4KBYA

Msting/c-di-gmp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
175
Chain Sequence
b'NVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stimulator of interferon genes protein
molecule tags Immune system
source organism Mus musculus
publication title Novel c-di-GMP recognition modes of the mouse innate immune adaptor protein STING
pubmed doi rcsb
total genus 50
structure length 175
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kbyA02
4KSYA 4LOKA 4QXPA 4F5EA 4YP1A 5CFNA 5CFLA 4QXOA 4KBYA 4JC5A 4F9GA 5CFMA 5BQXA 4LOIA 5CFPA 5CFOA 4LOJA 4EMUA 4EMTA 4QXRA 4LOLA 4F5WA 5CFRA 4EF5A 4QXQA 4EF4A 4F9EA 4KC0A 4LOHA 4F5DA 4F5YA 5CFQA
chains in the Genus database with same CATH superfamily
4OUDB 1JKFA 3NHWA 3OX4A 1SKBA 3OIWA 1FP4B 4RADA 4TWJA 1XTZA 2QKYA 3QX8A 2BV3A 4AWBA 3JD0A 2DUWA 1RXCA 3PNVA 2B8WA 1Q74A 2C4HA 3WHIA 1KTVA 3FOAA 3VR5D 5C5DA 4XB6B 4U6SA 3DWGA 1TK3A 1OC4A 1U5BA 4B75A 1B6SA 5E38A 5BYKA 1Y9JA 4ASUA 3KCQA 1OFIA 3CRQA 3KE8A 1GL7A 3M4ZA 3C98A 3JQ9C 9LDTA 3VXKA 3CHYA 1NGSA 1IJKA 2WILA 4AYTA 4ZI3A 4P7JA 4Y2PA 1EFVB 1TGVA 3HO8A 3TRHA 3ZVLA 1XAHA 2MSDB 5IJ9B 1YE8A 1RYMA 3EXFB 1IN7A 3A4VA 3EPPA 2X22A 2O57A 2NACA 1KYYA 1OX5A 3SM3A 4LYJA 3P2JA 5GTDA 4Q3KA 1OBVA 5B12A 3IYLW 1K88A 1MJGM 5F9FA 3WJAA 2X3YA 2HA2A 2EZUA 3EUFA 2JI9A 2OAQ1 1O7JA 5IK2D 1JHPA 3UZUA 3RPEA 2WLTA 5FKJA 4L50A 2CFIA 2BMDA 4JLPA 1PUJA 4NNPA 5LZ7A 1KZHA 4LRSB 2R6JA 3ZWMA 1NZDA 2RK4A 2WIBA 3GUUA 1MO4A 4G65A 4HH4A 3W2HA 3CUYA 3GG9A 1H0RA 3U7IA 2OLJA 1VMKA 3NH9A 4HWTA 3RGGA 1P8AA 2YXEA 1XTSA 3E9RA 3U4MA 2RI0A 2JVKA 2Y0EA 2CFCA 1MQSA 1LLQA 1YR3A 3OLQA 3WJ7A 4MINA 4RK1A 1WZCA 3FPFA 1DIGA 3SBDA 2JK0A 1TNDA 4Z8YA 4NESA 4B6JA 2AHOA 2ES4A 1YS2X 2Y77A 4FPXA 1TVKB 4MUYA 3H1GA 1IWBB 1OIWA 1W5SA 1DPGA 2F1KA 4ARVA 2H00A 1D1TA 3I37X 3PG5A 4KVFA 4X3OA 3R5FA 5D7NA 1RC1A 4BRWA 5CDUA 4FHZA 2EFDB 2UUAB 1VL8A 4GKBA 2RBEA 4RY0A 4YDRA 4YI5A 5SY9A 5D51S 3K5PA 2E82A 2J6IA 1Y9AA 2IE0A 3FHCB 4WY8A 3RVRA 3E18A 3AWDA 3TDKA 5CYOA 3JZMA 3MERA 1ODFA 2QRHA 1LF0A 1NNLA 3OEWA 2OFOA 3P4YA 3PHHA 4RSMA 4F92B 2ORYA 1M72A 3BA6A 4KU4A 3LT1A 1EZ1A 1D7OA 2EG5A 2LTAA 3VR2A 1MJFA 4RLFA 4ZT5A 4F9TA 4OHWA 2XADA 2C9MA 2BSXA 4R1LA 2W6CX 2PX0A 3RNOA 3G2MA 2V6JA 4U2BA 3E9DA 2RHJA 1JTVA 1V7PC 2WD9A 3DBLB 5AUQA 3U1TA 1UBHS 4TKUB 2GERA 1W36C 2VDMB 3OZ7A 4WA7A 5JDCC 3NFYA 4YAFA 4IHKA 3ZEIA 2AEJA 5BRAA 3ONNA 5B2FA 3TSOA 4RGBA 3WZLA 2OB2A 4M9RA 3PHGA 4B6SA 4F2HA 1OFUX 3W6UA 2X15A 2IYRA 4B3HA 3BREA 2REQB 4BLPA 3F5MA 3FZNA 3BDVA 3HB7A 1V2HE 4QBKA 5MGNA 4P4SB 3I4FA 1MW8X 3HEBA 1DAHA 3B70A 3V7FA 3GVCA 1SHKA 4PAWA 4UHEA 3AR6A 5TJ9A 1SG0A 1XRQA 3GLHE 3UK1A 3NBYC 3JQDA 4LOAA 1SU4A 1JLMA 3OOSA 4GBGA 4BDSA 1Q0HA 3LQKA 1QGZA 1C9DB 1UPBA 2H31A 1JTFA 1NOIA 1XTVA 2ISCA 2QT1A 3HSSA 2X9QA 2HLNA 3FMFA 4PRYA 3VOAA 2XRZA 5GONA 3E1GA 2Z3VA 4NZZA 1AKRA 3BMOB 2Q2VA 1M2VA 2Q3LA 4MDHA 2O0HA 3RVOA 2VRCD 1F48A 4QVIA 1UT6A 3FDZA 1EUZA 3IEXA 1V8OA 2YYSA 4FOSA 4EGJA 5K8IA 5HRCA 3N7TA 5FJIA 3UPUA 4R8VA 5CFQA 4XGIA 1GQYA 3JQAB 4A6PA 4BAZA 3PDIA 5IAOA 1MOZA 1CG6A 5HDBB 3KT6A 1KP3A 3EB9A 4HFJA 3W5HA 4WE3A 1FVHA 3IE0A 4GMHA 4AMZA 2CHEA 3K1AA 4N4AA 1RTKA 3ZW8A 3OTOB 4BZQA 3GWGA 5HBRA 4A0FA 2CL7X 4MI9A 1GLGA 2B7BA 5LP6B 1D0IA 2V55B 2LE0A 1MQAA 1T4CA 5EYPB 3GUZA 3T0GA 4H6PA 1PUXA 2BEVA 2JFYA 4X6LA 4A92A 4EMTA 2ZXEA 3IUQA 4LOLA 5GQSA 2C5HA 3VKUA 3ZQJA 1VLLA 3A2NA 4F21A 1E2NA 1IHUA 4QJIA 3GP5A 3FWZA 3LQ2A 4JJEA 2D5BA 2Z58A 4FE4A 1L1EA 1N5KA 1AQYA 1XRNA 3N2KB 4M0PA 2VF7A 3QYPA 4OQEA 4TTSA 2GWRA 1J5XA 3UJHA 1JU4A 1WEKA 4DA9A 2M32A 3LCUA 2OUIA 3EVEA 3K0FB 3RIXA 4LJ8A 1IHOA 1X38A 3T7RA 3EH1A 1KH2A 1M67A 1PQ4A 1QGUB 1ZC4A 1TZMA 4A6EA 1DEKA 3R23A 3IS3A 5DNUA 5EIEA 5KSYA 3HTXA 4ETNA 2X0FA 1RLOA 1TZKA 3H0KA 3JD2A 1A3CA 1IEQA 1X1AA 2I65A 4PPYA 3PX3A 4W5RA 3BB4A 5LZ8A 1C8BA 2HWXA 1C3EA 1XDWA 3BHNA 1II9A 3EQ9A 2XGSA 3PX2A 4ND3A 4DUPA 3BE4A 2M6LA 1T3SA 4EB8A 2HHAA 5JCOC 4XCVA 1W581 1T1JA 4TL8A 1R3UA 1XZ8A 2PUGA 5AI0A 3SJBA 3HN2A 3W1VA 1WXXA 3O6VA 4HWPA 5LM3A 2SCUB 1Z7YA 2G4LA 3GZNA 2FLVA 3ZX4A 4KWIA 1EX6A 5TXGA 1TVKA 1VTKA 4UBIA 1ODSA 2B0CA 3A6GA 6ADHA 2SCUA 2WJPA 3OCCA 5BV7A 1RQ2A 1YJAA 3QWIA 5AI8A 1GTRA 3L1UA 4IVPA 1ZXXA 4U8GA 4DMGA 5GZ1A 3M1YA 2BEVB 1VGQA 1XZHA 2DFTA 5E7IA 5LN1A 2V03A 1H69A 2BCJQ 2VDWB 1RAFA 4LC0A 5AOVA 3UUWA 4H7HA 3HXTA 1X80B 2YS6A 3PT5A 1IBCA 2TECE 3LYAA 4DVGA 3O83A 5IASA 1BH6A 1F1BA 3I05A 2WPNA 3D6VA 3CSDA 2YV4A 3FMIA 4M8SA 3TWOA 5HMLA 1JEDA 3I28A 3N8IA 4PNZA 2SHKA 4ZVUA 1L5HA 4DCNA 4EG3A 5F51A 2CV1A 2HNAA 3LKZA 3OVMA 4ZKEA 3ICPA 3RH0A 3RYCB 1EZZA 3Q41A 4R1QA 2BJHA 4ZDWA 2VHVA 4O3FA 1SQGA 4JC0A 3ZHVA 4CETA 2OR3A 1S89A 2DTXA 3V7YA 3ROPA 4Q9NA 4A0RA 3EXFA 1ZM2A 3LO8A 3QEKA 2JCSA 3LW7A 4NBTA 4ZO9A 1KSJA 2ZWVA 1NXSA 3DMTC 4UPDA 4C0WA 4Z6KA 1J24A 1N0WA 1EK1A 4KNWA 1QAMA 2P2SA 1I24A 4TTTS 2Q4BA 1VPTA 2NX2A 3PFFA 4HY3A 1TA4A 4KFTA 2B1RA 1KOJA 1LQ2A 3MTJA 3OZUA 4TVBA 3NHFA 3VR4A 1BCRB 3WOHA 2OCYC 1BXKA 1JDBC 1EH5A 2PANA 2VF8A 1RVV1 3GQBB 3WSVA 4CRWB 4KFCA 2EKDA 1RYFA 4WLOA 3ZI4A 1FLNA 5CDFA 3DVSX 4HWSA 4DXDA 3SVLA 3DBRB 4EELA 3TMKA 1PQUA 4EYOA 1Z8FA 5G1NA 5K45A 3LO5A 5H81A 5KYVA 4P3KA 3STXA 5GP1A 4DB2A 1UKAA 1O94C 2FZ5A 3HMQA 1B00A 2ZB8A 3TRKA 2WAYA 1DMRA 2W6JA 4J16C 4Y2VA 1QG6A 1V6CA 3SR0A 4HB4A 1KDVA 2B25A 3PXCX 4H59A 3QW4B 5EJ2A 3UH1A 3W1EA 5TLSA 4QDTA 2G8LA 2BFWA 3LG2A 2VTBB 3LY5A 1EWTA 5F52A 3F2IA 1S01A 5E9AA 2Z2IA 4AY6A 5SICE 2QIOA 2EL7A 1L4YA 1PEYA 3GLKA 4N1AA 3WAKA 4CLRB 1FYEA 3LKVA 4HGPA 5EWMB 1IN8A 3KQSA 1RWOA 3QVLA 4Q9AA 3CRZA 4Q4JA 4UXHA 2FP3A 4QM6A 4MIOA 1G8JA 5IAKA 2G67A 3COSA 4B3XA 2GHIA 3D2AA 4YPVA 4DR5B 1DT3A 1A5BB 4E5YA 1TM2A 5KJFA 3UC9A 1OHHD 3HCNA 3P9YA 1SK8A 3T3PB 1UAGA 4F7DA 5FL3A 2CSXA 2IUFA 3LF1A 3P19A 4I8DA 3M34A 3WBBA 1R6DA 4EHDA 3C7TA 4LN1A 1K6EA 1H8HD 2I5PO 1YWGO 3INTA 4OYHA 3CF4A 1MAWA 5DNYB 1PTKA 3ZWDA 4ZO8A 5K3CA 3QLJA 5ENVA 5HKKD 4W8OA 3DA8A 1GV0A 3NANA 2QEQA 4GP9A 5FBHA 5T5QA 4EY7A 5A5DA 1INLA 1GGJA 3FOBA 4Z54A 1F0YA 1TU3A 4YASA 4BNWA 4D8YA 3X2SA 4C0JA 1BKDR 4U5QA 3VHRA 4DANA 5AVZA 5KB3A 4HDKB 5IEJA 1GL3A 2GS9A 2DR3A 4K9LA 1H6DA 2C8LA 4IXMA 3V2UA 1NNSA 1XD2A 2FVYA 3GLUA 3WVNA 4AWAA 4HXFB 3PUHA 1LK7A 5CIYA 2V7WA 1QYWA 1T13A 1MKYA 2ODQA 1YJQA 2H2IA 1A4UA 4CMKA 3GDGA 3S8EA 1X8KA 2F43A 2GZHA 2VSXA 4K03A 4M0FA 2SKCA 4KX5A 1GSHA 2CMHA 2NZJA 2P2NA 3B1YA 4GW3A 1Z45A 4YJHB 4PX3A 3Q85A 2Z08A 4M7RA 4NP6A 4X5OA 1H3NA 5AUNB 3UXHA 1E9EA 1VGRA 1WXIA 2HMTA 2R6HA 3C7DB 4NONA 4TLDA 1DLJA 3PLRA 2OCPA 3WYCA 4I2NA 5EE0A 4KYUA 2G06A 3CKYA 4MRVA 2WJ3A 4X85A 3SP1A 5HRUA 1UJMA 3AJRA 3A3PA 4EVRA 1F0NA 1I6WA 2C3OA 3PHLA 3SZ3A 3ORYA 5BVHB 1EFVA 1I51A 5JNWA 1EUYA 3UPTA 1MX1A 2X7HA 2Y3IA 2QX4A 1QYIA 2ZQ5A 3QWBA 4QATA 3G2IA 1J33A 3B3FA 1LNZA 3E22A 1KYIA 3N8KA 2YXLA 5DISB 1AG9A 3TD2A 2XCRB 1RPTA 4N0MA 3GROA 3V4OA 1IULA 2VAWA 4NCJA 2XZLA 2QV0A 4YQFA 2AR7A 3HZRA 2J8ZA 2IDKA 1S1MA 2ZJAA 2VA8A 3IMGA 4PLVA 2OHIA 3P2OA 5DX1A 5I9SA 3ZE2B 3HR8A 1JMKC 1U8TA 4Y2GA 1QP4A 2FLWA 2XVZA 3EODA 1ODIA 1JUDA 2DPMA 4S2UA 4U9HS 1UPFA 2WQ6A 3ZBTA 4NQZA 3UMCA 2EW1A 1EHYA 3QJYA 4GMGA 5ALWA 1SXJB 4TMZA 4CMIA 5AW6A 1UEXC 3BZBA 1YOVB 2AG8A 1DC3A 1PK9A 2XUJA 4R8RA 1BFKA 2QLNA 1WZEA 1XKTA 4NSNA 1V4VA 2PTGA 3G8YA 3MF4A 3WLTA 3B60A 4UHCA 4KITB 1T3HA 2H5LA 1U04A 2BUAA 1WIWA 4YI3A 4MLDA 3TTVA 3WL6A 1JQDA 3CPHA 4J1SA 3E81A 2GEKA 3H2GA 1CF2O 2XSZA 4OU4A 2QM0A 4YDHB 1SC3A 1XAIA 5JEDA 1ESCA 3TX6A 2WWTA 1MEJA 4A5SA 1BXZA 4QDOA 1MJ5A 2XXJA 5C8VA 1X19A 3WB2A 2P4EA 1HRKA 1X86B 1OGYA 2JIMA 2O2HA 5C3UA 1YR9A 1C8VB 4KEAA 3EBLA 5HOQA 2PLRA 3BL6A 2GYWA 3KB1A 4PZLA 4IIJF 3HUTA 4S0ZA 2DF8A 4D3YA 3NOQA 5SY6A 3RVQA 1TDJA 1M1YA 1I5RA 4FX5A 3PT9A 4BL5A 2HR1A 4BRSA 5EIHA 2PWPA 1U3CA 4CKXA 3TBKA 1UKEA 1P7ZA 4XGKA 3ZLTA 1NYTA 1XZBA 1DJPA 1GNPA 3UMBA 1TK9A 4O02B 1QDEA 2PL5A 1DEXA 1J7JA 5B2ZA 2JAUA 3AL0C 3SF0A 1PD0A 3Q9UA 3LJKA 4ARIA 4KO1S 1G0NA 2PJZA 3N0WA 1HPLA 1GUFA 2IYTA 3A26A 3KPYA 4NMXB 4RY2A 1ZVKA 5C1IA 2WQZA 3OZBA 3DJYA 1DOZA 1ORVA 5CCEA 1ADGA 1WRBA 4B7ZA 4ZQIA 2UXCB 2GPJA 3OTHA 4D4GA 2ECFA 2PMKA 1YBAA 1J00A 2BMVA 2OSBA 4OM8A 1RRGA 5EG5A 4ZYTA 4DUZB 1EWRA 3IDAA 1GZ3A 1FTQA 2D3WA 3NWJA 4KOEC 3TCNA 4O2AB 4B32A 1OAAA 2V0CA 3K2BA 1PL6A 4H0CA 2F48A 4ROSA 4UE3S 3IIMA 4D9JA 5M7EA 2QRUA 2IHNA 4HHEA 3ZV5A 1A5ZA 2BFFB 4KLRA 3TOSA 3EOAI 2ZUCA 3NM6B 1N8TA 4UTPA 2Q0XA 1P1CA 1U0RA 2CSUA 2WV7A 3NH6A 3AW9A 5F21A 2WZCA 3HDJA 2WG2A 4OXQA 1K9SA 2W6JD 5FL7D 4EF6A 3TFOA 1TEZA 1Z0FA 3DV9A 3H65A 1S9HA 2IZ6A 1VG0B 4RD6A 5DW3A 2X5NA 1QZ3A 1FLDA 2B61A 2JKYA 5A3RA 1W49A 2E6UX 1ZWLA 4HZIA 4CIYA 4XIGS 3G5AA 2G28A 4OM7A 3AG6A 4NJEA 1U94A 1QHYA 1OIXA 2A5LA 3EYAA 1J1UA 2O7SA 3GF4A 3R5SA 5HQJA 2VXBA 1MN6A 1LU9A 3E6AA 2ZYVX 2YIJA 1US8B 1Z6QA 4F4JA 2DUJA 1KJJA 3RC9A 4IHJA 2QA5A 4B0OA 5IYZA 1FLVA 3LRTA 5FT9A 1J22A 1SKYE 1AKTA 3DGFC 1R12A 2A1TR 5K01A 1IN1A 2MYTA 3B13B 3EOZA 1QYDA 1T4GA 3ODPA 5J2TB 3T95A 1KJWA 1WUIS 2UYGA 3OC0A 3RHSA 3LAWA 5TQ0A 3VHXB 1XNHA 4R40A 4FONA 1MAUA 1TFRA 3ZQUA 3A9TA 3JTEA 5KU1A 3C3MA 3AR8A 4LYYA 3ESAA 2D4HA 2X19A 4NYMQ 3TB6A 4RPIA 4XTCS 3DOHA 4BKOA 1JW9B 4I4TB 2P3QA 2WHEA 4O4HA 4Q21A 4KIWA 2ZK7A 3FUVA 2CBZA 2ZIZA 2YJNA 3BE6A 4ZPXA 4Q1VA 1JPVA 2DWQA 5E6SB 5HEKA 2I8CA 3TQTA 2IGTA 4N5NA 2PE5A 4Y0NA 3GCGA 3HFRA 4MVJE 3FHLA 2XGMA 2C78A 5JS6A 1ABEA 4M87A 3SYKA 3KKKA 3PFHA 1GEGA 3G2QA 4NCKA 2F90A 1TT5B 4JEIA 2CL5A 4BX0A 3I32A 3WBJA 2XAUA 5B3KA 3MBKA 4M3NA 1JYSA 2H5JA 1E5QA 1Y3HA 2QN1A 4ZT7A 3HCEA 4DA8A 1QQAA 2XGJA 3PVSA 4A91A 1XRLA 3ZZMA 4C03A 1P81A 4V0RA 5LYJF 1GDTA 1XLVA 5CD1A 3OFNA 4NXNB 2V58A 2YZKA 2OHXA 3D8RA 5KSZA 1I9GA 2NT3A 5HKBA 4ADSG 3OFKA 3RFVA 3R7NA 2Y1GA 4DAOA 3TW8A 7REQA 2GCEA 1U9YA 2QOEA 3ZY4A 3HLKA 1V3TA 1BW9A 5ECYA 2PZFA 5J1TB 2I7CA 1GL6A 2MT9A 4EHKA 2CDAA 5JPCA 1N7IA 3GAFA 1BHQ1 2C2OA 5KYWA 1PDOA 1Z8HA 4EY5A 4LMPA 3MRVA 4LSGA 3PHIA 4GXTA 3NASA 4NBWA 2AT1A 1QH1A 3OEED 5FO1A 3IRVA 2D7JA 3GXOA 1ST2A 3PZBA 3ESQA 3VO8A 2PT9A 4LHYA 1RAIA 1JIJA 2VRWA 2ZVJA 3HYLA 3LOPA 3AI3A 3L07A 4B31A 4DM3A 1J9GA 5C32A 3AQIA 1XPRA 5IJXA 2P41A 4R8SA 5U4QA 1ZMXA 4DTCA 1DC7A 2GJSA 2BKAA 2GB4A 2GPBA 3CTMA 3KQOA 1TQ8A 3KBOA 3LVFO 3Q7RA 3OBIA 1KVTA 3CMMA 1AXRA 3QE3A 5IT4A 1Z63A 1NW7A 1WA5A 4D25A 4KQGA 3BGWA 2P65A 3WMXA 3IP6A 4WN9A 2FWBA 4BGVA 4EKGA 3ABZA 5CFOA 1J0BA 1ZI6A 4IZIA 5L95A 4D5EA 5LVAA 2B9VA 5GADl 3ICQB 4CMAA 2D0OB 3GFFA 4OGLA 3SYNA 4CFYA 4G26A 3GY0A 2K5UA 2D5AA 5FA8A 1F8GA 4YQYA 4C0XA 1W94A 2GD2A 2PNJA 3MOGA 5D6OA 4R1TA 3VKFA 5JJBA 2V9CA 5AHRA 3K70D 2W2QA 4P7KA 4REOA 1ISFA 2AK2A 3HI6A 3BA1A 4EUSA 4RJIA 4O4JA 2FWNA 3HP1A 1E2HA 3P8ZA 4UNIA 2R6R1 2VF2A 2E85A 3EYWA 3NJRA 3QE2A 5FPHA 5HBGA 3WADA 2REBA 5DNEA 5I7UA 1U0BB 1I2MA 1W85B 5JMPA 1ZP6A 2YWGA 2G63A 2ZJ5A 1WMBA 3ACBA 3UA4A 2H59A 4OSOA 5CDTA 3VI3B 4CKWA 2EBUA 1GM5A 4FI3F 2EHDA 2EKBA 4CDNA 4D9KA 1THZA 1JKJB 1Y1SA 1KH1A 1M0WA 2NM0A 2SKDA 3ILYA 3LC0A 4RLHA 1T9GS 4GZMA 2A7XA 2W6ID 1J0XO 4UZFA 3TLXA 2I2FA 5IC5A 5K7SA 3OE4A 1W36D 2FUNB 3DE3X 1PEDA 2WB4A 1EE2A 2B6NA 2GH1A 4GZ6A 2F8MA 3EIUA 2MIIA 4OI4A 4ZCSA 3WXMA 2ZRJA 3A14A 1MC1A 1U1EA 3FMVA 1PQWA 4L2IB 5E7JA 5ESXA 1CIJA 2YOGA 1G20E 2PXXA 4PU0A 1YV9A 3MOIA 4IV8A 4JFRA 1D2HA 5ALVA 4RS4A 1T4DA 2QW8A 4HEJA 4YRQA 3RQIA 4CEHB 1ZN2A 4BEVA 4IDHA 3C43A 2IIBA 5JROA 1UJ6A 2OUKA 3O8LA 2WDZA 4C4TA 2ANBA 3OG9A 1WD7A 2C94A 5FHRA 1P31A 3IUSA 4BNDB 4HS9A 5JSZB 1D2RA 2JLQA 3PHJA 3ZDAA 4RKFA 3SQOA 2ZIGA 3EN0A 3AVYA 2UYYA 1OBHA 3IP1A 2I6GA 4FFPA 3U4AA 5EP2A 2PSDA 1OZFA 4UM9B 3H9QA 2FPSA 1JR3D 2HI0A 3MTIA 2HA0A 4N6NA 3EVGA 4RA9B 1JEYB 4LISA 5JYCA 3KEFA 3AEZA 1A7AA 1QKIA 1J25A 1MC5A 3QVMA 1W0JD 3LPLA 3C7AA 1S7CA 1PBTA 3GRYA 4HXYA 4QXMA 4CV2A 2J9XB 3B6ZA 5DNDA 2ZZKA 3BGOS 4D4IA 3UNXA 3QP9A 4LYFA 3W4KA 4CHTA 5CDSA 3O3NB 1Z4NA 2ZYWX 3K0BA 1IXKA 4RZXA 4XGQA 3TRDA 4LV6A 3SI7A 3FJYA 1FBNA 2P6OA 3KQPA 4KFSA 4W9NC 5KWSA 1J56A 1RQPA 4HAVA 1GFSA 4R3NA 1YQDA 5CFZA 3RRMA 1ODJA 1HSOA 3AVXA 4IIXA 2II6A 2MCFA 3SIWA 4Q4AB 1YL5A 2G76A 2NV6A 2BF4A 2QUZA 1W87A 3TI9A 1JKMA 2B92A 2ZUDA 4IFIA 3EJ6A 1GU0A 1Y0BA 4JBYA 3QMMA 2PUJA 3DP9A 4DNPA 3BT7A 3RSSA 3G1UA 2R00C 3AM5A 4G24A 3ZY5A 3DAFA 2VPIA 3ENWA 3I04A 3FBWA 3NBMA 4IGAA 1MHPA 5G0WA 3T3GA 3ZOKA 5JC1A 1UKVY 4TRJA 1KWGA 4LF6B 3D8BA 2PMBA 2QG6A 1UMBB 1DV2A 2HHJA 4TQUS 2QZSA 1FMTA 2QLLA 1U1IA 4OQLA 3UV6A 5BNWA 1U8FO 5K3SA 1VKZA 3TAHA 3KJGA 1JU3A 2PMFA 2WSSD 3HJRA 4TZKA 2UU9B 3PPIA 2JIQA 3PXAA 3O8DA 5E1DA 3N74A 1AS0A 4TROA 3RU3A 1G5QA 1UPUA 4RPKA 3OOYA 4OGWA 1R6UA 4XLLA 1PT8A 3UKOA 4LZPA 2ASEA 3WGVA 4DSNA 1BE1A 2XUAA 5F9HA 4YYZA 1QRRA 5LMCA 3WISA 5ANRB 2HWWA 2O8FA 4ZVNA 3ZVMA 5EJ6A 5E95A 2J3HA 4WNYA 1ACJA 4Y2HA 3U4QB 1LBHA 4DR3B 4HRAA 1HWYA 3LWBA 1N33B 2QI9F 3IOMA 1JI3A 1P0FA 3PPXA 4RIHA 4AG5A 4GHWA 1VYUA 5REQA 4TS9A 3NG1A 1CVRA 3T94A 2NZUG 2D2IA 4RHUA 1MU0A 1R6BX 1GD1O 2DPXA 2EGGA 1YNOA 3E27A 3OT4A 4QTUB 3ZHZA 3CZQA 3CTPA 4W8GA 4CUJA 1U80A 3AF1A 1BRMA 3M6WA 3OJFA 4MB0A 3W2EA 3WDSA 2AHRA 3ZDXB 4CKEB 3OAAD 2CNDA 3O8QB 3R7SA 4H0NA 1ZL2A 9LDBA 2NGRA 1VJ0A 1UR5A 2C5EA 2ZUWA 3G82C 2P67A 2ZJ1A 4E5VA 2UUCB 1P5RA 4LJSA 1IHDA 2ONYA 1QG2A 2C9BA 3PHCA 4AJEA 2BGGA 5B1YA 5IDWA 2FDXA 1E6EA 2VHJA 3S1LA 4RHCA 5HUJA 3F74A 4ISBA 4HATA 4YP9A 1SWVA 1ZESA 2H63A 2VKQA 4GRDA 2VZ8A 3QLTA 1H1LA 2PSSA 4QPCA 5JNRA 1SUEA 3I83A 4BB0A 4ZI7A 2DR0A 1W7AA 2HBRA 1QK3A 2GD6A 2WVHA 3WLNA 2O8BB 2XD4A 1S8OA 1D2GA 2VSNA 2ZGVA 3A6JA 2QSUA 2VJDA 2ZUVA 1PFKA 5EPUA 4NPCA 3SZLA 4MDFA 2KYRA 4LYAA 3UMYA 2XWSA 1PZNA 1N6IA 1XN4A 4TV9B 3FM9A 3UMRA 5K3BA 3VOSA 4F6RA 5EJ9A 1HT2E 3KR9A 2XNJA 2VSYA 3BDIA 4TKVB 2AI3A 3MLEA 2YVAA 4G4IA 3ZE7A 1YOBA 2H11A 3A9SA 4BE9A 4ND8A 1B0AA 2ZDQA 1T4MA 3V46A 3CVOA 1RBQA 2WYVA 1JP7A 3AZQA 5IARA 4DHWA 5IUNC 1YZNA 3L8YA 1WNTA 1D2MA 4ETIA 3KYJB 4L8VA 4QBTA 1OJLA 2Z1NA 3L5OA 5UKDA 3TJZA 4KN6A 2PXAA 3A1EA 2ZVDA 3I8OA 3W05A 1I6MA 3JPYA 5B3JC 2EV9A 1WVGA 1ZNZA 3MCWA 1E2GA 3U49A 3RTBA 4DQLA 1XWWA 1E1NA 1WV1A 1PR4A 2R7KA 1LH0A 1RAEA 1OZHA 2BGJA 2ID7A 3I1IA 3WA6A 5D7BA 4DV2B 1H4VB 3M4JA 4RPCA 2QTTA 1NI4B 1J0CA 1XCLA 2FAXA 3TTTA 3WRXC 4FZVA 1JT9A 3WGIA 5DBEX 3GD5A 1GUYA 1X8XA 1OZ0A 3MMZA 2AS0A 1IDN1 3P2KA 4I1PA 3I8XA 3QPAA 4K6FA 2O8BA 2ATIA 1OXTA 3VH4A 4X7MA 2I1QA 2QUHA 3EGIA 4P22A 3KOXA 3KOYA 1IE3A 3WLIA 2I76A 2HPAA 3QJ5A 1YDHA 1ZQ1A 3AKZA 1Y5RA 4D5GA 4YRRA 2WM9B 4N54A 2DWOA 1JYFA 2MSWA 1NR5A 2ZE7A 1ZBDA 4EGQA 3U19A 2H4XA 4JJ8A 1NU8A 3N8GA 5ALSA 4CL2A 3G8CA 1VKOA 4WECA 3RV4A 2WUGA 3TQIA 4KQFA 3TLZA 3X43A 1RWKA 1RRPA 2BFBB 3BAFA 3WLHA 1TLTA 3U3OA 4A2QA 5BR1A 3J7AC 5EP4A 3ED1A 4RS3A 5ECWA 1JR2A 1O6BA 2NVBA 2FMHA 3QKSB 4GC5A 2VYQA 3RVKA 3CO0S 3NAGA 1PUIA 2XLBA 3DOEA 3BL8A 2EFGA 2FMKA 2QLMA 3VA7A 6GPBA 2NXEA 5LWHA 1D6NA 3PNSA 2Y68A 3LUFA 1CUEA 1HDEA 4GH5A 1CUDA 4Q7LA 4ZOLB 3SYRA 1MT0A 3AL2A 2Q3HA 1ZRSA 5IKOA 5CD9A 3DQZA 3DUFA 2PMWB 3GXBA 1LLFA 4C2TA 1PIWA 2P4QA 1HSZA 2DFVA 5KKAA 4E4TA 1LTQA 3VSBA 1EG7A 5A0FA 1GSOA 4L3WA 4MW5A 3Q3EA 4MRSA 2P1RA 3WHLA 2YYZA 3NV7A 4DT1B 1DWQA 4C88A 5CB8A 1N5MA 4MUKA 3UAVA 3UUGA 3I45A 2HDNB 4O4IB 2BCGY 4UUNA 1UODA 2YMLA 4G37A 2C3MA 1AKNA 3IILA 1SQSA 3CLVA 3G9XA 1E7YA 1RAGA 3H2IA 4MXDA 2I6QA 2Q27A 2Z8XA 5CM9C 1SBIA 1RCUA 2Z2YA 2CFOA 1I2ZA 3O5AA 4ZCPA 2Y9PB 2ZI4A 4QOHA 1KO7A 3ADDA 3RHFA 1Y82A 3EGCA 1GG2A 2VWHA 1LJ8A 3DBRA 4K28A 4LHEA 1B74A 2QV7A 4IDQA 4LBWA 1XZQA 3SSNA 4TUYB 2GBLC 4OHYA 1KEVA 2IFTA 2ZKLA 2FSSA 5B2EA 3OIUA 4MGYR 4IEIA 3THYA 3EMKA 4Q9IA 1JAHA 3S40A 2UDPA 1VLJA 4JYCA 4P38A 4QUAA 1B7GO 1PGOA 3AI7A 3DDSA 4D9EA 2WKRA 2FW0A 3RRZA 1NXVA 3O7MA 2FSVA 5B3LA 1CQJA 3BWCA 1H23A 4F3TA 5JJIA 3PFBA 3SQLA 4EIWA 1H2FA 4Q3EA 3HVRA 2HD4A 4F4UA 3AY7A 4RTPA 3ESCA 1K2VN 2EARA 4NG4A 4NCNA 1KFBB 1YQTA 1EM8B 1NJ8A 2UUBB 4EABA 1Z0SA 1GAXA 3DXXA 4CM4A 3SJZA 4EY6A 5AVVA 2WYUA 4WKBA 4YV7A 1PYDA 3WE7A 4CG2A 1YIDA 4PFKA 1K27A 3L1IA 5FUMA 3BWEA 3E22B 2MYNA 2YUTA 4LGMA 1KMHB 2IV7A 3DONA 1OXMA 1HTWA 2P4SA 1T43A 3VPHA 4Q1EA 5CFNA 1DAKA 4JMLA 3MUFA 1NN3A 4LXGA 4U2FA 3QNUA 3T3NA 3PKZA 3QITA 4PEVA 2I4OA 1JFFA 3MZ0A 4WQMA 5KVVA 4ESVA 4B3RB 1KI7A 9MHTA 1N6HA 3ENZA 2ZYDA 2UZ1A 3I6IA 1NC1A 4GYKA 1SUDA 2XVXA 1GAEO 1U02A 4TTAA 1Q7EA 2FYTA 4ACBA 4Z3KA 5JO0A 1HE2A 3R7BA 4HDMB 4KKVA 1QCCA 2QAJA 2FDRA 3T5CA 5DX8A 2P9EA 4JXZA 3T0IA 3OZFA 1T8RA 5JNTA 3H17A 2RG7A 3UG6A 3R3SA 1H05A 1R0BA 4IPTA 1GZSA 4D46A 4MA5A 4UEKA 2H2DA 4JQCA 1YR8A 2HK7A 3ROTA 1VP9A 4G1MB 4HS4A 1BEEA 1YKFA 1K7CA 3RG2A 2Y0BA 3M89A 4C29A 4CNQA 2D5LA 4KAAA 2H8GA 3OF3A 1COWA 5EKTA 5C8YA 2N47A 4ACAA 1YZGA 4DC9A 4BGDA 3HP4A 4PN7A 4GL2A 3ZJTA 1PJ8A 1GOTA 1Z7GA 1C1YA 1TF7A 3H4TA 4MGEA 3GT4A 4OP2A 2VC2B 1B16A 3K9LA 3ZXSA 2HF7A 1K68A 3KYDA 1XDGA 2SBTA 3RAPR 3LKBA 3GLSA 3NWOA 4DIEA 3LQFA 2HQRA 3MGAA 1EI9A 1V7QA 2QRVA 5DVZA 3R74A 4F5DA 4O0MA 4CR7A 2FETA 1BJKA 3VM6A 2CNWD 3GLQA 4PAOA 1R0SA 4PLCA 3AJEA 1O1YA 1X87A 5ITZB 3KSBC 3AWIA 1B2LA 3BD9A 5G40A 2IYVA 2FFBA 1TYEB 4UVGA 5LMZA 1TVCA 4MVWA 1NG9A 3EXAA 1NYRA 4PYRA 2NU6B 1V9CA 4MJLA 4KMSA 5YASA 1TLFA 2P2YA 5KHLB 3QNWA 4JI0B 1AGXA 1USWA 4KO3S 4ZOCA 2FN9A 3ZNOA 1X1EA 4V0LA 1E1CB 3F3YA 5D86A 1A9YA 4EB3A 1EIWA 1KEEA 5G1OA 1UFQA 1TEXA 5ELMA 3SN6A 4AG6A 1KI8A 1YFKA 2L18A 3GFSA 4D42A 1JI0A 3BQMB 4D81A 1XF9A 2ATEA 3EXHB 1NW6A 3GGCA 4PWZA 3K8OE 4Q1FA 5BSHA 2OKGA 5CVVA 1LLUA 5KNCD 1CYDA 2JI6A 2B2XA 1U2SA 1U0OC 1U7HA 5I7WA 1LVHA 2HJRA 3JRNA 2WHXA 4LHXA 4H7JA 5B57C 4F5ZA 1KXJA 3OY2A 3BH0A 4CF4A 4K86A 2RBKA 3IJPA 5KOHA 1FOEB 1QX3A 1IUPA 1NBHA 1G6Q1 2B7CA 1M1YB 2RCNA 3OOJA 3QPDA 4Q3NA 4V0MA 5E2IA 1UEIA 4DPMA 1AK9A 5IG2A 2FZCA 1VPEA 2LD4A 4YHHB 3OJWA 4WBNB 4DWVA 1ISMA 4I46A 1XKQA 1RWQA 2A1IA 2CBXA 4Z1MD 4PCLA 2R8BA 3FOWA 4MMYB 5IWAB 1FU8A 4EVIA 1YBVA 4CF3A 4PW0A 3WGKA 4X84A 3ZS9A 3GPLA 4MPTA 4L75A 5FRDA 1X15A 5KOJB 5LL6P 4P1ZA 4G4SO 3LTNC 2H8KA 3DCIA 2VJPA 3LFTA 4IIDA 5KVQA 3WKEA 5DM60 3JX9A 2BBSA 2R2AA 3DTVA 1O97C 1Q14A 3FFBA 2WU8A 2WUWE 1A1SA 5I4CA 4GI7A 2A2ZA 4ME6A 2GRAA 3IOBA 1I3LA 4KXVA 5FWNA 3GR6A 5AJTA 4H60A 3KE9A 1GA1A 3DSRA 1NJ5A 1BVRA 5EIFA 4PRKA 4X3PA 1OUMA 4MJXA 2WD7A 2G88A 4IJMA 3RTEA 2QQEA 2WU4A 2GESA 2WMOB 4YJGA 5FV4A 3P9CA 2O7QA 5AD1A 1LBEA 3W3AH 1AUPA 4YO8A 4KWCA 3E23A 3ZKWA 4DABA 2X5JO 4JB8A 3GLFA 4LYDA 3ZGVA 5JCJA 1ZWKA 4PPNA 3FCEA 3QHQA 1QK4A 3ML1A 2XX3A 1C5KA 1Z2NX 1UFVA 5DT2A 3JASA 1L5VA 4YCJA 4C78A 1VSQA 2X0RA 3CVXA 3R0QA 1B41A 4OLFA 1R4NB 2I2AA 4EB0A 2HJWA 2C29D 4Q03A 3QLVA 1XD8A 1WD5A 1LS6A 3EVFA 4FEEA 2P40A 4IHJB 5JAMA 1D6JA 1QWOA 3X44A 3G5UA 1GNQA 1T3TA 3I9V6 4PN3A 5JOQA 1AMOA 4KLAA 4LX8A 5E1MA 4GMKA 5K0CA 4JYZA 4PLYA 4BCBA 3LZ6A 1NT4A 4OY3A 3ZLVA 1GCUA 3GFTA 4NJEB 3MELA 1CDOA 3CT6A 5BSFA 1L7RA 1A8IA 1X7HA 4MP8A 2XUKA 5F3WB 4H3SA 2EJTA 4I9FA 3LZCA 3AM4A 4HK4A 4PC2A 3VDRA 3E3NA 1QGED 2QXUA 2AQKA 1ADFA 3MTBA 1PZFA 2AW5A 3EXIA 3U17A 3G89A 4O4IA 4BNNA 2NO7A 1ZXLA 3DZHA 1E66A 3HFSA 3IQEA 3ND9A 5KYTA 3UBMA 2JJ8A 4AUMA 5BOSA 2QI9C 1T3ZA 1QV6A 1W9MA 2VWPA 2XKJE 4GGPA 1G8KA 2PWAA 3TQSA 3V1UA 3FTFA 3UAYA 2OAGA 4MHOA 2WINI 3K6JA 1GZ7A 3EGOA 4KN9S 3URMA 5BWLA 1DX4A 2RGNA 2XUPA 1QCDA 3ERCA 3WGYA 4AO8A 3BHJA 3O1IC 5C52B 3DE0X 3GT0A 4OAPA 3JY6A 2C20A 2YICA 1LBIA 2ZJFA 2G1PA 2KMLA 4RTQA 1KI6A 2W6MA 2VDOB 1N2ZA 1DC6A 2X4LA 3SSMA 1CUUA 1GCOA 5BV2P 1DXOA 4XXHA 3RRBA 4BQQA 1LK5A 2A9PA 3CUWA 3D8HA 5ALIA 3KXPA 1YR7A 1UXOA 3KJXA 3V33A 3T61A 5JASA 1OHHA 1BVYF 1ND5A 2BFPA 2ZIVB 3FGZA 1VYHA 5KCMA 2P4UA 3DW3X 2EF0A 1I36A 2Q3FA 4F72A 4D9BA 4LG1A 4YV2A 1BW9B 1JR3A 1P80A 5JEEA 2ZQZA 4L3OA 2WLSA 3B1VA 3ZDZB 5GV7A 3G1TA 4EHJA 3JWIA 3T4UA 2Q1WA 1SURA 3C5CA 4EGAA 4YV1A 4L76A 5H3LA 3MCZA 3TDNA 3AHDA 1JSXA 2IDJA 1NZJA 1WWKA 3V42A 3DTVD 2NO4A 4LY6A 4ZV4A 4X1YA 3U7QA 5LIPA 3Q3IA 4EHBA 4W5OA 1E7WA 4OI0A 2ZIEA 5LD2C 2CEAA 3CZ9A 1R74A 3EEFA 1RCFA 2POCA 3MCUA 3MIZA 3S5JA 2JLAA 5I5EA 3L9WA 1NUPA 2AXNA 2G70A 2FUKA 1E1MA 2NUTB 4WUVA 1KEWA 3IIJA 1VPLA 3WMFA 3TNJA 2DR2A 3KKNA 5IJ0B 3FBGA 5B1EA 4RZIA 1J23A 3JARB 1JEYA 2O8EB 2RHWA 4ZZ2A 1PX2A 2ZPUA 2GM3A 1SBCA 2FX2A 2OWEA 4LXHA 2NO9A 4Z0PA 2ZAIA 2PGJA 3D9QX 4UOQA 1DIOB 4G4SP 2C0QA 4Q47A 1QHFA 3WHKA 3PYXA 4Q9DA 1RPAA 2XCQA 3PFCA 4GPIB 3NKFA 5T64A 4KDCA 1RZRD 3TM5A 4PPQA 2I4TA 1CY0A 1C7EA 3UTCA 3H04A 2B6HA 2YMQA 2NXCA 3HGTA 5E4JA 2R5NA 1V1JA 2VUUA 3BTSA 1JAYA 2CHFA 2IF2A 2R66A 2XV1A 4QU0A 3SXUB 4WCFB 1RZVA 2Q1YA 3ROZA 4WDQA 4BP9A 3J81A 4ZZ1A 1OXSC 1TADA 4TRMA 2XY4A 1E2BA 2BFOA 4YGXB 3M9LA 4PXYA 5JANA 3GRRA 3W9SA 4DLBA 4X1IA 1SELA 4ZI7B 3MCAA 3S0JA 3GLHA 4JJ4A 3VZCA 3O4JA 4B80A 4IH9A 4YX9A 4C0QC 2Y67A 4FFNA 4FXOA 4FT2A 2CN1A 2Z3WA 4UDXX 1NXQA 2BGRA 3ZE8A 5K09A 1E60A 1ZJ6A 2ZM5A 3RT9A 2V3CC 2ZYIA 3OQIA 3QXJA 1W0KA 4P93A 3H2YA 2V1UA 1VMAA 4M46A 3TG8A 3I6QA 2E4XA 3NW9A 1G16A 2JVJA 2ZRDA 1QGOA 3GFPA 3FMOB 1WKBA 4P9NA 2W90A 1ECBA 5TE9A 2GRJA 4Q01A 4BVGA 4BQEA 4BV3A 2CYCA 1N9GB 3LXXA 2PUTA 4UVEA 3ZHBA 2XXBA 4J16A 5KJ6A 1OB2A 2CMDA 1DFHA 4IQ8A 2QX7A 1OTXA 2UZ1B 1CJCA 4FE3A 3RRXA 4GX1A 3CF2A 3K0EA 4B33A 1JJAA 5K3OA 4PQRA 5KO2A 5ICSA 1JLRA 721PA 5EHIA 3V4PB 4Q93A 3TSZA 5AW7A 2OXFA 1ICEA 3PLAE 3DVQX 4E5NA 3K2QA 1COWD 3QA3E 4OB6A 4BBAA 1PSDA 1Z5VA 1SZCA 3IODA 4LJLA 1GZ6A 4RH3A 1OPXA 4Z3DA 2VF5X 4H1VA 4MS1A 4C14A 1C9EA 3W06A 5F7JA 2XDWA 4B7AA 5HJ5A 3FSRA 3JQ9A 1KO4A 3OPYA 4MITA 3OTQA 2Z3ZA 3T3EA 3DTVB 4XFKA 5A5FA 5BSKA 3SEAA 2WAXA 1ZXBA 3CNEA 3LX8A 4WERA 3Q6MA 4Y6RA 3IEPA 3KQHA 4ZCTA 1CEEA 4JUDX 1TO2E 3UN1A 2AXPA 4MYRA 1DWOA 3BCSA 4ZDKA 1MFZA 1JLHA 1V11A 5JISA 4XAQA 4U7TB 1DSSG 1L7AA 2FFAA 3NDJA 2P6PA 3B85A 4QX6A 4WWHA 1C50A 3FI9A 1QTQA 4DR2B 3AGPA 5FWAA 1O6CA 1SA0B 1FX1A 3CZ5A 2OQRA 2WUDA 3JARA 3P0RA 2RB5A 2WG0A 3P97A 1OLOA 2FQYA 3B8EA 4N5IX 1Y1QA 4FBMA 4GQIA 5BN5B 1OAOC 1NBAA 1RMYA 3NBKA 4HDNA 3A2MA 5FB3A 3U0BA 2QTGA 2RGDA 4HB2A 4IDGA 2W93A 4OA8A 1BCRA 2XYHA 4FQ8A 4AZWA 1ZONA 2ZR0A 2XOEA 1CK4A 4FUTA 3KWMA 4HN4B 4D9FA 3RCBA 4EHAA 1P9NA 3IB6A 2BLLA 2YR0A 3Q1LA 5G1PA 5D3MA 3OZVA 2ZJ6A 4HLCA 2A1UA 1C80A 4GOLD 2NUBA 1R6TA 2IHZA 3IOEA 1PR6A 4GUDA 4IWNA 1PZHA 4P7FA 3VC1A 3KTFA 1QTRA 4Z7QB 3N3BC 5BV8A 2CD9A 4WNAA 5ARCA 3BM5A 2VWGA 3G9TA 4L8LA 4OOEA 5ESRA 5BN3A 2D1YA 1YKGA 2IPXA 2OFXA 2P8JA 2ZW9A 3G7SA 3MWDA 1TW3A 3DDWA 5BXYA 4LMRA 4NZYA 1YZTA 4OJQA 1KZYC 2QD2A 4OP3A 3RVLA 1PI3A 1M6WA 5JTTA 3ETEA 3E7XA 2J0UB 4JQSA 4F86A 4JP2A 1VSVA 1XTBA 2OFPA 2PEZA 1SR8A 1UBOS 3H1TA 3I1YA 1Y4UA 2PQ6A 4EKEA 4MO2A 5J59A 4J0IA 4LZZA 2R44A 4ER0A 4FFWA 3KUUA 4PICA 5FTMA 3RB8A 2CL0X 1X1CA 4BMNA 2W5UA 4CM3A 1ISRA 3ADBA 2FUG1 3E03A 5WRFA 2PL9A 2PJDA 1PGQA 4Y8VA 2J9FA 2WTEA 5JAQA 1OGIA 1CJTC 1GNVA 3CH5A 4ZCIA 5DK6A 5F5NA 1HE5A 2BEJA 1VA4A 3RYIB 3MT0A 1FSFA 1DINA 3IDZA 3ZJ5A 2FG5A 1UWKA 1R5JA 4IVNA 4TRRA 2XMPA 4KV9A 2DP4E 2I78A 2OO7A 2ZDGA 3AR7A 2C7OA 2XOKD 1ENPA 4M1QA 2HO4A 3GJYA 2PM8A 3TB4A 2P0AA 1XMSA 1BNCA 5DCUA 4OQ4A 5EP3A 1WPRA 4FFLA 2LW7A 5EFOA 1HDYA 3PYLA 1R6VA 1YONA 2HT6A 1JSZA 2ZU6A 3GUCA 2OYRA 3GLHB 4R2IA 3PQCA 3COWA 4ZT2A 5H82A 1BQ3A 2DHEA 3B1FA 4DLWA 4GQAA 5CA1B 2Q29A 1ZHFA 2VK4A 2WMYA 3MILA 2EGUA 3USZA 1VG1A 3NKVA 4ENRA 2BH9A 2PVSA 3WNBA 2H7CA 2MR6A 1NAIA 1T1GA 2PAFA 3FDJA 3QWHA 3V7UA 4QFMA 1DI0A 1G6KA 4JL6A 1YL6A 1G7CA 1D4AA 1NE2A 3ECSA 2CXPA 3QKUA 4LW8A 4UOZA 3TTXA 5HE8A 1EZ4A 3NT2A 2C4KA 1ZRMA 3BFKA 3IQGX 4C4OA 2XQFA 1TTTA 4JI8B 4JEUA 4LCJA 3CLRD 1AIPA 1HE4A 1I0LA 1SK9A 3GJZA 3E9YA 4P0QB 3IP7A 2W6NA 2F3UA 2Y1DA 4MQFA 2BMFA 5JYBA 4M1TA 1D1QA 1I3KA 1JPUA 2FZLA 3CU5A 3V8MA 1KAOA 5IBCA 1EP9A 3OCUA 1IPFA 2H06A 3O4IA 2VXOA 4B7XA 4C20A 4PLHA 2QVCA 1PWEA 1KI3A 2GI4A 4ZMSA 4L3VA 1FFXA 2W4MA 2AGVA 3TR5A 4BZXA 4LNAA 4QFBA 2NADA 1TT7A 3QU4A 3HJUA 1AKWA 4GX2A 4AJHA 3OIYA 4H7KA 3Q3HA 2FUCA 2IIQA 3I3SR 1K4KA 4MEAA 3RYHA 3H16A 3VPXA 4YUZA 4KR6A 3DYIA 4PG6A 2BEKA 5HILA 4TYNA 4UD6A 1HT3A 2ZIUB 2AK3A 4JH0A 2A5DA 1VZ2A 1ZSVA 5HJ7A 5BMVF 4C0AC 2B8JA 3L93A 4WCDA 3FD8A 3QZUA 1QGYA 1W75A 3AL3A 4HDQB 4FILA 5AVRA 3R0XA 1NVAA 4GE0A 2J0EA 4KXLA 1VIVA 2R8XA 3WQHA 4YMWA 3G0CA 5JFGA 3W5DA 1XWFA 1UXJA 5KWVA 4GR9A 2FTKE 4BO6A 1M6HA 4M1KA 4HNUA 1PDVA 1KYZA 1W0CA 1AQ6A 2H92A 1ZIXA 4BO8A 1CFJA 3F6PA 2V97A 5IJ0A 2FMIA 3TDMA 2ZCVA 1NOKA 4JVOA 1HQDA 1I0ZA 1BMDA 1FS6A 1YVEI 1RLJA 2J5RA 3CPSA 3I9LA 1ZDMA 5L3RA 3ZV7A 3QXHA 3QLUC 2Z6QA 1IUNA 1X9GA 4MUMA 5CIQA 2E21A 1TD1A 5JBNA 4JBHA 1JF8A 1KI6B 2V4ZA 4G0ZA 3WLPA 3FTNA 5K0FA 2LVBA 5LQSA 4YCLA 4Y9UA 2VTVA 5C31A 1CD5A 2BGUA 3HP7A 3GFGA 1KI2A 1A82A 1O87A 3T12A 1USUA 2I34A 1BJRE 5REQB 3WMGA 1DO2A 5J2UA 2BD0A 3EA0A 1PWHA 5ICFA 2NPIA 2Q3MA 4F4FA 4JI4B 2ADMA 3EGXA 3TW6A 1MDBA 3ENKA 1YC5A 1VDZA 2JF0A 4XVQA 1C4OA 2RBGA 3FI0A 5EZYB 3SAJA 1UC4B 1Z37A 4TTVA 2FEMA 4JP8A 5HKOA 1MXHA 3I9OA 4YAWA 5LQMA 3RYCA 1DKRA 3ZWPA 3IQWA 1F2VA 1N2IA 5G4KB 1Z0ZA 4NBRA 1XRJA 3Q15C 3U4HA 3A6DA 3LTEA 5DLYA 1U28C 1FMJA 3I64A 1LDMA 3CX7A 1BMQA 4RK0A 4YDSA 5ALXA 3ZK7A 1LS1A 2YYAA 4HLDA 1IMJA 3DO6A 5C53B 4IQFA 2XQGA 3KR1A 3MWEB 3ZTWA 4ES6A 3QE9Y 5BUCA 1CUIA 5EJ8A 1WP4A 5DU2A 4PVDA 3DTYA 4XSGA 1E3DA 4J0KA 4YRKA 4L16A 4Z99A 2C83A 2W00A 3D4OA 5CR9A 3WTCA 1RAAA 3OQIB 3SJ7A 2OLEA 5I9TA 1ML4A 1N6NA 3COPA 5C8YB 1O58A 3HB5X 3I76A 1XX6A 3OZDA 5K4HA 3UMMA 1QAOA 4HEA1 1Y8AA 4BN4A 2Y1KA 3X1ZA 3MN1A 2VS1A 2AQHA 1E63A 4GP6A 3SNKA 2ZRQA 4LZWA 2QN9A 3L7OA 4UE2A 2WOJA 1QLHA 4LBYA 5DO9A 3EVAA 3NAMA 5ALUA 2GZ1A 1X7WB 2ERCA 3S2SA 2W0MA 3I09A 1QZTA 2ODEA 1DT5A 2ID9A 5KTPA 3V7WA 3AQ4A 2BGMA 3V2HA 2JFUA 3ZQ4A 4JBLA 4NIMA 3T1NA 5C8ZA 4A8JA 1RPJA 2Z1DA 4HT3B 1U3DA 5JXJA 1B14A 3H86A 1W46A 3HA7A 1ZK4A 2RCYA 4K7JA 4A8JC 5TT1A 5EXXA 3Q4GA 3M5CA 4AAYA 5KNBH 2HIHA 5EXDA 1PG2A 3MWEA 4IJ6A 1CEQA 5H3HA 1ZOPA 2YJ6A 3R3ZA 2ZM6B 2FWIA 4IH1A 3ADCA 1KNXA 1BJTA 1OXVA 3R3HA 5KSPA 1MF7A 2XF2A 3EIHA 4FOLA 1DRJA 1MB3A 2YUIA 4HCJA 3RBVA 1J90A 3TGWA 3TGPA 3MWYW 5KSWB 2ISSD 3C3CA 4TKVA 3L4JA 2OZLA 4PIVA 3WYAA 1TC1A 1VCOA 4TWBA 2CLSA 3LUJA 1G17A 4S35A 4XX1A 4QZVA 3FDZB 4MDYA 5CVJA 5FWYB 1CQIA 3I73A 1U99A 1A9PA 1W5BA 3NB0A 1SULA 3B7PA 5JPIA 1GP2A 1QMGA 3ANSA 1IAVA 1MORA 3PDIB 3T7IA 2D3TA 4HDRA 2JDID 2YFKA 4PBSA 5DNWA 2VL7A 4CE6A 4AQDA 2ZBGA 3WNZA 1BTOA 5JHHB 3CLKA 4Y67A 1LDBA 4MUNA 4HAYA 2ACKA 3M33A 2Q4DA 4K1LA 3HCFA 2H51A 2CCGA 1P45A 5FHQA 2XT6A 2EF1A 3RD5A 5A02A 2XKKA 3HWSA 2Z5VA 4NS1A 3B1JA 4XX0B 1M33A 1Z6TA 4FKBA 3BS4A 4CM5A 4ER7A 2IYYA 2E55A 2R8PA 3A36A 1NVUQ 3LNTA 2JBAB 2WFLB 2FXVA 3DB1A 2HMWA 4UXIA 4UXJA 3Q12A 5CGQB 5E9QA 3SY8A 4GQBA 3HKBA 4IIJA 2I67A 2VTEA 1D8TA 4L9WA 2G9VA 3PC6A 3T06B 3WIOA 1W4RA 5C7YA 4P4SA 2I1LA 2C2BA 3L0CA 1NF9A 2QVGA 3R41A 2FPMA 2C97A 3VOBA 4C6TA 4CEIA 2OP1A 3LRPA 1RQRA 5FNVA 4AU1A 4XYLA 5KYGA 5AVSA 4R9VA 4GDFA 4NI5A 1EX7A 2IQIA 2O06A 3E0XA 2BIFA 4K9NA 4BNMA 3KPUA 4DJAA 4U7DA 1SXQA 2Q9BA 4HAXA 2FFHA 1Z16A 1U1FA 3H18A 2C59A 3LH5A 1HETA 1CUAA 4CFZA 2A9VA 3U4QA 1XHFA 4P82A 3SHTA 3VNUA 1U4OA 1GA6A 5E6UA 5LQKA 1TUBB 1XJ0A 2FRDC 2HX1A 2Q2NA 3A31A 1K6JA 5K1ZA 1BDJA 1VIMA 5IM4F 2I3GA 3AW8A 2QG9A 3QW2A 2O14A 4NHOA 5E3JA 1RACA 5KTOA 3GLIB 2CVZA 1F8XA 4Y9RA 5ALDA 2YRWA 1X80A 1P77A 4I08A 2GNAA 4WGGA 1V9LA 4YJ3A 3P2EA 3JWEA 2QT0A 4HEHA 5ER9A 3TIFA 2NP6A 2G80A 2Y6VA 1Z73A 3N7AA 4FSHA 4ND6A 2BJWA 2VDWA 1V0JA 4NC9A 4ZQGA 5FFNA 2V0NA 2WJVA 4P0PB 2AD5A 2XRMA 1OVMA 3OCJA 3P7MA 1KY2A 4MQFB 2O4CA 4BNKA 2EFEB 1FJXA 4X7RA 1UKYA 3DMYA 2RAPA 3HEAA 4JOSA 4DLYA 2HDWA 3VMMA 2WF9A 4L5JA 4P53A 5SV2A 3BSSA 3C8MA 1I13A 1DRVA 4KYTA 4P80A 1VFNA 1U4SA 2WU3A 1HDOA 3VFDA 5GY7A 3DAPA 5JWOA 3GPDG 1HFJA 2BFAA 1TMKA 2GO1A 2I3ZA 2H4YA 2Y4OA 4Q4AA 4GMFA 4B84A 4DMFA 1LJUA 3V80A 1VG9B 4QOEA 4S1WA 3UCEA 3JQQA 4UATA 3RUIA 3KHKA 4AB1A 5DEOA 3M81A 5BP7A 1JIKA 1JVNA 1SNYA 3UC5A 2O5EA 1DG1G 4IUDS 1PFGA 3VGPA 1M6NA 2R6FA 3MGGA 5SZIA 2JASA 4QUEA 4Y1EA 1C2YA 5H5JA 2VJLA 4TOIA 1RBZA 3AMVA 1FRFS 2C7VA 2CXXA 1SG6A 3DBHA 1KO5A 2I4LA 3A3KA 3GEGA 1M6VB 4K40A 2HM7A 4MYTA 5FO0A 5HIMA 4E1VA 2I9KA 2XZPA 2ZPTX 1NAHA 4WCFA 3N2GA 3MOSA 1E20A 2DERA 4C7OA 1YRLA 4R4JA 2AUNA 3PEFA 3H11B 5P8WA 1XQVA 2NU9A 4M83A 4Y2YA 5DGDA 3RYIA 2OQIA 3IJRA 2HRBA 3N1UA 1WY7A 1Q1AA 5C8YF 1O0CA 1XF1A 4PC3A 2QL6A 1KK0A 3GHYA 4N47A 3FMGA 3H11A 3AOEC 1WVMA 2YBEA 4PGGA 1U2DA 3BICA 5HW0A 1MCZA 3KPWA 1UMCA 1OW3B 4DG5A 1L1QA 1L7XA 2O8EA 4LZNA 6CHYA 1PLKA 4IMJB 2WWGA 4AX4A 1ZX1A 2NV0A 1T6XA 4QREA 4RD4A 2Q5IA 4MRPA 1G291 2DWPA 2VNAA 3FYUA 1D2EA 1FFGA 1XR3A 1I8TA 2QMUA 1AKYA 2XMRA 3FPSA 3HBJA 3BKXA 1NUAA 1P4AA 3ID6C 2V54A 2B20A 1YFZA 2TMDA 3AGQA 4HMOA 1FFDA 1N75A 3FNBA 4U6QA 5BURA 5HQ3B 2JLCA 3VR0A 5LZ9A 1ODCA 3FSJX 1G9SA 2G3YA 4FHGA 1IRXA 4KO2S 3AB3A 2IGBA 4XPZA 3TLJA 3KYIB 3CPJB 2LRHA 2C61A 3SBOA 1GKLA 4CTJA 1NFQA 5IVPA 3H9CA 4YCMA 3I62A 2BFMA 4ARUA 3JXEA 4E11A 4L57A 1T9CA 1A8HA 2XGOA 3BD6A 3I2IA 1F1JA 2WA1A 4PYIA 5LJIA 4QLOA 4CCWA 1NF3A 2BKVA 1G0OA 3WV5A 2QJRA 1WHTA 2JFXA 3PFNA 4MI1A 4D9MA 2R5FA 3L7CA 3RS9A 5JD4A 3OY7A 2WFMA 3GQBA 2QNRA 5KWIA 1SU8A 4XD7A 4WKOA 2NYRA 1VZ3A 3PNPA 8GPBA 2G6TA 5JY6A 3GU3A 1AJEA 2VOEA 2NUAB 3N58A 1EBUA 1ZQ9A 1E9DA 2GZDA 4XFJA 4CF5A 2QUIA 1YA6A 1N2GA 3PC8A 5HCNA 3F6YA 1OE0A 4GPZA 1XD9A 4DQKA 4LQLA 1Y8RA 2VLBA 1LB1B 4QQRA 1AQUA 4ZANA 4RHEA 5THXA 1J8MF 2P90A 3VUEA 5LOVF 1HLPA 2PT7A 3JRXA 4LYGA 1QBKC 5AXAA 1XU4A 3HPQA 3HYTA 3RM3A 4A0SA 5CA0B 2G72A 4D4HA 4FN5A 2WYOA 4WV3A 2E2WA 3ZU4A 3E2IA 4OX9B 1F0PA 3S2ZA 2J5BA 2YC2C 3KUCA 5FJJA 3TL6A 3ELWA 4QKQA 2ZETA 3N87A 4J1NA 4KGVA 4QNRA 1DXQA 4YAOA 3R3JA 1E2DA 1RXUA 1ZM4A 4U8HA 4YMVA 4CVNA 1JFLA 1M75A 1WDTA 4WFIA 3M1LA 1QH1B 4NK5A 2ZCUA 2UXBB 4Q9KA 4WJZA 2OD7A 3T9EA 1FB5A 2DLNA 2WHRA 3LOUA 2IXEA 4QTZA 4FIDA 1E1QA 1BDBA 1CQXA 3TQFA 2F3TA 2WAMA 1G6HA 1Q0QA 5IJZA 2D7CA 2CDCA 3SX0A 4ZMBA 2ZIXB 3KX2A 2F8TA 3M5PA 3OQVA 2JJ1D 4BCDA 4J0JA 2C5FA 2G9QA 1YDGA 3LQRA 4FGLA 3FTCA 4NZNA 5CLJA 3K70B 4NPHA 1D4ZA 2VP4A 4JYBA 4QA9A 5KNCH 2UYOA 4RF2A 4KZPA 1I4OA 4XIIA 1DEOA 2C7BA 2WIDA 2C5BA 3D5QA 4OHPA 3GW8A 1T0HB 5DPMA 4FCWA 1JFRA 4YBZA 5EKSA 1NRIA 2I1VB 3EUWA 2QJTA 1RHJA 3SEQA 5KNDA 3QU7A 4YP0A 5LYJA 3MGCA 4YMTA 3UGJA 1J2RA 3JQAD 4PHFA 5GGYA 2PO7A 3PQ8A 4C0LA 1GG8A 2EXXA 4N40A 4EPYA 4ZTBA 5IC6A 1YI8A 3U3KA 1E8DA 4WKCA 1Y37A 1O5TA 1S2NA 1PP4A 2ZRPA 3FF1A 5CIWA 3PIIA 5CA0F 4CR8A 4WFJA 5HNKA 2HW8A 1RBMA 1S3GA 4Y2XA 2OZVA 3LT2A 3RVBA 1POXA 3I01M 4AICA 3QQ5A 4EBFA 3NBUA 5CAEA 1BAPA 4BYGA 4DADA 1M7GA 3N6RA 4LI3X 3R9KA 2VUIB 1WG8A 2PWBA 4HNVA 3KOUA 5AKJA 3D1JA 1IPEA 1PNQA 4KQ2A 4MVCA 2X8LA 3EG9A 3NTRA 1E94E 3IP3A 4F7WA 3JS5A 1AZLA 3NXSA 4RSRA 5T3YA 2IVZA 2IYAA 2XCOA 3QELA 5E8JA 3UMGA 2O8NA 4DSOA 3V1LA 2HLDD 5BVGB 1EEHA 5CXQA 4CLOB 1PJRA 5LBUA 3HDQA 1R16A 5ADHA 1M6VA 4HLNA 4TRNA 1G98A 4JLAA 4J7AA 3OPXA 1IU9A 2QVBA 5DYIA 1BMFD 2QRPA 4B4VA 1LSOA 1J20A 1YASA 5CJPA 4OAQA 1CE8B 3PXDA 2XCSB 1DFIA 1Y3IA 4Z53A 1H85A 1CR4A 1TJPB 2H1SA 2V9PA 4B2PA 3NVMB 3HCWA 3WB1A 4BLUA 5BYAA 2YHAA 4R01A 4EVSA 3FJ1A 3HG7A 4MV0A 5JLAA 3QX7A 3B6IA 5DTEA 3IBCA 1SXHA 1QYXA 3L02A 1FFBA 4K88A 4E5MA 4ALIA 1FNBA 4US2R 1KR2A 3OPNA 4I6EA 1UPTA 1WZUA 4QM7A 5KYYB 1F12A 2GEJA 1BE0A 3JQFC 3BVPA 4NCBA 5CFMA 2OLKA 3Q3VA 3DL0A 3QVOA 2GUWA 3KU1A 1AURA 3UK0A 1BGXT 2IH5A 5ICCA 2G08A 5DOZA 1XRPA 3T5MA 1B0PA 1O6GA 1PGNA 3I9FA 4PCVA 2GPTA 3DLPX 3NYQA 1S0UA 4YK7A 2YHIB 3TXXA 3ME5A 2VAVA 5FPPA 3S29A 4AMYA 8ABPA 1IVSA 1TF2A 1IY2A 1ODKA 5F5XA 1OY1A 1ST3A 4DZTA 1FDOA 1FVFA 3ZVKA 2QSYA 3IQXA 1YHZA 3LFHA 1E1QD 1YHYA 5EMMA 5K51A 2JLWA 1MABB 2WKSA 4J7UA 2APJA 2NP7A 3ANYB 3G2JA 5KREA 4O1MA 5J23A 4EPWA 4IUCS 1ADJA 1PF7E 2A9JA 2PLNA 1S6YA 2WD8A 1U3TA 3CEAA 4GX0A 4J0CA 3VU8A 1T1IA 4MRAA 3IVRA 5ALJA 4BB5A 1GQSA 1WMFA 4DLUA 5B1IA 3GX1A 6REQA 2PFSA 5JALA 1KWKA 2BUBA 2YWRA 1Z29A 2W22A 3NLLA 1NVVR 3IV7A 4XDHA 1R9MA 4C5BA 2WUEA 1RXEA 1LC0A 3KQLA 4J07A 1NIJA 1Y6JA 3O0TA 2X0KA 1PO7A 3A1SA 4NEHB 1T2DA 4BIIA 1SUIA 2FA9A 3TW8B 5JLJA 4ODIA 1ZJJA 1WHSA 4JX8A 2HXYA 3QBEA 4NFSA 1E7QA 3OPQA 3G2KA 4ZO6A 4EW6A 2C5SA 2VXCA 3GGSA 4MQUA 4QEKA 4TUYF 5CB4A 4CQLA 1IOWA 4R1NA 1UBNA 5DP2A 2ASVA 1N3BA 4KE8A 5D6NA 5LP6C 2O2YA 3E3MA 2H54A 2ZITA 4LWOA 3EA5A 4EG7A 3IXQA 2GMWA 1FVOA 2PNFA 1RKQA 5ALQA 3E70C 4RIGA 1E7MA 5EESA 2VJCA 2Z57A 3BXEA 4Q02A 4WBSA 3WWYA 4FQ7A 5B58C 1TMGE 1KRHA 3BORA 2WRZA 4RELA 3FHTA 3AJ8A 4DM4A 4G0QA 1SBTA 4ARSA 2Q7DA 1NBMA 4IIGA 2R7NA 2QM7A 2V5VA 4G2NA 2FKNA 3RDPA 2JZNA 1VIYA 4LMAA 4OFBA 5SZHB 3I52A 3MJFA 3LBHA 3LI2A 4M0DA 5F4ZA 2QY9A 1WBDA 4KDEA 3ZZNA 4DV3B 2HF8A 1L9KA 4E88A 5P21A 1B43A 4RPJA 4HDSB 3TEFA 3FNEA 3B1XA 2BDEA 1FFXB 2CDBA 5CPBA 5KYUB 2O3UA 1X70A 3ZHXA 4BX2A 3A25A 2MSCB 2BM8A 3KTAA 2WYHA 2VXYA 4XUDA 1D6SA 3UWKA 4C89A 4IV5A 1WKVA 5LDGA 1YE3A 2L69A 2QW1A 3SKVA 3VYSB 2NAFA 4EFMA 1DZ3A 1XU7A 4KPEC 4A0QA 5J2TA 1HR0B 1Y7IA 4IQ0A 4B74A 3CLUC 3PGXA 4B8WA 3AI1A 2Y1WA 4G5HA 3CBQA 2A30A 3P32A 1ZICA 4IJQA 1E1DA 1E96A 2FW9A 4MIKA 1U8CB 1US8A 1Z2OX 4AS1A 2P5UA 2FLKA 3A2KA 2XJ4A 1Z47A 2JFZA 3N5KA 1G8MA 3NWBA 1IAQA 3OZGA 4QXOA 4HVTA 5EIBC 4EZBA 2K7FA 2RHBA 1NQOA 4ERXA 2QF7A 1C30A 1SZPA 3VZQA 5L9AA 3IVMA 1Z07A 1GCIA 2AEMA 2CXRA 3KV3O 2M9MA 4KIGA 1CTQA 1G8PA 1CZKA 1GVHA 4C30A 3JD1A 4ONEA 3UAZA 2CJFA 1YB5A 1JQJC 1RLTA 2OXEA 3HUDA 3RF6A 1Y5LA 2QP4A 4F6LA 4ZQFA 2QSZA 4F91B 1CRLA 4BX8A 4EO7A 2OMEA 3ON5A 1SZJG 2J46A 5ARBA 4YRJA 4UE6A 4FMCF 2R85A 4AWXA 4C04A 1KEEB 3FB1A 3V3KA 1DAFA 1IHPA 1PNRA 1WUKS 3QX3A 2X8AA 3LRXA 3ET4A 5I9IA 3CRRA 2XWPA 3PPWA 4ZVSA 3LGXA 4TGLA 3ZDYB 4KMRA 1SG9A 1W4BA 1VJCA 3UT0A 1TCCA 2OV1A 3K6RA 3RANA 3IE2A 3OLCX 4W99A 3OUUA 4GFDA 1SCUB 2ADFA 2Z98A 2J5QA 4MW9A 4EUFA 2RHHA 1NI5A 3Q3GE 5AM4A 3GYBA 4BJ3A 5KC9A 1YSCA 3HKBB 4WADA 4FE7A 1L7VC 2IHKA 3MWLA 2D2EA 2Z30A 3U6KA 5HVNA 3I0ZA 3AERA 2CK3D 4NDNE 2ZTUA 4M53A 4QL3A 5COAA 1E3WB 1WAMA 1WEHA 1JILA 2Q6LA 2UZ3A 4KYVA 3G0OA 1C3OA 3ZK8A 4EG6A 4LXXA 5F7OA 1DJLA 1Z0JA 2BL4A 3AT1A 3BXPA 1CDEA 1G4HA 1AUXA 1HXHA 2BEUB 2QN8A 3DR3A 5C1BA 4LF7B 3NHUA 3KJQA 2EKLA 3OM0A 2D2FA 2C4WA 4D4LA 4QXAA 1GTVA 3DCJA 5H68A 5AJYA 2V7QD 1DRUA 1Q1BA 3OPYI 1R0LA 3CUTA 3ZLJA 2QLJA 4HDRB 2PFGA 4JLDA 5A4DA 3WI7A 2ILTA 4TLCA 1UM8A 4C4PA 3R8FA 1E8NA 1CLEA 1DBQA 4EY4A 3NYIA 3P9NA 1E89A 3K4PA 2PPLA 3AY0A 3QHAA 4RE6A 2ZRKA 1NRXA 4Z7NB 2I6TA 5A6SA 3PEYA 4TWRA 3DGEC 3PJGA 3ETDA 4Y1RB 1LI5A 1ZC3A 2IH4A 3BQNB 3E5RA 4JYPA 3RIYA 1XEAA 4XJTA 3W5IA 4C76A 1IZ8A 4E2YA 3BF7A 3GUVA 1IEXA 2FV8A 3ITNA 1GN8A 1II8A 2IUUA 4QSHA 4TQ9A 4DV0B 4K05A 1OLXA 3JVDA 4QNNA 2E18A 3W3AA 4IOLA 2WSIA 2WEKA 3EA4A 4KI7A 4TSKA 4N3AA 3DBVO 3QFTA 5FI1B 1JXOA 1AOXA 2CXUA 1ZBQA 1O95D 3CNLA 3F73A 2EX1A 4QPNA 1N0HA 3LCCA 3DVLA 2GLXA 1U8UA 5IZCA 4IDOA 4V38A 5EZ6B 5KYXA 1XXHE 2W6IA 1OAKA 5JVDA 2I6FA 3EULA 3NXKA 3PA8A 4JU8A 4DIOA 2B30A 4L6CA 2I6SA 2FZKA 4IKEA 3VR4D 1Y63A 5CEEA 1QBGA 2DHCA 5EC8A 5FDFA 1XMPA 2YZ2A 4MTLA 5NLLA 5C3MA 5C8DA 2I9PA 5I51A 5C81A 1H2EA 1ZSYA 3LUPA 5K99A 5DTIA 4CM6A 4L7QA 4WXEA 5NULA 3RASA 4PR0A 4MV7A 4Q4HA 1JYEA 5FP0A 2V7BA 4TQGA 3IIKA 1CR0A 1N4DA 4YCBA 4BVLA 4OJNA 1J42A 2BMJA 1SXPA 2NZYA 2PL3A 4FSXA 3Q5GA 2A9OA 5KVAA 4IY1A 1SKMA 4E21A 3D6HA 1FIUA 2O2DA 4OI2A 1S2GA 1LQTA 1Z33A 3E53A 1JA1A 2FK7A 3BFXA 3ZDBA 3WZMA 3LUCA 4B9EA 3Q6IA 3C0KA 3JSAA 3WDLA 5A3JA 3NRCA 1YZKA 1IY1A 1Y7LA 2X0IA 4RY8A 2C9DA 1PEKE 2CXHA 3NEYA 4Y1GA 3EEYA 1J7KA 3U3DA 3UMSA 4FQ5A 1ZSNA 5E6UB 2IPAB 4NV3A 4X63A 3RS3A 3UJDA 4NU8X 5CEFA 2FMUA 1Y33E 3SVTA 5HZMA 1LGYA 4S1VA 2J48A 4FU0A 4ZEXA 1JLLB 3IKMB 1Q7TA 1NPTO 2HSWA 1DUSA 4MB6A 4EX7A 5I7HA 2H1CA 3K9NA 4JT8A 4KRGA 5K0GA 4DCUA 4XJVA 4B3BA 1E2MA 2RKWA 2JGAA 4LCEA 1PD1A 1HFEL 1U81A 4CLHA 1DQPA 3L8HA 4C7XA 1XXHB 4WLNA 1K8ZB 1UDRA 4L4UA 4YJ3B 4ZJZA 1SKYB 4MVYA 2DBZA 5K0SA 4C0SA 5GMOA 1UIRA 2QLTA 3BJIC 2RGBA 4EF4A 1T8YA 2GHRA 3V1MA 1JHMA 4QRIA 1K8RA 1T9ZA 2LKCA 4GI1A 5EE1A 5JSHA 2GJ8A 4ZAYA 1T5IA 4ZA2A 2CNNA 9ATCA 1VCNA 4YP5A 4A7PA 2FNAA 1VBNA 1KH3A 5LLDA 4CZ2A 1NQ5A 2D5IA 1FP7A 1ISPA 5AKXA 1JWLA 3F7TA 4J8PA 3VR6H 2PFKA 4AG3A 5CBKA 3NTVA 4AL4A 2IX3A 3KUDA 3OSUA 3B5EA 5CVCA 3GLGA 4YCSA 1QOPB 1CRPA 3OEHD 4JLNA 1QIEA 1UP4A 4RVSA 1E0DA 1B1AA 3LIIA 3DV2A 1XROA 4WBXC 4REQB 3ZDEA 4QG7A 1B8PA 1Z6YA 2Z04A 2CFRA 3G6WA 4FDAA 4CDMA 1NSTA 4DUGD 2XNDD 1FRQA 3LT5A 3ZGLA 2XB2A 1YRHA 4G5FA 4BNJA 2JFPA 3G0IA 1FNNA 1XAJA 4MVJM 3TX2A 2AMJA 2J6BA 5KDOA 3V8QA 2LCFA 2YWDA 1Q2UA 4JT4A 4XD2A 4FYIA 3EW9A 2EZ4A 1UJ4A 3ZD9A 5KVCA 3AP2A 4CGYA 1EJ0A 1YBFA 1C81A 2CLOB 1CB7A 2DULA 3QOYA 1ZGBA 5TMEA 1UPCA 3NBZC 2VYND 1M1UA 2W2LA 3DZ8A 4DTIA 4BN0A 2DTDA 2RSLA 2OXTA 3NEPX 1JMYA 5TQ0B 2IU6A 4MYCA 1KK3A 4BNGA 4OHOA 4D8UA 1FFSA 1M7HA 4R7TA 4CM8A 4IO1A 5BVHA 4CW7A 2JAXA 1RTTA 2JFOA 4P4NA 4MYUA 4PV7A 5HKLA 4GPTA 1OXXK 1TYDE 2OVFA 3OJCA 4NENA 4AZSA 1WR8A 5JSZA 2VDLB 2C1ZA 1MAVA 2GM5A 3K0HA 3QH4A 3GAMA 4J1QA 1GG5A 1RWNA 1W96A 2BI4A 3BMCB 3I1FA 3N75A 1FC0A 5E6SA 3JWPA 3GLTA 4ZT3A 1YB4A 4KWEA 1I2BA 3UG7A 3TRJA 4KAJA 4W5TA 5ISMA 2R7LA 4NYIQ 4U4AA 4FYMA 4GRIA 1JLKA 1NJFA 1T8TA 4MW7A 2FSHA 4KR9A 1XZIA 4KVZA 5LBIA 3LPMA 3RODA 1JZSA 3FR8A 4AO6A 4F06A 3IBFA 2IS1A 4HYQA 2XYPA 4XLTA 3OTWA 1C8LA 4MUEA 4JJ7A 2PG3A 3KJIA 5B3JA 4JI3B 4IOKA 2AQIA 1T26A 3GC6A 3HWRA 4V3CA 1DKMA 4QYIA 4WXPA 5JADA 1L5ZA 1A9XB 2PZKA 1DCTA 1G5IA 4W1RA 5HKKA 2E87A 3DC2A 1KP9A 1SVNA 5E2BA 2FSIA 5L7TA 3H97A 4A36A 3JQ8B 4FCVA 5BQ5A 3B1WA 1RKVA 4M1OA 2VJBA 4QBGB 2ZAOA 3LXRA 4RA6A 4X45A 3KWLA 1AQIA 2FPOA 3IQHX 2P35A 2VIIA 1WOYA 3QTBA 1QQ5A 1UIMA 1IXZA 4W9RA 3S2UA 4DIKA 4LX0A 3JQCA 3GLFB 3ESRA 4NAUA 3UOAB 3E7FA 4BFCA 3IUYA 4QYXA 4R2LA 4CN8A 4H2DA 3BBLA 4X0EA 4D9CA 3TRIA 3PTLA 2IXAA 3RWBA 4LXTA 3THWA 2ZUTA 1M3SA 1LWOA 4I7EA 4RORA 3VU9B 2CZCA 3DF7A 5FAXA 1WPXA 2B3TA 2R6GA 4XASA 3ZWQA 2QXTA 4L78A 1X0XA 3JVIA 2V74B 1RM5A 5JRDS 5A4MS 1DDIA 2FRXA 2YQ4A 1Z74A 3N6VA 2C4TA 2PDAA 3OX1A 1HZZC 1Q7GA 1JQEA 1AXEA 1TUGA 1H6CA 5AI6A 2G04A 3ZW7A 2VQSA 1KPGA 3EDOA 4OQXA 1ZN7A 2B35A 2FSUA 4MKHA 5I8ZA 1EX9A 3MS2A 4CM9D 4JLSA 1JTEA 2NQ8A 3H4VA 4JOBA 4WESB 2O6LA 3D8TA 5C5CA 5L3SB 4P32A 4GR5A 2EJVA 2VSOA 4DLZA 3IVXA 4LTMA 3D64A 3WRWA 2XIQA 4XFDA 1E5TA 1USVA 4KV7A 5A71A 5IKXA 3A10A 3TCXB 4B2IA 3NT5A 4Q37A 4A8PA 2Z1MA 1ZNYA 5LKAA 5LXTA 4LXIA 3TLAA 5A4IS 4ZD6A 2JKZA 1HQCA 1SIUA 4OQPA 1QVZA 1Z4KA 1V5EA 3H5AA 2PWYA 3A6HA 1SPBS 2ZBDA 3DHVA 3PGLA 1J0AA 4YHBA 3V4FA 4DBLE 4IGKA 4YREA 5K6RA 1ZCAA 1PFYA 1WDWB 4HRXA 3TQCA 1PL8A 3QE4A 3KOOA 4DYHA 1M2HA 5CCDA 3I5XA 1C0IA 3CB4A 2H9YA 5D01A 4GSYA 4UU1A 5TB5A 4IH4A 4WAUA 5KEIA 1HEIA 1PJ2A 1O8CA 2W6ZA 3MJVA 4L85A 2C07A 1MIHA 3ZX5A 1TAHA 2FHPA 4RLSA 1YRQA 2IUEA 4R6XA 4B73A 5IKPA 4TXHA 5AQEA 3HS3A 4IDPA 1EK0A 1JIUA 1NW9B 3SZMA 3U9LA 2X2FA 1U6IA 3AVPA 3A06A 2YVQA 4Q00A 4DMUB 9GPBA 1LRLA 3I72A 4R0NA 3RRFA 1K0FA 3RIMA 4P8RA 3AUTA 4X20A 3THOA 3UGTA 5B36A 4EBBA 3PUIA 4PR3A 5DN6D 2EFJA 4WESA 3CGWA 1XWIA 3QELB 1LW7A 4O2LA 4F5EA 4TKUA 3V8PA 2PUDA 2J3IA 2PU7A 3GGPA 4L9AA 1M8JA 1TW2A 1M34A 4FHFA 3SWWA 4MWZA 1HMPA 4MICA 3GJSA 3O8OB 1IN4A 2A92A 4N49A 5IYZF 2AFVA 4JI1B 3WIDA 3ZGOA 2LBPA 2RIPA 4J7CA 1PYGA 4KOAA 2XWJI 1BFUA 3BEOA 3D31A 5EWLA 4BNYA 1EFPB 1EBFA 4YQEA 1YR1A 3RC1A 4P5DA 1CYEA 4ZDJA 1NN1A 3IMCA 4A27A 4BWYA 2A3RA 2XE7A 1OI3A 5FQNA 3IH5A 1MAHA 1LBQA 1PHRA 2DSNA 1Q57A 1R15A 3E3AA 4B34A 1VL6A 1ZUIA 4JBXA 1ZG3A 4YP1A 3CGGA 5JO9A 2OV3A 3SC2A 3N5CA 3UJ9A 4HP8A 1DHRA 4EKIA 4M0EA 1YZYA 1JGTA 4BLTA 4BNIA 4RYLA 4TLAA 2CMKA 1QV9A 2QXYA 3R9XB 1DU4A 2PWZA 1YQXA 1ADYA 2GVZC 2K2WA 2W4IA 3BHMA 4GWLA 3C3KA 3G2HA 2C4NA 1SXJC 4GVPA 5F1YA 3ZN2A 2G1AA 3D7LA 1PV2A 1B6RA 2Q6IA 1X7XA 3C3XA 3QTTA 4GLJA 621PA 3LK7A 3UHPA 2H2GA 3E8MA 5HPYB 1TE2A 2A4MA 3AKEA 1UDBA 2C0PA 4G97A 5CHYA 4MRRA 3UAOA 3V6MA 5EYPA 4TTRA 4X7PA 1IHXA 3MAAC 2OSVA 3Q8KA 4ZARA 1TI7A 4F9GA 1L7QA 4XUCA 2R96A 2P6MA 2R8EA 1GGMA 2VJMB 3D7MA 3K1AB 4LNUB 5K8LA 1MZPA 1I3NA 2WFZA 2HADA 5F78A 1W4CA 1I4LD 2RONA 1LA2A 4YT4A 4S12A 1N7GA 2BYTA 2OEPA 1U9IC 3JWGA 5G4KA 3AU9A 4L5BA 4Q4DA 5CVDA 2F3PA 5F33A 3ANMA 1G5FA 1N5DA 4ID9A 3CX8A 5KQMA 4G5RA 3U3JA 1F3LA 2WTUA 3WK5A 1Z3CA 2D74A 1Z0DA 1PJ4A 3CPEA 1CY6A 3BMOA 1XSEA 2EGHA 3EIQA 3MPOA 4CF6A 3LDHA 1BHO1 2CLFB 1HL7A 1N1DA 1NBWB 2AJDA 3L6DA 3TLGB 3WB0A 4D0SA 2WVAA 2GO7A 3K8ZA 3TLBA 2I55A 2O52A 3UXMA 1MG0A 4DRYA 2R87A 4WXHA 4MV8A 1FP4A 3AFIA 4ZOAA 4EA9A 1AKMA 2R1VB 1TLLA 3TSWA 3ITKA 2GZ3A 2IT1A 3I1JA 2X1HA 3PGKA 4HLQB 4Z9XA 1P8JA 3QLEA 4G5SA 3DE4X 5FUXA 4DMCA 1QS0A 3MTQA 4N5MA 3ECCA 4Q05A 2D62A 5DXAA 2PX3A 3F0TA 3IA2A 3H8JA 1JBKA 4PF1A 3O8NA 3OO1A 1P0CA 3TH5A 3ETHA 1J1ZA 4OU5A 4FLFA 3HNPA 4XM1A 2HJGA 2XI4A 3ENVA 2YVKA 2WJIA 5DSTA 2HIGA 4TTJA 1QO0A 2ODNA 4RBNA 3VPSA 4ABTA 2FR1A 4F11A 4RK6A 3R75A 5CNMA 1VMEA 5MN6A 1KYXA 3RI3A 4YUWA 1MHTA 3A6KA 1Z4PX 5DM4A 3TRFA 4I66A 1E3SA 2QP9X 3PPYA 5G41A 4MW0A 1V26A 1UZAA 1MIOB 1XDZA 4J29A 5HF6A 3AV0B 1BKYA 3IDSA 4ZT4A 1UMCB 3H1AA 4MTCA 2JW5A 2JJ2D 4TXLA 3SU8A 2PIDA 3GB9A 4LK3A 4I55A 2XVAA 4I4TA 3LCJA 5LWQA 4OLJA 1OKKD 4ID3A 5BWCA 3J80A 4AP5A 1FP2A 3F7MA 1DCMA 4AT1A 3OLZA 1X7XB 2CVQA 4F0JA 1T3GA 4DR4B 3GNLA 1G41A 2ORVA 3CEJA 4DSAA 1EAMA 4RTOA 3WYNA 4JHXA 1XP8A 4I5GA 4RA6B 4CKZA 1I01A 2QK4A 4LIPD 4AVYA 3OHPA 4C6RA 4TYWA 2MYPA 3EDCA 1P7CA 3E9QA 3NM4A 4QUIA 1TU0A 3HEMA 1UQTA 2GK7A 2XT0A 2YFYA 4D9GA 2EDCA 3BSYA 2ZAYA 4WOCA 3UJNA 2GF2A 4BVFA 1OD6A 3GMTA 4PLWA 2PTHA 3ET5A 3VJMA 3P52A 1PK7A 2Z4RA 1X7ZA 2E9SA 1Q1GA 4K3VA 4RVUA 5B58T 3U40A 1AN0A 2Q8PA 3UWSA 1CR1A 1TF5A 2FMTA 4HL6A 3WGTA 1QONA 3V4LA 4PRLA 4ENUA 4JBIA 1Q91A