4KBQA

Structure of the chip-tpr domain in complex with the hsc70 lid-tail domains
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
130
structure length
130
Chain Sequence
PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Bipartite Interaction between Hsp70 and CHIP Regulates Ubiquitination of Chaperoned Client Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein binding
molecule keywords E3 ubiquitin-protein ligase CHIP
total genus 52
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kbqA00
4J8DA 3AS5A 4Y6WA 5CHEE 3R9AB 2L6JA 3RIBA 3U3WA 3CVPA 4G26A 3CK7A 3S7JA 4GPKA 4U07A 4I2WA 4U0ZA 2KCLA 3VTYA 1WAO1 4H7XA 4N39A 3TG4A 2FO7A 3IEGA 4JA9A 3Q5MA 1IYGA 3CK9A 2XCBA 4WNGA 3GYZA 5KJKA 4WNDA 3U4TA 5JJ7A 1A17A 1OUVA 5A6CA 4G1TA 3UQ3A 3CEQA 2FEZA 5FZSA 4WNFA 4JA7A 1WM5A 2ONDA 2Y4TA 3MEKA 5DIZA 3AS4A 2C2LA 4J0UA 1HXIA 4LEUA 4UI9J 5FT9A 2XCCA 2XGSA 4G23A 5G04C 4AY5A 5BT1A 3FFLA 4CDRA 3ASFA 4N2QA 4I2ZA 5EX0A 2HYZA 2UWJG 3QWVA 3K9IA 3RKVA 3KS2A 3LY8A 4HORA 4ME2A 4U04A 4N2SA 3UUXA 3ZHEB 3QWWA 3S7BA 3TAXA 1PC2A 5FJYA 3GW4A 1FCHA 2XGMA 3EDTB 3Q47B 4N3CA 3QKYA 5D0QD 1P5QA 4GCNA 4GZ5A 4W9RA 3RO3A 3S7DA 3SF4A 5CCLA 1XNFA 2Q7FA 2UY1B 3LYAA 4GCOA 2MHKA 4GZ3A 4WUYA 1TJCA 1IHGA 2UY1A 4IN3B 3KD7A 2FI7A 4GA1A 5G05C 4GA2A 2LSUA 2PL2A 3ASHA 3RU0A 1B89A 1QZ2A 5D0OD 3URZA 3WXXA 3CVLA 3LY7A 4XIFA 1W3BA 2C0MA 3QDNA 2C0LA 4HOQA 3Q49B 2LNIA 4I9EA 5FZQA 3JYSA 2KCKA 3VTXA 4AIFA 4APOA 5G04J 3PE4A 4KXKB 1YA0A 4I17A 1HZ4A 3NF1A 3RO2A 4N3BA 5KJLA 2P58C 1NZNA 3ZFWA 2FF4A 4BT8A 5ARFA 2AVPA 4U0SA 4UQZA 4XI0A 4BTAA 4AY6A 3OXFA 3HYMB 4GYOA 1KT0A 2XPIA 3KAEA 4I9CA 5JJTA 4KBQA 4UI9C 2PQNA 4HOUA 2V5FA 1ZU2A 2XGOA 3N71A 5KJNA 2IF4A 3BEEA 3GZ1A 3MV3B 1KT1A 2VYIA 4GYWA 2KATA 1NA0A 2YQ8A 4U0UA 4BTBA 1E96B 3LPZA 2LSVA 4CGVA 5LCWC 2QFCA 4UI9K 2BUGA 4XI9A 3TGOA 2R5SA 2GW1A 4F3VA 4YVQC 2IFUA 2VSYA 5G05J 4Y6CA 2VGYA 4AM9A 4CGWA 4B94A 2YHCA 3MA5A 2KCVA 2XEVA 3ASDA 4YVOA 3CKCA 4JHRA 1QQEA 3MKRA 2WPVA 1HH8A 4G2VA 3ZN3A 5BW8C 3TG5A 3GZ2A 4RG9A 2HO1A 3ULQA 2WQHA 4UQYA 4J8FA 5BNWA 3UPVA 3FWVA 3PDNA 1ELRA 4N3AA 4WNEA 5EKQD 3CKBA 1Y8MA 4G25A 5A7DB 4HOTA 4A1SA 3ASGA 2VSNA 4YNDA 4GA0A 3ZGQA 4GYYA 3MV2B 4G24A 3CVNA 3ZHEA 5KJMA 4JL0A 4J8EA 5FTPA 4GZ6A 2FBNA 2HR2A 5AYWD 3CV0A 3QWPA 4ABNA 5LCWJ 3SZ7A 5CCMA 1KLXA 4O6FA 2Y4UA 5ARGA 4RG6A 5DBKA 3ZPJA 3LY9A 4EQFA 2E2EA 3Q15A 5C1DA 3CK8A 3CVQA 2KC7A 4HOSA 1ZBPA 1ELWA 4KYOB 4BWRA 5JJ6A 2JLBA 3ESKA 4NRHB 3Q4AB 3LKUA 4NQ0A 5EX3A 4I1AA 3S7FA 3AS8A 2PQRA 2VGXA 5HQ8A 1NA3A 3E4BA 5HI7A 5M72A 4BT9A 3OXGA 2DBAA 3FP3A 3QOUA 2VGXB 4UQXA 2I6HA 2OOEA 3O48A 4H7YA 2PZIA 3LCAA 2NC9A 3PE3A 4N5CA 3RJVA 5FZRA 2VQ2A 2J9QA 3OXLA
chains in the Genus database with same CATH superfamily
3L08A 4Q94A 2JABA 2R05A 4GTVA 1V54E 4GZDA 4JA9A 4WAFA 5KJKA 1D8EA 2P2CP 3DXMG 5JA4D 2FULA 4JXTA 4PH4B 4AV7A 5AIJA 3FFLA 1X81A 3FUIA 1QBQA 4DUIA 3CSTA 3UUXA 2GRNB 5D0QD 4XKBA 4GA1A 1O1RA 3Q78A 1QNFA 1JCSA 2C0MA 4AP2A 3L54A 2KCKA 4XE0A 4EZLA 3B95A 1NZNA 3DPYA 2FF4A 3SNXA 5CECB 2DZOA 3FU5A 4I9CA 2CFZA 2V5FA 2XGOA 3AJIA 1SA4A 3MV3B 4KZCA 3HVEB 2YHCA 2WPVA 3CHOA 4R7LA 3UM1A 2NYJA 3EIQC 4MLPA 5BNWA 2X6FA 3Q7FA 2H6GA 3JUEA 2V0PA 3QC1A 3FTUA 4K5CA 4KVOA 5AJLA 5C1DA 5C2YA 3C3QA 3V2OA 3IKOB 3E4BA 1MJ0A 3NBNB 3JQ1A 2NC9A 2XQ0A 5JMND 2WXPA 4JD2G 3ZKJA 2CG3A 3IEGA 3KSQA 2V4LA 5A6CA 2LO6A 4UI9J 3W9GA 1HX8A 1OWLA 4N2SA 2H6FA 1PY1A 3AG2E 4B8CB 4J6IA 5ANRA 4ILGA 1ELKA 2UY1B 4UUCA 5JHAA 1IHGA 4TV3A 2LSUA 4IRUA 3RK6A 2XPZA 3V2XA 1OWOA 4C9BB 5BV0A 2R59A 4AEZC 5FZQA 1YA0A 3ONLA 5KBAA 2HM8A 5T4YA 4PS7A 1EPUA 3MGBA 1AWCB 2MYOA 5HS0A 1E7UA 4RG9A 3PDNA 5ENSD 1WY6A 3FTXA 3Q79A 4HOTA 4GA0A 4BERA 1EDUA 3CVVA 3NQPA 3MKQB 1H2UA 1BLXB 2L6BA 3LY9A 2KC7A 3IV0A 4J8SA 1RZ4A 1H6PA 4I1AA 2PQRA 1QYMA 1DVPA 2VGXA 3UI2A 3PEVB 4JW1A 4H7YA 3EHMA 3PNTB 4PS8A 4GTSA 2BKGA 3ZYLA 3T9KA 4GMJA 4AVXA 2WQ7A 2DYSE 3UTMA 4WNGA 3GYZA 2J49A 1S63A 3G2SA 5G04J 2C2LA 3FTWA 4UWHA 4FU3A 1JCQA 2WM9A 3RKVA 3RSEG 3EHNA 4ILIA 2XGMA 4N3CA 3CHQA 4GZ3A 5AJDA 1UOHA 4IN3B 2FI7A 3U9WA 1N0RA 3D3MA 4GPMA 1QZ2A 4HRLA 4GMLA 4HOQA 4L2YA 3VTXA 1BPOA 3S2AA 4JEUA 1HZ4A 2P58C 2AVPA 2JEKA 3FULA 4CZ2D 4GYOA 3J5PA 4DLQA 1TJFA 3NOGD 3GZ1A 4FLBA 4Q96A 4BY6A 4YVQC 2VGYA 4GZCA 3B7SA 2YINA 1E90A 3CVUA 5B3SE 5KNGA 4EPZA 5KJMA 4EBAG 4FULA 4GTMA 5AYWD 3QWPA 3W9FA 3D9HA 3NOCD 3FUEA 2I9CA 3D9LA 3CQGB 4AXHA 5IY5E 4LRZA 5G2NA 5ENOD 3HXEA 2KZTB 5FINA 2OEVA 3LVQE 5FZRA 3ZRHA 2AXUA 3T8KA 1TNYA 3DXKG 4U07A 4U0ZA 5KCMA 3FH7A 4A63B 3TWVA 2GRRB 3ZXPA 1XGWA 3ULQA 3AS4A 4AY5A 4G23A 5G04C 5EX0A 3QWVA 3SFYA 3L82A 2V5QC 3EDTB 3QKYA 4GCNA 4WUYA 4D10C 5E75A 3WG7E 2LAIA 4WWPA 1SW6A 4FHJA 4I17A 4WWNA 1WG0A 3OXFA 2IF4A 2XEEA 4GYWA 3CQCB 4U63A 3VLEA 4JC8A 1X5BA 2XENA 1MZCA 3PVLA 4HB5A 2KCVA 2XEVA 2R03A 4CT0A 3TG5A 2ZIRA 2IY0C 1JUQA 2LXMA 5A7DB 5AN8A 4G24A 2IOLA 5LCWJ 2HR2A 2Y4UA 4YDWA 1Q2ZA 4U96D 5EIBE 4LNBA 2CFUA 5D2MC 1NP7A 3D9NA 4BT9A 3Q7AA 5KNHD 4G8KA 4MKTA 2X6HA 3MZLB 3R9AB 1NL4A 5CEAA 3U3WA 3CVPA 3CHMA 3VTYA 4U7EB 3T5XA 2ILRA 1LD7A 2MRIA 2IJGX 3CEQA 3B7BA 1K1AA 3UKUG 2GRPB 5BT1A 2WB2A 2HYZA 1OT8A 4HORA 1IHBA 3FU6A 2VTBA 2I1KA 3NB2A 1TJCA 4B89A 3RU0A 3WXXA 3ZXSA 2FO1E 4PDXA 4LNUD 3QARA 4KXKB 1N0QA 4AY6A 2IU1A 2PQNA 5FQ4A 5KJNA 1ZU2A 3C3RA 5LCWC 3LPZA 3VLDA 3PUKA 4FHKA 5BXUA 2DZNA 3ZN3A 4M7CA 3UIOC 2RG8A 4GB9A 5FTPA 5J90A 3FU3A 1RW2A 2EIME 5JJ6A 3Q4AB 4NQ0A 2BF0X 5M72A 2DBAA 2VQ2A 3ASOE 1Z6TA 1LF8A 3FUKA 3TWWA 2NSZA 1KPSB 3C3OA 3LVRE 1E8XA 1OY3D 4IULA 4AOFA 4G1TA 4RVBA 2R17C 4JPSA 3LY8A 3IHVA 3GW4A 3ZUVB 4ACKA 2VTBB 2IOSA 3U66A 3UIPC 4GTQA 1UW4B 4DK5A 2VJ8A 1TNUA 5D0OD 3R7RA 4BX9A 3OTNA 4BEPA 1SZAA 1OCRE 2P9IG 2QY7A 2XZDG 1K1BA 5B1AE 2PM6A 1HE8A 4O1PA 3TGOA 2LSVA 4B8AA 4UI9K 3BUAA 3EHRA 3LJ3A 4AM9A 4NURA 1VDYA 3BG1B 5BW8C 4DI4A 4KZ0A 2P9NG 2VSNA 4TXQA 1YYHA 3CVNA 4HFGA 5CERB 3CGHA 5CCMA 3KEAA 3ZPJA 1H6OA 4E6HA 3CHRA 1IQUA 3LKUA 4GAAA 4L1BA 3OXGA 2GGFA 3FP3A 2IEJA 3ZW3A 2PZIA 3G2VA 1EYHA 2X38A 3S7JA 3QAQA 2X6JA 2WVIA 3MX3A 4A1GA 1H2TC 2FO7A 3KEZA 3CK9A 1HO8A 1A17A 1TNZA 5FZSA 4JA7A 4L7TA 5JHBA 3FDHA 4CCAA 3K9IA 4HRNA 1Y6IA 1SVXA 4JEHA 5FIOA 3PZ3A 3T8MA 3SGHA 3TAXA 1AP7A 4JZYA 3LYAA 2L9BA 2HE0A 2P9SG 1U3DA 3ASHA 1Z3YA 2Y3AA 4DJAA 5CMYA 4N3BA 2X3MA 4U0SA 4UQZA 3DSWA 1U3CA 1KT0A 3KAEA 4ATZD 5JJTA 5ENRD 3FTYA 3ASNE 3TWSA 4U0UA 3HG0D 1NA0A 1E96B 3ZYKA 2B6CA 3HXBA 3FUFA 4GU5A 1LD8A 2AXVA 2HO1A 3UT4A 3RAUA 3DSSA 1N4RA 2E0IA 1TNOA 3DSXA 3MV2B 5EYPF 1KLXA 3V30A 5AQ9A 1ZBPA 2WMNA 2F8XK 2F8YA 1HG5A 4F7AA 4FADA 3I4GA 5FQ8A 3PZ1A 3PEUB 3G2TA 2WXLA 3HXCA 1E8ZA 4HLLA 4HRMB 1A5EA 3L6AA 3CVYA 2XCBA 3PH0C 4URKA 4V3IA 1Z5SC 1HF8A 4UWKA 4CDRA 3ASFA 4PUCA 4LERA 2UWJG 4JHKA 1S0PA 4A3TA 1EF1C 1SA5A 2ZGDA 5FQ6A 2XS8A 4X8QA 3G2UA 3KD7A 1B89A 3SI5A 5ENNA 3JYSA 2BEDA 1H0AA 2R2LA 4UWLA 1DC2A 1OCCE 4BTAA 3HYMB 3SHFA 2RD0A 4HOUA 3JQ0A 1PAQA 4XI9A 4DX2A 4Y6CA 2GRLA 3MA5A 5CRUA 4G2VA 4FLHA 4OVVA 5T3RA 3ABLE 3AU5A 4GTPA 4FP7A 4EQFA 3Q15A 3EIJA 4NRHB 3I3NA 3G2WA 2P9KG 2ZGGA 2J07A 2I6HA 2OOEA 4K5BA 3PE3A 4QFVA 2IO2C 3UMVA 2J4BA 3AS5A 4J8DA 2MOWA 5ANLA 4HVBA 4UWFA 1H2VC 4DLOA 4NIKA 3E33A 2LUHA 4I6EA 2OCCE 4F1SA 4HXIA 4XKCA 3ZYQA 2H6IA 5ENQD 5DIZA 4LEUA 2XCCA 1E8WA 4I2ZA 4WWOA 2ZXWE 3Q75A 3S7DA 1YCSB 3UX4A 4CT4A 4FJZA 5ENPD 3D9MA 2PL2A 3FH8A 4XEIG 1W3BA 2C0LA 4APOA 3UT8A 3HHMA 3D9IA 4TUUA 4C0MA 1MX6A 2L0IA 4HI8A 4L23A 3AG1E 3MCXA 3IHYA 2VYIA 4LUNU 2R5SA 1UJKA 5FQ7A 1S64A 2V8SE 3CVXA 2R02A 3PZ2A 3FWVA 3L22A 3C98A 2DIWA 1IKND 3CV0A 2DWZA 2KBXA 5ARGA 2ZISA 3TJPA 1Z3XA 3CK8A 4KYOB 3BG0B 3QB2A 4F53A 3FY4A 3QOUA 1V55E 3PRZA 2LAHA 2OEWA 4G26A 4I2WA 4IYPA 1WAO1 2AW6A 3TG4A 3RRNB 1IYGA 2XS1A 5E76A 4RLYA 4DRXE 2EILE 1OXJA 1FPPA 2Y4TA 5A23A 1SQMA 1OWNA 4U8YD 3ULEG 3AAAC 2WXKA 3ABME 3UM3A 4BSXA 1WDYA 5FJYA 2V4HC 4BFRA 1FCHA 3NZUA 2AJAA 4W9RA 4GMRA 3PS6A 3D9OA 4EHMA 3ML8A 4ANWA 2UY1A 4L2LA 2YNQA 3ML9A 2CHWA 2P9UG 5B1BE 5EN5D 2WXGA 3GZSA 3QDNA 2LNIA 3PE4A 1E8YA 4I1MA 2EIJE 3LEWA 3QK0A 4KVMA 4BSZB 3ZVVA 3B7RL 3R7QA 5CBNA 2QFCA 2GW1A 4RQIA 2VSYA 2H6HA 2WXOA 4YVOA 3CKCA 4MS6A 4A55A 1HH8A 2KM4A 1HU3A 3AG4E 4LSZE 3UPVA 3Q73A 1ELRA 4WNEA 5EKQD 3CKBA 3C72A 3ZHEA 4I43A 1UG3A 1JCRA 1JWGA 4FC8A 4O6FA 1ELWA 2JLBA 3FUJA 1DCEA 2CG2A 3AS8A 3IBEA 3LXUX 4EBAA 4ANXA 3CVWA 5ITZF 3L16A 2GRQB 1HG2A 3ZGQA 3V31A 2L6JA 2GRMA 4DPRA 4UWGA 4GPKA 3ULYA 4C48B 4MRUA 2F37A 1HXIA 5FT9A 1N9AA 4HBDA 3TWQA 4OAUC 1BD8A 2EIKE 4ME2A 3R9MA 2PNNA 3PNLB 3Q47B 3RO3A 2Q7FA 1UN9A 3B7TA 3E32A 3C5RA 2WQ6A 1TEZA 4HI9A 3SD5A 3CVLA 4XIFA 4AJWA 4AIFA 2QC9A 1BI7B 3BU8A 4HLEA 1L5JA 3VLFA 4BT8A 3ESLA 4XI0A 2EQXA 2XPIA 3FUMA 4OYSA 4NACA 4GTTA 2WXHA 3UM0A 3EJNA 2BUGA 3EHQA 3V79K 4FA6A 2IFUA 3FEYA 2YHEA 3SBSA 1GW6A 1QQEA 1LTXA 4K03A 2A4ZA 2XEHA 2IQCA 2I1JA 3SQVA 4BETA 3TXNA 2FBNA 4ABNA 5D66A 3SZ7A 5DBKA 3MKQA 4ACLA 3LS8A 3HXFA 3FEXA 5EX3A 4K5AB 2WXJA 1BI8B 4N5CA 4GZ5A 4Y6WA 3PZDA 4O1OA 3JUIA 3ZU7B 3HRAA 2WXMA 3KSLA 1MYOA 1N52A 2DCPA 4L9PA 4WNFA 4MBGA 3Q9UC 2XGSA 4N2QA 3PUJA 2IONA 4QQIA 5HRYA 3URZA 2PM7A 2ETCA 1YMPA 1P5QA 3DSUA 2F0YA 3L13A 3TWXA 3E37A 1N95A 2A5UA 5CEDB 1BU9A 2OVFA 3B13A 1MX4A 4UI9C 3DRAA 1TNBA 2KATA 5HKPA 3EU9A 3I4RB 1MHQA 3FU0A 3UINC 3TWRA 4KMOA 4CGWA 2QYJA 1O1SA 1HFAA 2OV8A 4LCTA 4HQDA 1N11A 4UQYA 1K8KG 4FJYA 4GYYA 3AG3E 3J5QB 1OCZE 1D8DA 1FT1A 3QNKA 4BWRA 3ZYMA 3NAWA 4ATGA 3EU5A 3FUDA 5CRVA 3S7FA 5HQ8A 5HI7A 1NA3A 1TYQG 4CEMA 1N4PA 2M63A 4GTRA 1DNPA 3DPDA 4DX7D 3OXLA 1JWFA 3RIBA 4JVSA 3CK7A 3FUNA 3CLJA 1DCQA 1MQSA 4N39A 4OAVB 3Q5MA 1WM5A 2B0OE 3L17A 4YDYA 3MEKA 4J0UA 1OWPA 2VGEA 3SY2A 4CDNA 5AARA 4P29A 4U04A 2XHEA 4PS3A 4C0EA 4K0RA 3SFZA 2LXLA 5G05C 1G3NB 4GA2A 3FUHA 2RKKA 3UXGA 3LDZA 3U64A 3AU4A 3NF1A 3RO2A 2WXRA 3ZFWA 4XZ4A 4TUMA 2XRYA 4KBQA 3DEPA 4APFA 4EZJA 1O5MA 2YQ8A 4DI3A 4BESA 4F3VA 2I2OA 5G05J 3MYVA 4JHRA 3DWLG 4M3OA 2WQHA 3MJWA 4YDEA 2P9PG 2KXPC 4RG6A 4GTOA 5CMWA 1IXVA 4G11A 3IXEA 2CHXA 3UT7A 2AXZA 2Y0BG 5FWQA 4UQXA 4DX1A 2WXIA 1NFIE 1UN8A 3LCAA 4EECA 1TN8A 4B0ZA 5LFAA 4LG6A 3CHSA 3UM2A 3TL5A 1MX2A 5CBOA 3U4TA 5JJ7A 3D9PA 2EINE 3SF4A 4CDMA 4TXRA 4U8VD 4Z68A 2J8SD 2AWIA 2NXPA 3QWWA 3S7BA 5J08A 2J08A 5CCLA 5EILA 3SO8A 2DVWA 2VSXE 4GCOA 1N54A 2XPYA 3FTSA 5AAOA 3P1UA 4HNAD 2J09A 5KJLA 3DSTA 2A5EA 5LOZA 3B7UX 5BUZA 4A3VA 4BTBA 4I6JA 1OCOE 4B93B 2QZAA 3CHPA 4B94A 3ASDA 4I6GA 1UJJA 1TN7A 3GZ2A 3BQOA 4ILHB 4KT6B 2VSOE 3QJZA 3E30A 3TWUA 4JHJA 3CSFA 4A1SA 4J8EA 2WXQA 4HS2A 3ZIMA 1H6KA 3RRUA 4BX8A 4DX6D 3HIZA 2ZU6B 3ABKE 4CRWA 3X2QE 1JPLA 1N4QA 3O48A 3RJVA 4YDOA 5KWDA 3L9TA 4LNGA 3SBTB 3JXIA 1SZ9A 5LP0A 4H7XA 2X6KA 4WNDA 3UQ3A 4DX5D 4F1PA 2ONDA 5EIDA 3DBSA 3RRMB 1E7VA 1TR4A 5EDSA 3ZHEB 5G55A 3DEOA 1PC2A 1U2VG 3CR3A 1XNFA 2MHKA 3O4ZA 4U8HA 4OVUA 5H7PA 1KZOA 4J7WA 3Q49B 4I9EA 2BTDA 2J4DA 3DSVA 3FH5A 1IQRA 3HXDA 3N71A 3T5VA 2RFAA 4J8YA 2ETBA 3FTVA 4TRQA 3HVEA 3ZNGA 3MKRA 3NZSA 4TXPA 1FVHA 4J8FA 1H19A 4I1OB 1TN6A 1Y8MA 3D9KA 3JXJA 3Q9NC 5AQ7A 4XX5A 4JL0A 4GZ6A 2X6IA 3UKRG 3ZEFA 5ENTD 2E2EA 3F6QA 3PREA 3CVQA 3HDXA 1HS6A 1D9SA 3D9JA 3TWTA 5T8IA 5BXOA 5BPPA 2VGXB 2J9QA 4U95D 5CHEE 2DYRE 3FTZA 1FVFA 2OVBA 2KCLA 3JCKC 5BV1A 2QYUA 3I5PA 4JB8P 4O60A 4F6RD 3PZ4A 1OUVA 2FEZA 3EUVA 2RFMA 4HOSA 2Y1LE 5AQBA 1O1TA 2WXNA 2WMOA 3KS2A 1S70B 4N5QA 1INZA 3CIAA 3SFXA 4G8LA 5AENA 3APCA 4EZKA 3LY7A 4Q69A 3ONKA 2Y69E 3OAWA 2WXFA 4ANUA 2KZTA 2P9LG 2ETAA 3TXMA 3APFA 5ARFA 4ZFHA 1NI1A 2L0TB 1OWMA 1KZPA 3BEEA 4E85A 1KT1A 4CYMD 1FT2A 1K3ZD 4CGVA 3FHEA 2IO3C 5EYLA 5LX8A 4ZHBA 3ENEA 4N3AA 2CHZA 1N4SA 1ZB1A 4G25A 3ASGA 3E34A 4YNDA 2XZTG 3LJNA 5AQAA 2GROB 2XRZA 3P2BA 3ISMC 3ESKA 3APDA 1N94A 2BKKB 4RSYA 4ANVA
chains in the Genus database with same CATH topology
2J4BA 3AS5A 4J8DA 2X6HA 2MOWA 3L08A 3MZLB 5ANLA 3R9AB 1JWFA 3RIBA 4HVBA 4UWFA 4JVSA 4Q94A 3U3WA 1H2VC 3CVPA 4DLOA 3CHMA 3CK7A 3FUNA 3CLJA 3VTYA 3T5XA 2ILRA 1MQSA 2MRIA 4I6EA 4GZDA 4N39A 4JA9A 4F1SA 4WAFA 3Q5MA 5KJKA 4HXIA 2IJGX 4XKCA 3ZYQA 3CEQA 1WM5A 3L17A 2FULA 4JXTA 4PH4B 4AV7A 3MEKA 5DIZA 5AIJA 4J0UA 4LEUA 1OWPA 2XCCA 1E8WA 5BT1A 3FFLA 4I2ZA 2WB2A 2HYZA 4CDNA 3UMVA 3FUIA 4WWOA 4HORA 4P29A 4U04A 2XHEA 3CSTA 3UUXA 3FU6A 4PS3A 4C0EA 2VTBA 5D0QD 3S7DA 2I1KA 3UX4A 4K0RA 3SFZA 4CT4A 1TJCA 4FJZA 5G05C 4XKBA 4B89A 4GA1A 4GA2A 3D9MA 2PL2A 3FUHA 3FH8A 3RU0A 1QNFA 3WXXA 3ZXSA 3LDZA 1W3BA 2C0MA 2C0LA 4PDXA 4APOA 4AP2A 3L54A 2KCKA 4XE0A 3U64A 3UT8A 4EZLA 3QARA 3AU4A 4KXKB 3HHMA 3D9IA 4TUUA 3NF1A 3RO2A 1NZNA 2WXRA 3ZFWA 4C0MA 2FF4A 4XZ4A 3SNXA 2XRYA 2L0IA 4AY6A 2IU1A 3FU5A 4I9CA 4KBQA 4L23A 2CFZA 2PQNA 5FQ4A 2V5FA 1ZU2A 2XGOA 5KJNA 3MCXA 4APFA 4EZJA 3IHYA 3MV3B 2VYIA 2YQ8A 4LUNU 5LCWC 3LPZA 3VLDA 3PUKA 4FHKA 4KZCA 4DI3A 2R5SA 4F3VA 2I2OA 5G05J 1UJKA 3HVEB 2YHCA 3MYVA 4JHRA 3ZN3A 2WPVA 5FQ7A 3CHOA 4R7LA 2V8SE 3CVXA 4M3OA 2WQHA 3EIQC 4MLPA 5BNWA 2X6FA 3FWVA 3MJWA 2RG8A 3L22A 3C98A 2DIWA 2V0PA 4GB9A 3QC1A 3FTUA 5FTPA 3CV0A 4KVOA 5ARGA 3FU3A 5J90A 5AJLA 1Z3XA 4RG6A 3TJPA 5CMWA 5C1DA 3CK8A 4KYOB 3BG0B 5C2YA 5JJ6A 4G11A 2CHXA 3UT7A 2AXZA 3Q4AB 4NQ0A 5FWQA 3QB2A 2BF0X 3IKOB 3E4BA 5M72A 4F53A 3FY4A 2DBAA 3JQ1A 3QOUA 4UQXA 2WXIA 1UN8A 2NC9A 3LCAA 2VQ2A 2XQ0A 4EECA 4B0ZA 3PRZA 1Z6TA 1LF8A 5LFAA 2LAHA 4G26A 3CHSA 3FUKA 4I2WA 3TL5A 2WXPA 4IYPA 2NSZA 1WAO1 2CG3A 2AW6A 3LVRE 1E8XA 3IEGA 3RRNB 3TG4A 1IYGA 5E76A 5JJ7A 4IULA 3U4TA 4AOFA 2V4LA 5A6CA 4G1TA 3D9PA 4RVBA 2R17C 2LO6A 2Y4TA 4JPSA 3SF4A 4UI9J 4CDMA 5A23A 1SQMA 1OWNA 1HX8A 3LY8A 1OWLA 2AWIA 2WXKA 3IHVA 2NXPA 4N2SA 3QWWA 1PY1A 3S7BA 4BSXA 4B8CB 5J08A 4J6IA 5FJYA 5ANRA 2J08A 3GW4A 4ILGA 1FCHA 4BFRA 3NZUA 5CCLA 1ELKA 4W9RA 4ACKA 2VTBB 2VSXE 2UY1B 2IOSA 3D9OA 3PS6A 4GCOA 1N54A 3ML8A 5JHAA 4ANWA 3U66A 1IHGA 2UY1A 2XPYA 3FTSA 4TV3A 4L2LA 1UW4B 2LSUA 2YNQA 2XPZA 3ML9A 2VJ8A 3P1UA 4IRUA 1OWOA 5D0OD 2CHWA 3RK6A 4C9BB 5BV0A 2J09A 3R7RA 2WXGA 3GZSA 3QDNA 2R59A 2LNIA 4AEZC 5FZQA 3PE4A 4BX9A 1YA0A 3ONLA 3OTNA 5KJLA 1SZAA 1E8YA 2HM8A 2QY7A 4I1MA 4KVMA 3LEWA 3QK0A 5LOZA 5T4YA 3ZVVA 3B7UX 5BUZA 3B7RL 4PS7A 1EPUA 3R7QA 2PM6A 4A3VA 3MGBA 4BTBA 4I6JA 1HE8A 3TGOA 2LSVA 4B8AA 2QFCA 4UI9K 3LJ3A 2GW1A 4AM9A 2VSYA 4NURA 3CHPA 2WXOA 4B94A 3ASDA 4I6GA 1UJJA 1VDYA 3BG1B 3CKCA 4MS6A 4YVOA 1HH8A 4A55A 5BW8C 2KM4A 1E7UA 1HU3A 3GZ2A 4RG9A 4ILHB 4DI4A 4KT6B 2VSOE 3QJZA 4JHJA 3UPVA 4KZ0A 3PDNA 1ELRA 1WY6A 4WNEA 5EKQD 3CSFA 3CKBA 3FTXA 4HOTA 4A1SA 2VSNA 4GA0A 3ZHEA 1EDUA 3CVNA 4HFGA 4I43A 1UG3A 4J8EA 2WXQA 4HS2A 3NQPA 3CVVA 3MKQB 3ZIMA 1H2UA 3CGHA 5CCMA 1JWGA 1H6KA 4FC8A 4O6FA 3RRUA 3ZPJA 3LY9A 2KC7A 3IV0A 1ELWA 4BX8A 4J8SA 2JLBA 3FUJA 4E6HA 3CHRA 1IQUA 2ZU6B 3HIZA 3LKUA 2CG2A 4I1AA 3AS8A 2PQRA 3IBEA 3LXUX 4GAAA 4EBAA 1DVPA 2VGXA 4L1BA 4ANXA 4CRWA 3CVWA 1JPLA 3OXGA 2GGFA 3FP3A 3PEVB 3L16A 4JW1A 4H7YA 3O48A 3ZW3A 2PZIA 3EHMA 3PNTB 4PS8A 3RJVA 1HG2A 3G2VA 1EYHA 3ZGQA 2L6JA 2X38A 2GRMA 4DPRA 4UWGA 3SBTB 3S7JA 3QAQA 3ZYLA 1SZ9A 4GPKA 2X6JA 4GMJA 4AVXA 5LP0A 2WVIA 3MX3A 4A1GA 4H7XA 1H2TC 2WQ7A 2FO7A 2X6KA 3KEZA 3CK9A 4WNGA 3GYZA 2J49A 4WNDA 1HO8A 4MRUA 1A17A 3UQ3A 5FZSA 4JA7A 2ONDA 3G2SA 5G04J 2C2LA 3FTWA 1HXIA 3DBSA 4L7TA 5FT9A 5JHBA 4UWHA 3FDHA 3RRMB 4FU3A 4CCAA 2WM9A 3K9IA 3RKVA 1E7VA 1Y6IA 4ME2A 5EDSA 3ZHEB 3EHNA 4JEHA 5G55A 3PNLB 1PC2A 3T8MA 4ILIA 2XGMA 3SGHA 3Q47B 4N3CA 3TAXA 3CR3A 3RO3A 1XNFA 2Q7FA 3CHQA 3LYAA 4GZ3A 2MHKA 4JZYA 1UN9A 3O4ZA 3B7TA 5AJDA 4IN3B 2L9BA 2FI7A 3U9WA 1U3DA 3D3MA 4U8HA 2WQ6A 1TEZA 3ASHA 4OVUA 1QZ2A 1Z3YA 3SD5A 4GMLA 3CVLA 4XIFA 2Y3AA 4AJWA 4HOQA 4DJAA 4L2YA 3Q49B 4I9EA 5CMYA 3VTXA 4AIFA 2BTDA 2J4DA 1BPOA 3FH5A 3S2AA 4JEUA 1HZ4A 4HLEA 4N3BA 2P58C 2X3MA 1L5JA 3VLFA 4BT8A 2AVPA 1IQRA 3ESLA 4U0SA 4UQZA 4XI0A 2JEKA 3FULA 1U3CA 4GYOA 1KT0A 2EQXA 2XPIA 3FUMA 3KAEA 4OYSA 4DLQA 5JJTA 4NACA 3N71A 3FTYA 1TJFA 3T5VA 3GZ1A 2WXHA 4U0UA 1NA0A 4FLBA 1E96B 4Q96A 3EJNA 2BUGA 4BY6A 4FA6A 3ZYKA 4YVQC 2IFUA 2VGYA 3FEYA 2YHEA 3SBSA 3FUFA 3FTVA 4GU5A 4TRQA 1GW6A 3HVEA 1QQEA 3MKRA 3NZSA 4GZCA 4K03A 3B7SA 2AXVA 2HO1A 1FVHA 2YINA 4J8FA 1H19A 4I1OB 1E90A 2A4ZA 3CVUA 3UT4A 4EPZA 1Y8MA 2IQCA 3D9KA 2E0IA 2I1JA 5KJMA 3MV2B 4EBAG 4XX5A 4JL0A 4FULA 4GZ6A 2FBNA 5AYWD 3TXNA 2X6IA 3QWPA 4ABNA 3SZ7A 3ZEFA 1KLXA 5DBKA 3MKQA 2E2EA 3PREA 4ACLA 3CVQA 3HDXA 1ZBPA 1HS6A 3LS8A 3FEXA 3FUEA 3D9JA 2WMNA 2I9CA 3D9LA 5EX3A 3CQGB 4AXHA 5T8IA 1HG5A 4FADA 4LRZA 2WXJA 4F7AA 3I4GA 5FQ8A 5G2NA 5BPPA 2VGXB 2KZTB 3LVQE 4N5CA 5FZRA 2J9QA 3PEUB 2AXUA 4GZ5A 4Y6WA 3G2TA 5CHEE 3ZRHA 3PZDA 3FTZA 1FVFA 3JUIA 2OVBA 2WXLA 4U07A 4U0ZA 5KCMA 2KCLA 2WXMA 3JCKC 5BV1A 1E8ZA 3FH7A 3L6AA 3I5PA 3CVYA 1N52A 2XCBA 2DCPA 3PH0C 1OUVA 4URKA 2FEZA 4V3IA 4WNFA 1XGWA 1HF8A 4UWKA 3AS4A 3ULQA 4HOSA 4AY5A 2XGSA 4G23A 5G04C 4N2QA 4CDRA 2WXNA 3ASFA 5EX0A 3PUJA 2WMOA 4PUCA 4LERA 2UWJG 3QWVA 3KS2A 2IONA 4JHKA 1S0PA 1INZA 4A3TA 3CIAA 3URZA 2PM7A 3EDTB 1EF1C 3QKYA 1P5QA 4GCNA 5AENA 5FQ6A 4WUYA 3L13A 3G2UA 3KD7A 3APCA 4EZKA 4D10C 1B89A 5E75A 3SI5A 5ENNA 3LY7A 4Q69A 2LAIA 2A5UA 3JYSA 4FHJA 4WWPA 3ONKA 3OAWA 4I17A 2WXFA 4WWNA 1H0AA 2OVFA 3B13A 4UWLA 4ANUA 2KZTA 3TXMA 3APFA 5ARFA 4BTAA 3OXFA 3HYMB 4UI9C 2L0TB 3SHFA 2RD0A 1OWMA 4HOUA 2IF4A 3BEEA 4E85A 1KT1A 4GYWA 2KATA 3CQCB 3JQ0A 4U63A 3FHEA 4CGVA 1PAQA 3I4RB 4XI9A 1MHQA 3VLEA 3FU0A 4JC8A 4DK5A 1X5BA 4Y6CA 2GRLA 3PVLA 4KMOA 4CGWA 3MA5A 5LX8A 2KCVA 2XEVA 4G2VA 4FLHA 1HFAA 2OV8A 4OVVA 3TG5A 4CT0A 4LCTA 1JUQA 3ENEA 5T3RA 4UQYA 4N3AA 2CHZA 3AU5A 4G25A 5A7DB 3ASGA 4YNDA 4FJYA 4GYYA 4G24A 2IOLA 5LCWJ 2HR2A 2Y4UA 4FP7A 2XRZA 3QNKA 4EQFA 3Q15A 3P2BA 4BWRA 3EIJA 3ESKA 4NRHB 3ZYMA 3APDA 4ATGA 3I3NA 3FUDA 3S7FA 3G2WA 1NA3A 2CFUA 1NP7A 3D9NA 5HI7A 4BT9A 4CEMA 5HQ8A 2J07A 2M63A 4RSYA 2I6HA 2OOEA 4ANVA 3PE3A 4QFVA 1DNPA 3DPDA 4MKTA 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8D A;  3AS5 A;  4Y6W A;  5CHE E;  3R9A B;  2L6J A;  3RIB A;  3U3W A;  3CVP A;  4G26 A;  3CK7 A;  3S7J A;  4GPK A;  4U07 A;  4I2W A;  4U0Z A;  2KCL A;  3VTY A;  1WAO 1;  4H7X A;  4N39 A;  3TG4 A;  2FO7 A;  3IEG A;  4JA9 A;  3Q5M A;  1IYG A;  3CK9 A;  2XCB A;  4WNG A;  3GYZ A;  5KJK A;  4WND A;  3U4T A;  5JJ7 A;  1A17 A;  1OUV A;  5A6C A;  4G1T A;  3UQ3 A;  3CEQ A;  2FEZ A;  5FZS A;  4WNF A;  4JA7 A;  1WM5 A;  2OND A;  2Y4T A;  3MEK A;  5DIZ A;  3AS4 A;  2C2L A;  4J0U A;  1HXI A;  4LEU A;  4UI9 J;  5FT9 A;  2XCC A;  2XGS A;  4G23 A;  5G04 C;  4AY5 A;  5BT1 A;  3FFL A;  4CDR A;  3ASF A;  4N2Q A;  4I2Z A;  5EX0 A;  2HYZ A;  2UWJ G;  3QWV A;  3K9I A;  3RKV A;  3KS2 A;  3LY8 A;  4HOR A;  4ME2 A;  4U04 A;  4N2S A;  3UUX A;  3ZHE B;  3QWW A;  3S7B A;  3TAX A;  1PC2 A;  5FJY A;  3GW4 A;  1FCH A;  2XGM A;  3EDT B;  3Q47 B;  4N3C A;  3QKY A;  5D0Q D;  1P5Q A;  4GCN A;  4GZ5 A;  4W9R A;  3RO3 A;  3S7D A;  3SF4 A;  5CCL A;  1XNF A;  2Q7F A;  2UY1 B;  3LYA A;  4GCO A;  2MHK A;  4GZ3 A;  4WUY A;  1TJC A;  1IHG A;  2UY1 A;  4IN3 B;  3KD7 A;  2FI7 A;  4GA1 A;  5G05 C;  4GA2 A;  2LSU A;  2PL2 A;  3ASH A;  3RU0 A;  1B89 A;  1QZ2 A;  5D0O D;  3URZ A;  3WXX A;  3CVL A;  3LY7 A;  4XIF A;  1W3B A;  2C0M A;  3QDN A;  2C0L A;  4HOQ A;  3Q49 B;  2LNI A;  4I9E A;  5FZQ A;  3JYS A;  2KCK A;  3VTX A;  4AIF A;  4APO A;  5G04 J;  3PE4 A;  4KXK B;  1YA0 A;  4I17 A;  1HZ4 A;  3NF1 A;  3RO2 A;  4N3B A;  5KJL A;  2P58 C;  1NZN A;  3ZFW A;  2FF4 A;  4BT8 A;  5ARF A;  2AVP A;  4U0S A;  4UQZ A;  4XI0 A;  4BTA A;  4AY6 A;  3OXF A;  3HYM B;  4GYO A;  1KT0 A;  2XPI A;  3KAE A;  4I9C A;  5JJT A;  4KBQ A;  4UI9 C;  2PQN A;  4HOU A;  2V5F A;  1ZU2 A;  2XGO A;  3N71 A;  5KJN A;  2IF4 A;  3BEE A;  3GZ1 A;  3MV3 B;  1KT1 A;  2VYI A;  4GYW A;  2KAT A;  1NA0 A;  2YQ8 A;  4U0U A;  4BTB A;  1E96 B;  3LPZ A;  2LSV A;  4CGV A;  5LCW C;  2QFC A;  4UI9 K;  2BUG A;  4XI9 A;  3TGO A;  2R5S A;  2GW1 A;  4F3V A;  4YVQ C;  2IFU A;  2VSY A;  5G05 J;  4Y6C A;  2VGY A;  4AM9 A;  4CGW A;  4B94 A;  2YHC A;  3MA5 A;  2KCV A;  2XEV A;  3ASD A;  4YVO A;  3CKC A;  4JHR A;  1QQE A;  3MKR A;  2WPV A;  1HH8 A;  4G2V A;  3ZN3 A;  5BW8 C;  3TG5 A;  3GZ2 A;  4RG9 A;  2HO1 A;  3ULQ A;  2WQH A;  4UQY A;  4J8F A;  5BNW A;  3UPV A;  3FWV A;  3PDN A;  1ELR A;  4N3A A;  4WNE A;  5EKQ D;  3CKB A;  1Y8M A;  4G25 A;  5A7D B;  4HOT A;  4A1S A;  3ASG A;  2VSN A;  4YND A;  4GA0 A;  3ZGQ A;  4GYY A;  3MV2 B;  4G24 A;  3CVN A;  3ZHE A;  5KJM A;  4JL0 A;  4J8E A;  5FTP A;  4GZ6 A;  2FBN A;  2HR2 A;  5AYW D;  3CV0 A;  3QWP A;  4ABN A;  5LCW J;  3SZ7 A;  5CCM A;  1KLX A;  4O6F A;  2Y4U A;  5ARG A;  4RG6 A;  5DBK A;  3ZPJ A;  3LY9 A;  4EQF A;  2E2E A;  3Q15 A;  5C1D A;  3CK8 A;  3CVQ A;  2KC7 A;  4HOS A;  1ZBP A;  1ELW A;  4KYO B;  4BWR A;  5JJ6 A;  2JLB A;  3ESK A;  4NRH B;  3Q4A B;  3LKU A;  4NQ0 A;  5EX3 A;  4I1A A;  3S7F A;  3AS8 A;  2PQR A;  2VGX A;  5HQ8 A;  1NA3 A;  3E4B A;  5HI7 A;  5M72 A;  4BT9 A;  3OXG A;  2DBA A;  3FP3 A;  3QOU A;  2VGX B;  4UQX A;  2I6H A;  2OOE A;  3O48 A;  4H7Y A;  2PZI A;  3LCA A;  2NC9 A;  3PE3 A;  4N5C A;  3RJV A;  5FZR A;  2VQ2 A;  2J9Q A;  3OXL A; 
#chains in the Genus database with same CATH topology
 3L08 A;  4Q94 A;  2JAB A;  2R05 A;  4GTV A;  1V54 E;  4GZD A;  4JA9 A;  4WAF A;  5KJK A;  1D8E A;  2P2C P;  3DXM G;  5JA4 D;  2FUL A;  4JXT A;  4PH4 B;  4AV7 A;  5AIJ A;  3FFL A;  1X81 A;  3FUI A;  1QBQ A;  4DUI A;  3CST A;  3UUX A;  2GRN B;  5D0Q D;  4XKB A;  4GA1 A;  1O1R A;  3Q78 A;  1QNF A;  1JCS A;  2C0M A;  4AP2 A;  3L54 A;  2KCK A;  4XE0 A;  4EZL A;  3B95 A;  1NZN A;  3DPY A;  2FF4 A;  3SNX A;  5CEC B;  2DZO A;  3FU5 A;  4I9C A;  2CFZ A;  2V5F A;  2XGO A;  3AJI A;  1SA4 A;  3MV3 B;  4KZC A;  3HVE B;  2YHC A;  2WPV A;  3CHO A;  4R7L A;  3UM1 A;  2NYJ A;  3EIQ C;  4MLP A;  5BNW A;  2X6F A;  3Q7F A;  2H6G A;  3JUE A;  2V0P A;  3QC1 A;  3FTU A;  4K5C A;  4KVO A;  5AJL A;  5C1D A;  5C2Y A;  3C3Q A;  3V2O A;  3IKO B;  3E4B A;  1MJ0 A;  3NBN B;  3JQ1 A;  2NC9 A;  2XQ0 A;  5JMN D;  2WXP A;  4JD2 G;  3ZKJ A;  2CG3 A;  3IEG A;  3KSQ A;  2V4L A;  5A6C A;  2LO6 A;  4UI9 J;  3W9G A;  1HX8 A;  1OWL A;  4N2S A;  2H6F A;  1PY1 A;  3AG2 E;  4B8C B;  4J6I A;  5ANR A;  4ILG A;  1ELK A;  2UY1 B;  4UUC A;  5JHA A;  1IHG A;  4TV3 A;  2LSU A;  4IRU A;  3RK6 A;  2XPZ A;  3V2X A;  1OWO A;  4C9B B;  5BV0 A;  2R59 A;  4AEZ C;  5FZQ A;  1YA0 A;  3ONL A;  5KBA A;  2HM8 A;  5T4Y A;  4PS7 A;  1EPU A;  3MGB A;  1AWC B;  2MYO A;  5HS0 A;  1E7U A;  4RG9 A;  3PDN A;  5ENS D;  1WY6 A;  3FTX A;  3Q79 A;  4HOT A;  4GA0 A;  4BER A;  1EDU A;  3CVV A;  3NQP A;  3MKQ B;  1H2U A;  1BLX B;  2L6B A;  3LY9 A;  2KC7 A;  3IV0 A;  4J8S A;  1RZ4 A;  1H6P A;  4I1A A;  2PQR A;  1QYM A;  1DVP A;  2VGX A;  3UI2 A;  3PEV B;  4JW1 A;  4H7Y A;  3EHM A;  3PNT B;  4PS8 A;  4GTS A;  2BKG A;  3ZYL A;  3T9K A;  4GMJ A;  4AVX A;  2WQ7 A;  2DYS E;  3UTM A;  4WNG A;  3GYZ A;  2J49 A;  1S63 A;  3G2S A;  5G04 J;  2C2L A;  3FTW A;  4UWH A;  4FU3 A;  1JCQ A;  2WM9 A;  3RKV A;  3RSE G;  3EHN A;  4ILI A;  2XGM A;  4N3C A;  3CHQ A;  4GZ3 A;  5AJD A;  1UOH A;  4IN3 B;  2FI7 A;  3U9W A;  1N0R A;  3D3M A;  4GPM A;  1QZ2 A;  4HRL A;  4GML A;  4HOQ A;  4L2Y A;  3VTX A;  1BPO A;  3S2A A;  4JEU A;  1HZ4 A;  2P58 C;  2AVP A;  2JEK A;  3FUL A;  4CZ2 D;  4GYO A;  3J5P A;  4DLQ A;  1TJF A;  3NOG D;  3GZ1 A;  4FLB A;  4Q96 A;  4BY6 A;  4YVQ C;  2VGY A;  4GZC A;  3B7S A;  2YIN A;  1E90 A;  3CVU A;  5B3S E;  5KNG A;  4EPZ A;  5KJM A;  4EBA G;  4FUL A;  4GTM A;  5AYW D;  3QWP A;  3W9F A;  3D9H A;  3NOC D;  3FUE A;  2I9C A;  3D9L A;  3CQG B;  4AXH A;  5IY5 E;  4LRZ A;  5G2N A;  5ENO D;  3HXE A;  2KZT B;  5FIN A;  2OEV A;  3LVQ E;  5FZR A;  3ZRH A;  2AXU A;  3T8K A;  1TNY A;  3DXK G;  4U07 A;  4U0Z A;  5KCM A;  3FH7 A;  4A63 B;  3TWV A;  2GRR B;  3ZXP A;  1XGW A;  3ULQ A;  3AS4 A;  4AY5 A;  4G23 A;  5G04 C;  5EX0 A;  3QWV A;  3SFY A;  3L82 A;  2V5Q C;  3EDT B;  3QKY A;  4GCN A;  4WUY A;  4D10 C;  5E75 A;  3WG7 E;  2LAI A;  4WWP A;  1SW6 A;  4FHJ A;  4I17 A;  4WWN A;  1WG0 A;  3OXF A;  2IF4 A;  2XEE A;  4GYW A;  3CQC B;  4U63 A;  3VLE A;  4JC8 A;  1X5B A;  2XEN A;  1MZC A;  3PVL A;  4HB5 A;  2KCV A;  2XEV A;  2R03 A;  4CT0 A;  3TG5 A;  2ZIR A;  2IY0 C;  1JUQ A;  2LXM A;  5A7D B;  5AN8 A;  4G24 A;  2IOL A;  5LCW J;  2HR2 A;  2Y4U A;  4YDW A;  1Q2Z A;  4U96 D;  5EIB E;  4LNB A;  2CFU A;  5D2M C;  1NP7 A;  3D9N A;  4BT9 A;  3Q7A A;  5KNH D;  4G8K A;  4MKT A;  2X6H A;  3MZL B;  3R9A B;  1NL4 A;  5CEA A;  3U3W A;  3CVP A;  3CHM A;  3VTY A;  4U7E B;  3T5X A;  2ILR A;  1LD7 A;  2MRI A;  2IJG X;  3CEQ A;  3B7B A;  1K1A A;  3UKU G;  2GRP B;  5BT1 A;  2WB2 A;  2HYZ A;  1OT8 A;  4HOR A;  1IHB A;  3FU6 A;  2VTB A;  2I1K A;  3NB2 A;  1TJC A;  4B89 A;  3RU0 A;  3WXX A;  3ZXS A;  2FO1 E;  4PDX A;  4LNU D;  3QAR A;  4KXK B;  1N0Q A;  4AY6 A;  2IU1 A;  2PQN A;  5FQ4 A;  5KJN A;  1ZU2 A;  3C3R A;  5LCW C;  3LPZ A;  3VLD A;  3PUK A;  4FHK A;  5BXU A;  2DZN A;  3ZN3 A;  4M7C A;  3UIO C;  2RG8 A;  4GB9 A;  5FTP A;  5J90 A;  3FU3 A;  1RW2 A;  2EIM E;  5JJ6 A;  3Q4A B;  4NQ0 A;  2BF0 X;  5M72 A;  2DBA A;  2VQ2 A;  3ASO E;  1Z6T A;  1LF8 A;  3FUK A;  3TWW A;  2NSZ A;  1KPS B;  3C3O A;  3LVR E;  1E8X A;  1OY3 D;  4IUL A;  4AOF A;  4G1T A;  4RVB A;  2R17 C;  4JPS A;  3LY8 A;  3IHV A;  3GW4 A;  3ZUV B;  4ACK A;  2VTB B;  2IOS A;  3U66 A;  3UIP C;  4GTQ A;  1UW4 B;  4DK5 A;  2VJ8 A;  1TNU A;  5D0O D;  3R7R A;  4BX9 A;  3OTN A;  4BEP A;  1SZA A;  1OCR E;  2P9I G;  2QY7 A;  2XZD G;  1K1B A;  5B1A E;  2PM6 A;  1HE8 A;  4O1P A;  3TGO A;  2LSV A;  4B8A A;  4UI9 K;  3BUA A;  3EHR A;  3LJ3 A;  4AM9 A;  4NUR A;  1VDY A;  3BG1 B;  5BW8 C;  4DI4 A;  4KZ0 A;  2P9N G;  2VSN A;  4TXQ A;  1YYH A;  3CVN A;  4HFG A;  5CER B;  3CGH A;  5CCM A;  3KEA A;  3ZPJ A;  1H6O A;  4E6H A;  3CHR A;  1IQU A;  3LKU A;  4GAA A;  4L1B A;  3OXG A;  2GGF A;  3FP3 A;  2IEJ A;  3ZW3 A;  2PZI A;  3G2V A;  1EYH A;  2X38 A;  3S7J A;  3QAQ A;  2X6J A;  2WVI A;  3MX3 A;  4A1G A;  1H2T C;  2FO7 A;  3KEZ A;  3CK9 A;  1HO8 A;  1A17 A;  1TNZ A;  5FZS A;  4JA7 A;  4L7T A;  5JHB A;  3FDH A;  4CCA A;  3K9I A;  4HRN A;  1Y6I A;  1SVX A;  4JEH A;  5FIO A;  3PZ3 A;  3T8M A;  3SGH A;  3TAX A;  1AP7 A;  4JZY A;  3LYA A;  2L9B A;  2HE0 A;  2P9S G;  1U3D A;  3ASH A;  1Z3Y A;  2Y3A A;  4DJA A;  5CMY A;  4N3B A;  2X3M A;  4U0S A;  4UQZ A;  3DSW A;  1U3C A;  1KT0 A;  3KAE A;  4ATZ D;  5JJT A;  5ENR D;  3FTY A;  3ASN E;  3TWS A;  4U0U A;  3HG0 D;  1NA0 A;  1E96 B;  3ZYK A;  2B6C A;  3HXB A;  3FUF A;  4GU5 A;  1LD8 A;  2AXV A;  2HO1 A;  3UT4 A;  3RAU A;  3DSS A;  1N4R A;  2E0I A;  1TNO A;  3DSX A;  3MV2 B;  5EYP F;  1KLX A;  3V30 A;  5AQ9 A;  1ZBP A;  2WMN A;  2F8X K;  2F8Y A;  1HG5 A;  4F7A A;  4FAD A;  3I4G A;  5FQ8 A;  3PZ1 A;  3PEU B;  3G2T A;  2WXL A;  3HXC A;  1E8Z A;  4HLL A;  4HRM B;  1A5E A;  3L6A A;  3CVY A;  2XCB A;  3PH0 C;  4URK A;  4V3I A;  1Z5S C;  1HF8 A;  4UWK A;  4CDR A;  3ASF A;  4PUC A;  4LER A;  2UWJ G;  4JHK A;  1S0P A;  4A3T A;  1EF1 C;  1SA5 A;  2ZGD A;  5FQ6 A;  2XS8 A;  4X8Q A;  3G2U A;  3KD7 A;  1B89 A;  3SI5 A;  5ENN A;  3JYS A;  2BED A;  1H0A A;  2R2L A;  4UWL A;  1DC2 A;  1OCC E;  4BTA A;  3HYM B;  3SHF A;  2RD0 A;  4HOU A;  3JQ0 A;  1PAQ A;  4XI9 A;  4DX2 A;  4Y6C A;  2GRL A;  3MA5 A;  5CRU A;  4G2V A;  4FLH A;  4OVV A;  5T3R A;  3ABL E;  3AU5 A;  4GTP A;  4FP7 A;  4EQF A;  3Q15 A;  3EIJ A;  4NRH B;  3I3N A;  3G2W A;  2P9K G;  2ZGG A;  2J07 A;  2I6H A;  2OOE A;  4K5B A;  3PE3 A;  4QFV A;  2IO2 C;  3UMV A;  2J4B A;  3AS5 A;  4J8D A;  2MOW A;  5ANL A;  4HVB A;  4UWF A;  1H2V C;  4DLO A;  4NIK A;  3E33 A;  2LUH A;  4I6E A;  2OCC E;  4F1S A;  4HXI A;  4XKC A;  3ZYQ A;  2H6I A;  5ENQ D;  5DIZ A;  4LEU A;  2XCC A;  1E8W A;  4I2Z A;  4WWO A;  2ZXW E;  3Q75 A;  3S7D A;  1YCS B;  3UX4 A;  4CT4 A;  4FJZ A;  5ENP D;  3D9M A;  2PL2 A;  3FH8 A;  4XEI G;  1W3B A;  2C0L A;  4APO A;  3UT8 A;  3HHM A;  3D9I A;  4TUU A;  4C0M A;  1MX6 A;  2L0I A;  4HI8 A;  4L23 A;  3AG1 E;  3MCX A;  3IHY A;  2VYI A;  4LUN U;  2R5S A;  1UJK A;  5FQ7 A;  1S64 A;  2V8S E;  3CVX A;  2R02 A;  3PZ2 A;  3FWV A;  3L22 A;  3C98 A;  2DIW A;  1IKN D;  3CV0 A;  2DWZ A;  2KBX A;  5ARG A;  2ZIS A;  3TJP A;  1Z3X A;  3CK8 A;  4KYO B;  3BG0 B;  3QB2 A;  4F53 A;  3FY4 A;  3QOU A;  1V55 E;  3PRZ A;  2LAH A;  2OEW A;  4G26 A;  4I2W A;  4IYP A;  1WAO 1;  2AW6 A;  3TG4 A;  3RRN B;  1IYG A;  2XS1 A;  5E76 A;  4RLY A;  4DRX E;  2EIL E;  1OXJ A;  1FPP A;  2Y4T A;  5A23 A;  1SQM A;  1OWN A;  4U8Y D;  3ULE G;  3AAA C;  2WXK A;  3ABM E;  3UM3 A;  4BSX A;  1WDY A;  5FJY A;  2V4H C;  4BFR A;  1FCH A;  3NZU A;  2AJA A;  4W9R A;  4GMR A;  3PS6 A;  3D9O A;  4EHM A;  3ML8 A;  4ANW A;  2UY1 A;  4L2L A;  2YNQ A;  3ML9 A;  2CHW A;  2P9U G;  5B1B E;  5EN5 D;  2WXG A;  3GZS A;  3QDN A;  2LNI A;  3PE4 A;  1E8Y A;  4I1M A;  2EIJ E;  3LEW A;  3QK0 A;  4KVM A;  4BSZ B;  3ZVV A;  3B7R L;  3R7Q A;  5CBN A;  2QFC A;  2GW1 A;  4RQI A;  2VSY A;  2H6H A;  2WXO A;  4YVO A;  3CKC A;  4MS6 A;  4A55 A;  1HH8 A;  2KM4 A;  1HU3 A;  3AG4 E;  4LSZ E;  3UPV A;  3Q73 A;  1ELR A;  4WNE A;  5EKQ D;  3CKB A;  3C72 A;  3ZHE A;  4I43 A;  1UG3 A;  1JCR A;  1JWG A;  4FC8 A;  4O6F A;  1ELW A;  2JLB A;  3FUJ A;  1DCE A;  2CG2 A;  3AS8 A;  3IBE A;  3LXU X;  4EBA A;  4ANX A;  3CVW A;  5ITZ F;  3L16 A;  2GRQ B;  1HG2 A;  3ZGQ A;  3V31 A;  2L6J A;  2GRM A;  4DPR A;  4UWG A;  4GPK A;  3ULY A;  4C48 B;  4MRU A;  2F37 A;  1HXI A;  5FT9 A;  1N9A A;  4HBD A;  3TWQ A;  4OAU C;  1BD8 A;  2EIK E;  4ME2 A;  3R9M A;  2PNN A;  3PNL B;  3Q47 B;  3RO3 A;  2Q7F A;  1UN9 A;  3B7T A;  3E32 A;  3C5R A;  2WQ6 A;  1TEZ A;  4HI9 A;  3SD5 A;  3CVL A;  4XIF A;  4AJW A;  4AIF A;  2QC9 A;  1BI7 B;  3BU8 A;  4HLE A;  1L5J A;  3VLF A;  4BT8 A;  3ESL A;  4XI0 A;  2EQX A;  2XPI A;  3FUM A;  4OYS A;  4NAC A;  4GTT A;  2WXH A;  3UM0 A;  3EJN A;  2BUG A;  3EHQ A;  3V79 K;  4FA6 A;  2IFU A;  3FEY A;  2YHE A;  3SBS A;  1GW6 A;  1QQE A;  1LTX A;  4K03 A;  2A4Z A;  2XEH A;  2IQC A;  2I1J A;  3SQV A;  4BET A;  3TXN A;  2FBN A;  4ABN A;  5D66 A;  3SZ7 A;  5DBK A;  3MKQ A;  4ACL A;  3LS8 A;  3HXF A;  3FEX A;  5EX3 A;  4K5A B;  2WXJ A;  1BI8 B;  4N5C A;  4GZ5 A;  4Y6W A;  3PZD A;  4O1O A;  3JUI A;  3ZU7 B;  3HRA A;  2WXM A;  3KSL A;  1MYO A;  1N52 A;  2DCP A;  4L9P A;  4WNF A;  4MBG A;  3Q9U C;  2XGS A;  4N2Q A;  3PUJ A;  2ION A;  4QQI A;  5HRY A;  3URZ A;  2PM7 A;  2ETC A;  1YMP A;  1P5Q A;  3DSU A;  2F0Y A;  3L13 A;  3TWX A;  3E37 A;  1N95 A;  2A5U A;  5CED B;  1BU9 A;  2OVF A;  3B13 A;  1MX4 A;  4UI9 C;  3DRA A;  1TNB A;  2KAT A;  5HKP A;  3EU9 A;  3I4R B;  1MHQ A;  3FU0 A;  3UIN C;  3TWR A;  4KMO A;  4CGW A;  2QYJ A;  1O1S A;  1HFA A;  2OV8 A;  4LCT A;  4HQD A;  1N11 A;  4UQY A;  1K8K G;  4FJY A;  4GYY A;  3AG3 E;  3J5Q B;  1OCZ E;  1D8D A;  1FT1 A;  3QNK A;  4BWR A;  3ZYM A;  3NAW A;  4ATG A;  3EU5 A;  3FUD A;  5CRV A;  3S7F A;  5HQ8 A;  5HI7 A;  1NA3 A;  1TYQ G;  4CEM A;  1N4P A;  2M63 A;  4GTR A;  1DNP A;  3DPD A;  4DX7 D;  3OXL A;  1JWF A;  3RIB A;  4JVS A;  3CK7 A;  3FUN A;  3CLJ A;  1DCQ A;  1MQS A;  4N39 A;  4OAV B;  3Q5M A;  1WM5 A;  2B0O E;  3L17 A;  4YDY A;  3MEK A;  4J0U A;  1OWP A;  2VGE A;  3SY2 A;  4CDN A;  5AAR A;  4P29 A;  4U04 A;  2XHE A;  4PS3 A;  4C0E A;  4K0R A;  3SFZ A;  2LXL A;  5G05 C;  1G3N B;  4GA2 A;  3FUH A;  2RKK A;  3UXG A;  3LDZ A;  3U64 A;  3AU4 A;  3NF1 A;  3RO2 A;  2WXR A;  3ZFW A;  4XZ4 A;  4TUM A;  2XRY A;  4KBQ A;  3DEP A;  4APF A;  4EZJ A;  1O5M A;  2YQ8 A;  4DI3 A;  4BES A;  4F3V A;  2I2O A;  5G05 J;  3MYV A;  4JHR A;  3DWL G;  4M3O A;  2WQH A;  3MJW A;  4YDE A;  2P9P G;  2KXP C;  4RG6 A;  4GTO A;  5CMW A;  1IXV A;  4G11 A;  3IXE A;  2CHX A;  3UT7 A;  2AXZ A;  2Y0B G;  5FWQ A;  4UQX A;  4DX1 A;  2WXI A;  1NFI E;  1UN8 A;  3LCA A;  4EEC A;  1TN8 A;  4B0Z A;  5LFA A;  4LG6 A;  3CHS A;  3UM2 A;  3TL5 A;  1MX2 A;  5CBO A;  3U4T A;  5JJ7 A;  3D9P A;  2EIN E;  3SF4 A;  4CDM A;  4TXR A;  4U8V D;  4Z68 A;  2J8S D;  2AWI A;  2NXP A;  3QWW A;  3S7B A;  5J08 A;  2J08 A;  5CCL A;  5EIL A;  3SO8 A;  2DVW A;  2VSX E;  4GCO A;  1N54 A;  2XPY A;  3FTS A;  5AAO A;  3P1U A;  4HNA D;  2J09 A;  5KJL A;  3DST A;  2A5E A;  5LOZ A;  3B7U X;  5BUZ A;  4A3V A;  4BTB A;  4I6J A;  1OCO E;  4B93 B;  2QZA A;  3CHP A;  4B94 A;  3ASD A;  4I6G A;  1UJJ A;  1TN7 A;  3GZ2 A;  3BQO A;  4ILH B;  4KT6 B;  2VSO E;  3QJZ A;  3E30 A;  3TWU A;  4JHJ A;  3CSF A;  4A1S A;  4J8E A;  2WXQ A;  4HS2 A;  3ZIM A;  1H6K A;  3RRU A;  4BX8 A;  4DX6 D;  3HIZ A;  2ZU6 B;  3ABK E;  4CRW A;  3X2Q E;  1JPL A;  1N4Q A;  3O48 A;  3RJV A;  4YDO A;  5KWD A;  3L9T A;  4LNG A;  3SBT B;  3JXI A;  1SZ9 A;  5LP0 A;  4H7X A;  2X6K A;  4WND A;  3UQ3 A;  4DX5 D;  4F1P A;  2OND A;  5EID A;  3DBS A;  3RRM B;  1E7V A;  1TR4 A;  5EDS A;  3ZHE B;  5G55 A;  3DEO A;  1PC2 A;  1U2V G;  3CR3 A;  1XNF A;  2MHK A;  3O4Z A;  4U8H A;  4OVU A;  5H7P A;  1KZO A;  4J7W A;  3Q49 B;  4I9E A;  2BTD A;  2J4D A;  3DSV A;  3FH5 A;  1IQR A;  3HXD A;  3N71 A;  3T5V A;  2RFA A;  4J8Y A;  2ETB A;  3FTV A;  4TRQ A;  3HVE A;  3ZNG A;  3MKR A;  3NZS A;  4TXP A;  1FVH A;  4J8F A;  1H19 A;  4I1O B;  1TN6 A;  1Y8M A;  3D9K A;  3JXJ A;  3Q9N C;  5AQ7 A;  4XX5 A;  4JL0 A;  4GZ6 A;  2X6I A;  3UKR G;  3ZEF A;  5ENT D;  2E2E A;  3F6Q A;  3PRE A;  3CVQ A;  3HDX A;  1HS6 A;  1D9S A;  3D9J A;  3TWT A;  5T8I A;  5BXO A;  5BPP A;  2VGX B;  2J9Q A;  4U95 D;  5CHE E;  2DYR E;  3FTZ A;  1FVF A;  2OVB A;  2KCL A;  3JCK C;  5BV1 A;  2QYU A;  3I5P A;  4JB8 P;  4O60 A;  4F6R D;  3PZ4 A;  1OUV A;  2FEZ A;  3EUV A;  2RFM A;  4HOS A;  2Y1L E;  5AQB A;  1O1T A;  2WXN A;  2WMO A;  3KS2 A;  1S70 B;  4N5Q A;  1INZ A;  3CIA A;  3SFX A;  4G8L A;  5AEN A;  3APC A;  4EZK A;  3LY7 A;  4Q69 A;  3ONK A;  2Y69 E;  3OAW A;  2WXF A;  4ANU A;  2KZT A;  2P9L G;  2ETA A;  3TXM A;  3APF A;  5ARF A;  4ZFH A;  1NI1 A;  2L0T B;  1OWM A;  1KZP A;  3BEE A;  4E85 A;  1KT1 A;  4CYM D;  1FT2 A;  1K3Z D;  4CGV A;  3FHE A;  2IO3 C;  5EYL A;  5LX8 A;  4ZHB A;  3ENE A;  4N3A A;  2CHZ A;  1N4S A;  1ZB1 A;  4G25 A;  3ASG A;  3E34 A;  4YND A;  2XZT G;  3LJN A;  5AQA A;  2GRO B;  2XRZ A;  3P2B A;  3ISM C;  3ESK A;  3APD A;  1N94 A;  2BKK B;  4RSY A;  4ANV A; 
#chains in the Genus database with same CATH homology
 2J4B A;  3AS5 A;  4J8D A;  2X6H A;  2MOW A;  3L08 A;  3MZL B;  5ANL A;  3R9A B;  1JWF A;  3RIB A;  4HVB A;  4UWF A;  4JVS A;  4Q94 A;  3U3W A;  1H2V C;  3CVP A;  4DLO A;  3CHM A;  3CK7 A;  3FUN A;  3CLJ A;  3VTY A;  3T5X A;  2ILR A;  1MQS A;  2MRI A;  4I6E A;  4GZD A;  4N39 A;  4JA9 A;  4F1S A;  4WAF A;  3Q5M A;  5KJK A;  4HXI A;  2IJG X;  4XKC A;  3ZYQ A;  3CEQ A;  1WM5 A;  3L17 A;  2FUL A;  4JXT A;  4PH4 B;  4AV7 A;  3MEK A;  5DIZ A;  5AIJ A;  4J0U A;  4LEU A;  1OWP A;  2XCC A;  1E8W A;  5BT1 A;  3FFL A;  4I2Z A;  2WB2 A;  2HYZ A;  4CDN A;  3UMV A;  3FUI A;  4WWO A;  4HOR A;  4P29 A;  4U04 A;  2XHE A;  3CST A;  3UUX A;  3FU6 A;  4PS3 A;  4C0E A;  2VTB A;  5D0Q D;  3S7D A;  2I1K A;  3UX4 A;  4K0R A;  3SFZ A;  4CT4 A;  1TJC A;  4FJZ A;  5G05 C;  4XKB A;  4B89 A;  4GA1 A;  4GA2 A;  3D9M A;  2PL2 A;  3FUH A;  3FH8 A;  3RU0 A;  1QNF A;  3WXX A;  3ZXS A;  3LDZ A;  1W3B A;  2C0M A;  2C0L A;  4PDX A;  4APO A;  4AP2 A;  3L54 A;  2KCK A;  4XE0 A;  3U64 A;  3UT8 A;  4EZL A;  3QAR A;  3AU4 A;  4KXK B;  3HHM A;  3D9I A;  4TUU A;  3NF1 A;  3RO2 A;  1NZN A;  2WXR A;  3ZFW A;  4C0M A;  2FF4 A;  4XZ4 A;  3SNX A;  2XRY A;  2L0I A;  4AY6 A;  2IU1 A;  3FU5 A;  4I9C A;  4KBQ A;  4L23 A;  2CFZ A;  2PQN A;  5FQ4 A;  2V5F A;  1ZU2 A;  2XGO A;  5KJN A;  3MCX A;  4APF A;  4EZJ A;  3IHY A;  3MV3 B;  2VYI A;  2YQ8 A;  4LUN U;  5LCW C;  3LPZ A;  3VLD A;  3PUK A;  4FHK A;  4KZC A;  4DI3 A;  2R5S A;  4F3V A;  2I2O A;  5G05 J;  1UJK A;  3HVE B;  2YHC A;  3MYV A;  4JHR A;  3ZN3 A;  2WPV A;  5FQ7 A;  3CHO A;  4R7L A;  2V8S E;  3CVX A;  4M3O A;  2WQH A;  3EIQ C;  4MLP A;  5BNW A;  2X6F A;  3FWV A;  3MJW A;  2RG8 A;  3L22 A;  3C98 A;  2DIW A;  2V0P A;  4GB9 A;  3QC1 A;  3FTU A;  5FTP A;  3CV0 A;  4KVO A;  5ARG A;  3FU3 A;  5J90 A;  5AJL A;  1Z3X A;  4RG6 A;  3TJP A;  5CMW A;  5C1D A;  3CK8 A;  4KYO B;  3BG0 B;  5C2Y A;  5JJ6 A;  4G11 A;  2CHX A;  3UT7 A;  2AXZ A;  3Q4A B;  4NQ0 A;  5FWQ A;  3QB2 A;  2BF0 X;  3IKO B;  3E4B A;  5M72 A;  4F53 A;  3FY4 A;  2DBA A;  3JQ1 A;  3QOU A;  4UQX A;  2WXI A;  1UN8 A;  2NC9 A;  3LCA A;  2VQ2 A;  2XQ0 A;  4EEC A;  4B0Z A;  3PRZ A;  1Z6T A;  1LF8 A;  5LFA A;  2LAH A;  4G26 A;  3CHS A;  3FUK A;  4I2W A;  3TL5 A;  2WXP A;  4IYP A;  2NSZ A;  1WAO 1;  2CG3 A;  2AW6 A;  3LVR E;  1E8X A;  3IEG A;  3RRN B;  3TG4 A;  1IYG A;  5E76 A;  5JJ7 A;  4IUL A;  3U4T A;  4AOF A;  2V4L A;  5A6C A;  4G1T A;  3D9P A;  4RVB A;  2R17 C;  2LO6 A;  2Y4T A;  4JPS A;  3SF4 A;  4UI9 J;  4CDM A;  5A23 A;  1SQM A;  1OWN A;  1HX8 A;  3LY8 A;  1OWL A;  2AWI A;  2WXK A;  3IHV A;  2NXP A;  4N2S A;  3QWW A;  1PY1 A;  3S7B A;  4BSX A;  4B8C B;  5J08 A;  4J6I A;  5FJY A;  5ANR A;  2J08 A;  3GW4 A;  4ILG A;  1FCH A;  4BFR A;  3NZU A;  5CCL A;  1ELK A;  4W9R A;  4ACK A;  2VTB B;  2VSX E;  2UY1 B;  2IOS A;  3D9O A;  3PS6 A;  4GCO A;  1N54 A;  3ML8 A;  5JHA A;  4ANW A;  3U66 A;  1IHG A;  2UY1 A;  2XPY A;  3FTS A;  4TV3 A;  4L2L A;  1UW4 B;  2LSU A;  2YNQ A;  2XPZ A;  3ML9 A;  2VJ8 A;  3P1U A;  4IRU A;  1OWO A;  5D0O D;  2CHW A;  3RK6 A;  4C9B B;  5BV0 A;  2J09 A;  3R7R A;  2WXG A;  3GZS A;  3QDN A;  2R59 A;  2LNI A;  4AEZ C;  5FZQ A;  3PE4 A;  4BX9 A;  1YA0 A;  3ONL A;  3OTN A;  5KJL A;  1SZA A;  1E8Y A;  2HM8 A;  2QY7 A;  4I1M A;  4KVM A;  3LEW A;  3QK0 A;  5LOZ A;  5T4Y A;  3ZVV A;  3B7U X;  5BUZ A;  3B7R L;  4PS7 A;  1EPU A;  3R7Q A;  2PM6 A;  4A3V A;  3MGB A;  4BTB A;  4I6J A;  1HE8 A;  3TGO A;  2LSV A;  4B8A A;  2QFC A;  4UI9 K;  3LJ3 A;  2GW1 A;  4AM9 A;  2VSY A;  4NUR A;  3CHP A;  2WXO A;  4B94 A;  3ASD A;  4I6G A;  1UJJ A;  1VDY A;  3BG1 B;  3CKC A;  4MS6 A;  4YVO A;  1HH8 A;  4A55 A;  5BW8 C;  2KM4 A;  1E7U A;  1HU3 A;  3GZ2 A;  4RG9 A;  4ILH B;  4DI4 A;  4KT6 B;  2VSO E;  3QJZ A;  4JHJ A;  3UPV A;  4KZ0 A;  3PDN A;  1ELR A;  1WY6 A;  4WNE A;  5EKQ D;  3CSF A;  3CKB A;  3FTX A;  4HOT A;  4A1S A;  2VSN A;  4GA0 A;  3ZHE A;  1EDU A;  3CVN A;  4HFG A;  4I43 A;  1UG3 A;  4J8E A;  2WXQ A;  4HS2 A;  3NQP A;  3CVV A;  3MKQ B;  3ZIM A;  1H2U A;  3CGH A;  5CCM A;  1JWG A;  1H6K A;  4FC8 A;  4O6F A;  3RRU A;  3ZPJ A;  3LY9 A;  2KC7 A;  3IV0 A;  1ELW A;  4BX8 A;  4J8S A;  2JLB A;  3FUJ A;  4E6H A;  3CHR A;  1IQU A;  2ZU6 B;  3HIZ A;  3LKU A;  2CG2 A;  4I1A A;  3AS8 A;  2PQR A;  3IBE A;  3LXU X;  4GAA A;  4EBA A;  1DVP A;  2VGX A;  4L1B A;  4ANX A;  4CRW A;  3CVW A;  1JPL A;  3OXG A;  2GGF A;  3FP3 A;  3PEV B;  3L16 A;  4JW1 A;  4H7Y A;  3O48 A;  3ZW3 A;  2PZI A;  3EHM A;  3PNT B;  4PS8 A;  3RJV A;  1HG2 A;  3G2V A;  1EYH A;  3ZGQ A;  2L6J A;  2X38 A;  2GRM A;  4DPR A;  4UWG A;  3SBT B;  3S7J A;  3QAQ A;  3ZYL A;  1SZ9 A;  4GPK A;  2X6J A;  4GMJ A;  4AVX A;  5LP0 A;  2WVI A;  3MX3 A;  4A1G A;  4H7X A;  1H2T C;  2WQ7 A;  2FO7 A;  2X6K A;  3KEZ A;  3CK9 A;  4WNG A;  3GYZ A;  2J49 A;  4WND A;  1HO8 A;  4MRU A;  1A17 A;  3UQ3 A;  5FZS A;  4JA7 A;  2OND A;  3G2S A;  5G04 J;  2C2L A;  3FTW A;  1HXI A;  3DBS A;  4L7T A;  5FT9 A;  5JHB A;  4UWH A;  3FDH A;  3RRM B;  4FU3 A;  4CCA A;  2WM9 A;  3K9I A;  3RKV A;  1E7V A;  1Y6I A;  4ME2 A;  5EDS A;  3ZHE B;  3EHN A;  4JEH A;  5G55 A;  3PNL B;  1PC2 A;  3T8M A;  4ILI A;  2XGM A;  3SGH A;  3Q47 B;  4N3C A;  3TAX A;  3CR3 A;  3RO3 A;  1XNF A;  2Q7F A;  3CHQ A;  3LYA A;  4GZ3 A;  2MHK A;  4JZY A;  1UN9 A;  3O4Z A;  3B7T A;  5AJD A;  4IN3 B;  2L9B A;  2FI7 A;  3U9W A;  1U3D A;  3D3M A;  4U8H A;  2WQ6 A;  1TEZ A;  3ASH A;  4OVU A;  1QZ2 A;  1Z3Y A;  3SD5 A;  4GML A;  3CVL A;  4XIF A;  2Y3A A;  4AJW A;  4HOQ A;  4DJA A;  4L2Y A;  3Q49 B;  4I9E A;  5CMY A;  3VTX A;  4AIF A;  2BTD A;  2J4D A;  1BPO A;  3FH5 A;  3S2A A;  4JEU A;  1HZ4 A;  4HLE A;  4N3B A;  2P58 C;  2X3M A;  1L5J A;  3VLF A;  4BT8 A;  2AVP A;  1IQR A;  3ESL A;  4U0S A;  4UQZ A;  4XI0 A;  2JEK A;  3FUL A;  1U3C A;  4GYO A;  1KT0 A;  2EQX A;  2XPI A;  3FUM A;  3KAE A;  4OYS A;  4DLQ A;  5JJT A;  4NAC A;  3N71 A;  3FTY A;  1TJF A;  3T5V A;  3GZ1 A;  2WXH A;  4U0U A;  1NA0 A;  4FLB A;  1E96 B;  4Q96 A;  3EJN A;  2BUG A;  4BY6 A;  4FA6 A;  3ZYK A;  4YVQ C;  2IFU A;  2VGY A;  3FEY A;  2YHE A;  3SBS A;  3FUF A;  3FTV A;  4GU5 A;  4TRQ A;  1GW6 A;  3HVE A;  1QQE A;  3MKR A;  3NZS A;  4GZC A;  4K03 A;  3B7S A;  2AXV A;  2HO1 A;  1FVH A;  2YIN A;  4J8F A;  1H19 A;  4I1O B;  1E90 A;  2A4Z A;  3CVU A;  3UT4 A;  4EPZ A;  1Y8M A;  2IQC A;  3D9K A;  2E0I A;  2I1J A;  5KJM A;  3MV2 B;  4EBA G;  4XX5 A;  4JL0 A;  4FUL A;  4GZ6 A;  2FBN A;  5AYW D;  3TXN A;  2X6I A;  3QWP A;  4ABN A;  3SZ7 A;  3ZEF A;  1KLX A;  5DBK A;  3MKQ A;  2E2E A;  3PRE A;  4ACL A;  3CVQ A;  3HDX A;  1ZBP A;  1HS6 A;  3LS8 A;  3FEX A;  3FUE A;  3D9J A;  2WMN A;  2I9C A;  3D9L A;  5EX3 A;  3CQG B;  4AXH A;  5T8I A;  1HG5 A;  4FAD A;  4LRZ A;  2WXJ A;  4F7A A;  3I4G A;  5FQ8 A;  5G2N A;  5BPP A;  2VGX B;  2KZT B;  3LVQ E;  4N5C A;  5FZR A;  2J9Q A;  3PEU B;  2AXU A;  4GZ5 A;  4Y6W A;  3G2T A;  5CHE E;  3ZRH A;  3PZD A;  3FTZ A;  1FVF A;  3JUI A;  2OVB A;  2WXL A;  4U07 A;  4U0Z A;  5KCM A;  2KCL A;  2WXM A;  3JCK C;  5BV1 A;  1E8Z A;  3FH7 A;  3L6A A;  3I5P A;  3CVY A;  1N52 A;  2XCB A;  2DCP A;  3PH0 C;  1OUV A;  4URK A;  2FEZ A;  4V3I A;  4WNF A;  1XGW A;  1HF8 A;  4UWK A;  3AS4 A;  3ULQ A;  4HOS A;  4AY5 A;  2XGS A;  4G23 A;  5G04 C;  4N2Q A;  4CDR A;  2WXN A;  3ASF A;  5EX0 A;  3PUJ A;  2WMO A;  4PUC A;  4LER A;  2UWJ G;  3QWV A;  3KS2 A;  2ION A;  4JHK A;  1S0P A;  1INZ A;  4A3T A;  3CIA A;  3URZ A;  2PM7 A;  3EDT B;  1EF1 C;  3QKY A;  1P5Q A;  4GCN A;  5AEN A;  5FQ6 A;  4WUY A;  3L13 A;  3G2U A;  3KD7 A;  3APC A;  4EZK A;  4D10 C;  1B89 A;  5E75 A;  3SI5 A;  5ENN A;  3LY7 A;  4Q69 A;  2LAI A;  2A5U A;  3JYS A;  4FHJ A;  4WWP A;  3ONK A;  3OAW A;  4I17 A;  2WXF A;  4WWN A;  1H0A A;  2OVF A;  3B13 A;  4UWL A;  4ANU A;  2KZT A;  3TXM A;  3APF A;  5ARF A;  4BTA A;  3OXF A;  3HYM B;  4UI9 C;  2L0T B;  3SHF A;  2RD0 A;  1OWM A;  4HOU A;  2IF4 A;  3BEE A;  4E85 A;  1KT1 A;  4GYW A;  2KAT A;  3CQC B;  3JQ0 A;  4U63 A;  3FHE A;  4CGV A;  1PAQ A;  3I4R B;  4XI9 A;  1MHQ A;  3VLE A;  3FU0 A;  4JC8 A;  4DK5 A;  1X5B A;  4Y6C A;  2GRL A;  3PVL A;  4KMO A;  4CGW A;  3MA5 A;  5LX8 A;  2KCV A;  2XEV A;  4G2V A;  4FLH A;  1HFA A;  2OV8 A;  4OVV A;  3TG5 A;  4CT0 A;  4LCT A;  1JUQ A;  3ENE A;  5T3R A;  4UQY A;  4N3A A;  2CHZ A;  3AU5 A;  4G25 A;  5A7D B;  3ASG A;  4YND A;  4FJY A;  4GYY A;  4G24 A;  2IOL A;  5LCW J;  2HR2 A;  2Y4U A;  4FP7 A;  2XRZ A;  3QNK A;  4EQF A;  3Q15 A;  3P2B A;  4BWR A;  3EIJ A;  3ESK A;  4NRH B;  3ZYM A;  3APD A;  4ATG A;  3I3N A;  3FUD A;  3S7F A;  3G2W A;  1NA3 A;  2CFU A;  1NP7 A;  3D9N A;  5HI7 A;  4BT9 A;  4CEM A;  5HQ8 A;  2J07 A;  2M63 A;  4RSY A;  2I6H A;  2OOE A;  4ANV A;  3PE3 A;  4QFV A;  1DNP A;  3DPD A;  4MKT A;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...