4KCWA

Pyruvate kinase (pyk) from trypanosoma brucei soaked with oxalate
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
498
structure length
498
Chain Sequence
b'SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate kinase 1
publication title Pyruvate kinases have an intrinsic and conserved decarboxylase activity.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 186
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4kcwA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4kcwA01
2E28A 2X0SA 3HQPA 3LYEA 3SRHA 1IZCA 3SRFA 1A3WA 1PKYA 1KC7A 1PKMA 1O68A 4KCWA 4WJ8A 1M1BA 1S2UA 1OY0A 3P0XA 3QV6A 1XG4A 4L9YA 2HWGA 5JVLA 3QV8A 4KS0A 1E0UA 1O5QA 3HQNA 4MF4A 4IQDA 5TAOA 3E0VA 4LSBA 1S2TA 1SGJA 3FA3A 1ZLPA 3QZ6A 3QTGA 2QIWA 4B2DD 4TV6A 1OQFA 3SRKA 1F3WA 1XG3A 1DQUA 2HROA 2G50A 1VBHA 4L9ZA 4TV5A 1S2WA 4HYWA 1S2VA 4L80A 1UJQA 3N25A 2HRWA 4B5TA 1PKNA 3SRDA 1O66A 2BG5A 3H6OA 1U5HA 3KHDA 1F8MA 1F3XA 3EOEA 3QQWA 1JDEA 4ROQA 3E5BA 3GG8A 4KRZA 3OQ8A 3T05A 3OYZA 1DIKA 2VGBA 3I4EA 3PP7A 4G1NA 2OLSA 2VGFA 1DXFA 4KCTA 4KCVA 4QG8A 1F61A 4DRSA 3E0WA 1E0TA 3B8IA 2KX9A 3KTXA 4IMAA 3GR4A 1IGWA 2DUAA 2L5HA 2VWSA 2XDFA 4IQEA 2VWTA 4QG9A 2HJPA 1PKLA 3T07A 1VBGA 2VGIA 3M0KA 4L7ZA 1T5AA 2WQDA 3QLLA 3U2ZA 4B2DA 2VGGA 2XZ9A 1A3XA 1PYMA 1U5VA 3M0JA 4IP7A 4B5UA 1ZJHA 3OYXA 1GGOA 3PUGA 1A49A 3BJFA 4YJ5A 2R82A 4B5XA 3IS4A 1Z6KA 2XZ7A 3EZ4A 3MA8A 1A5UA 4FXFA 3BJTA 1KBLA 4RPPA 1AQFA 1MUMA 2ZE3A 4HYVA 3G2GA 3QV7A 3QV9A 3GQYA 4MG4A 3FA4A 4YNGA 4B5WA 4B5SA 1VP8A 4B5VA 3HQOA 2V5KA 4FXJA 1DXEA 3T0TA 1T57A 3EOLA 4QG6A 1F8IA 3R4IA 4QGCA 3ME3A 2V5JA 3LG3A 2DIKA 4JPGA 4KCUA 3VAVA 3EOOA 1M3UA
chains in the Genus database with same CATH superfamily
3SZ8A 3S9IA 4REQB 1P4CA 3LRLA 4MY1A 2ALDA 2VFIA 4X60A 1NTHA 1ZENA 3H2FA 1WKFA 3GTHA 3GVRA 1TE1A 3WDRA 3AJXA 5I23A 2ACUA 1WCGA 4PR4A 1S5NA 1HJSA 3MWAA 5ECUA 4WGHA 1NIUA 1LL4A 4F0MA 2PB1A 1BF2A 4ZA0A 1BPLB 1JD7A 3EKLA 1UJQA 3QGKC 4S3FA 1RA5A 5C9ZA 4O1FA 3EWYA 4MVAA 1Y5VA 3W7KA 2AGTA 4JN7A 4IPIA 2H6RA 1H7OA 2E09A 3VIIA 2DJLA 4KCVA 2H9AA 4J3WA 3L4YA 4W88A 1BWKA 1CWYA 1LL7A 2V3FA 4R7OA 2MANA 3M4HA 4FNPA 1KV8A 2VGIA 5MKGA 1OADA 2QCNA 4XISA 4EP8C 1E9LA 2WQDA 1AVAA 3K30A 4NKCA 1J6PA 2OZTA 3TWBA 5JU6A 4WDXA 3N18A 1QHZA 3UR2A 3MJMA 3MP4A 1KO0A 1K9FA 1HFBA 1LLOA 3C6CA 3O3RA 5CC7A 4Z1CA 1J0JA 4ZQPA 1M04A 1XL9A 3OBKA 1NOWA 1FWAC 3GHSA 2VO5A 4PL2A 3W1XA 4J28A 3ZVHA 3W7IA 1XIMA 1R2RA 2ZC8A 4UCFA 2YCKX 2OLAA 1U2YA 1XYZA 4HYRA 2HBXA 2V2DA 4NHVA 2V6AA 4UFKA 2OT1A 2DW7A 3S6DA 1WAWA 2AL2B 1RBLA 3PJUA 3HPZA 4LUJA 2D1ZA 1U1HA 1KFEA 3BVJA 3K46A 4H9VA 3UXIA 3GH7A 4PTWA 4X63A 4QAIA 3FXYA 4AD1A 1Q66A 1VEPA 1DHPA 1F76A 2WJEA 4WGXA 1W3HA 4DO7A 1PB0A 4HIBA 4LS1A 3DAQA 4E4PA 1DJNA 1KWGA 3P93A 5LHEA 2GVEA 7PTDA 1MW1A 4UMAA 3CYJA 3Q2DA 3NGJA 1VIWA 1NDZA 4LCRA 4QDPA 1E0TA 4XK2A 4BHYA 3WQFA 2BGSA 1Y5XA 1R3TA 1LWIA 1FFQA 1UR2A 3EA1A 3HFYA 4FR1A 3GNOA 1FP8A 1ZBWA 2XH4A 1HTIA 4JHZA 2YR1A 3LXAA 6ENLA 4IGSA 5IOBA 3TUUA 3P84A 5D2WA 4REQA 3R0UA 1SZRA 4JQ4A 2DEPA 3SCUA 4W89A 4NJJA 1FHLA 3L0KA 4JYDA 3MSYA 4HNNA 3L5AA 3VILA 3ZO9A 1TELA 1O5RA 1OT2A 1YE4A 1VH7A 4KIRA 5D09A 4L6DA 4C65A 1TFVA 3QR0A 1RA0A 4Y6GA 2GGJA 3PZNA 4GBDA 2Z1BA 5GJMA 3S8HA 2AAAA 1VCFA 3FVDA 2WM1A 3PK7A 3CK5A 2CXGA 2FQIA 2ISFA 2TODA 3WBWA 4ERAA 4A8RA 4R27A 2RKXA 3VDGA 4LNCA 4WD0A 2MNRA 1MW2A 3WKZA 3QKEA 1DTUA 3RGTA 1T96A 1CXFA 1PHWA 3II1A 1MZHA 4ML4A 3AIBA 4JFWA 1E1CB 3QHNA 1XLBA 4R3UA 4LVGA 1NOFA 4DJDD 1XCXA 3VXGA 3BWWA 3EXTA 2ZVIA 2AKZA 4HOXA 1UQYA 3RLGA 4ZO7A 1OGBA 1UWUA 4J3SA 2W3ZA 2IKHA 5LA1A 3CLMA 4S3BA 1XIJA 4OTKA 1M7PA 4N0RA 4UQAA 1W0MA 4RDVA 2QLYA 5I07A 1UWTA 1EUAA 1OEPA 4PMYA 4L65A 2CWXA 3CZLA 2VD9A 3FN9A 3A9BA 5HNRA 4GD0A 3OGRA 1G01A 2VVNA 3EMZA 4JTEA 1H0GA 2TMDA 3AIEA 1TCMA 3VABA 3Q65A 3TQ0A 1K77A 2QULA 1SQ7A 7TIMA 4M8UA 4HSHA 1XWYA 3W2KA 1DWGM 2PGEA 3BE7A 2AL2A 3KCJA 4JAWA 1WKDA 3SRFA 4HD5A 1JFXA 1JPDX 4YWSA 4LC8A 4YTTA 4KETA 4O52A 4G2DA 1K4HA 4UTTA 4PMUA 4Y7EA 1W56A 1MW0A 3BK0A 5LYRA 1W9XA 4MJZA 5FJJA 3S2JA 5FJIA 5T9BG 5CG7A 1OABA 1O95A 2G4FA 1IWPA 2YOCA 5E0FA 3HG5A 1DQUA 1XQLA 3IVTA 1C90A 2VEPA 1AL8A 3KRZA 2C18A 3SUUA 3WLSA 1KQZA 2GQ3A 1MZRA 4KGLA 1RBAA 1YYAA 1XISA 3BAXA 5TF0A 3WNLA 5C8BB 3QFEA 1V08A 3HGOA 3OZOA 4V15A 2GZXA 3WNNA 1DL3A 3VOIA 2ZWYA 1BXNA 3OAAG 4GHRA 1XYFA 2QIIA 2C14A 1FWWA 2VENA 4QJ3B 4IHCA 4AF0A 1E72M 5IHRA 3AZRA 1UA7A 3LM3A 1E56A 3S2CA 3U2OA 3P81A 3AU6A 3TJXA 3C8NA 4K8EA 4KT2A 4P7NA 4UFLA 2HE5A 3LMYA 5KZDA 3QV7A 4FZIA 3TQKA 5HJLA 4CQ9A 2W6RA 3E2QA 3GWQA 5AKQA 4LUYA 4MFEA 4LCSA 4ASTA 4JICA 3HQPA 1Q5MA 5HMFA 3RCYA 4KFPA 3ALFA 3JZUA 1JG9A 1JZ5A 4B3KA 3BW2A 3N15A 4OV9A 4EOUA 5D8ZA 1TV2A 1UBPC 1EOKA 4XD4A 1ZJAA 1XIFA 3RFAA 3VUPA 1QMLA 4LYPA 3MP3A 3FYOA 1GOIA 4L1WA 1W9BM 3WNPA 3N13A 3CH9A 2XINA 2DZBA 1CEOA 3TTSA 3VCRA 2WQPA 3GSMA 3WSUA 3URAA 3QQWA 1JDEA 1PL9A 4C1KA 3SY8A 5A8MA 3B8IA 3TH6A 1MVYA 2HISA 4IMAA 1E3XA 4H9XA 5CAHA 5C9RA 3UCCA 1IEIA 3CM4A 4WDWA 2QJHA 2PDXA 2DSVA 4GUGA 3W1MA 1EWDA 2FZNA 1J5TA 3VKDA 4HU8A 2CFFA 1TCDA 4HNUA 1QI3A 3E0IA 3KP0A 1X1OA 1JZ8A 5A95A 3QOMA 4LBSA 2W0UA 4YYCA 1S5MA 1UOKA 3R79A 4QROA 3UT0A 4TTUA 5G2IA 2J79A 4KBXA 2OELA 4BZYA 5SWUA 1EXBA 5D33A 1OF6A 3Q37A 2P3EA 2Q8LA 2OGYA 2ZTKA 1FWBC 4DAIA 2BY0A 2AQWA 1VKFA 4X22A 3CPRA 3BURA 1RQBA 4G9PA 3WFLA 4JTHA 2YFOA 1K6WA 5EFDA 7CGTA 5C0QA 2FTWA 4GFSA 1V03A 1ONWA 1ZY9A 4CQDA 3OU8A 1KGXA 4ZOAA 3HF3A 1LUCB 4XBSA 4GK8A 3E0FA 4C6PA 5D9OA 3M0IA 4QSHA 4JFSA 5KMYA 3QRHA 5CPOA 2WMIB 2BY2A 2UY2A 4DZ5A 5H1WA 2B4GA 3SFKA 1EF2A 2EQDA 3DHUA 1F61A 1GVSA 2QCLA 4OECA 3UGRA 1L9WA 2GLKA 3EA3A 4NAFB 3I7SA 1FY6A 2VWSA 3GX9A 4GIEA 1GYMA 1QHPA 4NXSA 4UQBA 4XD3A 3MV01 4IXXA 1XX1A 4LUTB 1YTDA 3W73A 3V5OA 1GYNA 3W37A 3K5XA 1SO6A 3P74A 3BQ5A 2WNQA 1W3JA 2DJXA 4CUCA 5HBFA 1Q6DA 1CZ1A 4Q22A 1EOMA 3KTCA 4AC7C 1TVLA 3R58A 1DXEA 4AMCA 4RZ5A 3FK4A 1F8IA 5F1UA 5E0CA 1GKRA 3RRAA 1TV5A 1JZ7A 3W9ZA 3TSBA 1K7FA 1HN1A 3KAOA 1TYGA 3HPAA 4CNSA 5CC3A 1QW9A 1ZS2A 3VIJA 3H2EA 3B8WA 1TJRA 2WNNA 1H8EG 2XIMA 1YADA 2NUXA 2OSWA 5I2UA 4IP5A 1TQJA 2GUYA 1G0CA 3GD6A 1DQWA 3N2TA 3N25A 1CYGA 4JIPA 2R1KA 1M01A 2WCAA 3T2QA 4AY7A 2A3HA 3TSMA 2YW3A 2JJ1G 3AMDA 1MQPA 5CZJA 4KWOA 3I7QA 2V82A 3WBYA 3MHUA 5A6JA 2PD5A 3U8GA 1XGEA 3A4AA 4YCOA 2YDAA 3F03K 3DUGA 5G4HC 3A3WA 3O1NA 1PSCA 4RK8A 2PE4A 2ON3A 3AIQA 1ZAJA 2J7DA 6REQB 5EPDA 1WAUA 2I56A 3SCRA 4H7ZA 3EOSA 1Z8AA 3STEA 2QUNA 3CTLA 1ZBKA 3WQOA 1EJVC 1RVGA 2E9BA 1RD5A 3QMTA 3T8LA 1KBBA 1XLIA 2AOSA 4Z0SA 3CQIA 3H24A 2I9EA 1W5QA 4F2BA 2VFHA 3EYPA 4HOZA 4A3UA 2XM2A 3LA4A 1I1WA 4H04A 3OHIA 1XYAA 2ADAA 1EH9A 4EK7A 2Z1SA 5LGZA 3THAA 1HQTA 1MWOA 4W5UA 1J2WA 4M56A 3E96A 2VQTA 1LUCA 3GIYA 1UD4A 2CZ5A 3E6EA 2WMIA 4NY2A 2D2JA 4LY4A 2ESCA 4QNEA 4WEVX 4O1CA 4YCPA 4NAFA 1WOBA 1P6BA 1IEXA 1NWSA 3LHZA 1FWGC 2SFPA 2ZUWA 3GVWA 1F3TA 3EMQA 3SQMA 1BXBA 1VLWA 3VD9A 2J7CA 4LUTA 4JTSA 1W54A 2G4JA 3B4UA 3NQGA 4AWSA 1PXGA 1YBQB 4BK9A 1JL8A 3V75A 3RO8A 3KVKA 1PYMA 3T0BA 3B9NA 3BAWA 3I6TA 2EJAA 1R85A 2GDUA 3WEMA 5KSWA 3FS2A 1FHDA 3DFNA 4BQ3A 2W62A 4PUNA 1US2A 1GQLA 3H21A 1RK6A 2W91A 3H55A 2D0GA 4MNJA 4UZUA 1PEZA 1C9DA 4K1WA 3P62A 5D05A 3SBFA 1SSGA 3VINA 4EXQA 2Z26A 1UW9A 2QCGA 2YW4A 3TVAA 3T0CA 1GQKA 3W70A 1ZALA 1CECA 2AMGA 2V38A 1M7XA 4F0RA 3O6CA 4DBUA 4OE7A 4UB9A 2J75A 4AD3A 3VIGA 3M41A 2VP8A 3RX3A 4GI8A 2I16A 2PWFA 3MWCA 3GDMA 1OCJA 3QZ6A 4B4HA 5A8QA 1FH9A 4B2DD 2GK1B 1E15A 2WO5A 1XH1A 1YDOA 4GC4A 4PH6A 3HTWA 2YIHA 5AHEA 3L68A 3IUHA 2WWCA 1W37A 2GWGA 1IXPA 3DFQA 1UP2A 4QNWA 3NZPA 1FWHC 3KBNA 3FSUA 4M51A 1WO2A 4PEEA 1QPRA 4QDWA 1KBJA 3OHMB 1GVYA 1O5XA 2CZEA 2OYKA 2DFAA 3R7MA 3K13A 1QUMA 4JL2A 3R89A 4DI9A 1AD1A 3TYAA 3TJLA 4AZGA 3N04A 4DXVA 3UY7A 1A5KC 2ATSA 1G69A 4QISA 3W7OA 3RAOA 4MJ2A 3TEVA 4TVUA 5C7VA 3VIKA 4LW7A 2I5QA 3PG8A 5FJOA 4L56A 4TMBA 5L9FA 3K1DA 4F9DA 5AVHA 3ZXWA 1W9DM 1H2JA 4GG9A 4DYKA 3MMUA 1JUKA 1JGIA 3URBA 1O1HA 2Y24A 3DI0A 1AH3A 4UWMA 5I24A 1XDMA 2QV5A 3VIOA 4Q6XA 2EAWA 3EGJA 4QS6A 3SCVA 1JUBA 1S1PA 1RUSA 4BQ5A 2QUUA 8XIMA 3TYBA 2J62A 5CPMA 4MZ1A 1NJJA 1XBXA 2W67A 5BMXA 3P5YA 3Q45A 3AS3A 1S5WA 3A3HA 2PZ0A 2J13A 4WVXA 4O11A 4IIEA 1CGWA 1E6RA 1UKOA 4TO8A 2FVMA 4NILA 1OZQA 2GOKA 2PURA 3DFOA 4CEUC 3NO3A 1V5XA 2UY3A 3TC7A 3KOZA 4XSMA 3G6MA 3GNXA 4U2YA 3O9NA 3OYZA 3DENA 3I4EA 3HPSA 1X6LA 4C6FA 3T55A 1VHNA 2CCRA 1US0A 3M0MA 1PYFA 1QHOA 4O0ZA 2DP3A 1PO9A 2YZRA 1XDLA 3O0FA 3UG4A 3AISA 4JN8A 3S42A 3J7HA 3FCPA 2FDMA 3F4CA 2Z1VA 3O15A 3G2GA 5JIPA 3KCLA 1E40A 4BWLC 3ZR6A 1EP3A 3RUBL 3W02A 1G1YA 2OSXA 1IWBA 1KXVA 1OGSA 2Q3OA 2ZCGA 4DJFD 1S3TC 1YMYA 3VDHA 3WLPA 4PB3A 5BOEA 3LQLA 3M0ZA 1A5BA 3ARRA 4KW2A 5EMLA 2O9RA 2CHRA 1XYLA 4K7VA 3S9YA 3LK6A 2GK1A 3GVGA 3ARXA 3KVLA 1UWRA 4BI5A 3H26A 4F3HA 5G1MA 1E0UA 3AS2A 3OLGA 4XIAA 1ZGDA 4ZZ9A 2HEJA 4FOUA 4WQ6A 2DQWA 2GGEA 4AVFA 2XNDG 3OE7G 3WIJA 3FYPA 4ZXOA 1LM1A 3QGAC 3KLLA 3NA8A 4OHQA 3H4WA 4IIBA 3L5MA 3V5FA 3DHDA 2X8RA 1DE5A 4AWEA 3NXFA 5DXXA 1MXSA 2J6XA 2GSHA 1ZFJA 3DN5A 1RD6A 1QAPA 4EACA 5FIPA 3A13A 2WZHA 3EB2A 4UOQA 2E4TA 4I7VA 4DBDA 3NSNA 3D5HA 2F2KA 3HMJG 4C90A 3M0JA 4MWAE 1XLJA 1A49A 5AYYA 4MWAB 5T26A 3GR7A 4OVXA 3WJSA 1F74A 1HL2A 3RR4A 5ABHA 2C0AA 1GEQA 3IGHX 2CBJA 5AHMA 2V5KA 3M0XA 1YPXA 1H60A 4K8GA 1AG1O 1U22A 2V5JA 2OU4A 3AXHA 2ZADA 3MB9A 4LAOA 4GKLA 1OT1A 3SO7A 5AC6A 3W6LA 1PAMA 2ZTJA 3SAZA 4XB3A 4A22A 2QYGA 5FL1A 1Z32X 3B05A 3UNTA 5F2LA 3ITCA 3DHPA 1YPFA 3PJWA 4A4AA 3BGJA 3OA3A 5F2IA 2Z1XA 3CZ8A 1C8QA 5D8WA 4LB3A 1UUMA 1EP1A 4M6UA 4ZB0A 5GNXA 2ZRVA 1E9IA 4B5TA 3FV9A 4BR1A 1FRBA 1WV2A 2FDSA 4MADA 5ABFA 4XZMX 3Q4DA 1OGGA 4YMZA 1CLXA 5JBDA 4MB1A 1EF3A 1QJWA 1CIUA 3CH0A 1J9YA 4ALDA 1OC5A 3BLKA 5DANA 3WY1A 3C3NA 4FALA 4E3VA 3GG0A 2D24A 3GU9A 1WPCA 3GR4A 1TV8A 5D9PA 1J12A 3CLWA 4HHLA 5KZ6A 5AYXA 4ZOBA 3C0JA 1YRRA 2E5CA 3H22A 1QBAA 5A69A 1W8GA 3KOFA 3KDOA 1CGXA 4JXCA 1V0MA 5BW6A 3IIZA 5FD0A 2ZUVA 3B06A 3LI1A 2GQAA 3WNMA 1FWCC 3UXKA 2G41A 1CXIA 4Z2LA 3K8MA 1H61A 3W1TA 1V7YA 3T6CA 4QM1A 5M1TA 4AX7A 3E2RA 1BVNP 5E5CA 3OLIA 2V8ZA 3GU2A 4IX2A 3BG3A 3RR1A 1UH3A 3E5PA 1X97A 3EXRA 3CV7A 4N42A 1MSSA 4UTWA 3LD5A 4P61A 2J8GA 3UXDA 5E1QA 4CKQA 3RO6A 1W17A 3OBEA 4TQTA 1VPQA 1UP3A 3U5UA 3KS5A 1E6ZA 2I9UA 4XG1A 3W00A 3VFLA 2Z7KA 3N6QA 2BFGA 2BLEA 4AX6A 3ELFA 4ZO6A 3ITTA 3O06A 1TWIA 9CGTA 4YHGA 4M19A 5M03A 3I10A 1EYEA 1W3NA 2VNCA 1WX0A 2GDQA 2ZX7A 2G3FA 1GJUA 3LERA 3WD1A 1KKOA 2QAPA 4HKPA 4S3KA 1VS1A 5E93A 1JYVA 4IX0A 5D03A 4PMZA 4H2CA 1TVPA 1FXQA 1K6AA 3OG3A 3B4YA 5HINA 4MNMA 3IJDA 2ZIDA 3QR1A 2WWDA 4MWAA 5D04C 1U1JA 4O1AA 2ALRA 3SN4A 3VIFA 3WMCA 4QCEA 5D9MA 3QLLA 3KX6A 3QW3A 2QVHA 1S1RA 3GTNA 1ZJHA 1NSJA 2OXNA 3M6YA 3VIHA 3WLNA 1HVQA 3PUEA 4E8CA 3C2RA 2G5WA 1FDJA 2QCEA 2NX3A 4TR9A 4GI9A 2DSWA 2ZA2A 5A1AA 5FL7G 1UCWA 3DG6A 1G67A 2PDGA 1H7PA 4Y96A 3AU2A 1E6XM 1E9ZB 1KRBC 2FZBA 2H3BA 2Z0IA 3PPGA 2JKEA 2YB1A 1VRXA 3RPMA 1VZWA 2VZVA 1H5VA 4PRTA 1UC4A 5LGXA 1UR0A 1HGYA 1JDFA 3MUAA 1E4LA 1K8XA 4OZOA 3N73A 3SUSA 3ZIAG 3MMDA 2CESA 4QSFA 3CT7A 4LTSA 3S5OA 1A0CA 3AZTA 5C9WA 1A5OC 4K39A 4O54A 3MI6A 4IGNA 4ORIA 2FPYA 1XLFA 4GABA 4GGHA 1R3WA 1F3WA 4WSHA 1GOXA 4C5ZA 3QPYA 1J4EA 2YCLB 2PA6A 1QO5A 2V3DA 3OBAA 2A3AA 5D32A 4ONVA 3CB8A 2VC9A 1QI0A 1ISVA 4OKDA 1W0JG 4M6PA 4NZ3A 4Z2HA 1JXKA 2O4QA 3H70A 1YXYA 2CZDA 3IK2A 2BXVA 3G0XA 1PPIA 4MLRA 1DJQA 2VXNA 4C6MA 4M29A 4RDYA 3PN8A 3TYCA 5TQLA 3ZYZA 2BMBA 2JBMA 1EZWA 3DDMA 3VKKA 3IWPA 5C6MA 5KEZA 3G1RA 3GUGA 4EAMA 5AYIA 1GT8A 4DZAA 3UZXA 4IPPA 5C2CA 1TPDA 4M80A 4MIMA 4JTKA 4GVIA 1EJSC 1LWJA 5EU9A 1BWVA 3THUA 3L67A 1M3UA 2X0SA 4DB7A 3BOXA 1CB2A 1DP0A 2P88A 3SN1A 1Q13A 3QJAA 1BTMA 2WMFA 1L6YA 1KFLA 2J78A 3CV1A 1DWJM 1ZJIA 2ZXAA 2V63A 1W3IA 4H9MA 3AAMA 2BP1A 3HQNA 1GG1A 2YX0A 2VD8A 1VFTA 3R2GA 3I7RA 1TSIA 3H7RA 1WYIA 2QJJA 2FYMA 1QFEA 4HNLA 4QIUA 3GIPA 4XVDA 1KRAC 1H09A 1ECEA 1AH0A 2ZZ3A 2X0YA 4E2DA 4H6KA 3WK1A 1G4SA 3E5BA 1NF0A 2VUYA 4IPJA 2J7BA 4JHOA 4XKYA 1P1MA 3W81A 1N8WA 4IQEA 1SW0A 2PF8A 5D2TA 3T07A 5EMUA 2VI0A 3W85A 3PS7A 2FIQA 4XZNX 4TX9A 3IJIA 2GUUA 3C3UA 3PY2A 4C7DA 1YTEA 4IJCA 3EX1A 3CJPA 2PS2A 2BVTA 4HMDA 4HHMA 2ZQ0A 2P8BA 3CAVA 1I2RA 2WCGA 5I03A 2GGHA 1TR1A 3TSDA 1LRNA 4DO6A 5CGTA 1L6WA 1YNYA 1K8CA 1AODA 4DXXA 4UIOA 3UG3A 3UF9A 4JCMA 4DQWA 4WLCA 3UFYA 1XSKA 2WSRA 4C6KA 3ABOA 3LYEA 2FPVA 2FVKA 1P0BA 4GMEA 1UG6A 1H62A 3MZNA 4QJ1A 1CTNA 1RLCL 3IAQA 4DJFA 1OINA 3DH7A 1XP3A 2YCLA 2QJGA 1N82A 3OZMA 3ZZ1A 3NDZA 2D20A 1EBGA 2QE7G 4NNBA 2D2GA 5GJNA 3CZEA 4N02A 2AQOA 2WM0A 4PB5A 1F73A 4EWJA 2E1DA 5HDRA 1DJXA 4DJDC 1R8LA 1B1YA 3VGEA 2QPSA 4S39A 3TV8A 1K9TA 4FNQA 3WD4A 1AUSL 4ZQNA 1FCBA 2FZMA 2HVNA 2HZGA 4FK9A 2OLHA 2CETA 3N2CA 3QZAA 4PGLA 4DEFA 2RAGA 5TBOA 3F4DA 3PFRA 3WBEA 2A4AA 4GZ7A 2J47A 3HBLA 1H63A 1UD3A 4J35A 3QTPA 2QCFA 4GZJA 1BYAA 3AMGA 4Q33A 2F38A 2CLOA 3U4FA 5D38A 4HA3A 3IS4A 3L9CA 3AROA 3SM0A 3W7JA 3R94A 3ZIZA 3WK3A 4YYFA 3SADA 2BSLA 4K36A 5DN1A 4ZSTA 5ENLA 2Q8ZA 5H91A 5AHNA 1U5JA 1MFUA 2Y5EA 3L4TA 1BQGA 4NX0A 1UWQA 1Q6GA 3KWSA 4RW5A 4J3TA 3L4WA 2YSWA 5AC5A 3CL8A 3T4WA 2NQ9A 1KFBA 4WXYA 4UNIA 1KBIA 3NUKA 4F0KA 5K9XA 4D6GA 3MY9A 3M64A 4PBFA 1G5AA 3QXBA 3V35A 1ALDA 3EPOA 1FCVA 3CUJA 2XU2A 5BXSA 3W84A 5LA0A 1DE6A 3C2YA 4ZR8A 3VGBA 1R3QA 1Q7MA 1UIPA 2EKCA 2FLIA 4XD6A 4GIRA 1O7AA 3E12A 4WJXA 6TIMA 1NDWA 2DGAA 2JF6A 1YXDA 2P3ZA 3HGRA 1BWLA 2PD9A 1CGYA 1TMLA 1JZ3A 1EC7A 3W7GA 1S39A 1ISXA 3W76A 1NFPA 3TLLA 4TMCA 1W1YA 3AALA 3UWUA 3WDJA 4XUGA 1IGWA 3VKBA 3FGCB 1SFJA 1XIIA 4POCA 2PP1A 3QN3A 3KLKA 3PTDA 4GY1A 2FMOA 3B40A 3VGDA 3QMSA 1KKRA 4GQRA 2QCCA 2HK1A 4FX6M 4G7FA 3CUXA 4K37A 3RJXA 6XIMA 3THCA 4C1LA 4EE9A 3WUFA 7XIMA 3IAPA 3PSVA 3MHFA 4JTJA 3OPSA 1EKOA 2IS7A 3SCNA 4RNFA 3ZT6A 2X05A 1A4LA 1GZJA 2W27A 3GHTA 1DQXA 2JGQA 3LHVA 2V5BA 3GNRA 1Z42A 1IWAA 3WQPA 4I6KA 1TUXA 1WA3A 2Y61A 4UMBA 3NQVA 5C70A 4UXDA 4JN6A 1F4HA 1FCUA 4CQCA 2YCEA 2IUZA 4R9OA 2QJNA 4CD7A 5ECVA 2Q01A 5HULA 4MFDA 1JEZA 3EX2A 3GS6A 3MSGA 3WK0A 1XXXA 3WX7A 4H01A 4GQBA 4O50A 4O12A 3V3WA 4D71A 1MEHA 1B31A 3A24A 3NVTA 5ABGA 3IIXA 3GR8A 2WC3A 4GCXA 4PMNA 2ODOA 3DC8A 2VWTA 1VFOA 1VBGA 1XS2A 3NEVA 2YDRA 3G3MA 4DHGA 1H7RA 1F6KA 2J9YA 2VDIA 4MAZA 3Q58A 2P76A 1OF8A 4K8HA 2BGNE 3W25A 1V6TA 3APTA 1PCKA 3OLEA 2C16A 3DKLA 3GKFA 3ARTA 1E71M 2NZLA 3GH5A 3CUFA 5TD4A 1ENUA 3EDJA 3OQEA 2I14A 2OTDA 1JVNA 1CPUA 1VAHA 4TU1A 2BHYA 3COTA 1EPVA 4MB4A 1JQVA 1XYMA 4URIA 3JR2A 1AD4A 3WLKX 1Q65A 3TP4A 4NG3A 4E3TA 3SB0A 4JIIX 5FJUA 4LSBA 4J3UA 4WDTA 4S3JA 4ES4A 1GPWA 4OOZA 3C4UA 4A2RA 1VR6A 4GIAA 1VGAA 1LG2A 2PEVA 5FSEC 1D2KA 5AECA 1TX2A 3G1FA 3SCTA 5HANA 3FJ4A 1DKWA 3KXQA 3EAUA 2G3NA 4H6QA 1U5HA 3FGCA 3DESA 1X8FA 1XYCA 1FBAA 3OVQA 4Z2IA 4KPLA 3FVMA 3MMTA 4KWWA 4CCDA 1JYXA 3IJLA 3SI9A 5LZLA 3M0KA 4L7ZA 4HN4A 1I1XA 2QT3A 2YBTA 5K4ZA 3VNJA 3PBVA 3ISIX 1OX4B 4RE2A 1LCOA 1P6WA 3TOPA 2XGIA 4LCQA 1JR1A 3CL7A 1VC4A 3IJQA 4MG4A 3GZ3A 4NYUA 1ZL1A 1OK4A 5BU6A 3VE9A 1ODZA 2JQXA 5XINA 3SQLA 3NL3A 2GFTA 4MUZA 5JXQA 3VAVA 2PCQA 1H3GA 3WMBA 2ZZ2A 1I2OA 4AMAA 2YLLA 5EMYA 2WHJA 1JZ6A 1UD2A 3UY8A 2G3JA 2WYSA 2WVVA 1VHCA 5IM51 3SDOA 4DF2A 1R3VA 3IPWA 3QBUA 5FF4A 4DZHA 3MI2A 3GB6A 4ZE4A 2YDSA 5FJRA 2O9TA 1UB3A 3HZ3A 4D6HA 1UMYA 1Q6QA 2RH9A 4UCGA 1PJ9A 2Q71A 3REQB 2O4MA 1Y8BA 3U7BA 2WPGA 1XLKA 1XG3A 4V33A 2BGQA 4WKFA 3BAIA 4KF1A 3KZSA 4EX4A 2PDFA 4GQQA 3EDDA 1E0WA 3PANA 4W5ZA 2A3CA 4LVFA 3W7LA 4PMJA 1EEPA 3R12A 4JEQA 2W6IG 4G7EB 4MDPA 2XYLA 2E9LA 3LPFA 1M7JA 4H19A 4LFYA 4WKHA 3UCQA 3D46A 4RDZA 3UVIA 4Z0JA 2GJNA 1P48A 3PAJA 3ENLA 3IANA 1WXZA 4YU1A 4UTWC 4XUYA 1Q85A 1QOPA 4M82A 3USZA 4DBEA 3UZYA 2X2GA 1GZ1A 4ENLA 1M65A 4WHBA 3WLOA 4CCCA 1ZZMA 4UMCA 4E2VA 3PWAA 3VK5A 2ZX6A 4PUEA 3CO8A 4O17A 3BL3A 1XRFA 2NW0A 3UERA 1OX5A 1IZKA 2E8YA 1LL6A 2A3BA 4C6LA 1LBLA 1S2CA 4A6GA 3E0VA 2JGYA 4W8LA 2WZEA 1YPIA 4LB4A 2RGLA 2PWVA 1CENA 3LOTA 4K6AA 5CSRA 3IJ6A 2NLIA 3KZPA 3R8HA 2ZZ4A 3AMLA 2GVGA 4XD5A 4CQ8A 1KGWA 2YL6A 5F2GA 2PDNA 1TPWA 4XTIA 2CLPA 1O6IA 3QVQA 1OX4A 1Z7AA 3WF1A 4LEFA 2P50A 3RM9A 1QR7A 1SO4A 1BTCA 3N19B 1LRQA 4K2SA 2XZ9A 5FKYA 3SUTA 1W9PA 3EDEA 3AIUA 2NUYA 2Z27A 3U0HA 4LAMA 5J04A 3ARVA 1KTBA 5BXRA 4JKMA 2ZE3A 4CD4A 1KM6A 1A5MC 1XC4A 5G2HA 1RP9A 2PLCA 5JBEA 1H7WA 5JIWA 3UNDA 1N7KA 4JTIA 3NQ2A 1OD8A 4RLIA 5DCEA 2NV9A 3TYEA 3XISA 3LBOA 3QQ0A 2C1IA 1A3WA 3EEGA 3REQA 3SCQA 3H23A 4MJ4A 4P8WA 4XAZA 4GXPA 3A5FA 1S2UA 1KBKA 1T7LA 2O9OA 4DNMA 1MO0A 1SYTA 2ZX9A 2QJIA 1V6YA 1IZJA 2V68A 3RLUA 5I3JA 3W75A 3CMGA 2X1RA 3S1XA 3VD4A 4ADUA 3PTQA 5C7HA 4UNLA 4EXBA 2ABAA 3ZMRA 3KHJA 1R9XA 4G7EA 4NYYA 4JQ2A 4UR7A 1VYSX 1TWWA 2UY4A 1ZNNA 3GTXA 3DKJA 1TB3A 3DGBA 1GWJA 3G18A 2F6XA 3TYUA 1MQQA 3Q94A 3BLOA 3RX4A 3NFUA 1OFOA 4RXGA 3MT1A 4GWEA 2QS8A 1LG1A 4YTUA 3QYQA 4MKNA 4I6VA 5CBJA 2GWNA 3NZRA 3WBXA 3EMCA 5GQBA 1KXHA 2X1UA 1PTGA 1GG0A 3N29A 3DBPA 2Y85A 3U2CA 4D6DA 4AD5A 3NNTA 2DIKA 1PDZA 3IIPA 3TTQA 4BCEA 1CXKA 1GOOA 2Y62A 1GW9A 3DXIA 4RKAA 1RK5A 1X98A 1DEDA 3K8KA 3RK8A 3OTRA 5EGRA 1D3GA 1XBYA 3SQSA 3GBDA 1H1NA 3L2MA 3PC0A 3ITLA 1KNWA 3PNZA 1K7EA 3KS6A 3BG9A 5FSDC 3S83A 2Y7GA 4H9ZA 5CAKA 1LP6A 2E5DA 3LTPA 4LRTA 5G4EA 4PC8A 3U3HA 1XUZA 2ZZ5A 3IUDA 1W31A 1A0DA 1E79G 3LBCA 3EB3A 1JFHA 3HA1A 4F0HA 1XLAA 4HZ8A 2C3ZA 2WSSG 2PDIA 2WJZA 4R85A 3RU6A 1I0DA 4WY0B 4IIDA 1PWLA 1CT5A 2XTKA 2GQ9A 3MKKA 2A7PA 4Z08A 1ZUAX 4B5UA 4Q4RA 3LUTA 1TZ7A 4F2UA 3M7SA 5KZEA 5CPQA 3STPA 4HA0A 4G1KA 4H9TA 2Z1WA 3LSBA 4HYVA 4HU3A 4UQDA 3T0DA 2OEMA 1SJCA 3WCZA 3DERA 3OO2A 1C7SA 1T57A 3PBMA 4DJFC 2XJ7A 2W92A 2YDQA 5HMSA 3MSDA 2R1NA 3BCFA 3WJYA 4AZBA 5C54A 4M6QA 3QF0A 3UWEA 1JRBA 1L2UA 4L6HA 1ZBVA 5DELA 4C91A 1PHQA 4I8DA 3IV8A 1CB7B 4FXSA 4DUVA 1D7KA 3PSWA 2OZ3A 1T8XA 2DT0A 1LLZA 1XRSA 3MC5A 1XJBA 2VRKA 4AD0A 4NZ5A 1FOBA 3N6JA 3OVGA 4WOZA 4XKMA 4KFNA 1ZLPA 1ZBCA 3CV6A 1RXOB 1VYRA 2CBVA 3E1F1 3ZQ9A 2XOKG 1GK8A 4I7UA 3GFYA 2DVTA 3G6LA 4AVOA 2J74A 5PTDA 2P10A 4CNUA 3G24A 3N17A 1E70M 4IUGA 4H41A 4AH7A 2WBGA 2WKGA 1XCWA 3D47A 3RCNA 3SW6A 1KWKA 2Z6JA 3TNBA 1TTJA 3CHCA 2BY3A 2QHAA 3ANVA 2Y63A 3W26A 3ABSA 4IWWA 5LIWX 4ERIA 3EKGA 4O8RA 1GHRA 5GNZA 4YVPA 3IARA 1KM2A 3WMLA 3G1HA 1UWAA 3CASA 4WZHA 1FUYA 5A2CA 1TZ9A 3C61A 3KWXA 1RJRA 2RHGA 2B7OA 1FWRA 4ZB2A 4S3EA 2AGKA 3H4GA 1OJXA 2PLKA 3PFMA 3BJTA 1NWTA 3EPNA 5LIYX 3P80A 3G1YA 3VMPA 3VOFA 4ACZB 1Q6EA 2WNZA 3BZJA 4QG6A 3W7MA 1UZHA 4R7JA 1IQ8A 3ABRA 4DWSB 4DYJA 4NF7A 2DV0A 4UQCA 4H3DA 4M1RA 1QNPA 3VKJA 5REQB 1G4EA 4FOKA 2ZOXA 3MV11 4EAYA 2FGZA 3VPLA 1PZ3A 4AZCB 2YA2A 1VB9A 2DUXA 3W38A 4L9YA 3LNPA 5D2YA 1YTKA 3N3MA 4DUOA 4KWVA 5LA2A 3A4WA 2XG9A 4M7SA 3WL0A 1YXCA 3PB0A 3GM8A 3LENA 4O8AA 4L9ZA 3BLPX 2CKSA 3F2BA 3MPGA 1V79A 1MRAA 2R1LA 4WUIA 3PJXA 1TJPA 3KRSA 3FKSG 3M6DA 1SJBA 1V3HA 3HQ1A 2NX1A 3CL6A 3AHVA 2CLHA 3EDFA 1XH0A 3AS0A 4JTDA 3LV6A 4BI7A 2VR2A 4FOJA 3HO8A 1KCLA 5FEPA 4D72A 3FLUA 3BGAA 1CXHA 2DY3A 3A6OA 4M5PA 3NQCA 1BG9A 4ORMA 4N4QA 1RJPA 2POZA 4HHHA 1ELSA 1V6XA 1HKVA 4DYEA 3HIJA 4GYJA 3H2CA 4NJHA 2DIEA 2E1WA 5FEWA 2E67A 5AVNA 1Z9AA 1RY8A 1ZPTA 4NU7A 3GKAA 1E1FA 2A7RA 2RDTA 4I8YA 3BMXA 2DU2A 2X40A 4PL1A 3BV4A 3DYMA 1V02E 5LSMA 3T08A 3AFBA 1M1BA 3SY5A 2XVGA 2IPWA 4TOQA 5AFDA 4Q3MA 5CPLA 1E0VA 4JYFA 1LT7A 1XPGA 1VJIA 2FFIA 3O16A 2QZRA 3PZ9A 4EPEC 3VX0A 5AC7A 2GGIA 2V7QG 2YKKA 4W85A 1QNVA 1YX1A 7ENLA 3GNDA 5CZKA 3GG7A 2PFHA 3WLIA 2INFA 2VYOA 3RM4A 3UVAA 3NZGA 1HJUA 3B8UA 4KRZA 3N9KA 3NM3A 5G5IA 4JQ3A 2EF9A 2OOGA 2A0NA 5F2MA 4PE8A 2HMCA 4DJEA 4PUWA 4HNVA 2EPOA 4PUMA 4BQ2A 3O6DA 3LHTA 3BV7A 3NYDA 2XIJA 5CXPA 1W1ZA 2J24A 3NQBA 4ACZA 2O55A 4KKXA 5F7UA 4AFYA 2ZVRA 2P5NA 4FXRA 1UR9A 2A3LA 4FXFA 1UWSA 1C29A 1PTDA 1P1XA 2QEZA 1VP8A 1U1UA 3SJNA 4GIYA 1JDDA 3IGSA 3LZ5A 4TVDA 1HGWA 5REQA 1H51A 1M03A 1ME9A 4AZCA 1E5NA 2DUZA 3KRBA 2CLEA 2DSZA 3LM7A 3AMCA 3VNKA 3GRIA 4P7QA 1X7FA 4B90A 1MNSA 1TIMA 2ZUUA 1LORA 4ROPA 2J27A 4C6DA 5HWNA 2QUVA 4QS5A 3U2EA 4NUWA 3LCFA 1GJWA 3DC0A 1Q8JA 1D7FA 3MUXA 1KRCC 4CNPA 5HA7A 3FOKA 5U7SA 3GC5A 4XIMA 4E2BA 3W88A 2A6NA 3W7NA 1I75A 4DZIA 1E1EA 3G22A 4O57A 2OPJA 3KL3A 1WXYA 2E6DA 1SR0A 3BSHA 3GY1A 4XAYA 1JCYA 1QI5A 3I68A 1ZP4A 2XHYA 2PDPA 3ORWA 5IFTA 1DWHM 1FWJC 1FX6A 3B0VC 2PODA 4C6QA 1KV5A 5C9UA 3UQNA 4MUPA 2PRHA 1M41A 1MDRA 4NRRA 1GQIA 1H7NA 3O2LA 4GXMA 4F79A 2XWEA 2ZUMA 4P8UA 1IR2A 1HXJA 2EG6A 3SCWA 3IK4A 1F3EA 3S1UA 4EKJA 1IT0A 1J0IA 3WFAA 4KWSA 2ATMA 3V1HA 4O10A 1CXLA 1V02A 5HPCA 2AAMA 2VCAA 3SRHA 2E68A 4R88A 3UR7A 4D6IA 1QI4A 2IPJA 1Q6FA 7REQB 2ZICA 3DG3A 4BEQA 1FS0G 2F7FA 2OODA 2VFEA 3LV5A 2PUZA 2R14A 3UG5A 3TR2A 2W5FA 1BEUA 1XDJA 1MNZA 2Y7DA 4UZSA 3HM7A 3W7QA 3AWOA 5G1TA 1DJZA 5CSYA 1ADOA 2BTMA 3MUCA 2ZDRA 1GYLA 3BTNA 3R0DA 5H2ZA 1W3KA 1VPXA 1EWEA 1G7VA 2X30A 1MI3A 4ZMGA 3FW6A 3GLCA 4AU0A 5DXYA 3PZUA 2ICSA 1E5JA 5TNVA 5EBAA 1P0NA 3K4AA 4L64A 1VF8A 1DHKA 5CG0A 1SVDA 3GYEA 2I57A 1XSIA 3ZSSA 3Q67A 3C2VA 3PUDA 3HMCA 2DH3A 3LDVA 1GJPA 1GVQA 1SM9A 1AH4A 1JCTA 2VELA 3G1AA 3GW0A 1TWZA 5HR6A 1NP2A 3VNIA 1YDNA 4PMQA 4FXJA 2OZ8A 1UKPA 4FLOA 1BXCA 3S1VA 1I9CB 1H49A 5FA5A 5CC6A 2OQLA 1XLLA 3HOJA 2C1HA 3HG4A 1E6PA 5T9CE 2XFRA 1N55A 1TJ2A 4O19A 3H2MA 2ZRWA 3H2AA 3FHAA 3JS3A 4I9TA 3WG6A 2JIZG 3P14A 4PCNA 1HG3A 2Y4SA 3ZM8A 1Z44A 3MUIA 1QPNA 3LXCA 1XLGA 3LGEA 4R33A 4A21A 1TJ0A 2A7NA 1PBGA 2P0OA 4R7WA 1NY1A 2FH8A 1GHSA 3T4CA 4LXFA 1BRLB 4CU6A 3G1DA 4JYEA 3A64A 3E74A 2GJRA 3S46A 2E6FA 1MUCA 4GUHA 5HR7A 1M5WA 2WLZA 4ATLA 2FVLA 4BI6A 2POTA 5B80A 3STGA 3MUY1 1IXOA 3TFXA 1XD1A 4ZEPA 4GFIA 4C5YA 5U4NA 2PTDA 3S4TA 1AJ0A 4HZ6A 2PTYA 1ITUA 2OG9A 3CQ0A 4KQNA 2D69A 4Q4QA 1DV7A 3N2XA 4EPDC 3GZAA 1QDSA 4RCXA 3W74A 3B0PA 1XIGA 3HQOA 4F40A 4JKKA 1HX0A 7REQA 4JNZA 2UZ9A 4H8NA 1W6TA 4K68A 4Q4MA 9XIMA 5A6AA 1QT1A 3LHWA 1FTXA 4OUEA 2NXGA 3MANA 3DBNA 1HKIA 1R3RA 3IVUA 4AZ5A 4AIBA 2XIOA 4CCEA 4JX6A 3GNNA 1JDCA 1F4AA 4UQ9A 3W7PA 1CDGA 3TC3A 1JCXA 3CHFA 1XI3A 2CERA 3VNYA 3EWDA 3O63A 1WZAA 2I17A 5IRPA 1K3UA 3M44A 3N3TA 3WDIA 3EKZA 4OU1A 2TRSA 1WBJA 4CN1A 2WZMA 2A2IA 3SFWA 4GZIA 3TXVA 4AG0A 1QNRA 2NSOA 1EDQA 1EUNA 3LCWA 3VA8A 1KCXA 2PGRA 2I7GA 4HTBA 1R0MA 3F1QA 1RCQA 4GX8A 4V28A 4E2OA 3GXIA 3AHYA 2YPIA 3CZKA 3JU2A 4U4MA 3THDA 2EGZA 1LT8A 2HLDG 3WD0A 1ISYA 2X41A 1RCXB 2O7SA 5A6MA 3BARA 2Y0FA 4L4LA 2AMXA 2IW0A 4JZ5A 5A8NA 1HJVA 1RJQA 4UUIA 4JTFA 4PA8A 3LQGA 1W91A 3CU2A 4CD8A 3K1GA 1YW1A 5H8PA 3MHGA 4Q32A 2EPLX 2HSAA 5GJPA 3TN4A 4IIHA 5M2FX 3GG1A 2BVDA 3GU1A 1B9BA 1EZ2A 4HGXA 2CXEA 2QAFA 4RV8A 1WZLA 4QP0A 1OC7A 1SGJA 1BRLA 3QKZA 2VT0A 3B9DA 1QCWA 3WYZA 2EKGA 3PR2A 3CXOA 4MAVA 1KB3A 2YCJA 4GLEA 5L6UA 3NQ8A 2YFNA 4IMGA 3NSXA 1BSIA 3W2MA 5MHBA 1EPXA 2CKRA 3A4JA 1D9EA 4UTUA 3H6OA 3LCLA 1L0PA 3TZNA 1TV7A 1MUWA 3NSMA 1DORA 3AUJA 4W87A 3VU2A 4HB7A 3T81A 1OX6A 1FWDC 1HJXA 3M0VA 3NO5A 5DEZA 3DFTA 3UA3A 1WDSA 3H54A 2XIQA 4Y90A 1AL7A 1EO7A 2WSKA 1J01A 3WQGA 5JMUA 4AXKA 3VE7A 3NZ1A 2WPDG 5HUOA 2IPFA 1E9YB 2C8NA 3LXBA 1JCNA 5A6BA 3W82A 5HQMA 4Y9AA 1C3FA 3SECA 3F5JA 4PMOA 3ABZA 3G8RA 3C5QA 3VKCA 1JZ4A 1TX0A 5CZTA 4US6A 1SMAA 4YXWG 1NP0A 4O4WA 4OWGA 1E1CA 1QK0A 4C6BA 5D2VA 1JDAA 3URNA 3UJ2A 3VC6A 5J8LA 1V7AA 2NXIA 4TXEA 1R2TA 3WFZA 4LYKA 3QQ1A 4HK6A 4HZMA 3EOUA 4NZ1A 1BQCA 1PDYA 4GINA 3MKVA 1A53A 4K7YA 4EIVA 3B0XA 3I6EA 4J2MA 5A6KA 4YTSA 4UTJA 3LHYA 3O6YX 4LVDA 1H5YA 2G50A 3BAJA 1OCNA 1GONA 3M0HA 1PIFA 1P7TB 4O28A 1Q6RA 3BLEA 1QW8A 1GOMA 4NX5A 1Q6OA 4QG8A 1UMLA 3ZLFA 3W28A 1LBFA 3M46A 1EA0A 4MZ8A 6A3HA 3U57A 3E2VA 3WLMA 3CMFA 3G3DA 1OK6A 2XFYA 4OBSA 2OZ0A 5GPRA 4JIEA 3H12A 4GUFA 1JI1A 1LQAA 4DM2A 3LPOA 4J3ZA 1OCQA 2C6QA 3M1ZA 1T40A 1XLDA 3H2OA 2E0PA 1GCYA 2GVLA 1HO4A 3QSRA 4LGXA 2IXUA 3P7YA 2J7FA 3H7VA 4YPJA 1TPUA 3P60A 4KCUA 2CLKA 3NM1A 4DI8A 4IICA 1TA3B 5LIXX 3BMVA 1ONEA 5LNSA 2XIIA 4US5A 3GDRA 4PTNA 1XFBA 5DFAA 3ZWSA 4JTAA 1JPIA 1BYCA 4E0CA 1PKMA 5IBXC 4CCZA 5CH9A 1L8NA 1TRIA 2VRQA 3SCPA 5HAOA 1E6QM 3AO0A 4JIRA 3DEQA 4X9SA 4E8DA 1XC6A 3MS8A 4BJHA 1Z89A 2VC7A 1GPFA 3MVIA 1IXNA 3L5LA 2ONEA 1W2VA 4S3GA 2BVYA 3HPFA 5F1VA 4JOMA 3VDBA 4TTGA 1XICA 1ZU8A 4S1FA 1NWRA 2PPGA 4EF8A 4JDYA 3FA5A 3HJZA 1IR1A 2WV8A 1C8YA 3R5EA 2VGBA 2PWGA 4U31A 1OZMA 5EYWA 1XFCA 3E0WA 1NARA 2QJMA 2ZX8A 1H4PA 1F2JA 4W4QA 2RGMA 4UQEA 4V1YA 1CGUA 1EJRC 4GNJA 3BLIA 2NV1A 2O56A 1E73M 1UUQA 3NL5A 4UTFA 1JPHA 1VCGA 5I09A 5C71A 3G77A 4UTKA 3V7PA 2VZUA 4Q8MA 3QH2A 3CNYA 3N34A 1YLVA 1UBSA 2QGYA 2C7FA 3OG2A 2DZSA 3ZR4A 4B4FA 3TYDA 3QSTA 3RYSA 1DJGA 2NT1A 3T09A 3M5XA 4DO5A 1XBVA 4RZ6A 1N8IA 3FEQA 3NURA 4UFJA 2WMGA 4Z1DA 1FWIC 4LS2A 4N6FA 4RNIA 2EG8A 4RV3A 4IMFA 1NQ6A 3W1QA 4B5NA 1DIOA 4I7WA 4WOQA 3W23A 1N2VA 3ITOA 2D22A 2CPUA 4RUBA 3CV2A 2PDCA 1X1ZA 1R87A 3UZJA 3QLDA 4OV4A 2Z2BA 4HCDA 4FIRA 1P7TA 3AXIA 3F5LA 4IZGA 3TAKA 2JEPA 5LHFA 1PKNA 2YCIX 5BOFA 2W79A 2VX6A 2IKGA 2NXHA 5BYWA 1KM1A 1NEYA 4GH3A 1J93A 4RE4A 1E6NA 2VFGA 3GXMA 1TWDA 2VJXA 1DIKA 2BVWA 2A3EA 3DYPA 4Y9PA 3MJYA 4JGDA 4V2XA 3MCMA 5EL1A 2PDQA 4IG2B 4GVGA 2VZTA 1A5NC 2RJHA 3TDFA 1S2AA 4JTLA 2R91A 2NUWA 2PWUA 5AZ1A 2CYGA 1A5UA 1CBGA 2Z29A 4U3AA 4ZGYA 4ADTA 1TA3A 4ZOEA 3TXZA 3FA4A 2J7GA 1C7TA 4MMWA 4IJRA 1FKWA 1FDYA 3WLHA 1JF5A 5M17A 4GKTA 2QPXA 3E0LA 2TSYA 2Y2WA 1J0YA 1Z3NA 2ZZ1A 3VGFA 4DO4A 3R13A 2JKAA 1E4NA 2UV8G 5I5RA 3UA4A 2DZXA 4PFMA 1X7IA 1UASA 5K9CA 1PZ2A 4U3CA 3WK2A 4PRRA 4AQLA 2HWGA 2PDUA 6ALDA 4C6JA 4NNCA 1UPPA 4MWAD 4HPGA 1HKJA 5B7YA 1M7OA 1AJZA 3ZFHA 1V3LA 4O1BA 1XLCA 3NWRA 4OOUA 1QPOA 4HJWA 5FEZA 1B0IA 1F05A 1QRQA 4C6IA 2A79A 4H6EA 1EDGA 1BFNA 1KCZA 1LTDA 3WNKA 4C60A 2DDXA 2QCMA 3EWUA 3CYVA 3KTXA 3EWCA 4ZQCA 4KRTA 3WQWA 4MHBA 4QITA 3PF3A 1AZ1A 2B0MA 1R3YA 4IFRA 4D9PA 1JNDA 1I45A 3WQDA 4YJ5A 2OB3A 4GJJA 4AEOA 4LC6A 5AZ0A 1W1PA 5G4WA 3AYSA 3TN6A 1BAGA 1B3ZA 3R4IA 5F4XA 4GVHA 3WELA 4IH3A 1R86A 1G4PA 3CAKA 4IFKB 5E6YA 3UJFA 1NWUA 1VEOA 2UWFA 2ZBTA 5H6HA 1C91A 5A8OA 4ICCX 2EJ1A 3PAOA 4UTLA 3UETA 2PDKA 4M24A 3N2MA 1J8VA 5I06A 1VFSA 2WANA 1O5QA 4HQVA 3GTIA 5XIAA 1EFZA 4J40A 4Y9NA 3ARPA 3LS9A 3BAKA 3DFSA 3POHA 4HBKA 3K8LA 2BWGA 1UWIA 1R6WA 2BXYA 4U33A 3RM8A 3UJEA 2FZ8A 6REQA 3L0GA 4RZ4A 3W07A 3ZLHA 4L4PA 1X6UA 5I00A 4XX6A 4IG2A 1K7XA 3P8IA 1XINA 5HOSA 1GQJA 3UZWA 4HOWA 1BD0A 4JX4A 2J7EA 1GTHA 3W3OA 2WKLA 1J0ZA 3URQA 5CBIA 2QF7A 8CGTA 1T41A 3BQ6A 4CGTA 1X6NA 1GVFA 3RF9A 1OYCA 1VP5A 3O0KA 4D8LA 3HJEA 3PB2A 3CC1A 1EYWA 4KEUA 4YN5A 4UBPC 3B0UX 3P0WA 1TPH1 3LRKA 4M7TA 4D8AA 3GNPA 3EXSA 3H2NA 4QJ5B 4RJEA 3ITGA 3LI0A 4E4UA 4LBRA 4HJFA 4PUJA 1YKWA 2ZRZA 5LNVA 3F4VA 5MKGB 4IL2A 3TONA 4C6OA 1Q2SA 1DPMA 3MDWA 3AS1A 4DF1A 5BROA 1A50A 2Z6IA 3AC0A 2ZRYA 5T8GA 5I3DA 1HL9A 2PBOA 5LIUX 1YBQA 3TFCA 1QTWA 5C5YA 1ZRQA 4O0QA 1HZYA 2I1OA 4IL0A 3CTTA 1NH6A 3WLTA 2H8ZA 1TPVA 1OIFA 4IM4A 7TAAA 1MYRA 2ZRXA 2WB5A 2RDUA 3TTOA 4QJ4B 3A3XA 1F9CA 3B9EA 1BF6A 1BGGA 3VD5A 5ABTA 4CEXC 1XGDA 2Y8VA 2OCZA 2QDGA 2YGYA 5BRBA 1A80A 4GBUA 1TTQA 1JD9A 3QY8A 2JIWA 4PCPA 3U2ZA 3VNZA 3DU0A 3HB9A 3MKCA 3RPDA 2ZRUA 1DXIA 4GJ1A 1KR0A 1KM5A 3EWBX 3OA5A 1CI1A 3CO4A 2PMQA 4PODA 4N6EA 3IEBA 1DBTA 4IFKA 3QV9A 3NDOA 2BX7A 4Z2KA 3WF2A 3I3EA 4A8IA 3T2OA 3MCOA 5AHLA 1ITCA 4H83A 2BNJA 5FAJA 2DZTA 2WSYA 3KP1A 2HVMA 5JH2A 3ITYA 3RDKA 1QXLA 4LALA 2QDHA 3CIWA 1O4UA 5AYBA 3P8JA 1A47A 1QPQA 5JQ9A 2DSKA 1PCWA 1I60A 1WDQA 3NQ7A 3VD7A 4RE3A 3QW4B 2ACQA 3SIMA 4CQBA 3MO4A 4LQ1A 3RNDA 4OGZA 3U7VA 3AYRA 1LRTA 4B3ZA 2XH0A 4ZTYA 3MQTA 4GNVA 5A6SA 1VFLA 1V0NA 4IF2A 3QZEA 1PUDA 2V30A 2OSYA 2AKMA 3DIPA 3OZYA 2NSXA 3WH8A 1JCLA 1H1ZA 4LPCA 2VDHA 3TTYA 5C2XA 3GDKA 3S0CA 2J8FA 1OFQA 1LOSA 4UTTC 2VGGA 4A05A 3ARQA 3C0SA 2E77A 2NVDA 2Q02A 5B7ZA 5DLCA 2J7HA 1MXGA 3EA2A 1KBLA 2QMKA 3DI1A 2DPEA 4IQLA 5D9NA 1RQEA 2OX4A 5HNTA 1ONXA 1GNXA 3BCDA 1UR8A 1UZ4A 1WB0A 1KM4A 2RUSA 1FKXA 2ZWZA 4UR9A 1HJQA 1ZJBA 1GTEA 4MDOA 4EPBC 3UEQA 3BH4A 5DQPA 4PCSA 2WPBA 3NL6A 4C6NA 3E2SA 2FPTA 2LLEA 1H50A 1PE1A 1VENA 2OWWA 4ZSUA 4L4OA 3R11A 2X7WA 1SU5A 5XIMA 4HNOA 2EPNA 3F4NA 1ZAIA 1CX9A 4TV6A 1B9ZA 4B3LA 4LU0A 4AC1X 3CWOX 4W7UA 1JUEA 3ONBA 1GKQA 4DY1A 1AW5A 1LLWA 4F66A 1ME7A 4LANA 2G97A 1WBHA 2CK3G 2VEFA 3MZ2A 3B8TA 4RL3A 3TN5A 4DAFA 1QOQA 4TT3G 2Y89A 1SMDA 3CWNA 1J5SA 4GO9A 5FEXA 3CHEA 3P2VA 1Q8AA 5LIKX 1NQKA 3TIMA 2NT0A 4A8NA 4S23A 4FO4A 1VD6A 4JY8A 3LRMA 3RXZA 3MDUA 2OMAA 3BPWA 2VZOA 4QHRA 1L6SA 5C2GA 1JIBA 1HVXA 3ES7A 3EZ4A 4DELA 4MOZA 4J3VA 3ONCA 3INPA 3WD2A 3H8AA 4XZLX 3XINA 2JK2A 4Y9MA 2EG7A 1HKMA 2VDGA 4JIQA 2WVSA 4NT0A 4WX2A 2E28A 1V6WA 3HN3A 4C6EA 4Q4PA 3HV8A 4NI8A 2DVXA 3RILA 1OFRA 4AF0B 1V4YA 4GVFA 4QTGA 4FI4A 1AMKA 1T6MA 2A1YA 2OX1A 2VC6A 1OY0A 1RQHA 3POCA 5D30A 3UPWA 4O14A 1EHNA 1OG6A 1REQB 1QWKA 2X0HA 3U48A 3VTRA 5DMLA 2J6VA 3PG9A 4PN2A 4L80A 2HPIA 2WZTA 4BWLA 3HGSA 3VOHA 2F2HA 4N4PA 4GZEA 1RVKA 4NXKA 1MFVA 3UXLA 4Z42C 1RZMA 1YEYA 4DNHA 1R7OA 3EWWA 1R5YA 3QPZA 1SW3A 2VM8A 2WJFA 3P82A 3W2NA 2Z28A 1ME8A 1DOSA 4G5DA 3P67A 4UOZA 2ZE0A 2Z7GA 3MYOA 2ZUSA 2GJXB 2PTWA 4IP7A 3APGA 8TIMA 4GE8A 2EO7A 4OJYA 4FA3A 3O8AA 3TX9A 1G7UA 2CBIA 3DG7A 4GX9A 4QE1A 5CEWA 5A6LA 3W1LA 3CMJA 4WK9A 4CNTA 3B3DA 4JS3A 1UOZA 5HJYA 3T42A 4LNYA 1XKJA 2YYTA 1A5SA 1PKYA 3UXAA 1UR1A 2A6LA 2XM1A 3GVVA 1R46A 4ZE5A 3SUVA 3WJWA 1YE6A 1TV4A 2Z4GA 2VOMA 3OZPA 1E55A 2HVOA 3GIQA 2FHCA 4JQ1A 5BXPA 2E7FA 3W71A 4Y8EA 5E9AA 3M5ZA 1UA3A 3BC9A 3FJ6A 5EMJA 3SRDA 5CSSA 3TMQA 2NQJA 3WF0A 1JCJA 3RN6A 4CLMA 2NQLA 2PWHA 3EDKA 1PVNA 3UWYA 3GG8A 4IPNB 5C55A 4O0KA 2O7QA 2NQHA 1KTCA 1UR3M 2OKTA 1SZEA 4UFMA 2D73A 3QEZA 3MO7A 4WSJA 2OKOA 3G0UA 4Q4KA 2Y1HA 4A35A 1TE6A 4GYFA 3W2JA 5I6SA 3S5NA 1LOLA 4O15A 5HXMA 2Y5JA 4W8BA 2XZ7A 2J25A 2CW6A 2TPSA 2BB0A 1PWMA 3W01A 2DVUA 5AHIA 4CNOA 3OEHG 1SFTA 4NRSA 3P61A 4YNGA 5BRPA 1TPB1 3CBWA 4LV4A 3B97A 1EQPA 1JAKA 4LJ3A 3W6YA 2W6JG 1UHVA 5I77A 4AHOA 5K9DA 4RW3A 2BASA 3OEXA 5DCDA 3FX4A 2FZ9A 3ZJKA 4H9UA 3TOYA 4G6CA 1REQA 2HCVA 1RV8A 2WNWA 3PJTA 3L12A 3WLQA 4KCWA 3VM5A 2IQTA 1XG4A 2ZXDA 1UZ1A 4GY0A 3YPIA 1IIHA 3O7UA 3UD6A 4HPNA 3W2UA 3IJ7A 1HJWA 2J9XA 3W86A 1KR1A 3V18A 4F0LA 1KXTA 4Q8QA 4JNYA 1KM0A 5KITA 1UYQA 3SIZA 2ZKMX 1B5TA 2VX7A 2C71A 2F9RA 4FNUA 4LS0A 3ZS4A 4JFUA 1T99A 3IIOA 5FF7A 3TJIA 2G0WA 3CEPA 4B9ZA 2GJXA 1NAL1 2P1FA 3WQEA 1DWFM 5HATA 1VLIA 1SZFA 2QPUA 4TUFA 3RG6A 1LF1A 1ISZA 3SUWA 5DF0A 2QXWA 3CEUA 4GA8A 1TRDA 5G2WA 2J8TA 2R6OA 1HW6A 5RUBA 4JTGA 1WZKA 3LTSA 3AJ7A 1LQ2A 3VNDA 3VIPA 1EJ7L 5E70A 3PUOA 1Q45A 3VYLA 1PZ1A 4O18A 4P5UA 3TQVA 4W84A 3GW3A 3ME3A 3N11A 3WLRA 5DRCA 3ZJ8A 4GXWA 2X1SA 4ATDA 3E9AA 4MTVA 2DT3A 4D2JA 5K3VA 4GY7A 3IUIA 5H8UA 4RNHA 3G1XA 1W3TA 3L21A 2G96A 2C19A 4ECLA 1XPYA 4HK5A 1SPQA 1Y5WA 4XAPA 4MJMA 3CGTA 3WH9A 3PBGA 5DCBA 4ILSA 5LKYA 2D23A 1WOAA 1V6VA 2YB4A 4JFTA 2PWDA 2J88A 3EB4A 1VBHA 2E6AA 5DMMA 2G37A 1NDYA 2VC5A 1RSCA 4BF9A 2Z2UA 1EC8A 4D6JA 1F5ZA 3ARSA 3ANYA 1MEWA 2FJUB 3WQ4A 2OJPA 3WF4A 4DX3A 1XH2A 1FCQA 3EX6A 4PTMA 4PMXA 1T8QA 2G3IA 4PB4A 3KDNA 2ASHA 1XKYA 4U10A 2QMJA 3AHZA 4PBEA 2VUNA 3KCOA 4LEQA 2DUAA 1X1NA 3E49A 2L5HA 1I6NA 2BV9A 3L4ZA 1FHUA 1KLZA 2VTFA 3OW1A 2KAUC 3SSJA 4EVZA 1BYBA 4RE0A 4LV9A 1TTIA 3F7JA 4AZIA 2IKJA 5AC8A 1ICSA 2OR2A 3JVAA 1B90A 2R82A 3GFXA 1NVMA 3ICJA 3GO2A 4YVVA 3TK7A 4RPPA 3UGVA 5BZAA 1SZGA 3PZQA 4PSRA 2GL5A 3ZJ6A 1OYAA 4EWND 3MTWA 4FAMA 3GUWA 4ZFCA 2V81A 4JPGA 3UPBA 1XIDA 4ZOCA 4I9AA 3WEOA 3PZTA 3BXWA 4LVAA 3VC5A 1W2PA 4I3GA 1WNOA 2QVNA 3BJSA 3L2IA 3WMSA 1UZDA 1B3WA 2CITA 2J9ZA 1ZSXA 1OM0A 3ITVA 5JVLA 2OEKA 4Q8OA 3AIWA 3N9SA 3KTSA 3IRSA 1DVJA 4I5RA 5AN7A 2CLFA 2PLJA 3OEEG 4FPSA 2E8ZA 2F8QA 3WUBA 3VOCA 1S2WA 4J7RA 1VFUA 2JKPA 4F2TA 2ZC1A 3M16A 5HWMA 1SUXA 4MGGA 3MCNA 4CVUA 2OOFA 3PTKA 5D2XA 4ZQMA 3UZZA 4NASA 5HMEA 3WJZA 1W1TA 3T05A 1B3VA 2CC0A 2BOEX 4FP1A 4Z1BA 4L61A 4G56A 3F2DA 4AUBA 1YQ2A 1EX5A 3BG5A 5D37A 2DIJA 4PEKA 4LF1A 3TJ4A 1QNQA 1E4MM 1FXPA 3S1WA 1JXJA 2ACSA 5C9XA 2E3ZA 2VFFA 4ICNA 5BNKA 2UBPC 2WK2A 1V3JA 5CPSA 3SGZA 3GYCA 3WQVA 1A5AA 2O92A 1OCBA 4S3CA 2IXVA 2ACRA 1HP5A 1FH7A 3S5SA 1PIGA 3HGJA 4BS0A 3WQ6A 3MYPA 3UZ5A 2XSAA 3BSGA 2AQVA 3BLDA 1H1YA 3OP2A 4IOTA 1PX3A 3VDAA 1MMFA 3DECA 1KC7A 1OFBA 5HJXA 1JJKA 4HT3A 1IEWA 3P5ZA 3JZEA 5DBTA 5CJNA 1PIIA 3HFTA 2XUCA 4Z1AA 5CPNA 4I90A 4V1XA 5LNWA 3BW3A 3L23A 3CUHA 1OSEA 3ZLGA 1ISWA 1QBBA 3M7WA 3UESA 2H3DA 5AHFA 4KESA 3ARYA 3NIYA 4B9YA 1SFSA 1ZB5A 3OQ8A 4GQ0A 4FB7A 1TPFA 3V16A 2W63A 4DRSA 1S5VA 2PP0A 4A29A 3ARZA 3R25A 4N9DA 4H8UA 1O5KA 1K4GA 3AQUA 3PTMA 2BDQA 4GH1A 3PZOA 4KERA 1KRMA 5BU9A 2DH2A 5CZ0A 2WBKA 3RX2A 5E09A 3BJFA 1VJSA 3NQ6A 3MW7A 4KH2A 3ID7A 4YLWA 4XVEA 2R8WA 2QR6A 4IT1A 5A2BA 4DJDA 3KOWA 3FSTA 3CHDA 2BOGX 4W93A 3PPFA 5EMKA 3TCSA 2V0TA 5E6ZA 2BBFA 2GPTA 3IGXA 2QW5A 2NWRA 3FXGA 2XSBA 3W29A 1ITXA 4XO6A 4XV0A 3PPHA 4IJBA 3AXMA 1JGMA 3HURA 3AHTA 2WHKA 3NQAA 1KD0A 5J5DA 3ECQA 3QV6A 2CU0A 2Z1KA 4FNRA 1YDYA 3L4VA 5LNUA 8XIAA 1G94A 1OFAA 1R38A 1TR9A 4LOCA 5FAGA 3UWZA 2GUBA 2WAGA 1US3A 3GXTA 1M6JA 2CLIA 1FVPA 4U28A 1F8MA 3EOEA 4DUXA 2EPHA 4GACA 2QDEA 3UG8A 3CAWA 1JYNA 3F4WA 2JDIG 3W87A 1CCWB 3GBEA 4LYRA 2HXTA 2Y8KA 1POJA 4JD4A 3MI3A 5ABEA 4P7OA 2A85A 1Z69A 4JY9A 3MSRA 4HMCA 1KM3A 4ZQRA 4OBTA 1V3KA 4QLKA 1XIEA 3BOLA 2HQAA 4H7CA 1AW2A 4CVWA 1QK2A 2PC4A 2BXZA 1VCVA 3F2CA 1LQ0A 9XIAA 2HNHA 2OWXA 3SEPA 3TROA 1SSDA 1GOKA 2XN0A 1A5CA 1G4TA 4IGMA 1HIZA 1TG7A 5MF5A 1V3MA 4X9YA 1WZMA 1KW1A 3TYZA 3VUSA 1KFCA 3PHAA 2VFDA 1ONRA 4AISA 4O4VA 4H4IA 3EEZA 4FEZA 4NJIA 5M3WA 2I5IA 3BW4A 4B16A 1WXJA 3PBYA 5A8PA 4D6EA 2NWSA 3AZSA 2ZXBA 4N7QA 2ZX5A 2WSQA 4XSLA 4OFCA 4AWUA 3RPTA 3K4DA 1BVWA 2VEIA 2RDWA 3LCXA 2DQXA 3BCJA 3FEMA 1DJHA 3PBWA 4Q8PA 1V93A 1FA2A 3ALGA 4ZENA 1UH2A 3ZVIA 2VR5A 1UROA 4GGBA 1EC9A 1J11A 1WUFA 2PDWA 1XF0A 2Z2AA 2IPGA 1U33A 4JEJA 3TR9A 1A3XA 4R53A 4ZBCA 3EWXA 3OJGA 2XH7A 4J3XA 2V2CA 1ITQA 4NAEB 3TC6A 5ABFB 1VQTA 5IDIA 4TSFG 4Z2JA 4NSBA 2Y5SA 1W9VA 1UQZA 4CNNA 2BHUA 4ZO9A 5HUPA 4AW7A 5I79A 2NQ5A 1Y7VA 1MEIA 3PZGA 2YZ5A 4J9JA 2CZFA 3C0QA 4Q8NA 3G5EA 4S3DA 1B2YA 4MWAC 2FGBA 3ARWA 2WVTA 4EXAA 1YNQA 2NQZA 2ZZ6A 2FKPA 4JTQA 3QR3A 4DJED 1K9DA 1QVBA 3PWIA 5I7GA 1IXQA 1OB0A 5LXEA 2PU1A 1TPEA 3AYVA 5KETA 2OO0A 3H53A 4UOJA 2Y6ZA 4E8GA 4UFHA 4QLJA 2F6UA 3KEHA 3NG3A 4U2ZA 2GJLA 3V0UA 4Y2WA 1F3XA 4DWSD 3LN3A 1IV8A 4FX8A 4HPJA 4LWWA 4A8LA 3W1RA 4OQVA 1D3CA 1D8CA 1XSJA 1CNVA 1POKA 3U9IA 3KFTA 2G3MA 1O12A 2HJPA 3M0LA 3WLLA 1QO2A 3VCNA 1J0KA 3K4WA 4NZJA 4S2BA 2H8XA 1Q7ZA 4I9MA 4KWUA 5A5WA 3CB3A 3B8VA 3OODA 1Z41A 1L2QA 2ISWA 2QDDA 4B5WA 3AXKA 2OQHA 3L65A 4NJGA 4BY3A 3AIRA 4BFAA 2TAAA 2VEKA 5BOOA 3LEPA 2Y8UA 4BA0A 1M9HA 1X8CA 3DFPA 2HS8A 4WCJA 3IJ9A 2WVUA 3T0AA 2PBGA 3C52A 2OVLA 1DJYA 1QU4A 4AHQA 1JYWA 1W5PA 4ML9A 2D3LA 1LJYA 3AWNA 1E4IA 2XN1A 5EMMA 5TAOA 3W83A 3PZIA 4OIFA 1O1ZA 3W1NA 3QTGA 2ABBA 4I9JA 4HCLA 4PMDA 2D2OA 2NVCA 4NI3A 1TV3A 3N4FA 3FKKA 3W6MA 1FWNA 4QLLA 2X16A 3T78A 1WDPA 4N9EA 2FJKA 5BWAA 5FL0A 2VCBA 5JH1A 3A12A 3TN3A 1OWQA 3QC0A 1WKYA 2DT2A 4U5KA 5DBUA 4J1OA 1GVOA 2B81A 1A0EA 1N8FA 1CXEA 3OVRA 4RR4A 1T5AA 4NAEA 1Q4WA 3EBVA 1BGAA 4J5NA 2REQB 4WSKA 2V67A 4N9CA 5IHSA 4IFOA 3G1VA 3AI0A 3S2LA 2JEQA 3MA8A 4QEEA 1AQFA 3EPMA 3VMOA 3NAVA 2VEMA 1EO5A 2J66A 4XWUA 1JNEA 4A2SA 3A22A 4WR3A 4UFIA 3NOYA 1KGUA 1Z48A 1DTNA 4F4RA 4RNJA 1CLVA 3RCMA 1W1A1 2W66A 4Q8UA 3ITXA 4Z1MG 3UJRA 4DWDA 2IMRA 5I02A 3NR0A 3P0XA 3KOXA 3IJ8A 4PCTA 4E5TA 3LMZA 2J4GA 1BKSA 1BVZA 1WE5A 2PAJA 5FF2A 4JCLA 3T40A 3SCOA 4TIMA 4PFHA 1GEHA 1R3SA 4YL2A 3OGSA 1UH4A 3F5KA 3QC3A 3UWWA 5BWFA 1YDVA 5A94A 4HYWA 3QY7A 4DPPA 4H6RA 3WDQA 1OBAA 2PZNA 3NCOA 1EA9C 4N2YA 1AJ2A 4J27A 2DZPA 4QQUA 2ZFAA 3LHUA 1I2NA 2VOTA 1VJZA 2B31A 1BLIA 1UJPA 2C1GA 3KVMA 3FKRA 1VFFA 3EWZA 2XGBA 4PTXA 3APYA 3UBPC 4IQJA 4FF7A 4OUIA 1HF6A 3NYZA 1XCFA 3GK0A 4FF5A 1Y65A 1FHVA 3SURA 3NVDA 4O16A 2OWCA 3WN6A 4FNTA 1XBZA 3TAOA 1W5OA 2PTZA 3WQCA 5K4XA 4R5EA 2VX4A 3T0TA 1IT7A 4M6VA 2IQ0A 3TW9A 3WUEA 1TREA 1FFRA 4TVCA 4XKYB 1M53A 4HCHA 4LAUA 4EF9A 4QAWA 3I6RA 3L66A 3PZMA 3TMLA 1G6CA 5I0DA 2O0TA 5I3FA 2YL8A 2V3EA 4Q8TA 1MDLA 2WCSA 3PPCA 2VZSA 1GVRA 3KL5A 3RMJA 3LCHA 2DORA 3WBAA 3W72A 2KZHA 1P6CA 4DPQA 1W5NA 3AHXA 4YHEA 2WMJA 3HPXA 2HDJA 2GSEA 3BO9A 4HN8A 1IF2A 2PTXA 2VMFA 1Y0EA 2OO6A 4QRNA 3VD3A 2CNCA 2GVJA 3MMWA 4I5UA 3IGUA 3GHRA 4UTIA 1VBUA 1XUUA 1VYPX 3M43A 4JKLA 5DX7A 3EX3A 3AAGA 1AFSA 3L2LA 4AEFA 1J18A 1CLKA 1XRTA 1V0LA 3GC2A 3NPVA 1Q6CA 1DXFA 2REQA 1GW1A 1SJDA 1QWGA 5HK4A 3LCIA 1BSLA 2XISA 3JW7A 7A3HA 1PV8A 4M0XA 2INEA 1VBJA 2PDBA 3TW6A 3ATYA 4B2DA 1WDRA 3S6OA 1ZTVA 3OYXA 1J6OA 4RPQA 1OG0A 1FQ0A 4IMEA 2O9PA 2WMHA 3T1GA 4AVNA 4Q4SA 1EXPA 4WIWA 1S3HA 3FHQA 3CZJA 2VQUA 1WP6A 4HVXA 4MKVA 3LGDA 3NO1A 3MP5A 1O94A 2EHHA 1S38A 2CLMA 4FLSA 1RHCA 3W27A 3I3DA 1P43A 3PM6A 1H7XA 4HNCA 1UIOA 2R1PA 2WC4A 5G1YA 4ZODA 4PULA 3VFCA 1TWSA 4WY0A 4Q7BA 4V27A 4NZCA 1OIMA 1SO3A 3CUGA 1OQFA 3A23A 5DMYA 2A21A 1VIZA 3FFSA 3ZJ7A 2CHNA 2V5DA 1OD0A 1JF6A 2ZUTA 3R10A 2FHBA 2HTMA 2PGWA 1LZOA 1NF7A 1OFDA 1ZHAA 3OOQA 5A8GA 3CWHA 5T91A 3MVTA 1TPC1 4JTUA 2QGHA 5A3HA 1KTNA 3RJYA 4ZB5A 1MW3A 2ISSA 4JTTA 3W7CA 1ICPA 2HS6A 3HG3A 3DZ1A 1W8SA 3R43A 1RCOB 2CWNA 4O1EA 1KFWA 3O07A 4NL1A 3EOLA 1YIXA 4NNAA 1EBHA 3NPWA 2VURA 4IIGA 1EEXA 3EOOA 2FB2A 2R24A 1IGSA 3AYTA 2PSNA 2QKFA 5FF3A 4QFUA 3OGVA 4I5XA 1ZCCA 3GDLA 4GPNA 3WNOA 1JCMP 1WQ5A 1VEMA 1RY0A 1ML1A 1R2SA 3LZ3A 2BOFX 3NL2A 5FI8A 1JPMA 1XW8A 1I0BA 5CLTA 4ERGA 4LRSA 1KXQA 1RBOB 2HPMA 3VNLA 2PDMA 2V5CA 1V0KA 1H41A 1XD0A 3ERPA 4CQAA 1NFBA 4ZFMA 3C0LA 2FB3A 3M5YA 1LROA 5FESA 2HRWA 1OFEA 3AIVA 3IVSA 4XZHA 2GYIA 2JJ2G 2NLYA 2AL1A 2D3NA 3KHDA 3V1PA 5A6BD 1RLDA 3CPGA 2JALA 1PZ0A 5D4YA 4NP7A 2QCDB 1UR4A 2VGFA 3OFNG 2JIEA 4F8XA 3U5YA 1FDZA 4NZFA 3ES8A 3T7VA 1W5MA 4YVXA 3VO0A 4DWSA 2PU0A 2XDFA 2V5LA 1TKKA 2ZDSA 2ANUA 4JDBA 2FTPA 2F84A 3VX1A 4GI4A 3BUVA 3K2GA 4W9TA 2C13A 3FJLA 3KBJA 5F4WA 4S38A 3CQKA 1GGOA 3PUGA 3SGUA 1D3HA 4O1DA 3BLFA 3LU2A 1IHIA 4WY0F 1P0KA 3O6AA 1IEVA 2PDJA 3KM8A 3T8QA 4UTHA 2YJQA 4IP4A 3UJSA 4AXNA 1JI2A 2HK0A 2X7VA 4JTCA 4YIWA 4Q6JA 1HT6A 4L1GA 1IZCA 3DYOA 3ABQA 3E3HA 3IV3A 3WO8A 4JNMA 1XQKA 1C8VA 1IE7C 1EGZA 4LH8A 4B91A 4CD6A 4Q7IA 1VPYA 1NDVA 3STFA 3THQA 4ASUG 5CSUA 1QPKA 3N2OA 3C2OA 1GORA 5AY7A 2UY5A 3S2MA 1GOWA 3N4EA 2QIWA 1V51A 5KTLA 4QEHA 3R8GA 1UKQA 1PS9A 2WLYA 2ZYFA 1JPKA 5I78A 3E02A 3VDCA 3KRUA 2BG5A 5DY3A 4GC3A 1IYXA 3VI2A 1SFLA 4X0NA 4YWIA 1HL8A 3C8FA 4N9BA 3GXDA 1B3XA 2FMNA 4DUWA 3BZGA 1IIGA 4GO8A 3NDYA 3QYSA 1UC5A 4FMVA 2BHZA 4US5D 5BXTA 5CGQA 1NU5A 4BEUA 4D1IA 5AYZA 3WENA 1SW7A 2W9MA 2XH2A 2NX9A 4LUSB 2Y7EA 3OIXA 3USBA 1YHTA 4QE4A 2HNEA 3A4XA 3DHFA 3QM3A 3KBSA 1HO1A 1S5TA 1XHGA 3CZGA 4B5VA 1SZNA 1RPKA 2V3GA 4K3ZA 3NPUA 2X2YA 1W9UA 4QGCA 2DW6A 4JFVA 3I65A 2X42A 1RP8A 4MSSA 1HP4A 3LY0A 3NOEA 4LYQA 1KCKA 5JBFA 2EEXA 4QDMA 4HNTA 4WJ8A 5E9XA 1UUOA 2DZVA 3VGGA 4INFA 4HPHA 3P3BA 4FS9A 1E43A 1Q2RA 3GXNA 4MPKA 4JX5A 2YL5A 2PDHA 1Q6LA 3N4AA 4LAZA 1EQCA 1J96A 4DN1A 1HKWA 2QCDA 2PCEA 1QATA 4FSAA 5KZMA 1U30A 2QUTA 1RPXA 5TIMA 2J77A 3CQJA 1NOUA 3LGGA 1TUFA 1EHAA 4XBKA 3JRKA 2WVVB 4G1NA 3BDKA 2OLSA 4W86A 4C6CA 3TQPA 3TLQA 2B7QA 4MNLA 4UR8A 3LNMA 1VBRA 4HSOA 5LNRA 3NPXA 1K8ZA 4GUJA 1QNSA 2IKIA 1K9EA 1AQMA 3HU7A 3WJXA 1Q4NX 2HBVA 1ODUA 1MUMA 1K1DA 1P5BA 4AIEA 3LCGA 5BRQA 1V8EA 3R8RA 4B5SA 3LSCA 3TTEA 1ESWA 1B3YA 1H11A 4ICMA 3QGVA 5DMNA 4AY1A 4MNKA 5BCAA 1LWHA 5CLWA 1KFJA 1ZCOA 4M81A 3GFZA 3GC4A 3LX9A 4YTQA 3FDKA 3WH5A 3CT2A 3PNUA 3R6IA 2R1MA 3LTYA 3I3BA 4Z17A 2C91A 2WHMA 4H00A 3FA3A 1OC6A 1F6PA 1FWEC 4AZHA 1WDDA 3E38A 4S2CA 1AK5A 1JQXA 3LLXA 4TV5A 2CEQA 1S2VA 2YYUA 4H9YA 4HZ7A 5GNYA 3GDTA 1XLMA 1O66A 3P6LA 4U5IA 3TE9A 4DLMA 4GYPA 3AOFA 4Q4OA 4LAKA 3QMRA 2EXOA 4Y9OA 4AB4A 1R9ZA 3CQHA 1EGVA 4AZ7A 4ZTXA 1J2BA 1BKHA 2GQ8A 3N9RA 4LUSA 2YA0A 3JUGA 3NGFA 4QG9A 1UD8A 2OQYA 4KIEA 2W61A 5I3GA 3UW6A 3WDHA 1P0EA 1OYBA 1I2QA 3NQMA 5EB8A 3L4XA 3V36A 4TX6A 3GDBA 4IMDA 5GVJA 5IXEA 3DX5A 3NQFA 3W7DA 3TZFA 2YL9A 3A21A 3PWGA 4L5ZA 3RLHA 3UYIA 1SJAA 1J79A 3BGGA 3LLDA 2WSPA 2R94A 2YXXA 1EX1A 4DXKA 1JAEA 1TIWA 5FCZA 3DOPA 5IFPA 3AICA 3NJ3A 1M68A 2PGFA 1EJTC 1DIDA 3GAKA 4MYAA 1IEQA 6PTDA 3UR8A 2INZA 3BAYA 4JR5A 2E40A 3QOKA 4A3YA 1GUVA 2WC7A 6XIAA 4Q7NA 5CBBA 4CN4A 2PDLA 1E0XA 3VM7A 3ANUA 2XVLA 4AY8A 4DBSA 5HNNA 1CGVA 4JTRA 3B9AA 3H7UA 2GJPA 5J5RA 1U83A 4F0SA 2FZDA 3A9IA 1W32A 6TAAA 4PMVA 1T0OA 4UC5A 4ROQA 4X2PA 3GXPA 4ATWA 3TA9A 1HKKA 1R9YA 2BS9A 3KOYA 5BMWA 3S2NA 4KEZA 3QHOA 5FACA 1X38A 2YBUA 2VKZG 6CGTA 4M1BA 2WHLA 4FX7A 4HHPA 2V69A 3KBWA 5CKSA 2OFJA 4AZ6A 2ZXQA 4CD5A 5JUVA 2ZA3A 4H1ZA 3S9ZA 3LG3A 3VIMA 1B30A 3O05A 3XIMA 4IUOA 4LBUA 4BKNA 2FTYA 3VCCA 2PDYA 4QCFA 1QOXA 1EDTA 4L4MA 3TNOA 2WKJA 4PSPA 5FOOA 1SR9A 4HU0A 3VZZA 3A5VA 4Q8VA 4NIRA 4QXIA 3ZT5A 3VZYA 1S2TA 5IDZA 2QCHA 1KLYA 4BQ4A 3GAYA 3L4UA 1LDCA 3UU0A 1FWFC 1K02A 4C7GA 2EPMX 3UPMA 4A3QA 2HROA 2PRMA 4Z1YA 2BODX 2G95A 1KA9F 4XBJA 3RITA 1PX8A 1QW7A 2EBNA 3U6WA 4DIAA 4WDUA 2TYSA 4JIHA 2WJDA 3CPUA 2B7NA 3W7RA 5AB3A 3CAQA 4AAJA 1AW1A 1IT8A 4YS1A 5CQ1A 3IRDA 4GOAA 1LOQA 1TTPA 4A3HA 3ZWTA 3KVJA 4X3ZA 3IIVA 4MPQA 4AIUA 1CW2A 3L7RA 1GZGA 3M0YA 3LBMA 1TZZA 1Q3NA 2XVNA 4PYSA 1XLEA 5HPOA 1GKPA 3UR5A 5AOUA 1Z6KA 2E9MA 1XYBA 2GGGA 4D1JA 3KW3A 1K8YA 3D3AA 3M47A 3DFHA 1UPMB 4FHAA 3ZR5A 8RUCA 1C8XA 4H2HA 2IQDA