2C2LA 5HQ8A 4N39A 4U04A 4J8EA 3ASHA 4UI9C 4AIFA 2J9QA 2HR2A 3CK9A 2YHCA 1QZ2A 3ZGQA 1ELWA 2UWJG 4G26A 3QOUA 3SF4A 1IHGA 2BUGA 4UQYA 4GA1A 5JJ7A 2Y4UA 2L6JA 1P5QA 5C1DA 2XGSA 4GYYA 4KXKB 4HORA 3RO3A 5CHEE 3S7BA 3CEQA 3N71A 4NRHB 3JYSA 3TAXA 4U0SA 4AM9A 3UQ3A 3OXGA 4AY6A 3Q49B 2NC9A 4H7XA 2JLBA 2IFUA 3VTYA 4U0ZA 3LKUA 4CGWA 4N5CA 5BT1A 3GZ1A 1KT0A 4GZ6A 1HH8A 4BTAA 3QWWA 2VYIA 3ZPJA 5D0OD 4EQFA 2PQNA 3QWVA 3PDNA 3Q47B 2PZIA 3MA5A 2HO1A 4W9RA 3CVQA 3GYZA 4UQZA 2FBNA 5G04C 4Y6CA 4ABNA 3Q5MA 4GCOA 3OXLA 4B94A 2VSYA 4XI0A 4CGVA 1IYGA 3E4BA 4I2WA 4NQ0A 5EX3A 2AVPA 3ASGA 4GYOA 5FZQA 1PC2A 2Q7FA 3ZHEA 1QQEA 2OOEA 3RKVA 4I17A 2LSUA 4UI9K 4F3VA 3S7DA 3KD7A 4N3AA 2Y4TA 2KATA 2E2EA 2FEZA 2R5SA 5ARFA 3LY8A 3BEEA 5HI7A 1TJCA 2WPVA 3K9IA 2XPIA 3PE3A 3CVLA 4BT8A 5G05J 4J8DA 2IF4A 3U3WA 5DBKA 2C0MA 4JA9A 3IEGA 4XI9A 3LPZA 4HOTA 5KJMA 1NZNA 3VTXA 3ZFWA 4RG6A 1Y8MA 1KLXA 4G23A 4AY5A 2PL2A 2V5FA 4O6FA 3RU0A 3MEKA 3U4TA 5CCMA 2LNIA 4GPKA 3WXXA 3O48A 2XGMA 1NA0A 4WNDA 2VSNA 4KBQA 3UPVA 3FFLA 1ZBPA 4G2VA 4YVQC 4GZ5A 4YVOA 2C0LA 3LCAA 3KS2A 4UQXA 4BT9A 2QFCA 4XIFA 5FT9A 3QKYA 3LY9A 1HXIA 2UY1A 3TG4A 5DIZA 5KJKA 5JJ6A 2KCLA 5EKQD 4G1TA 2MHKA 5FJYA 2VGXA 5LCWJ 4GA2A 2GW1A 5ARGA 4JA7A 1B89A 5JJTA 4LEUA 5BNWA 1A17A 2XCBA 3CK8A 1OUVA 2UY1B 4I2ZA 4H7YA 4CDRA 4RG9A 4I9EA 4BWRA 1HZ4A 1XNFA 3MV3B 5FZSA 2VGXB 3TG5A 4N3CA 4UI9J 2KC7A 4GCNA 5KJNA 4HOQA 5CCLA 2WQHA 4GYWA 5KJLA 5AYWD 3AS5A 4N3BA 3CK7A 2KCVA 2XGOA 1ELRA 4G25A 4J8FA 3CKCA 3ASDA 3ZHEB 3NF1A 4GZ3A 2LSVA 2ONDA 5A6CA 5D0QD 3HYMB 2VQ2A 1ZU2A 1KT1A 1WM5A 3RO2A 3S7FA 4Y6WA 4HOSA 4N2SA
chains in the Genus database with same CATH superfamily
4GTMA 3RRUA 3FU5A 3EHNA 3FTYA 2VGYA 2YQ8A 3RRNB 2FF4A 5FZRA 2OV8A 4MRUA 2QY7A 3FEXA 3RIBA 2NXPA 4AOFA 3FWVA 5IY5E 2FI7A 3FU6A 3I4GA 1WDYA 1E8YA 1N0RA 3UUXA 4L9PA 5FINA 4WNGA 4GTTA 2CFZA 2XCCA 2OEWA 2WM9A 2IQCA 2DCPA 3HXBA 2L0IA 4J7WA 4JL0A 4GMJA 5BW8C 4YDWA 5AQAA 3CVYA 3V79K 4APFA 4JHKA 4KMOA 3EHRA 3ISMC 4BESA 4WNFA 5CEDB 2XEEA 3SHFA 3AG2E 2J49A 1JCQA 1E90A 3DSVA 1NI1A 3SFYA 3SZ7A 2WXNA 2YHEA 2ZISA 3TWTA 1N4PA 1IQRA 4I1OB 4ANVA 1H6KA 3HG0D 1TNOA 3MKRA 4JD2G 4LCTA 3AU4A 2IY0C 1DCEA 5A7DB 2XS1A 4J0UA 4PS8A 2R03A 2JEKA 2DYRE 5CECB 2C2LA 4ATGA 4N39A 1TN7A 3AG1E 3JXJA 2L0TB 4FJYA 1BI8B 3SFZA 5HS0A 1SZAA 3V31A 3CK9A 1QZ2A 2ETBA 1WG0A 1Z3XA 4G26A 4UQYA 1AP7A 3JUEA 3L54A 3RO3A 4MLPA 3MGBA 1SW6A 1NFIE 3T5XA 4EZKA 3CGHA 3QARA 3CEQA 3TWWA 3TWRA 3JYSA 3TAXA 3S2AA 1LD7A 4WAFA 3HVEA 2GRRB 3Q49B 4NACA 4AXHA 2NC9A 4U8YD 3SGHA 2IFUA 1HG5A 1NL4A 3B7SA 3FUNA 5E75A 4EPZA 4KZCA 1LD8A 3UXGA 2XPYA 5CBNA 1OXJA 2VJ8A 4GZ6A 3CVUA 4LG6A 4BTAA 3CHSA 2VYIA 4V3IA 1O1SA 5D0OD 4F6RD 3C72A 2PNNA 2PQNA 4O1PA 5AN8A 3GZSA 1MX4A 4U8VD 4JHJA 2DYSE 5G04C 1X81A 1H2UA 1S64A 4CGVA 4I2WA 2BTDA 5FZQA 1S63A 2EILE 4EZLA 4TUUA 3MKQB 3SY2A 2OOEA 3Q9UC 5JHAA 4UWHA 3V2OA 4FP7A 3QJZA 4HXIA 3UT7A 3T8MA 3G2TA 3CHRA 3SBTB 5BXOA 4AV7A 1MX6A 2WPVA 2KXPC 2XPIA 4AP2A 4JPSA 3IV0A 2IF4A 2C0MA 2X6FA 3B7UX 1UN8A 4JA9A 1LTXA 1HFAA 2V4HC 4ZHBA 4GMLA 5ENRD 4HOTA 5KJMA 1UOHA 4RG6A 2EQXA 2GROB 2EINE 2EIKE 1K3ZD 3HXEA 3Q7AA 3EIJA 3UT8A 2CFUA 1NA0A 4P29A 3DRAA 2AJAA 4JZYA 4CT4A 3UPVA 2QZAA 3PS6A 4B89A 5CMYA 5EIDA 3MCXA 5KCMA 4GZ5A 4YVOA 2R05A 3LCAA 2QFCA 5ENNA 3ZXSA 1HXIA 1BPOA 2UY1A 2XRYA 3CIAA 5JA4D 4G1TA 2IOSA 4HRNA 3PEUB 3D9LA 2DWZA 4URKA 4JA7A 1B89A 4C9BB 4LEUA 3ZIMA 2XCBA 3O4ZA 5ITZF 4H7YA 4GTPA 4O60A 1DVPA 1TR4A 4I9EA 4BWRA 1HZ4A 1XNFA 4J8YA 5FZSA 3CVVA 2Y0BG 4DUIA 2KC7A 5CCLA 4L1BA 1E7VA 4DX2A 3AS5A 2XGOA 5JHBA 3FEYA 4J8FA 4PDXA 1MYOA 5A6CA 3ASNE 4G8KA 5D0QD 3HYMB 1ZU2A 4LRZA 1WM5A 3TJPA 5FQ6A 1IXVA 4B8CB 4JW1A 4GTQA 2RKKA 1UN9A 3LY7A 5G05C 1HG2A 1W3BA 2WXMA 2CHXA 4HFGA 3R9AB 4CYMD 4C0MA 3ZNGA 2PQRA 4HOUA 3SI5A 4YDOA 3PUKA 5AARA 4K0RA 4I6EA 3LYAA 3ULQA 3URZA 5BUZA 3ULEG 5EIBE 3VLEA 1RW2A 4J6IA 3DSSA 3OTNA 1E96B 3UKUG 5AQ9A 1VDYA 2FO7A 2HYZA 5G04J 3TXMA 3MJWA 4A3VA 4A63B 4WUYA 2LXMA 4EBAA 5EYLA 1TNZA 5ENPD 3Q15A 3ABKE 2RG8A 3PEVB 4GTVA 3NB2A 2OVBA 4TUMA 5EX0A 2J4DA 2I6HA 2IO3C 2VTBA 2DBAA 4HI8A 1IQUA 3EDTB 2P9LG 2J4BA 3ML9A 3IBEA 3PNTB 1H6OA 1KZPA 3GW4A 3NOGD 3TWUA 3KEZA 2ZU6B 3V2XA 4HLLA 2I1KA 2I2OA 4UI9C 3UM1A 3CLJA 4OYSA 2J9QA 3ZYMA 4F1PA 4FC8A 2IEJA 3E34A 3PH0C 4FU3A 4GAAA 4IRUA 4ANXA 2X6KA 3ZGQA 1UW4B 3L08A 1ELWA 3QOUA 4F7AA 2WQ7A 1MJ0A 4UWLA 4L2LA 3FTXA 5J90A 5ANLA 2BF0X 2J07A 3ZRHA 2NYJA 5CHEE 4U96D 3S7BA 3N71A 3KSLA 3Q7FA 4U0SA 2R02A 4ACKA 1BLXB 1X5BA 3OXGA 2B6CA 3SNXA 2R59A 4A3TA 4XE0A 3W9GA 4TV3A 4E85A 1FPPA 1N9AA 3ZKJA 3LKUA 5JMND 1E8XA 3W9FA 4GTSA 3CSTA 3TXNA 1H19A 3UM3A 5LOZA 1EDUA 3ML8A 3SBSA 3QWWA 3AJIA 3HVEB 2BEDA 1N54A 4B93B 3PDNA 5FQ4A 4TXRA 2WB2A 3FY4A 5KNHD 4W9RA 4AJWA 4UQZA 2FBNA 4ABNA 3QAQA 4CZ2D 2WXHA 2X6HA 4GCOA 5BV1A 1IYGA 1Z6TA 3TWSA 3ZYLA 3D9OA 3E4BA 5EX3A 1HO8A 1N4SA 4GYOA 3R9MA 1PC2A 1H6PA 2Q7FA 5FIOA 3Q73A 4I17A 4HNAD 2LAHA 4MKTA 4F3VA 1Y6IA 3KD7A 3J5PA 2ZGDA 1S70B 2KATA 2CHWA 1DCQA 4Z68A 5CRUA 4G8LA 1N4RA 3K9IA 3CVLA 2P9UG 1IHBA 5G05J 3C3RA 2GRMA 4EHMA 3LPZA 2P9SG 1JUQA 2FO1E 2P9IG 3P2BA 3FH7A 3VTXA 2GRQB 1JCSA 5CBOA 2V5QC 2X3MA 3AG3E 3DXMG 3RU0A 1O1TA 4O6FA 1JWFA 1D8EA 5CCMA 5ENOD 2LNIA 2MOWA 2QYJA 3LVRE 3E32A 3WXXA 3ZW3A 1TEZA 4WNDA 1N4QA 3NZUA 4HI9A 2EIJE 2DIWA 3DSUA 1ZBPA 3AU5A 4M3OA 2C0LA 3CQCB 4UQXA 3APDA 4Q96A 4XIFA 5FT9A 3LY9A 4BETA 5DIZA 1AWCB 3G2UA 5EKQD 5FJYA 3BG0B 2VGXA 4UWFA 2JABA 5AIJA 1DNPA 2GW1A 3E37A 5CMWA 3PZ4A 4D10C 2DVWA 3IHVA 5JJTA 3UI2A 1K8KG 5BNWA 4CDMA 3CQGB 1HU3A 4RLYA 3UM2A 1N52A 3CK8A 3PUJA 2UY1B 3TWVA 2P9PG 3C5RA 3D9KA 4JXTA 3ZYQA 3MV3B 3KEAA 2I9CA 3HDXA 3ABME 4PH4B 1MZCA 4UI9J 3ZEFA 2H6IA 2WXPA 2P9NG 3L6AA 3C98A 3APFA 4GYWA 5KJLA 4GB9A 4N3BA 3HXCA 3CK7A 3I3NA 2KCVA 4U7EB 2FULA 3PRZA 4A1GA 2XEHA 3TL5A 4BSZB 4GU5A 3IXEA 1O1RA 1MX2A 1N95A 3CVWA 3ZHEB 1TNYA 1E7UA 2LSVA 3EIQC 1Q2ZA 4KZ0A 3B7BA 2ETCA 3RO2A 4Y6WA 4HOSA 4K5BA 3NAWA 4QQIA 1LF8A 3UIOC 4N2SA 4YDYA 1E8ZA 4PUCA 3U66A 4GA0A 4NURA 3AG4E 3AS4A 4A1SA 4RSYA 5M72A 4E6HA 3GZ2A 4CRWA 2ZXWE 1UJKA 2X6IA 4DI3A 4HVBA 3QWPA 2IU1A 3D9HA 3P1UA 5HKPA 4BERA 3CKBA 3FUIA 4DX7D 3NQPA 5D2MC 4N2QA 3LDZA 3KAEA 3MV2B 2GRNB 4L2YA 4M7CA 2KZTB 2EIME 2M63A 1IKND 5EYPF 4UUCA 5AQ7A 4YNDA 3AS8A 4OAVB 2P2CP 2A5EA 5KWDA 2MYOA 3TGOA 3MKQA 3S7JA 1SZ9A 1OT8A 4ME2A 3DSXA 2BKGA 2P58C 3C3QA 2AW6A 4JHRA 2R2LA 3IKOB 2ETAA 3I4RB 2MRIA 3Q78A 5LCWC 3BQOA 2XZTG 4C0EA 1YA0A 1N0QA 2XEVA 4G11A 1U3DA 3ASFA 2V8SE 3FU3A 2LAIA 5BPPA 3CVNA 4I9CA 5AAOA 3CVPA 1K1AA 4K03A 4YDEA 3T5VA 3Q4AB 3QNKA 3RJVA 3B7RL 4ILHB 3UM0A 3ZU7B 2J09A 2WXIA 4U04A 2P9KG 3ZUVB 3D9PA 2ILRA 4FADA 4JEUA 5LP0A 2LO6A 1KZOA 2HR2A 4BY6A 2J08A 3PNLB 3PZDA 2Y3AA 3JUIA 2PM7A 2DZOA 2OEVA 5JJ7A 2L6JA 2Y69E 4XKBA 1P5QA 3L9TA 3ZXPA 5C1DA 2XGSA 2X38A 4KXKB 1Z3YA 2OCCE 1SVXA 2GRPB 4PS7A 3FUJA 3L13A 4BX9A 3IHYA 1OWNA 4NRHB 4EBAG 2WXQA 2X6JA 4AM9A 3UQ3A 2KM4A 3DEPA 4DX1A 3U64A 2CG3A 2A5UA 3DWLG 4FA6A 4U0ZA 5AJDA 2WMNA 1TYQG 4N5CA 5BT1A 4ACLA 1KT0A 4JB8P 5ENSD 3G2VA 5AENA 3FTZA 1HH8A 3ULYA 5H7PA 3LXUX 3ZPJA 3EUVA 4EQFA 2XQ0A 4NIKA 3QWVA 2H6GA 1HX8A 3Q47B 2PZIA 1GW6A 1OY3D 3MA5A 2HO1A 2LXLA 3PZ1A 3MX3A 3OXLA 1ZB1A 2WXKA 4NQ0A 2AVPA 3ASGA 3DPDA 2RFAA 3U9WA 4GTRA 1DC2A 2L6BA 2LSUA 4FLHA 4LSZE 4UI9K 3HXDA 3D9MA 4IULA 4DJAA 3ONKA 2FEZA 3ZVVA 3T9KA 5B1BE 3T8KA 3PREA 4TXPA 1TJCA 4CT0A 4BT8A 2HM8A 4EECA 5BXUA 4KVMA 5DBKA 4CEMA 2A4ZA 4TRQA 2HE0A 3TWQA 2WXFA 4FHKA 3B13A 3LEWA 5T3RA 5FQ8A 4B0ZA 3PZ2A 1Y8MA 1SQMA 1KLXA 2DZNA 4N5QA 4MBGA 4X8QA 4WWNA 4AY5A 1PAQA 2PL2A 2V5FA 5E76A 3RRMB 2YNQA 1L5JA 4C48B 3ZYKA 5B3SE 4OAUC 4GPKA 3O48A 3FULA 2LUHA 2QC9A 1QNFA 2V0PA 2F0YA 2VSNA 3G2SA 4XEIG 2IONA 4KBQA 3QK0A 3FFLA 4YVQC 1O5MA 3L17A 4L7TA 1QBQA 3FH5A 3KS2A 5AQBA 5LX8A 3EJNA 2VGEA 3EHQA 3QKYA 3UMVA 4FULA 2WXRA 4EZJA 3TG4A 5KJKA 3CHPA 2KCLA 3BU8A 4LERA 2MHKA 3D9NA 3SD5A 2AXZA 5LCWJ 3VLFA 3DXKG 5CEAA 2WXOA 1A17A 4LNBA 2WQ6A 3C3OA 3QC1A 1OUVA 1FVFA 5ENQD 2YINA 3UINC 2IOLA 3CR3A 3V30A 2VGXB 2F37A 2VSXE 4QFVA 4JC8A 2WXGA 4N3CA 1D8DA 4HOQA 1OCOE 2L9BA 2WQHA 4XZ4A 4WWPA 5ENTD 4G25A 3CKCA 3ASDA 3ABLE 4DI4A 5CRVA 3NF1A 3HIZA 4GZ3A 5FWQA 3Q75A 3ESLA 4I43A 2ONDA 4Q69A 2VQ2A 1KT1A 1WY6A 3NOCD 5C2YA 3APCA 3HHMA 4HBDA 3EHMA 4FHJA 3JCKC 1NP7A 4O1OA 4UWGA 1FVHA 2B0OE 3ZN3A 3OXFA 4ZFHA 5EDSA 1EPUA 1FCHA 4GZDA 1H2TC 2XHEA 1YCSB 1H0AA 4JVSA 1N11A 4G24A 1TJFA 4I1AA 2H6HA 4U07A 3RAUA 1FT2A 3I5PA 3OAWA 3FUMA 3ESKA 4AVXA 3FU0A 1JCRA 5LFAA 3WG7E 2J8SD 3BG1B 3QDNA 4BTBA 3B95A 2IJGX 5G2NA 3DBSA 4HQDA 4KYOB 2PM6A 4U0UA 3F6QA 2KCKA 3X2QE 4HRLA 5B1AE 4U8HA 1V54E 4FJZA 4ILIA 4HLEA 3CHQA 4IN3B 3PZ3A 3UIPC 5T8IA 4APOA 3L82A 1QYMA 1NA3A 3FP3A 3DSTA 1A5EA 5BV0A 1MQSA 2I1JA 1OCZE 1WAO1 1TN8A 2GRLA 2WVIA 3FTSA 3CV0A 4GPMA 3PE4A 2R17C 3FUFA 4KT6B 4BX8A 2QYUA 3DSWA 5CERB 3CHOA 5EN5D 4BSXA 4WNEA 5KBAA 5D66A 4I6GA 5FTPA 4WWOA 3FTUA 3G2WA 3VLDA 4OVUA 1MHQA 4LNGA 3ENEA 3QB2A 5HQ8A 2CG2A 4J8EA 3ASHA 1N94A 3FTVA 4AIFA 4ATZD 1E8WA 2YHCA 1UJJA 2UWJG 3SF4A 2GGFA 4DLOA 3EU5A 1IHGA 2BUGA 4GA1A 4LNUD 4L23A 2Y4UA 4K5AB 1BU9A 3FH8A 2XPZA 3L16A 5T4YA 4U63A 4GYYA 3UT4A 4HORA 3JQ1A 4BEPA 4PS3A 2NSZA 1JPLA 3Q79A 3FHEA 4A55A 1ELKA 3LVQE 4MS6A 1TNBA 4AY6A 5A23A 1JWGA 1OCRE 3B7TA 4H7XA 2JLBA 4GMRA 3VTYA 2RD0A 2AWIA 4CGWA 3L22A 5J08A 1BI7B 1OWMA 1D9SA 2AXVA 3FUKA 2ZIRA 4HB5A 4DLQA 3GZ1A 3JXIA 3NZSA 4GTOA 1U3CA 1BD8A 4HRMB 3MYVA 4B8AA 2KBXA 1V55E 1SA4A 4AEZC 1HE8A 3CVQA 1INZA 3GYZA 4Y6CA 3Q5MA 2F8XK 3RSEG 1FT1A 1TNUA 4B94A 2VSYA 4XI0A 3JQ0A 1Z5SC 3ZHEA 2XENA 1QQEA 2XZDG 3DPYA 2RFMA 4ILGA 3RKVA 3SFXA 4RVBA 4GZCA 1OWOA 4R7LA 3S7DA 3AAAC 4XKCA 5ANRA 4ANUA 3DEOA 4N3AA 2Y4TA 1UG3A 3Q9NC 2E2EA 2R5SA 3D3MA 3KSQA 5ARFA 2CHZA 3LY8A 3TWXA 2BKKB 3BEEA 5HI7A 5EILA 4DPRA 3PE3A 3D9IA 4J8DA 3U3WA 1HF8A 1H2VC 1G3NB 3IEGA 4XI9A 2VTBB 3LJNA 1OWPA 4BFRA 3MZLB 3CSFA 3ONLA 3UX4A 4OVVA 1NZNA 4K5CA 2WXJA 4TXQA 4F53A 2XRZA 3EU9A 3ZFWA 4CDNA 2AXUA 3RK6A 4G23A 2H6FA 3MEKA 4XX5A 1KPSB 3U4TA 2KZTA 4ANWA 1YYHA 1HS6A 2E0IA 3FDHA 3J5QB 1PY1A 3SQVA 4HS2A 2XGMA 4CCAA 3FUHA 4I6JA 3SO8A 1XGWA 5AJLA 4G2VA 3R7RA 4DK5A 1U2VG 4U95D 3LS8A 4BT9A 2V4LA 1K1BA 4DX5D 5JJ6A 2WMOA 3UKRG 3HXFA 5G55A 1S0PA 1EF1C 4GA2A 1EYHA 4RQIA 3UTMA 3CVXA 4UWKA 5ARGA 1RZ4A 1YMPA 2VSOE 3FTWA 4LUNU 1TN6A 2IO2C 2Y1LE 4I2ZA 4CDRA 2WXLA 2ZGGA 4RG9A 3LJ3A 3TG5A 3D9JA 3ASOE 3NBNB 3R7QA 4J8SA 4GCNA 3HRAA 4DX6D 4F1SA 5KJNA 1OCCE 4FLBA 3PVLA 5AYWD 2XS8A 3FUDA 3FUEA 4JEHA 1ELRA 1OWLA 3E33A 5KNGA 1SA5A 3E30A 5FQ7A 4KVOA 5HRYA 4I1MA 3S7FA 4DRXE 4Q94A 3BUAA 4IYPA 3CHMA 2F8YA 2OVFA
chains in the Genus database with same CATH topology
3EHMA 3RRUA 4FHJA 3FU5A 3JCKC 1NP7A 1E8ZA 1UN9A 4PUCA 4UWGA 3LY7A 3EHNA 5G05C 3FTYA 1FVHA 2VGYA 1HG2A 3U66A 4GA0A 4NURA 2YQ8A 1W3BA 2WXMA 2CHXA 3RRNB 3ZN3A 2FF4A 4HFGA 5FZRA 3AS4A 2OV8A 3OXFA 5EDSA 4A1SA 1EPUA 3R9AB 4RSYA 4MRUA 1FCHA 2QY7A 3FEXA 5M72A 3RIBA 3GZ2A 4GZDA 4E6HA 1H2TC 4C0MA 4CRWA 1UJKA 2PQRA 2NXPA 4HOUA 2X6IA 2XHEA 4AOFA 3QWPA 2IU1A 3FWVA 4DI3A 4HVBA 3SI5A 3P1UA 1H0AA 2FI7A 3FU6A 3I4GA 3PUKA 4JVSA 3CKBA 3FUIA 4K0RA 1E8YA 3NQPA 4G24A 1TJFA 4I1AA 4U07A 4N2QA 3I5PA 3LDZA 3UUXA 4I6EA 3LYAA 3KAEA 3MV2B 4WNGA 3OAWA 3ULQA 3FUMA 2CFZA 2XCCA 4L2YA 3URZA 5BUZA 3ESKA 2WM9A 2IQCA 2DCPA 2KZTB 3FU0A 4AVXA 2M63A 3VLEA 4J6IA 2L0IA 5LFAA 3BG1B 4JL0A 3QDNA 3OTNA 4GMJA 1E96B 5BW8C 4BTBA 1VDYA 3CVYA 2IJGX 2FO7A 4YNDA 2HYZA 5G04J 4APFA 4JHKA 3AS8A 4KMOA 4WNFA 3TXMA 3MJWA 4A3VA 5G2NA 3SHFA 3DBSA 2J49A 1E90A 4KYOB 4WUYA 3TGOA 2PM6A 3MKQA 4U0UA 3S7JA 1SZ9A 2KCKA 4EBAA 3SZ7A 2WXNA 4ME2A 2YHEA 4U8HA 2P58C 4FJZA 2AW6A 4ILIA 4JHRA 3Q15A 3CHQA 4IN3B 1IQRA 4I1OB 5T8IA 3IKOB 4ANVA 4APOA 3I4RB 2MRIA 1H6KA 1NA3A 3FP3A 5LCWC 3MKRA 4C0EA 5BV0A 1MQSA 1YA0A 4LCTA 2RG8A 2I1JA 1WAO1 3PEVB 2GRLA 3AU4A 2OVBA 2XEVA 2WVIA 3FTSA 5EX0A 3CV0A 2J4DA 4G11A 2I6HA 2R17C 3FUFA 3PE4A 4KT6B 4BX8A 1U3DA 3ASFA 2V8SE 3CHOA 2VTBA 3FU3A 4BSXA 4WNEA 2LAIA 2DBAA 5BPPA 3CVNA 4I6GA 1IQUA 3EDTB 5FTPA 4WWOA 3FTUA 5A7DB 2J4BA 3G2WA 3VLDA 4I9CA 3CVPA 4J0UA 3ML9A 3IBEA 4K03A 3T5VA 3PNTB 3Q4AB 3GW4A 4PS8A 3QNKA 2JEKA 4OVUA 3B7RL 4ILHB 1MHQA 3KEZA 3RJVA 2ZU6B 3ENEA 2C2LA 3QB2A 2J09A 2WXIA 5HQ8A 2CG2A 4ATGA 2I1KA 4N39A 2I2OA 4U04A 4J8EA 2L0TB 4FJYA 3D9PA 3ASHA 4UI9C 3CLJA 3FTVA 4AIFA 2ILRA 4OYSA 2J9QA 3SFZA 4JEUA 4FADA 5LP0A 2LO6A 2HR2A 3ZYMA 1SZAA 4FC8A 3PH0C 4FU3A 4BY6A 4GAAA 1E8WA 2J08A 3CK9A 2YHCA 4IRUA 1QZ2A 4ANXA 3PNLB 2X6KA 3PZDA 1UJJA 3ZGQA 1Z3XA 1UW4B 3L08A 1ELWA 2UWJG 4G26A 3QOUA 3SF4A 2GGFA 2Y3AA 4DLOA 3JUIA 1IHGA 2BUGA 4UQYA 2PM7A 4GA1A 4F7AA 2WQ7A 4L23A 2Y4UA 5JJ7A 3FH8A 2XPZA 4UWLA 2L6JA 3L16A 5T4YA 4XKBA 1P5QA 4U63A 5C1DA 2XGSA 4GYYA 2X38A 3L54A 4KXKB 3JQ1A 4L2LA 3RO3A 3UT4A 4HORA 1Z3YA 3FTXA 4MLPA 4PS3A 2NSZA 2BF0X 3MGBA 5ANLA 2J07A 5J90A 1JPLA 3ZRHA 4PS7A 3T5XA 3FUJA 4EZKA 3CGHA 3L13A 4BX9A 5CHEE 3IHYA 1OWNA 3CEQA 3N71A 3QARA 4NRHB 3S7BA 3FHEA 3JYSA 4A55A 3TAXA 1ELKA 4EBAG 2WXQA 4U0SA 3S2AA 2X6JA 4AM9A 3LVQE 4MS6A 4ACKA 3UQ3A 1X5BA 3OXGA 4AY6A 2KM4A 4WAFA 3HVEA 3SNXA 5A23A 2R59A 4A3TA 3U64A 3Q49B 1JWGA 2A5UA 2CG3A 3B7TA 2NC9A 4NACA 4AXHA 4XE0A 4H7XA 2JLBA 4TV3A 2IFUA 1HG5A 3SGHA 4U0ZA 3VTYA 4E85A 2RD0A 5AJDA 4FA6A 2WMNA 3B7SA 3FUNA 3LKUA 2AWIA 5E75A 4EPZA 3L22A 4CGWA 4KZCA 5J08A 1OWMA 2AXVA 4N5CA 1E8XA 3FUKA 2XPYA 5BT1A 4DLQA 3GZ1A 3CSTA 4ACLA 1KT0A 1H19A 3NZSA 3TXNA 3G2VA 2VJ8A 5AENA 3FTZA 5LOZA 4GZ6A 3CVUA 1EDUA 3ML8A 1U3CA 3SBSA 1HH8A 4BTAA 4CEMA 3CHSA 3QWWA 2VYIA 4V3IA 3LXUX 3MYVA 3ZPJA 4B8AA 5D0OD 4EQFA 2PQNA 2XQ0A 3HVEB 4AEZC 3QWVA 1N54A 3GZSA 3PDNA 5FQ4A 1HX8A 3Q47B 2WB2A 2PZIA 1GW6A 3MA5A 3FY4A 2HO1A 4JHJA 1HE8A 4W9RA 4AJWA 3CVQA 1INZA 3GYZA 4UQZA 2FBNA 5G04C 3QAQA 4Y6CA 4ABNA 3Q5MA 1H2UA 2WXHA 3MX3A 2X6HA 4GCOA 3OXLA 4B94A 2VSYA 4XI0A 5BV1A 4CGVA 1Z6TA 3ZYLA 2WXKA 3JQ0A 1IYGA 3D9OA 3E4BA 4I2WA 4NQ0A 5EX3A 1HO8A 2BTDA 2AVPA 3ASGA 4GYOA 5FZQA 1PC2A 2Q7FA 3ZHEA 4EZLA 1QQEA 3DPDA 4TUUA 3MKQB 3U9WA 2OOEA 4ILGA 3RKVA 4RVBA 4I17A 2LSUA 4GZCA 5JHAA 4FLHA 1OWOA 4UWHA 4UI9K 2LAHA 4MKTA 4F3VA 4R7LA 4FP7A 3S7DA 4XKCA 5ANRA 3QJZA 3D9MA 4HXIA 4ANUA 1Y6IA 3KD7A 4IULA 4DJAA 4N3AA 2Y4TA 1UG3A 3UT7A 3T8MA 2KATA 3G2TA 2CHWA 3ONKA 2E2EA 3CHRA 2FEZA 2R5SA 3D3MA 3ZVVA 5ARFA 2CHZA 3LY8A 3SBTB 4AV7A 3PREA 3BEEA 5HI7A 1TJCA 2WPVA 3K9IA 4CT0A 4DPRA 2XPIA 3PE3A 4AP2A 4JPSA 3CVLA 3D9IA 4BT8A 2HM8A 5G05J 4EECA 3IV0A 4J8DA 2IF4A 4KVMA 3U3WA 1H2VC 1HF8A 5DBKA 2C0MA 2X6FA 2A4ZA 1UN8A 2GRMA 3B7UX 3IEGA 4JA9A 3LPZA 4XI9A 4TRQA 2VTBB 1JUQA 1OWPA 4BFRA 3MZLB 1HFAA 4GMLA 2WXFA 3CSFA 4FHKA 4HOTA 3ONLA 3UX4A 3B13A 3P2BA 4OVVA 5KJMA 3FH7A 3LEWA 5T3RA 1NZNA 3VTXA 2WXJA 4F53A 2XRZA 3ZFWA 5FQ8A 4CDNA 2AXUA 4B0ZA 4RG6A 1Y8MA 1SQMA 3RK6A 1KLXA 2X3MA 2EQXA 4WWNA 4G23A 4AY5A 1PAQA 2PL2A 2V5FA 4O6FA 3RU0A 1JWFA 3MEKA 4XX5A 5E76A 3U4TA 5CCMA 3RRMB 2YNQA 2KZTA 2LNIA 1L5JA 2MOWA 4ANWA 3LVRE 2E0IA 1HS6A 3ZYKA 3FDHA 3EIJA 4GPKA 3UT8A 1PY1A 3WXXA 3ZW3A 2CFUA 2XGMA 3FULA 3O48A 4HS2A 4CCAA 1TEZA 3FUHA 4I6JA 1NA0A 1QNFA 2V0PA 4WNDA 2VSNA 3G2SA 4P29A 3NZUA 2IONA 4JZYA 4KBQA 3QK0A 4CT4A 2DIWA 1XGWA 3FFLA 5AJLA 3UPVA 3PS6A 1ZBPA 4B89A 3AU5A 4M3OA 5CMYA 4G2VA 3MCXA 4YVQC 3R7RA 5KCMA 3L17A 4DK5A 4GZ5A 4L7TA 2C0LA 4YVOA 3CQCB 3LS8A 3LCAA 3FH5A 3KS2A 4UQXA 4BT9A 5LX8A 2V4LA 2QFCA 3APDA 3EJNA 4Q96A 5ENNA 4XIFA 3ZXSA 5FT9A 3QKYA 3UMVA 3LY9A 1HXIA 1BPOA 2UY1A 4FULA 2WXRA 4EZJA 3TG4A 2XRYA 3CIAA 5DIZA 3CHPA 2KCLA 5JJ6A 2WMOA 5KJKA 3G2UA 4LERA 5EKQD 4G1TA 2IOSA 2MHKA 3D9NA 5FJYA 3SD5A 3PEUB 3BG0B 2AXZA 2VGXA 4UWFA 5G55A 1S0PA 5LCWJ 3D9LA 5AIJA 1EF1C 1DNPA 4GA2A 1EYHA 3VLFA 2GW1A 5CMWA 3CVXA 4UWKA 4D10C 4URKA 5ARGA 4JA7A 2VSOE 3IHVA 1B89A 5JJTA 4C9BB 2WXOA 4LEUA 5BNWA 4CDMA 1A17A 3CQGB 3FTWA 4LUNU 3ZIMA 2XCBA 2WQ6A 1HU3A 3O4ZA 3QC1A 1N52A 3CK8A 1OUVA 3PUJA 1FVFA 2UY1B 4H7YA 4I2ZA 2WXLA 4CDRA 1DVPA 2YINA 4RG9A 3D9KA 2IOLA 4I9EA 3CR3A 4JXTA 1HZ4A 4BWRA 3LJ3A 1XNFA 3ZYQA 3MV3B 2I9CA 3HDXA 5FZSA 3CVVA 2VGXB 4QFVA 2VSXE 4PH4B 3TG5A 3D9JA 4JC8A 2WXGA 4N3CA 3R7QA 4UI9J 3ZEFA 2WXPA 4J8SA 2KC7A 4GCNA 3L6AA 4F1SA 5KJNA 4HOQA 5CCLA 3C98A 3APFA 2L9BA 2WQHA 4FLBA 4L1BA 4XZ4A 3PVLA 1E7VA 4GYWA 4WWPA 4GB9A 5KJLA 5AYWD 3AS5A 4N3BA 3FUDA 3CK7A 3FUEA 3I3NA 2KCVA 2XGOA 1ELRA 4JEHA 2FULA 4G25A 3PRZA 3FEYA 4J8FA 4A1GA 5JHBA 3TL5A 3CKCA 4GU5A 4PDXA 1OWLA 3ASDA 4DI4A 3CVWA 3ZHEB 3NF1A 3HIZA 4GZ3A 5FWQA 1E7UA 2LSVA 3ESLA 4I43A 3EIQC 2ONDA 5A6CA 5D0QD 5FQ7A 4Q69A 3HYMB 4KZ0A 4HLEA 2VQ2A 1ZU2A 4LRZA 4KVOA 1KT1A 1WM5A 4I1MA 1WY6A 3RO2A 3S7FA 4Y6WA 4Q94A 3TJPA 4IYPA 5FQ6A 4HOSA 5C2YA 3APCA 1LF8A 3HHMA 3CHMA 4N2SA 4B8CB 4JW1A 2OVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LY7 A;  5G05 C;  2VGY A;  4GA0 A;  2YQ8 A;  1W3B A;  3ZN3 A;  2FF4 A;  5FZR A;  3AS4 A;  3OXF A;  4A1S A;  3R9A B;  1FCH A;  5M72 A;  3RIB A;  3GZ2 A;  2PQR A;  4HOU A;  3QWP A;  3FWV A;  2FI7 A;  3CKB A;  4G24 A;  4I1A A;  4U07 A;  4N2Q A;  3UUX A;  3LYA A;  3KAE A;  3MV2 B;  4WNG A;  3ULQ A;  3URZ A;  2XCC A;  3ESK A;  4JL0 A;  3QDN A;  1E96 B;  5BW8 C;  4BTB A;  2FO7 A;  4YND A;  2HYZ A;  5G04 J;  3AS8 A;  4WNF A;  4KYO B;  4WUY A;  3TGO A;  4U0U A;  3S7J A;  2KCK A;  3SZ7 A;  4ME2 A;  2P58 C;  4JHR A;  3Q15 A;  4IN3 B;  4APO A;  1NA3 A;  3FP3 A;  5LCW C;  3MKR A;  1YA0 A;  1WAO 1;  2XEV A;  5EX0 A;  3CV0 A;  2I6H A;  3PE4 A;  3ASF A;  4WNE A;  2DBA A;  3CVN A;  5FTP A;  3EDT B;  5A7D B;  4I9C A;  3CVP A;  4J0U A;  3Q4A B;  3GW4 A;  3RJV A;  2C2L A;  5HQ8 A;  4N39 A;  4U04 A;  4J8E A;  3ASH A;  4UI9 C;  4AIF A;  2J9Q A;  2HR2 A;  3CK9 A;  2YHC A;  1QZ2 A;  3ZGQ A;  1ELW A;  2UWJ G;  4G26 A;  3QOU A;  3SF4 A;  1IHG A;  2BUG A;  4UQY A;  4GA1 A;  5JJ7 A;  2Y4U A;  2L6J A;  1P5Q A;  5C1D A;  2XGS A;  4GYY A;  4KXK B;  4HOR A;  3RO3 A;  5CHE E;  3S7B A;  3CEQ A;  3N71 A;  4NRH B;  3JYS A;  3TAX A;  4U0S A;  4AM9 A;  3UQ3 A;  3OXG A;  4AY6 A;  3Q49 B;  2NC9 A;  4H7X A;  2JLB A;  2IFU A;  3VTY A;  4U0Z A;  3LKU A;  4CGW A;  4N5C A;  5BT1 A;  3GZ1 A;  1KT0 A;  4GZ6 A;  1HH8 A;  4BTA A;  3QWW A;  2VYI A;  3ZPJ A;  5D0O D;  4EQF A;  2PQN A;  3QWV A;  3PDN A;  3Q47 B;  2PZI A;  3MA5 A;  2HO1 A;  4W9R A;  3CVQ A;  3GYZ A;  4UQZ A;  2FBN A;  5G04 C;  4Y6C A;  4ABN A;  3Q5M A;  4GCO A;  3OXL A;  4B94 A;  2VSY A;  4XI0 A;  4CGV A;  1IYG A;  3E4B A;  4I2W A;  4NQ0 A;  5EX3 A;  2AVP A;  3ASG A;  4GYO A;  5FZQ A;  1PC2 A;  2Q7F A;  3ZHE A;  1QQE A;  2OOE A;  3RKV A;  4I17 A;  2LSU A;  4UI9 K;  4F3V A;  3S7D A;  3KD7 A;  4N3A A;  2Y4T A;  2KAT A;  2E2E A;  2FEZ A;  2R5S A;  5ARF A;  3LY8 A;  3BEE A;  5HI7 A;  1TJC A;  2WPV A;  3K9I A;  2XPI A;  3PE3 A;  3CVL A;  4BT8 A;  5G05 J;  4J8D A;  2IF4 A;  3U3W A;  5DBK A;  2C0M A;  4JA9 A;  3IEG A;  4XI9 A;  3LPZ A;  4HOT A;  5KJM A;  1NZN A;  3VTX A;  3ZFW A;  4RG6 A;  1Y8M A;  1KLX A;  4G23 A;  4AY5 A;  2PL2 A;  2V5F A;  4O6F A;  3RU0 A;  3MEK A;  3U4T A;  5CCM A;  2LNI A;  4GPK A;  3WXX A;  3O48 A;  2XGM A;  1NA0 A;  4WND A;  2VSN A;  4KBQ A;  3UPV A;  3FFL A;  1ZBP A;  4G2V A;  4YVQ C;  4GZ5 A;  4YVO A;  2C0L A;  3LCA A;  3KS2 A;  4UQX A;  4BT9 A;  2QFC A;  4XIF A;  5FT9 A;  3QKY A;  3LY9 A;  1HXI A;  2UY1 A;  3TG4 A;  5DIZ A;  5KJK A;  5JJ6 A;  2KCL A;  5EKQ D;  4G1T A;  2MHK A;  5FJY A;  2VGX A;  5LCW J;  4GA2 A;  2GW1 A;  5ARG A;  4JA7 A;  1B89 A;  5JJT A;  4LEU A;  5BNW A;  1A17 A;  2XCB A;  3CK8 A;  1OUV A;  2UY1 B;  4I2Z A;  4H7Y A;  4CDR A;  4RG9 A;  4I9E A;  4BWR A;  1HZ4 A;  1XNF A;  3MV3 B;  5FZS A;  2VGX B;  3TG5 A;  4N3C A;  4UI9 J;  2KC7 A;  4GCN A;  5KJN A;  4HOQ A;  5CCL A;  2WQH A;  4GYW A;  5KJL A;  5AYW D;  3AS5 A;  4N3B A;  3CK7 A;  2KCV A;  2XGO A;  1ELR A;  4G25 A;  4J8F A;  3CKC A;  3ASD A;  3ZHE B;  3NF1 A;  4GZ3 A;  2LSV A;  2OND A;  5A6C A;  5D0Q D;  3HYM B;  2VQ2 A;  1ZU2 A;  1KT1 A;  1WM5 A;  3RO2 A;  3S7F A;  4Y6W A;  4HOS A;  4N2S A; 
#chains in the Genus database with same CATH topology
 4GTM A;  3RRU A;  3FU5 A;  3EHN A;  3FTY A;  2VGY A;  2YQ8 A;  3RRN B;  2FF4 A;  5FZR A;  2OV8 A;  4MRU A;  2QY7 A;  3FEX A;  3RIB A;  2NXP A;  4AOF A;  3FWV A;  5IY5 E;  2FI7 A;  3FU6 A;  3I4G A;  1WDY A;  1E8Y A;  1N0R A;  3UUX A;  4L9P A;  5FIN A;  4WNG A;  4GTT A;  2CFZ A;  2XCC A;  2OEW A;  2WM9 A;  2IQC A;  2DCP A;  3HXB A;  2L0I A;  4J7W A;  4JL0 A;  4GMJ A;  5BW8 C;  4YDW A;  5AQA A;  3CVY A;  3V79 K;  4APF A;  4JHK A;  4KMO A;  3EHR A;  3ISM C;  4BES A;  4WNF A;  5CED B;  2XEE A;  3SHF A;  3AG2 E;  2J49 A;  1JCQ A;  1E90 A;  3DSV A;  1NI1 A;  3SFY A;  3SZ7 A;  2WXN A;  2YHE A;  2ZIS A;  3TWT A;  1N4P A;  1IQR A;  4I1O B;  4ANV A;  1H6K A;  3HG0 D;  1TNO A;  3MKR A;  4JD2 G;  4LCT A;  3AU4 A;  2IY0 C;  1DCE A;  5A7D B;  2XS1 A;  4J0U A;  4PS8 A;  2R03 A;  2JEK A;  2DYR E;  5CEC B;  2C2L A;  4ATG A;  4N39 A;  1TN7 A;  3AG1 E;  3JXJ A;  2L0T B;  4FJY A;  1BI8 B;  3SFZ A;  5HS0 A;  1SZA A;  3V31 A;  3CK9 A;  1QZ2 A;  2ETB A;  1WG0 A;  1Z3X A;  4G26 A;  4UQY A;  1AP7 A;  3JUE A;  3L54 A;  3RO3 A;  4MLP A;  3MGB A;  1SW6 A;  1NFI E;  3T5X A;  4EZK A;  3CGH A;  3QAR A;  3CEQ A;  3TWW A;  3TWR A;  3JYS A;  3TAX A;  3S2A A;  1LD7 A;  4WAF A;  3HVE A;  2GRR B;  3Q49 B;  4NAC A;  4AXH A;  2NC9 A;  4U8Y D;  3SGH A;  2IFU A;  1HG5 A;  1NL4 A;  3B7S A;  3FUN A;  5E75 A;  4EPZ A;  4KZC A;  1LD8 A;  3UXG A;  2XPY A;  5CBN A;  1OXJ A;  2VJ8 A;  4GZ6 A;  3CVU A;  4LG6 A;  4BTA A;  3CHS A;  2VYI A;  4V3I A;  1O1S A;  5D0O D;  4F6R D;  3C72 A;  2PNN A;  2PQN A;  4O1P A;  5AN8 A;  3GZS A;  1MX4 A;  4U8V D;  4JHJ A;  2DYS E;  5G04 C;  1X81 A;  1H2U A;  1S64 A;  4CGV A;  4I2W A;  2BTD A;  5FZQ A;  1S63 A;  2EIL E;  4EZL A;  4TUU A;  3MKQ B;  3SY2 A;  2OOE A;  3Q9U C;  5JHA A;  4UWH A;  3V2O A;  4FP7 A;  3QJZ A;  4HXI A;  3UT7 A;  3T8M A;  3G2T A;  3CHR A;  3SBT B;  5BXO A;  4AV7 A;  1MX6 A;  2WPV A;  2KXP C;  2XPI A;  4AP2 A;  4JPS A;  3IV0 A;  2IF4 A;  2C0M A;  2X6F A;  3B7U X;  1UN8 A;  4JA9 A;  1LTX A;  1HFA A;  2V4H C;  4ZHB A;  4GML A;  5ENR D;  4HOT A;  5KJM A;  1UOH A;  4RG6 A;  2EQX A;  2GRO B;  2EIN E;  2EIK E;  1K3Z D;  3HXE A;  3Q7A A;  3EIJ A;  3UT8 A;  2CFU A;  1NA0 A;  4P29 A;  3DRA A;  2AJA A;  4JZY A;  4CT4 A;  3UPV A;  2QZA A;  3PS6 A;  4B89 A;  5CMY A;  5EID A;  3MCX A;  5KCM A;  4GZ5 A;  4YVO A;  2R05 A;  3LCA A;  2QFC A;  5ENN A;  3ZXS A;  1HXI A;  1BPO A;  2UY1 A;  2XRY A;  3CIA A;  5JA4 D;  4G1T A;  2IOS A;  4HRN A;  3PEU B;  3D9L A;  2DWZ A;  4URK A;  4JA7 A;  1B89 A;  4C9B B;  4LEU A;  3ZIM A;  2XCB A;  3O4Z A;  5ITZ F;  4H7Y A;  4GTP A;  4O60 A;  1DVP A;  1TR4 A;  4I9E A;  4BWR A;  1HZ4 A;  1XNF A;  4J8Y A;  5FZS A;  3CVV A;  2Y0B G;  4DUI A;  2KC7 A;  5CCL A;  4L1B A;  1E7V A;  4DX2 A;  3AS5 A;  2XGO A;  5JHB A;  3FEY A;  4J8F A;  4PDX A;  1MYO A;  5A6C A;  3ASN E;  4G8K A;  5D0Q D;  3HYM B;  1ZU2 A;  4LRZ A;  1WM5 A;  3TJP A;  5FQ6 A;  1IXV A;  4B8C B;  4JW1 A;  4GTQ A;  2RKK A;  1UN9 A;  3LY7 A;  5G05 C;  1HG2 A;  1W3B A;  2WXM A;  2CHX A;  4HFG A;  3R9A B;  4CYM D;  4C0M A;  3ZNG A;  2PQR A;  4HOU A;  3SI5 A;  4YDO A;  3PUK A;  5AAR A;  4K0R A;  4I6E A;  3LYA A;  3ULQ A;  3URZ A;  5BUZ A;  3ULE G;  5EIB E;  3VLE A;  1RW2 A;  4J6I A;  3DSS A;  3OTN A;  1E96 B;  3UKU G;  5AQ9 A;  1VDY A;  2FO7 A;  2HYZ A;  5G04 J;  3TXM A;  3MJW A;  4A3V A;  4A63 B;  4WUY A;  2LXM A;  4EBA A;  5EYL A;  1TNZ A;  5ENP D;  3Q15 A;  3ABK E;  2RG8 A;  3PEV B;  4GTV A;  3NB2 A;  2OVB A;  4TUM A;  5EX0 A;  2J4D A;  2I6H A;  2IO3 C;  2VTB A;  2DBA A;  4HI8 A;  1IQU A;  3EDT B;  2P9L G;  2J4B A;  3ML9 A;  3IBE A;  3PNT B;  1H6O A;  1KZP A;  3GW4 A;  3NOG D;  3TWU A;  3KEZ A;  2ZU6 B;  3V2X A;  4HLL A;  2I1K A;  2I2O A;  4UI9 C;  3UM1 A;  3CLJ A;  4OYS A;  2J9Q A;  3ZYM A;  4F1P A;  4FC8 A;  2IEJ A;  3E34 A;  3PH0 C;  4FU3 A;  4GAA A;  4IRU A;  4ANX A;  2X6K A;  3ZGQ A;  1UW4 B;  3L08 A;  1ELW A;  3QOU A;  4F7A A;  2WQ7 A;  1MJ0 A;  4UWL A;  4L2L A;  3FTX A;  5J90 A;  5ANL A;  2BF0 X;  2J07 A;  3ZRH A;  2NYJ A;  5CHE E;  4U96 D;  3S7B A;  3N71 A;  3KSL A;  3Q7F A;  4U0S A;  2R02 A;  4ACK A;  1BLX B;  1X5B A;  3OXG A;  2B6C A;  3SNX A;  2R59 A;  4A3T A;  4XE0 A;  3W9G A;  4TV3 A;  4E85 A;  1FPP A;  1N9A A;  3ZKJ A;  3LKU A;  5JMN D;  1E8X A;  3W9F A;  4GTS A;  3CST A;  3TXN A;  1H19 A;  3UM3 A;  5LOZ A;  1EDU A;  3ML8 A;  3SBS A;  3QWW A;  3AJI A;  3HVE B;  2BED A;  1N54 A;  4B93 B;  3PDN A;  5FQ4 A;  4TXR A;  2WB2 A;  3FY4 A;  5KNH D;  4W9R A;  4AJW A;  4UQZ A;  2FBN A;  4ABN A;  3QAQ A;  4CZ2 D;  2WXH A;  2X6H A;  4GCO A;  5BV1 A;  1IYG A;  1Z6T A;  3TWS A;  3ZYL A;  3D9O A;  3E4B A;  5EX3 A;  1HO8 A;  1N4S A;  4GYO A;  3R9M A;  1PC2 A;  1H6P A;  2Q7F A;  5FIO A;  3Q73 A;  4I17 A;  4HNA D;  2LAH A;  4MKT A;  4F3V A;  1Y6I A;  3KD7 A;  3J5P A;  2ZGD A;  1S70 B;  2KAT A;  2CHW A;  1DCQ A;  4Z68 A;  5CRU A;  4G8L A;  1N4R A;  3K9I A;  3CVL A;  2P9U G;  1IHB A;  5G05 J;  3C3R A;  2GRM A;  4EHM A;  3LPZ A;  2P9S G;  1JUQ A;  2FO1 E;  2P9I G;  3P2B A;  3FH7 A;  3VTX A;  2GRQ B;  1JCS A;  5CBO A;  2V5Q C;  2X3M A;  3AG3 E;  3DXM G;  3RU0 A;  1O1T A;  4O6F A;  1JWF A;  1D8E A;  5CCM A;  5ENO D;  2LNI A;  2MOW A;  2QYJ A;  3LVR E;  3E32 A;  3WXX A;  3ZW3 A;  1TEZ A;  4WND A;  1N4Q A;  3NZU A;  4HI9 A;  2EIJ E;  2DIW A;  3DSU A;  1ZBP A;  3AU5 A;  4M3O A;  2C0L A;  3CQC B;  4UQX A;  3APD A;  4Q96 A;  4XIF A;  5FT9 A;  3LY9 A;  4BET A;  5DIZ A;  1AWC B;  3G2U A;  5EKQ D;  5FJY A;  3BG0 B;  2VGX A;  4UWF A;  2JAB A;  5AIJ A;  1DNP A;  2GW1 A;  3E37 A;  5CMW A;  3PZ4 A;  4D10 C;  2DVW A;  3IHV A;  5JJT A;  3UI2 A;  1K8K G;  5BNW A;  4CDM A;  3CQG B;  1HU3 A;  4RLY A;  3UM2 A;  1N52 A;  3CK8 A;  3PUJ A;  2UY1 B;  3TWV A;  2P9P G;  3C5R A;  3D9K A;  4JXT A;  3ZYQ A;  3MV3 B;  3KEA A;  2I9C A;  3HDX A;  3ABM E;  4PH4 B;  1MZC A;  4UI9 J;  3ZEF A;  2H6I A;  2WXP A;  2P9N G;  3L6A A;  3C98 A;  3APF A;  4GYW A;  5KJL A;  4GB9 A;  4N3B A;  3HXC A;  3CK7 A;  3I3N A;  2KCV A;  4U7E B;  2FUL A;  3PRZ A;  4A1G A;  2XEH A;  3TL5 A;  4BSZ B;  4GU5 A;  3IXE A;  1O1R A;  1MX2 A;  1N95 A;  3CVW A;  3ZHE B;  1TNY A;  1E7U A;  2LSV A;  3EIQ C;  1Q2Z A;  4KZ0 A;  3B7B A;  2ETC A;  3RO2 A;  4Y6W A;  4HOS A;  4K5B A;  3NAW A;  4QQI A;  1LF8 A;  3UIO C;  4N2S A;  4YDY A;  1E8Z A;  4PUC A;  3U66 A;  4GA0 A;  4NUR A;  3AG4 E;  3AS4 A;  4A1S A;  4RSY A;  5M72 A;  4E6H A;  3GZ2 A;  4CRW A;  2ZXW E;  1UJK A;  2X6I A;  4DI3 A;  4HVB A;  3QWP A;  2IU1 A;  3D9H A;  3P1U A;  5HKP A;  4BER A;  3CKB A;  3FUI A;  4DX7 D;  3NQP A;  5D2M C;  4N2Q A;  3LDZ A;  3KAE A;  3MV2 B;  2GRN B;  4L2Y A;  4M7C A;  2KZT B;  2EIM E;  2M63 A;  1IKN D;  5EYP F;  4UUC A;  5AQ7 A;  4YND A;  3AS8 A;  4OAV B;  2P2C P;  2A5E A;  5KWD A;  2MYO A;  3TGO A;  3MKQ A;  3S7J A;  1SZ9 A;  1OT8 A;  4ME2 A;  3DSX A;  2BKG A;  2P58 C;  3C3Q A;  2AW6 A;  4JHR A;  2R2L A;  3IKO B;  2ETA A;  3I4R B;  2MRI A;  3Q78 A;  5LCW C;  3BQO A;  2XZT G;  4C0E A;  1YA0 A;  1N0Q A;  2XEV A;  4G11 A;  1U3D A;  3ASF A;  2V8S E;  3FU3 A;  2LAI A;  5BPP A;  3CVN A;  4I9C A;  5AAO A;  3CVP A;  1K1A A;  4K03 A;  4YDE A;  3T5V A;  3Q4A B;  3QNK A;  3RJV A;  3B7R L;  4ILH B;  3UM0 A;  3ZU7 B;  2J09 A;  2WXI A;  4U04 A;  2P9K G;  3ZUV B;  3D9P A;  2ILR A;  4FAD A;  4JEU A;  5LP0 A;  2LO6 A;  1KZO A;  2HR2 A;  4BY6 A;  2J08 A;  3PNL B;  3PZD A;  2Y3A A;  3JUI A;  2PM7 A;  2DZO A;  2OEV A;  5JJ7 A;  2L6J A;  2Y69 E;  4XKB A;  1P5Q A;  3L9T A;  3ZXP A;  5C1D A;  2XGS A;  2X38 A;  4KXK B;  1Z3Y A;  2OCC E;  1SVX A;  2GRP B;  4PS7 A;  3FUJ A;  3L13 A;  4BX9 A;  3IHY A;  1OWN A;  4NRH B;  4EBA G;  2WXQ A;  2X6J A;  4AM9 A;  3UQ3 A;  2KM4 A;  3DEP A;  4DX1 A;  3U64 A;  2CG3 A;  2A5U A;  3DWL G;  4FA6 A;  4U0Z A;  5AJD A;  2WMN A;  1TYQ G;  4N5C A;  5BT1 A;  4ACL A;  1KT0 A;  4JB8 P;  5ENS D;  3G2V A;  5AEN A;  3FTZ A;  1HH8 A;  3ULY A;  5H7P A;  3LXU X;  3ZPJ A;  3EUV A;  4EQF A;  2XQ0 A;  4NIK A;  3QWV A;  2H6G A;  1HX8 A;  3Q47 B;  2PZI A;  1GW6 A;  1OY3 D;  3MA5 A;  2HO1 A;  2LXL A;  3PZ1 A;  3MX3 A;  3OXL A;  1ZB1 A;  2WXK A;  4NQ0 A;  2AVP A;  3ASG A;  3DPD A;  2RFA A;  3U9W A;  4GTR A;  1DC2 A;  2L6B A;  2LSU A;  4FLH A;  4LSZ E;  4UI9 K;  3HXD A;  3D9M A;  4IUL A;  4DJA A;  3ONK A;  2FEZ A;  3ZVV A;  3T9K A;  5B1B E;  3T8K A;  3PRE A;  4TXP A;  1TJC A;  4CT0 A;  4BT8 A;  2HM8 A;  4EEC A;  5BXU A;  4KVM A;  5DBK A;  4CEM A;  2A4Z A;  4TRQ A;  2HE0 A;  3TWQ A;  2WXF A;  4FHK A;  3B13 A;  3LEW A;  5T3R A;  5FQ8 A;  4B0Z A;  3PZ2 A;  1Y8M A;  1SQM A;  1KLX A;  2DZN A;  4N5Q A;  4MBG A;  4X8Q A;  4WWN A;  4AY5 A;  1PAQ A;  2PL2 A;  2V5F A;  5E76 A;  3RRM B;  2YNQ A;  1L5J A;  4C48 B;  3ZYK A;  5B3S E;  4OAU C;  4GPK A;  3O48 A;  3FUL A;  2LUH A;  2QC9 A;  1QNF A;  2V0P A;  2F0Y A;  2VSN A;  3G2S A;  4XEI G;  2ION A;  4KBQ A;  3QK0 A;  3FFL A;  4YVQ C;  1O5M A;  3L17 A;  4L7T A;  1QBQ A;  3FH5 A;  3KS2 A;  5AQB A;  5LX8 A;  3EJN A;  2VGE A;  3EHQ A;  3QKY A;  3UMV A;  4FUL A;  2WXR A;  4EZJ A;  3TG4 A;  5KJK A;  3CHP A;  2KCL A;  3BU8 A;  4LER A;  2MHK A;  3D9N A;  3SD5 A;  2AXZ A;  5LCW J;  3VLF A;  3DXK G;  5CEA A;  2WXO A;  1A17 A;  4LNB A;  2WQ6 A;  3C3O A;  3QC1 A;  1OUV A;  1FVF A;  5ENQ D;  2YIN A;  3UIN C;  2IOL A;  3CR3 A;  3V30 A;  2VGX B;  2F37 A;  2VSX E;  4QFV A;  4JC8 A;  2WXG A;  4N3C A;  1D8D A;  4HOQ A;  1OCO E;  2L9B A;  2WQH A;  4XZ4 A;  4WWP A;  5ENT D;  4G25 A;  3CKC A;  3ASD A;  3ABL E;  4DI4 A;  5CRV A;  3NF1 A;  3HIZ A;  4GZ3 A;  5FWQ A;  3Q75 A;  3ESL A;  4I43 A;  2OND A;  4Q69 A;  2VQ2 A;  1KT1 A;  1WY6 A;  3NOC D;  5C2Y A;  3APC A;  3HHM A;  4HBD A;  3EHM A;  4FHJ A;  3JCK C;  1NP7 A;  4O1O A;  4UWG A;  1FVH A;  2B0O E;  3ZN3 A;  3OXF A;  4ZFH A;  5EDS A;  1EPU A;  1FCH A;  4GZD A;  1H2T C;  2XHE A;  1YCS B;  1H0A A;  4JVS A;  1N11 A;  4G24 A;  1TJF A;  4I1A A;  2H6H A;  4U07 A;  3RAU A;  1FT2 A;  3I5P A;  3OAW A;  3FUM A;  3ESK A;  4AVX A;  3FU0 A;  1JCR A;  5LFA A;  3WG7 E;  2J8S D;  3BG1 B;  3QDN A;  4BTB A;  3B95 A;  2IJG X;  5G2N A;  3DBS A;  4HQD A;  4KYO B;  2PM6 A;  4U0U A;  3F6Q A;  2KCK A;  3X2Q E;  4HRL A;  5B1A E;  4U8H A;  1V54 E;  4FJZ A;  4ILI A;  4HLE A;  3CHQ A;  4IN3 B;  3PZ3 A;  3UIP C;  5T8I A;  4APO A;  3L82 A;  1QYM A;  1NA3 A;  3FP3 A;  3DST A;  1A5E A;  5BV0 A;  1MQS A;  2I1J A;  1OCZ E;  1WAO 1;  1TN8 A;  2GRL A;  2WVI A;  3FTS A;  3CV0 A;  4GPM A;  3PE4 A;  2R17 C;  3FUF A;  4KT6 B;  4BX8 A;  2QYU A;  3DSW A;  5CER B;  3CHO A;  5EN5 D;  4BSX A;  4WNE A;  5KBA A;  5D66 A;  4I6G A;  5FTP A;  4WWO A;  3FTU A;  3G2W A;  3VLD A;  4OVU A;  1MHQ A;  4LNG A;  3ENE A;  3QB2 A;  5HQ8 A;  2CG2 A;  4J8E A;  3ASH A;  1N94 A;  3FTV A;  4AIF A;  4ATZ D;  1E8W A;  2YHC A;  1UJJ A;  2UWJ G;  3SF4 A;  2GGF A;  4DLO A;  3EU5 A;  1IHG A;  2BUG A;  4GA1 A;  4LNU D;  4L23 A;  2Y4U A;  4K5A B;  1BU9 A;  3FH8 A;  2XPZ A;  3L16 A;  5T4Y A;  4U63 A;  4GYY A;  3UT4 A;  4HOR A;  3JQ1 A;  4BEP A;  4PS3 A;  2NSZ A;  1JPL A;  3Q79 A;  3FHE A;  4A55 A;  1ELK A;  3LVQ E;  4MS6 A;  1TNB A;  4AY6 A;  5A23 A;  1JWG A;  1OCR E;  3B7T A;  4H7X A;  2JLB A;  4GMR A;  3VTY A;  2RD0 A;  2AWI A;  4CGW A;  3L22 A;  5J08 A;  1BI7 B;  1OWM A;  1D9S A;  2AXV A;  3FUK A;  2ZIR A;  4HB5 A;  4DLQ A;  3GZ1 A;  3JXI A;  3NZS A;  4GTO A;  1U3C A;  1BD8 A;  4HRM B;  3MYV A;  4B8A A;  2KBX A;  1V55 E;  1SA4 A;  4AEZ C;  1HE8 A;  3CVQ A;  1INZ A;  3GYZ A;  4Y6C A;  3Q5M A;  2F8X K;  3RSE G;  1FT1 A;  1TNU A;  4B94 A;  2VSY A;  4XI0 A;  3JQ0 A;  1Z5S C;  3ZHE A;  2XEN A;  1QQE A;  2XZD G;  3DPY A;  2RFM A;  4ILG A;  3RKV A;  3SFX A;  4RVB A;  4GZC A;  1OWO A;  4R7L A;  3S7D A;  3AAA C;  4XKC A;  5ANR A;  4ANU A;  3DEO A;  4N3A A;  2Y4T A;  1UG3 A;  3Q9N C;  2E2E A;  2R5S A;  3D3M A;  3KSQ A;  5ARF A;  2CHZ A;  3LY8 A;  3TWX A;  2BKK B;  3BEE A;  5HI7 A;  5EIL A;  4DPR A;  3PE3 A;  3D9I A;  4J8D A;  3U3W A;  1HF8 A;  1H2V C;  1G3N B;  3IEG A;  4XI9 A;  2VTB B;  3LJN A;  1OWP A;  4BFR A;  3MZL B;  3CSF A;  3ONL A;  3UX4 A;  4OVV A;  1NZN A;  4K5C A;  2WXJ A;  4TXQ A;  4F53 A;  2XRZ A;  3EU9 A;  3ZFW A;  4CDN A;  2AXU A;  3RK6 A;  4G23 A;  2H6F A;  3MEK A;  4XX5 A;  1KPS B;  3U4T A;  2KZT A;  4ANW A;  1YYH A;  1HS6 A;  2E0I A;  3FDH A;  3J5Q B;  1PY1 A;  3SQV A;  4HS2 A;  2XGM A;  4CCA A;  3FUH A;  4I6J A;  3SO8 A;  1XGW A;  5AJL A;  4G2V A;  3R7R A;  4DK5 A;  1U2V G;  4U95 D;  3LS8 A;  4BT9 A;  2V4L A;  1K1B A;  4DX5 D;  5JJ6 A;  2WMO A;  3UKR G;  3HXF A;  5G55 A;  1S0P A;  1EF1 C;  4GA2 A;  1EYH A;  4RQI A;  3UTM A;  3CVX A;  4UWK A;  5ARG A;  1RZ4 A;  1YMP A;  2VSO E;  3FTW A;  4LUN U;  1TN6 A;  2IO2 C;  2Y1L E;  4I2Z A;  4CDR A;  2WXL A;  2ZGG A;  4RG9 A;  3LJ3 A;  3TG5 A;  3D9J A;  3ASO E;  3NBN B;  3R7Q A;  4J8S A;  4GCN A;  3HRA A;  4DX6 D;  4F1S A;  5KJN A;  1OCC E;  4FLB A;  3PVL A;  5AYW D;  2XS8 A;  3FUD A;  3FUE A;  4JEH A;  1ELR A;  1OWL A;  3E33 A;  5KNG A;  1SA5 A;  3E30 A;  5FQ7 A;  4KVO A;  5HRY A;  4I1M A;  3S7F A;  4DRX E;  4Q94 A;  3BUA A;  4IYP A;  3CHM A;  2F8Y A;  2OVF A; 
#chains in the Genus database with same CATH homology
 3EHM A;  3RRU A;  4FHJ A;  3FU5 A;  3JCK C;  1NP7 A;  1E8Z A;  1UN9 A;  4PUC A;  4UWG A;  3LY7 A;  3EHN A;  5G05 C;  3FTY A;  1FVH A;  2VGY A;  1HG2 A;  3U66 A;  4GA0 A;  4NUR A;  2YQ8 A;  1W3B A;  2WXM A;  2CHX A;  3RRN B;  3ZN3 A;  2FF4 A;  4HFG A;  5FZR A;  3AS4 A;  2OV8 A;  3OXF A;  5EDS A;  4A1S A;  1EPU A;  3R9A B;  4RSY A;  4MRU A;  1FCH A;  2QY7 A;  3FEX A;  5M72 A;  3RIB A;  3GZ2 A;  4GZD A;  4E6H A;  1H2T C;  4C0M A;  4CRW A;  1UJK A;  2PQR A;  2NXP A;  4HOU A;  2X6I A;  2XHE A;  4AOF A;  3QWP A;  2IU1 A;  3FWV A;  4DI3 A;  4HVB A;  3SI5 A;  3P1U A;  1H0A A;  2FI7 A;  3FU6 A;  3I4G A;  3PUK A;  4JVS A;  3CKB A;  3FUI A;  4K0R A;  1E8Y A;  3NQP A;  4G24 A;  1TJF A;  4I1A A;  4U07 A;  4N2Q A;  3I5P A;  3LDZ A;  3UUX A;  4I6E A;  3LYA A;  3KAE A;  3MV2 B;  4WNG A;  3OAW A;  3ULQ A;  3FUM A;  2CFZ A;  2XCC A;  4L2Y A;  3URZ A;  5BUZ A;  3ESK A;  2WM9 A;  2IQC A;  2DCP A;  2KZT B;  3FU0 A;  4AVX A;  2M63 A;  3VLE A;  4J6I A;  2L0I A;  5LFA A;  3BG1 B;  4JL0 A;  3QDN A;  3OTN A;  4GMJ A;  1E96 B;  5BW8 C;  4BTB A;  1VDY A;  3CVY A;  2IJG X;  2FO7 A;  4YND A;  2HYZ A;  5G04 J;  4APF A;  4JHK A;  3AS8 A;  4KMO A;  4WNF A;  3TXM A;  3MJW A;  4A3V A;  5G2N A;  3SHF A;  3DBS A;  2J49 A;  1E90 A;  4KYO B;  4WUY A;  3TGO A;  2PM6 A;  3MKQ A;  4U0U A;  3S7J A;  1SZ9 A;  2KCK A;  4EBA A;  3SZ7 A;  2WXN A;  4ME2 A;  2YHE A;  4U8H A;  2P58 C;  4FJZ A;  2AW6 A;  4ILI A;  4JHR A;  3Q15 A;  3CHQ A;  4IN3 B;  1IQR A;  4I1O B;  5T8I A;  3IKO B;  4ANV A;  4APO A;  3I4R B;  2MRI A;  1H6K A;  1NA3 A;  3FP3 A;  5LCW C;  3MKR A;  4C0E A;  5BV0 A;  1MQS A;  1YA0 A;  4LCT A;  2RG8 A;  2I1J A;  1WAO 1;  3PEV B;  2GRL A;  3AU4 A;  2OVB A;  2XEV A;  2WVI A;  3FTS A;  5EX0 A;  3CV0 A;  2J4D A;  4G11 A;  2I6H A;  2R17 C;  3FUF A;  3PE4 A;  4KT6 B;  4BX8 A;  1U3D A;  3ASF A;  2V8S E;  3CHO A;  2VTB A;  3FU3 A;  4BSX A;  4WNE A;  2LAI A;  2DBA A;  5BPP A;  3CVN A;  4I6G A;  1IQU A;  3EDT B;  5FTP A;  4WWO A;  3FTU A;  5A7D B;  2J4B A;  3G2W A;  3VLD A;  4I9C A;  3CVP A;  4J0U A;  3ML9 A;  3IBE A;  4K03 A;  3T5V A;  3PNT B;  3Q4A B;  3GW4 A;  4PS8 A;  3QNK A;  2JEK A;  4OVU A;  3B7R L;  4ILH B;  1MHQ A;  3KEZ A;  3RJV A;  2ZU6 B;  3ENE A;  2C2L A;  3QB2 A;  2J09 A;  2WXI A;  5HQ8 A;  2CG2 A;  4ATG A;  2I1K A;  4N39 A;  2I2O A;  4U04 A;  4J8E A;  2L0T B;  4FJY A;  3D9P A;  3ASH A;  4UI9 C;  3CLJ A;  3FTV A;  4AIF A;  2ILR A;  4OYS A;  2J9Q A;  3SFZ A;  4JEU A;  4FAD A;  5LP0 A;  2LO6 A;  2HR2 A;  3ZYM A;  1SZA A;  4FC8 A;  3PH0 C;  4FU3 A;  4BY6 A;  4GAA A;  1E8W A;  2J08 A;  3CK9 A;  2YHC A;  4IRU A;  1QZ2 A;  4ANX A;  3PNL B;  2X6K A;  3PZD A;  1UJJ A;  3ZGQ A;  1Z3X A;  1UW4 B;  3L08 A;  1ELW A;  2UWJ G;  4G26 A;  3QOU A;  3SF4 A;  2GGF A;  2Y3A A;  4DLO A;  3JUI A;  1IHG A;  2BUG A;  4UQY A;  2PM7 A;  4GA1 A;  4F7A A;  2WQ7 A;  4L23 A;  2Y4U A;  5JJ7 A;  3FH8 A;  2XPZ A;  4UWL A;  2L6J A;  3L16 A;  5T4Y A;  4XKB A;  1P5Q A;  4U63 A;  5C1D A;  2XGS A;  4GYY A;  2X38 A;  3L54 A;  4KXK B;  3JQ1 A;  4L2L A;  3RO3 A;  3UT4 A;  4HOR A;  1Z3Y A;  3FTX A;  4MLP A;  4PS3 A;  2NSZ A;  2BF0 X;  3MGB A;  5ANL A;  2J07 A;  5J90 A;  1JPL A;  3ZRH A;  4PS7 A;  3T5X A;  3FUJ A;  4EZK A;  3CGH A;  3L13 A;  4BX9 A;  5CHE E;  3IHY A;  1OWN A;  3CEQ A;  3N71 A;  3QAR A;  4NRH B;  3S7B A;  3FHE A;  3JYS A;  4A55 A;  3TAX A;  1ELK A;  4EBA G;  2WXQ A;  4U0S A;  3S2A A;  2X6J A;  4AM9 A;  3LVQ E;  4MS6 A;  4ACK A;  3UQ3 A;  1X5B A;  3OXG A;  4AY6 A;  2KM4 A;  4WAF A;  3HVE A;  3SNX A;  5A23 A;  2R59 A;  4A3T A;  3U64 A;  3Q49 B;  1JWG A;  2A5U A;  2CG3 A;  3B7T A;  2NC9 A;  4NAC A;  4AXH A;  4XE0 A;  4H7X A;  2JLB A;  4TV3 A;  2IFU A;  1HG5 A;  3SGH A;  4U0Z A;  3VTY A;  4E85 A;  2RD0 A;  5AJD A;  4FA6 A;  2WMN A;  3B7S A;  3FUN A;  3LKU A;  2AWI A;  5E75 A;  4EPZ A;  3L22 A;  4CGW A;  4KZC A;  5J08 A;  1OWM A;  2AXV A;  4N5C A;  1E8X A;  3FUK A;  2XPY A;  5BT1 A;  4DLQ A;  3GZ1 A;  3CST A;  4ACL A;  1KT0 A;  1H19 A;  3NZS A;  3TXN A;  3G2V A;  2VJ8 A;  5AEN A;  3FTZ A;  5LOZ A;  4GZ6 A;  3CVU A;  1EDU A;  3ML8 A;  1U3C A;  3SBS A;  1HH8 A;  4BTA A;  4CEM A;  3CHS A;  3QWW A;  2VYI A;  4V3I A;  3LXU X;  3MYV A;  3ZPJ A;  4B8A A;  5D0O D;  4EQF A;  2PQN A;  2XQ0 A;  3HVE B;  4AEZ C;  3QWV A;  1N54 A;  3GZS A;  3PDN A;  5FQ4 A;  1HX8 A;  3Q47 B;  2WB2 A;  2PZI A;  1GW6 A;  3MA5 A;  3FY4 A;  2HO1 A;  4JHJ A;  1HE8 A;  4W9R A;  4AJW A;  3CVQ A;  1INZ A;  3GYZ A;  4UQZ A;  2FBN A;  5G04 C;  3QAQ A;  4Y6C A;  4ABN A;  3Q5M A;  1H2U A;  2WXH A;  3MX3 A;  2X6H A;  4GCO A;  3OXL A;  4B94 A;  2VSY A;  4XI0 A;  5BV1 A;  4CGV A;  1Z6T A;  3ZYL A;  2WXK A;  3JQ0 A;  1IYG A;  3D9O A;  3E4B A;  4I2W A;  4NQ0 A;  5EX3 A;  1HO8 A;  2BTD A;  2AVP A;  3ASG A;  4GYO A;  5FZQ A;  1PC2 A;  2Q7F A;  3ZHE A;  4EZL A;  1QQE A;  3DPD A;  4TUU A;  3MKQ B;  3U9W A;  2OOE A;  4ILG A;  3RKV A;  4RVB A;  4I17 A;  2LSU A;  4GZC A;  5JHA A;  4FLH A;  1OWO A;  4UWH A;  4UI9 K;  2LAH A;  4MKT A;  4F3V A;  4R7L A;  4FP7 A;  3S7D A;  4XKC A;  5ANR A;  3QJZ A;  3D9M A;  4HXI A;  4ANU A;  1Y6I A;  3KD7 A;  4IUL A;  4DJA A;  4N3A A;  2Y4T A;  1UG3 A;  3UT7 A;  3T8M A;  2KAT A;  3G2T A;  2CHW A;  3ONK A;  2E2E A;  3CHR A;  2FEZ A;  2R5S A;  3D3M A;  3ZVV A;  5ARF A;  2CHZ A;  3LY8 A;  3SBT B;  4AV7 A;  3PRE A;  3BEE A;  5HI7 A;  1TJC A;  2WPV A;  3K9I A;  4CT0 A;  4DPR A;  2XPI A;  3PE3 A;  4AP2 A;  4JPS A;  3CVL A;  3D9I A;  4BT8 A;  2HM8 A;  5G05 J;  4EEC A;  3IV0 A;  4J8D A;  2IF4 A;  4KVM A;  3U3W A;  1H2V C;  1HF8 A;  5DBK A;  2C0M A;  2X6F A;  2A4Z A;  1UN8 A;  2GRM A;  3B7U X;  3IEG A;  4JA9 A;  3LPZ A;  4XI9 A;  4TRQ A;  2VTB B;  1JUQ A;  1OWP A;  4BFR A;  3MZL B;  1HFA A;  4GML A;  2WXF A;  3CSF A;  4FHK A;  4HOT A;  3ONL A;  3UX4 A;  3B13 A;  3P2B A;  4OVV A;  5KJM A;  3FH7 A;  3LEW A;  5T3R A;  1NZN A;  3VTX A;  2WXJ A;  4F53 A;  2XRZ A;  3ZFW A;  5FQ8 A;  4CDN A;  2AXU A;  4B0Z A;  4RG6 A;  1Y8M A;  1SQM A;  3RK6 A;  1KLX A;  2X3M A;  2EQX A;  4WWN A;  4G23 A;  4AY5 A;  1PAQ A;  2PL2 A;  2V5F A;  4O6F A;  3RU0 A;  1JWF A;  3MEK A;  4XX5 A;  5E76 A;  3U4T A;  5CCM A;  3RRM B;  2YNQ A;  2KZT A;  2LNI A;  1L5J A;  2MOW A;  4ANW A;  3LVR E;  2E0I A;  1HS6 A;  3ZYK A;  3FDH A;  3EIJ A;  4GPK A;  3UT8 A;  1PY1 A;  3WXX A;  3ZW3 A;  2CFU A;  2XGM A;  3FUL A;  3O48 A;  4HS2 A;  4CCA A;  1TEZ A;  3FUH A;  4I6J A;  1NA0 A;  1QNF A;  2V0P A;  4WND A;  2VSN A;  3G2S A;  4P29 A;  3NZU A;  2ION A;  4JZY A;  4KBQ A;  3QK0 A;  4CT4 A;  2DIW A;  1XGW A;  3FFL A;  5AJL A;  3UPV A;  3PS6 A;  1ZBP A;  4B89 A;  3AU5 A;  4M3O A;  5CMY A;  4G2V A;  3MCX A;  4YVQ C;  3R7R A;  5KCM A;  3L17 A;  4DK5 A;  4GZ5 A;  4L7T A;  2C0L A;  4YVO A;  3CQC B;  3LS8 A;  3LCA A;  3FH5 A;  3KS2 A;  4UQX A;  4BT9 A;  5LX8 A;  2V4L A;  2QFC A;  3APD A;  3EJN A;  4Q96 A;  5ENN A;  4XIF A;  3ZXS A;  5FT9 A;  3QKY A;  3UMV A;  3LY9 A;  1HXI A;  1BPO A;  2UY1 A;  4FUL A;  2WXR A;  4EZJ A;  3TG4 A;  2XRY A;  3CIA A;  5DIZ A;  3CHP A;  2KCL A;  5JJ6 A;  2WMO A;  5KJK A;  3G2U A;  4LER A;  5EKQ D;  4G1T A;  2IOS A;  2MHK A;  3D9N A;  5FJY A;  3SD5 A;  3PEU B;  3BG0 B;  2AXZ A;  2VGX A;  4UWF A;  5G55 A;  1S0P A;  5LCW J;  3D9L A;  5AIJ A;  1EF1 C;  1DNP A;  4GA2 A;  1EYH A;  3VLF A;  2GW1 A;  5CMW A;  3CVX A;  4UWK A;  4D10 C;  4URK A;  5ARG A;  4JA7 A;  2VSO E;  3IHV A;  1B89 A;  5JJT A;  4C9B B;  2WXO A;  4LEU A;  5BNW A;  4CDM A;  1A17 A;  3CQG B;  3FTW A;  4LUN U;  3ZIM A;  2XCB A;  2WQ6 A;  1HU3 A;  3O4Z A;  3QC1 A;  1N52 A;  3CK8 A;  1OUV A;  3PUJ A;  1FVF A;  2UY1 B;  4H7Y A;  4I2Z A;  2WXL A;  4CDR A;  1DVP A;  2YIN A;  4RG9 A;  3D9K A;  2IOL A;  4I9E A;  3CR3 A;  4JXT A;  1HZ4 A;  4BWR A;  3LJ3 A;  1XNF A;  3ZYQ A;  3MV3 B;  2I9C A;  3HDX A;  5FZS A;  3CVV A;  2VGX B;  4QFV A;  2VSX E;  4PH4 B;  3TG5 A;  3D9J A;  4JC8 A;  2WXG A;  4N3C A;  3R7Q A;  4UI9 J;  3ZEF A;  2WXP A;  4J8S A;  2KC7 A;  4GCN A;  3L6A A;  4F1S A;  5KJN A;  4HOQ A;  5CCL A;  3C98 A;  3APF A;  2L9B A;  2WQH A;  4FLB A;  4L1B A;  4XZ4 A;  3PVL A;  1E7V A;  4GYW A;  4WWP A;  4GB9 A;  5KJL A;  5AYW D;  3AS5 A;  4N3B A;  3FUD A;  3CK7 A;  3FUE A;  3I3N A;  2KCV A;  2XGO A;  1ELR A;  4JEH A;  2FUL A;  4G25 A;  3PRZ A;  3FEY A;  4J8F A;  4A1G A;  5JHB A;  3TL5 A;  3CKC A;  4GU5 A;  4PDX A;  1OWL A;  3ASD A;  4DI4 A;  3CVW A;  3ZHE B;  3NF1 A;  3HIZ A;  4GZ3 A;  5FWQ A;  1E7U A;  2LSV A;  3ESL A;  4I43 A;  3EIQ C;  2OND A;  5A6C A;  5D0Q D;  5FQ7 A;  4Q69 A;  3HYM B;  4KZ0 A;  4HLE A;  2VQ2 A;  1ZU2 A;  4LRZ A;  4KVO A;  1KT1 A;  1WM5 A;  4I1M A;  1WY6 A;  3RO2 A;  3S7F A;  4Y6W A;  4Q94 A;  3TJP A;  4IYP A;  5FQ6 A;  4HOS A;  5C2Y A;  3APC A;  1LF8 A;  3HHM A;  3CHM A;  4N2S A;  4B8C B;  4JW1 A;  2OVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...