4KCWA

Pyruvate kinase (pyk) from trypanosoma brucei soaked with oxalate
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
498
structure length
498
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate kinase 1
publication title Pyruvate kinases have an intrinsic and conserved decarboxylase activity.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 186
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4kcwA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4kcwA01
3G2GA 3GG8A 3OYZA 1UJQA 2KX9A 4KS0A 3T0TA 3OYXA 3QV6A 1DXFA 3I4EA 5JVLA 1GGOA 3QQWA 4KCWA 2VWTA 1O5QA 3LG3A 4B5SA 3M0JA 4HYVA 4KCUA 1PKNA 3M0KA 1PKMA 4QGCA 1S2WA 1XG4A 2ZE3A 1DQUA 3QZ6A 2HJPA 1IGWA 2OLSA 2R82A 4MG4A 1F61A 1PKYA 1VBGA 3QV9A 3H6OA 4IMAA 3MA8A 1M1BA 2VGIA 4IQDA 2L5HA 1T57A 4QG6A 3KTXA 3T07A 2HRWA 3SRFA 3IS4A 2VGFA 1PYMA 4L7ZA 1S2UA 1XG3A 2WQDA 3EOOA 3N25A 1T5AA 1F3XA 3ME3A 4L80A 3B8IA 4KRZA 3E0VA 3EZ4A 4KCTA 4LSBA 4B5WA 3PP7A 3QLLA 1ZLPA 2XDFA 1DXEA 1U5HA 2V5KA 2DUAA 1M3UA 3BJFA 4QG9A 3PUGA 3P0XA 4B5VA 3GR4A 2HWGA 1OQFA 1F8MA 4ROQA 3FA4A 1O68A 1DIKA 3EOEA 4HYWA 4IQEA 4KCVA 3U2ZA 4B5TA 4FXFA 2X0SA 4IP7A 3R4IA 1JDEA 1A49A 1PKLA 4WJ8A 1VP8A 3SRKA 1ZJHA 3GQYA 1U5VA 2XZ7A 4TV6A 4TV5A 3SRDA 2VGBA 4B2DA 1KC7A 1AQFA 3SRHA 2DIKA 4FXJA 3VAVA 2VWSA 3LYEA 4G1NA 2XZ9A 1S2VA 4B5XA 2VGGA 1A3WA 3QV7A 1E0UA 3HQNA 1IZCA 2V5JA 1Z6KA 4YJ5A 3E0WA 4MF4A 5TAOA 4B5UA 4B2DD 3FA3A 1F3WA 2E28A 2HROA 3OQ8A 1O66A 4JPGA 4L9ZA 1E0TA 3E5BA 1OY0A 4QG8A 1SGJA 2QIWA 4DRSA 1KBLA 3EOLA 1S2TA 1A3XA 1VBHA 3HQPA 2G50A 1F8IA 3KHDA 4RPPA 3T05A 4L9YA 1A5UA 3QV8A 1MUMA 4YNGA 3HQOA 3BJTA 2BG5A 3QTGA
chains in the Genus database with same CATH superfamily
3WQDA 1J6PA 4YVPA 1EYEA 1FWCC 2Y5SA 3LM3A 4ERAA 1Y65A 3BLEA 2BV9A 1XPYA 1TVLA 4Z2IA 4UTLA 2VC9A 1KWGA 3I6RA 1QVBA 3RR4A 1F4AA 3BCFA 2ACUA 1R47A 3WIJA 1ME9A 3UXDA 2VP8A 1G94A 2TRSA 2OVLA 4HNNA 2Q6ZA 1H49A 2WMFA 4XWUA 5D30A 3W02A 4UMBA 2EKGA 1RJRA 3VKBA 3AHXA 2VEGA 2YGYA 3BQ6A 1SYTA 2EG6A 4O53A 5HPCA 3TW6A 5HINA 4NRSA 4ZOCA 4FR1A 1UMYA 3EX3A 4XIMA 1TR9A 2BP1A 4RLIA 5EYWA 2E3ZA 4UTHA 1FXQA 1BRLA 1MXDA 2C0AA 2W61A 1V77A 3ZR6A 4QAWA 5AYZA 3BAJA 1AW2A 2BNJA 3WQ6A 5EL1A 2RH9A 4GMEA 4N9CA 3O0FA 4XBJA 3L4YA 2XIOA 4IFKB 5BOOA 1R6WA 4HA3A 4XZIA 3M9YA 1OCNA 3L23A 4ZZ9A 4MY9A 4MB3A 5T91A 1OFQA 2YW3A 1M7OA 2QJJA 1GQJA 2GWGA 3FA3A 4JIHA 4US5A 4CCEA 1IIHA 3VM7A 2PDYA 3H4WA 4MFEA 2NV2A 1D8WA 1GPWA 3AXKA 2YL8A 1OG0A 2DQWA 2W27A 3LMYA 3F7JA 3RJYA 1CENA 4TSFG 4S3GA 4ZO7A 4C6OA 3FEMA 1GW9A 1XG4A 4E8CA 4MZ8A 4KMQA 4A2SA 1Q2SA 4JQAA 2GJXB 4GYFA 2ZIDA 4AZBA 3O15A 2ZUVA 3PZOA 1RLDA 4H6RA 3T2QA 1M7XA 2QCDA 1DE5A 2A79A 1NAL1 3U5YA 3T07A 3CPGA 3FY1A 4DQWA 1X6NA 1W2VA 2A2IA 5DMNA 2WMKA 2NQLA 3V5FA 1WUFA 2YBUA 3GXPA 3B9AA 5HULA 1ZLPA 4H2HA 1DYSA 2PU1A 4Q3MA 4CVUA 4LJ3A 4RX0A 1FOBA 4BI7A 3R58A 4CD5A 2VNCA 3R8HA 2XVKA 3VIIA 5JH2A 1LP6A 3L5MA 5T26A 2WC3A 1YNYA 1BYCA 1X1OA 2FYMA 5IHRA 2KAUC 1BHGA 3PZTA 4MYXA 1DOSA 1Z48A 3V0SA 1VEMA 3PZIA 5C9XA 1Z9AA 3W4RA 3TN6A 4DUXA 2FHBA 1CX9A 1LYXA 3W83A 1XR2A 4CQ9A 1A50A 1XLLA 4UUIA 7REQA 1XDJA 3SY1A 1KM2A 1FWEC 4PRTA 4B90A 1ZS2A 3GIQA 1FWHC 3AMLA 3AFBA 2GUBA 4BQ2A 3SQLA 3SFKA 4X0NA 1HL9A 3QYSA 3D3AA 3LS9A 2J4GA 3R8RA 3U6WA 2JKEA 5D04C 3CQHA 3ZSSA 5E9XA 3PANA 4CLMA 1DWGM 2RAGA 3M0LA 3SY5A 1H4PA 1XYLA 4XZBA 2WZEA 1E3XA 2JJ2G 4KFOA 1VFOA 2TSYA 3EGJA 4JIIX 4Z0JA 3WQ4A 3NUKA 3WENA 2QCMA 7TIMA 1R87A 3F4WA 3AHVA 5CSYA 2Y7GA 2FIQA 5DCDA 1LUCB 3DUGA 2E8ZA 4DYJA 2NZLA 3OZMA 1J0IA 4C6EA 4HU0A 3EYPA 4GUFA 2OZTA 5F2GA 1CNVA 4D6HA 3T08A 1J2BA 4YTTA 4AEFA 4GGHA 3ZSTA 4L4OA 3EXSA 3ARQA 3N4AA 3RCYA 1M04A 4B92A 3G18A 4B3KA 2ZX9A 1XIFA 4ACZB 3RHGA 1QK2A 4Q4KA 2OTDA 3DIPA 3W7NA 2O4QA 4JPGA 1ZZMA 3E5BA 4S3EA 2Y5JA 3OLEA 1TJ0A 3CS2A 3QVQA 2RDTA 4HCDA 3PZQA 1N8WA 3BG3A 4FF5A 1VYRA 3ABSA 1HX0A 1QNVA 3W2JA 2J9YA 2EHHA 2HXTA 4O28A 3A4WA 4J28A 1I1XA 3WLSA 2OR2A 3TTSA 3FYPA 5CQ1A 5A8QA 2GOUA 4Z2JA 1TX0A 1HG3A 2OX4A 1TUFA 1CXEA 2CHOA 4AFYA 1A5OC 1Z89A 1E1EA 3BJSA 4U2ZA 4RW3A 2UBPC 2I1OA 4NYUA 3RMJA 3KVLA 2VD9A 3MZNA 1JJKA 2P10A 1K8YA 3PY2A 4P8XA 1RQHA 1Z32X 1YDVA 3WFLA 1EF3A 3UZXA 3UJSA 3TEVA 2OEJA 5DO8A 2AOSA 4E3VA 1S3HA 2UY3A 4LVGA 3MKKA 5AC6A 1V6VA 4X22A 2E77A 1JF5A 2Z27A 3TSMA 2EO7A 1FHUA 1VGAA 4HP5A 4UZUA 1G5AA 1OT2A 4WY0B 5AKQA 2ZDSA 4EACA 3FV9A 1CLVA 2V2CA 2PB1A 1I0BA 4YVVA 3OLIA 3PPFA 1QBBA 2VDGA 1L0PA 4GX8A 1H09A 1QI3A 1W5MA 5A1AA 5FL7G 3SZ8A 5JIPA 2OXNA 3VNZA 2YFOA 5AHEA 4QJ5B 1Z8AA 3APGA 3RITA 1J96A 1XRSA 4BZYA 2DSVA 4PRRA 5CJNA 5D8ZA 3AMGA 4XTIA 1MI3A 1LBLA 1PIFA 4HZMA 2JQXA 1ITQA 3L0KA 4EPEC 3MZ2A 3KRUA 1E72M 4ECLA 5U4NA 4Q6JA 4PCNA 1QWGA 4XSLA 1RJPA 5I3HA 1ECEA 1J5TA 3SDOA 4N9DA 3EWXA 3UCDA 1SR0A 2XTKA 1H51A 4IGHA 1WXZA 4HYRA 4ATWA 5A8NA 2V5DA 2YA1A 2YYUA 2ZRVA 2GUUA 2ISDA 3VYLA 4ATLA 3VNKA 4HMNA 5LXEA 4LALA 3WQFA 4MHBA 1O66A 2HDJA 3VC6A 4GZ7A 4JIEA 4E3TA 3KL0A 4CQDA 4LAMA 1IEQA 3W7GA 4O19A 1TJRA 1UMLA 2G50A 2YCIX 5D02A 2INZA 1A5UA 3QV8A 4NG3A 3C61A 4LFYA 3FOKA 1XCXA 3AIRA 3R1ZA 1XRVA 2J78A 2GSHA 2IKHA 3W1MA 1LLZA 1MRQA 2WK2A 4IXXA 2J8TA 3OEEG 4WK9A 3I4EA 2XIMA 3BG5A 5DMLA 3GC5A 1LWHA 3PAOA 4LWWA 2EQDA 4BK9A 4MLJA 1XC6A 3URQA 1IGWA 4H8VA 3TSBA 4D6CA 3STPA 4U10A 3VD3A 4IQDA 1T57A 2QCGA 3KWSA 3NSNA 4QLKA 3T40A 3UJFA 3O6CA 3PPHA 3ALGA 3NQMA 1F3XA 1W3JA 2ZXAA 3E02A 4H2CA 5FJPA 3IARA 4JTRA 1MQRA 1GJUA 4JGDA 1EBHA 1F07A 3ES8A 2WPDG 1HZYA 1C7SA 2B31A 4AD5A 4LUSB 3P0XA 3KFTA 2ZDRA 4RE2A 3WQ8A 3UWEA 2ZUTA 3MU7A 1TYGA 3TE9A 1OC5A 4IQLA 4JTKA 3GH5A 3CYJA 3CMFA 3C5QA 1UP3A 2DZTA 3RM4A 2FZMA 3DFQA 4DIAA 1HVXA 1XLEA 1B3OA 3W7QA 3C2RA 3B03A 1LL4A 4NX0A 1E6RA 1FP8A 1FUYA 5HUOA 1ZP4A 3I4KA 2D2HA 4M29A 4Q8NA 4OJYA 3UESA 1V3KA 4DBDA 4WCJA 3W24A 1P6WA 1DL3A 2Y61A 4R33A 3GXIA 4GUIA 4ALDA 4CEUC 3BAYA 4Q8PA 1C91A 3DHFA 3PK7A 4IMEA 2XH7A 4V28A 3O16A 3UJEA 5CC7A 2QJGA 1TV5A 2HE8A 1JGIA 1RA0A 1WX0A 3I3BA 4UTUA 3H7VA 2GVYA 2HJPA 4NXKA 3Q4DA 1XD1A 3WMBA 3H6OA 1G7VA 3LMZA 1OF6A 2ZWZA 4E8DA 1WXYA 2D2GA 1XISA 2XG9A 1GZGA 3WBYA 1UD3A 4QBXA 3TYDA 3B0PA 4KRZA 4HPGA 2X2GA 3Q37A 3THUA 2W4XA 2J7FA 1O5RA 3GU1A 3N2TA 2WNWA 1P0KA 4I90A 3TUUA 3QM3A 3VPLA 3LHTA 3WCZA 5LA1A 4MMWA 3P7YA 1PL9A 1M41A 3LHUA 1TB3A 1TV7A 4ZE4A 4M6PA 3GC4A 3D3FA 1VP8A 1JAEA 5HBFA 1TIWA 3S1UA 1YBQA 1WDPA 3MMDA 1XL9A 3NZGA 1UWIA 4GC3A 4GY1A 1RCQA 3BLLA 2NSXA 1MVYA 3ZVHA 4UB9A 2PDXA 3WF0A 4LF2A 3T05A 3H22A 1SO5A 2WMHA 1QCWA 3M4HA 4NJKA 4GACA 1HL2A 4GWEA 3VXGA 3WLQA 3GIPA 2KX9A 3VNJA 3PM6A 2AL2A 3WBAA 1WKFA 1U5JA 2ZICA 5D9NA 3L67A 2VQTA 3EMQA 2GGHA 4YWSA 3KCOA 3SUUA 3MANA 5LKYA 3CT7A 1DTUA 3CUIA 3BDKA 2ZBTA 1DQXA 1DHKA 5CZSA 3EX1A 4KT2A 1ZENA 3WEOA 2GQ3A 3ZS4A 3V3WA 1JDFA 5CJMA 2G41A 3NOYA 4FHAA 4IGSA 2ZUUA 4Y9PA 2BXVA 2GGEA 3N15A 2ISSA 4GJJA 2XFYA 4LAKA 1WP6A 2VO5A 1EIBA 4Y9MA 1E6NA 1H63A 2O56A 1CYGA 1DJQA 3QC3A 4IP7A 1CTNA 1HJVA 3DHDA 1LT7A 2IQ0A 2NQZA 1JDDA 1CCWB 1CGUA 5FL1A 2F84A 4JTSA 1MW3A 4QM1A 2QUVA 2JIZG 1UG6A 1JI2A 4W86A 4ACYA 4MNKA 3HF3A 2IS7A 4A3YA 5H8UA 5DELA 3ZJ6A 1UUOA 4EF9A 2RFGA 5I6SA 4ZFCA 1OG6A 3BARA 3MY9A 4IGMA 4MPKA 3B0YA 5D38A 3QPYA 2C19A 4PTWA 1TRDA 3EEGA 5D33A 3VGFA 1G9HA 6A3HA 2YYTA 5D9OA 3W0KA 3OG3A 2Z1WA 3EPOA 3HFYA 3H2MA 3UNTA 1L8PA 3BC9A 5BNKA 5F4SA 1H50A 3N9RA 1GKPA 3GVRA 3WQPA 3TN3A 4JQ3A 1B5TA 1QPQA 4F0MA 4IIHA 1QW7A 1GQNA 1UC4A 3TVAA 2H8ZA 2IPJA 4L64A 3F5KA 4PUNA 3AIUA 3SUSA 1UP2A 4Q8WA 5DX7A 4WSJA 1QOQA 4IJCA 2DUAA 4UTWA 5FA5A 5MHBA 1JRCA 2FFCA 5K9DA 3N6QA 4TTUA 3B40A 3PR2A 3RDKA 3H54A 1QBAA 2BVYA 1VB9A 3PWIA 4HCHA 4D6EA 3W86A 1BYBA 1M7PA 3NQGA 1DKWA 2NVCA 1EA9C 1G4SA 1ZU8A 4AHQA 3PG8A 5FAJA 5ABTA 4UBPC 1TQXA 3FDGA 4R7JA 5REQA 3BMVA 2REQB 4QCEA 1ME7A 1R2TA 3S42A 3ITGA 5AYBA 1NWSA 3WBWA 1F4HA 1R30A 2FTWA 3PF3A 3C0SA 4FNRA 5EMLA 4JHOA 5A8MA 4D72A 9XIAA 5C70A 4OHQA 2I7GA 2BFGA 2AL1A 2AAAA 3PHAA 2Y88A 1UB3A 3L0NA 4Y9NA 5DY2A 3WQGA 4PEEA 1DQUA 2I5GA 3SGZA 4BCEA 3GXFA 4JTJA 2O9RA 4I8YA 1ZBKA 1BF2A 4K8GA 3P5ZA 2Q8LA 2CBJA 4GQBA 3LXBA 4MNLA 3AIBA 2PZ0A 3S3GA 1NDWA 2GLKA 4MZ1A 3W3OA 6REQA 1J8VA 3UU0A 3W7RA 3OG2A 3NEHA 3KP0A 3ARYA 1ICPA 3LY0A 1WXJA 2BDQA 1NWRA 3COTA 2G95A 3CHDA 4XD4A 3NQ7A 4X63A 3ARZA 2XIJA 3GHTA 3E2RA 4I9AA 1XYMA 3LLFA 4AF0B 2V8ZA 3AYRA 4G1KA 1S5MA 5GNZA 3NCOA 4TMBA 1QTWA 4YMZA 3RK8A 3B8WA 2FGLA 3E74A 1G4TA 3SRHA 4FXJA 5IOBA 1OX5A 4LUJA 1D2KA 1MDLA 2NLIA 3G1VA 2YR1A 4GIYA 5ABHA 1XLAA 3MDUA 1NTHA 4AZCA 3S5NA 4QITA 4Z2HA 1NWTA 3QPEA 4F48A 2UY5A 1B2YA 4Q7NA 3IJQA 3BJTA 4J2MA 3FN9A 1YXDA 1JZ4A 1B3YA 3QFWA 2Z2BA 4AZ7A 1E0XA 3R79A 3UZWA 1KKRA 3U2EA 3TYCA 3G1XA 1O5QA 3M0JA 3PPGA 5FESA 2PURA 2ZC1A 3TQPA 4JL1A 1JRBA 4CD6A 7CGTA 5C5YA 1H8EG 1CGXA 4HCLA 4QQUA 4WR3A 3HPAA 2F8QA 5E0KA 4XBSA 1BTCA 2WPBA 2WBGA 1JUBA 2PDUA 4IFKA 1H7XA 3ZLFA 5EB8A 3NQDA 1DP0A 4TU1A 2DVTA 1OC7A 3BOXA 4Q8TA 1BG9A 3SR7A 3HGJA 1W56A 1IWAA 2CZEA 3ME3A 2P1FA 3NQ8A 1F7BA 2JJ1G 2J7CA 2OEKA 2XDFA 3SCVA 2WVSA 3MP3A 1XWYA 2PDKA 4WGXA 1H5YA 4WVXA 3OLDA 4R7WA 4RPQA 1EO7A 4PUKA 1HO1A 3WK2A 3WJXA 2ZUWA 3H2CA 1TR1A 2OT1A 3WLHA 4JEQA 3FIGA 4XB3A 5I03A 3IAPA 3BLPX 2HS8A 4MJ2A 3DBNA 3TWBA 2DVXA 2X8RA 1IXQA 3DFOA 5HNTA 2Y7EA 4WGHA 3U4AA 4JTIA 4ZE5A 3CK5A 2E67A 4IIGA 3LGDA 4TTGA 4W7WA 5CPOA 4LBUA 3K8KA 3PBGA 4FXRA 1F8IA 1OFBA 4CCCA 3FYOA 3D46A 3UZ5A 3VMPA 1POKA 4PB4A 2VZVA 2P3ZA 3HQOA 2A85A 3BMWA 1H3GA 2Q3RA 3GK0A 3BZGA 4S3KA 1DXFA 3HGRA 1PTAA 3QGVA 4MZYA 1R7AA 5J8LA 3LOTA 4HU4A 2CLIA 3S1WA 2WKJA 3OGVA 3D47A 3QY7A 4UNKA 3TFXA 1F61A 3MMWA 1HT6A 1M1BA 2GVLA 3G6MA 1TMHA 2CLHA 4H41A 1YPXA 5I24A 5A8GA 4M24A 3TAKA 4CU7A 4U33A 1C8XA 5AYYA 3N25A 1E6PA 3LCFA 1EGMA 3VDHA 3RYSA 4HNUA 3RILA 3VTRA 5D9PA 1P48A 4C7DA 3FCPA 1EC7A 1QPOA 4GI9A 4PYSA 1VYPX 4C7GA 1GOWA 3UZZA 1GCYA 3TW9A 2DV0A 3NPXA 3ZLHA 5FJJA 2BY2A 1ECQA 3NAVA 2XIIA 5FEZA 1OT1A 2NXGA 4XZ9A 3NL5A 1J0HA 1A3HA 2QLYA 3DG3A 1FWRA 3TH6A 4ICCX 3T6CA 4H01A 4UQBA 4C91A 5LA2A 3PULA 2E28A 1FDYA 3K8LA 1TWIA 4O4VA 3VA8A 3NVDA 3B0XA 2VEFA 1W8SA 4GHRA 1UR4A 1E9YB 3ZWTA 3TW7A 5HK4A 3G1SA 1BYAA 3DZ1A 2R6OA 1L8NA 1LUCA 3R43A 1GK8A 1KBIA 4PL1A 4ZQOA 1HIZA 3QQWA 4IXHA 1IWBA 2P0IA 4IF2A 4MY1A 2PBGA 2ZRWA 4CQCA 2X05A 3WD3A 2E4TA 1AG1O 2IPWA 1WQ5A 1GJWA 5I09A 2XM2A 1KFWA 4OVXA 2JIEA 3VIPA 5A8OA 2R1MA 5EMJA 4DBUA 3L21A 3URAA 1PHQA 4ACZA 1VIZA 1EJUC 1B0IA 3H7RA 3M0ZA 2Z6IA 1NEYA 3EZ4A 1HJQA 4NF7A 2D3LA 4RXFA 1UA3A 2WSRA 2Y62A 4ML9A 1FP9A 1SMDA 3SN0A 3K4WA 4P8VA 4Y2WA 3UWZA 1HKIA 1CIUA 4ONVA 5H8PA 1QATA 3UPMA 3G6LA 3UETA 1TG7A 1SFJA 2JGYA 5A2BA 1W17A 3AC0A 3QMRA 2YA2A 4W87A 1SZGA 4OQVA 5E70A 1OYBA 3WH8A 5MF5A 2FPYA 5FEPA 4Y9AA 1JNEA 1H1NA 4XUYA 4UFLA 1G4EA 1O12A 4W89A 1Q85A 3C4UA 1HKMA 1WE5A 1ZHAA 1Q6LA 2FVLA 3SIMA 4WF7A 3P74A 3KRBA 4DEFA 3O05A 4J27A 1NH6A 3M43A 4C6DA 2H9AB 1MNSA 1Z44A 1JCTA 4H7CA 3RIKA 4O0QA 1QUMA 5H8MA 1YPIA 1B3VA 3EKGA 4JQ1A 3W01A 4QP0A 1BVNP 2DZUA 3ZMRA 2RKXA 4AU0A 1LORA 3CZ8A 2P5NA 3WQVA 3QHMA 3VX1A 7TAAA 4M82A 3VD5A 3TIMA 1QOXA 5F2LA 5C2XA 1BKSA 2PDJA 3WG6A 3CAWA 1HN1A 4ZODA 4IPIA 3C0JA 2WNNA 2DT1A 3WJYA 1BD0A 5JQ9A 1EJRC 1E1CB 3CLMA 3C3NA 4TO8A 1MFUA 2V3EA 4BA0A 4RNFA 1F3TA 3SURA 3PZUA 3LTYA 1PS9A 1FWBC 3GDRA 1W1A1 4C6JA 1ZBCA 4GY7A 4J3UA 3M7WA 5K9XA 2ZA3A 1VRXA 3RRAA 5FJOA 4PB3A 3C6CA 1E0UA 5HWNA 2V5JA 4K8EA 1VRDA 3MWCA 4ICMA 4UTJA 5EKYA 5HWJA 3UR2A 5FF3A 4QG8A 1O5KA 4DJFC 3AXHA 4EXAA 3PB0A 1QNPA 1FCBA 3G0UA 4GUJA 4ZSTA 4LS1A 2X2YA 4D1IA 4S3DA 1CXFA 1UKPA 3LERA 2VFGA 4LOCA 3USZA 3SJNA 3M0KA 2NUWA 5C2GA 4UCFA 3NOEA 4TIMA 2ZE3A 3HA1A 1RPXA 1W1ZA 1ZCOA 2ZZ1A 1XCWA 1CEOA 2QR6A 1GVYA 4LUYA 2FKPA 2OSXA 4G2DA 2RGLA 3B4UA 3HN3A 1NF0A 5C9UA 2B7OA 4YU1A 1OCJA 1WO2A 2AAMA 3QFEA 2NWRA 3CAVA 4AHOA 1T0OA 3W1PA 1W91A 3NIYA 4ZQMA 3GAYA 3UYIA 4TOQA 5KZDA 3GTIA 4PUMA 2A3AA 3EWUA 3E0IA 5TF0A 2CLLA 2VZUA 3M1ZA 3VK5A 5HMFA 3NWRA 2ZA2A 1GVRA 4QLLA 1H11A 1VFLA 2PTYA 3BG9A 3KOWA 4DHGA 2CHRA 4OOZA 1EJWC 2A3HA 2XVGA 4AZIA 1VCFA 4NILA 3A5FA 3HG5A 3N29A 3OB8A 1Q6CA 1I2NA 2GGIA 2CZ5A 5T8GA 2WJDA 2YZ5A 2WHJA 3WUFA 3U9IA 1W1PA 1VEOA 3HQPA 1JULA 4AH7A 5EU9A 5CXPA 3R10A 2VDHA 2WSSG 4AYGA 1ZQ5A 3S2NA 4B4HA 2BG5A 3MT1A 1E4IA 1EEXA 1LWJA 3G22A 4LUSA 4ERIA 2V63A 3P14A 2PI6A 4QR6A 3NYZA 4EXQA 3U3HA 1SQ7A 2BX7A 2C91A 4ZBCA 3WF3A 3LHWA 4YTRA 4NL1A 5DBTA 2C13A 2V69A 1I2QA 4QE5A 4Q32A 2HRWA 4MADA 2PP3A 1EDTA 3N3TA 1KW1A 2Z1KA 2ASHA 4L80A 4N7QA 4LCRA 3DU0A 2NLYA 2YX0A 7ENLA 3GVGA 4QDWA 1G1YA 1X98A 5CGMA 4OV9A 1PZ2A 3ARWA 3ANVA 1O68A 5EMKA 3WDJA 4IQEA 3BTNA 3W1XA 3VCRA 1BF6A 4W93A 5CAHA 4MUPA 3NQEA 1VFFA 4IJRA 1EDQA 3FJNA 4GXMA 3TSDA 3SRKA 3W1NA 4D9PA 1V3HA 2F2HA 1NOWA 3VAVA 4DXVA 1FS0G 3MSRA 4PSPA 3QGAC 2PDCA 1XP3A 4DX3A 3NM1A 1ESWA 4AX7A 1S5WA 1GORA 5AECA 3QR1A 1KWKA 4FEZA 4TVUA 2J75A 3VGDA 2DIJA 1EFZA 3AJXA 4N4QA 4E8GA 4U28A 3H55A 2X7VA 2OG9A 4XAPA 2ZZ7A 5CPQA 2ACQA 4S3CA 4WEVX 3GKAA 3UWUA 1S5VA 1P0BA 1VFMA 4MY8A 1P0EA 4HYVA 1TWSA 3EOUA 1WDWA 1TFVA 3V4BA 2P53A 4GY0A 3C3UA 3LRKA 5CBJA 3JZUA 3WJSA 3WLKX 1YIXA 1ADSA 2Y7FA 3GIYA 4IFOA 1J18A 2XINA 3JVAA 1EXPA 3B04A 5BZAA 1GOXA 2VGFA 3QBUA 3IGXA 3MUY1 2WJFA 1PB0A 3NEVA 2A4AA 1DTNA 4NZCA 1GZJA 2D23A 1E43A 4H1ZA 4JR5A 3MDWA 2E1DA 3OA3A 3GR4A 3DI1A 1FWFC 4FSAA 3RRXA 2BTMA 3UR5A 2EPKX 2VUNA 4X60A 2DPEA 4NUWA 1HFBA 4RDZA 1ZL1A 3PZGA 1BEUA 2QV4A 4PBGA 2DFAA 4WXZA 3JZEA 2VGBA 3EDDA 4U3CA 3ZR5A 4HZ6A 5TBOA 5C9RA 1DVJA 3INPA 2XHYA 4ZOEA 3OZYA 5AVNA 2VR4A 2KZHA 1WZKA 1LL7A 5LNUA 2OYKA 4HMDA 3WQOA 4KFPA 3RX3A 3BPWA 2OX1A 2OO0A 1UBPC 2PDWA 3EXRA 1IXOA 3MTWA 4NQ1A 4AD1A 3OYXA 3W26A 1BXNA 5AC4A 2TODA 4UTTC 1D9EA 2CEQA 3HB9A 1JYVA 3BANA 3RO6A 4V1YA 5E1QA 2ZZ2A 5TIMA 5BXPA 4GCAA 1TREA 4FS9A 1KBKA 3T09A 3TJ4A 3WDPP 3CIVA 3WUGA 3LCXA 4GOAA 1O7AA 1RUSA 3VNDA 1XFBA 3S2CA 2FH8A 1DXEA 3BV7A 4FX8A 1SVDA 1TVNA 1KFCA 2ZZ4A 2YLLA 4H6KA 2X41A 2Z25A 2I5IA 2IKJA 2EPHA 3AYVA 3F2DA 3LM7A 4GD0A 3H26A 2X0YA 4DXXA 3GQYA 3AYTA 1TJ1A 1JZ7A 2PF8A 4AX6A 2BY1A 3BCJA 1HUVA 3EMZA 1W3NA 2VGGA 4ENLA 1GOMA 1KO0A 4EWND 2ZX8A 8XIAA 1Z6KA 1GYLA 4HK6A 2P0OA 4PUUA 3W73A 2WOQA 3C52A 1E0TA 1A4LA 2FJKA 3SQMA 5DMMA 3T9PA 3ALFA 3IK4A 4DF1A 1RJQA 4F0LA 2FLIA 5CGQA 1F5ZA 1NU5A 4NAFB 4FNUA 1I75A 1R8LA 5C9WA 3W2MA 5BCAA 4DWSC 2PE4A 2PCEA 4XK2A 1ZBWA 1Q6GA 2FZBA 5I7GA 1W3IA 1R3QA 4MNMA 1JIBA 4LYQA 2W79A 2ISVA 4AIOA 3OQEA 3UPBA 4LS2A 4RDWA 4X61A 2VD8A 1YX1A 3MMUA 5HQLA 2Z7GA 4AVFA 3NPWA 3MA8A 1PZ1A 1UASA 3GU2A 4HJWA 5I77A 1AH4A 4M7TA 3A5VA 4WRHA 3DI0A 1Q7MA 4JL2A 2ESCA 2REQA 1KRMA 3MQTA 1CWYA 1H2JA 1EA0A 3BLDA 2DSZA 7PTDA 3OZOA 4R9XA 1AK5A 4ZVJA 2VC7A 6ALDA 3NJ3A 3LHVA 3PJUA 1KGXA 4JBRA 4CU6A 4QEHA 5I02A 4AC1X 4XD5A 4UNLA 1FXPA 3VIMA 1V7YA 3N34A 1XIJA 2AQVA 1O94A 3WZ0E 3UXAA 4GYPC 4D8AA 3NO3A 3A3WA 1KQYA 5LYRA 1UKOA 4XD6A 8RUCA 4A35A 4J3XA 1HKVA 1GG1A 2OQHA 1HQTA 3WNKA 3WDRA 3NVTA 3CMJA 4MVAA 2DH3A 2DVUA 3R8GA 1RBAA 1DJGA 1A3XA 1CW2A 4KPLA 2RDUA 2C7FA 3CPUA 3N3MA 2Z6JA 1EUAA 2OLAA 2XN0A 4S23A 1E55A 4AF0A 1VEPA 5C54A 1Q6FA 1T96A 1EJSC 2WMGA 2OSWA 4MPQA 4F0HA 2FTYA 2C0HA 1DIEA 1SSDA 3DXIA 3WQCA 4IPJA 5K3VA 3TU9A 1RCXB 4UTMA 4F8XA 2VR2A 4GQRA 2DSWA 1ISWA 4AZHA 2JKPA 4Z0SA 4C6LA 3WLIA 5GJNA 4XZMX 4RNJA 4W8AA 5E93A 1UWSA 2Q01A 2HK0A 4PMNA 2A5HA 4L6DA 4B5VA 3VMOA 1ODUA 4K3ZA 2C1GA 4F0RA 1C3FA 4FXFA 3LDVA 4GA8A 1A0DA 2P8BA 1F76A 3AIVA 4F4RA 3WLLA 2ZE0A 2XM1A 4CNSA 5LIKX 4IPNB 3K13A 4P7RA 1GEQA 5CLTA 1A3WA 2Y89A 1TPEA 3KP1A 3SCUA 1JCMP 4Z1BA 3UT0A 3F4NA 3S6TA 3IUIA 1GVSA 3IVUA 2PGWA 4E2DA 3REQB 3TV8A 4AY1A 2YW4A 3R25A 4L9YA 1JDAA 1I9CB 2CBIA 1F74A 1J79A 2BBFA 3IJ7A 1WKEA 2VUYA 3BAIA 3LGEA 3CQJA 3G2GA 3CQKA 5F4WA 1PEZA 3I7SA 3K4AA 4GO8A 1MQPA 2F61A 4A2RA 3GRIA 3F1QA 4JTHA 5A2AA 1BQGA 4XUGA 3N19B 1VBGA 5LNVA 3TK7A 3KL3A 5CC6A 4L4MA 5G2WA 5KMYA 4S39A 4EIVA 3O6AA 3WJWA 3NPUA 3MJYA 2WC7A 3N2MA 5IFTA 2CETA 5A69A 1Z41A 3B8VA 5HQMA 3DESA 3SCNA 4NZ5A 4XSMA 3FHAA 2R9RA 1S2AA 2FGBA 4O18A 1G7UA 2DT2A 4WDUA 3DHPA 4JX6A 1NFGA 2J62A 1EBGA 3R4IA 1M6JA 3OVPA 2YA0A 1RK5A 2D73A 4FALA 4NZJA 3SO7A 1RPKA 1EKOA 9RUBA 2DEPA 5AZ0A 3E9AA 3CV7A 4A21A 3VNLA 3UWVA 2XH4A 3QQ0A 4PR4A 2YDQA 4FK9A 4O13A 1EDGA 5I79A 4HGXA 3K8MA 3H70A 4LV9A 5C2CA 4PEKA 2E1WA 4K8HA 4RCXA 1VFSA 1PX8A 4PTXA 4TXEA 4ZOBA 1ITXA 5K7JA 1B90A 5BW6A 5DRCA 5BWAA 1GVQA 4YL2A 2B81A 3F4VA 2E9MA 1DWIM 3LCWA 4ZB0A 5H2ZA 1TX2A 3EWZA 5D2YA 1ONRA 4MM1A 3DC0A 3ZVIA 5BWFA 1FHDA 3HTWA 4UQAA 5DANA 1P4CA 2MANA 5U7SA 3TJLA 3PPCA 4L4LA 5A94A 4GUHA 2CIPA 2BXYA 3HBLA 3GU9A 1OC6A 3V5OA 1ALDA 4P8UA 4Y7EA 1GONA 3MUIA 4MWAC 4Q7BA 2BHYA 3ZR4A 4A8LA 5LNWA 3LCGA 1XLJA 4PMUA 3QLLA 4D6JA 3PFRA 1TSIA 4CUCA 2PDLA 3WEZA 3O6YX 2WWDA 4MAZA 1Q6DA 3TDFA 3AUOA 4NZ1A 3A4XA 4W5ZA 4GCXA 1QNSA 1E5JA 4EAMA 2DH2A 5IDZA 1ZUAX 3W85A 1H7NA 5TNVA 2NT1A 1YDNA 5E9AA 2RHGA 3TXVA 2HE5A 4LB4A 3G1AA 4UR8A 3B9OA 2W67A 4IUOA 4J1OA 2VJXA 6TAAA 3N12A 3I6TA 1JYWA 1T7LA 2ACSA 2PDNA 1KXTA 2DP3A 1E6SM 3SSZA 3SUTA 2CLOA 3W70A 1W5QA 3UY7A 5I07A 1UOKA 1XSJA 4JTAA 3EX6A 4XX6A 4UOQA 2VFEA 1E6QM 1W1YA 4ZO6A 2D69A 4TR9A 4O17A 4WD0A 4IG2B 4UFHA 3RNDA 4O10A 3QYQA 1V6UA 5BU9A 3O0KA 3TR2A 4PSRA 4DY1A 4LCSA 1H7OA 5G4HC 1B3XA 3W27A 2PDFA 2QUMA 3N17A 1JFHA 5KETA 4REQB 2OWXA 1WDRA 4Q33A 1I6NA 3STCA 4I9JA 1Q6OA 3JRKA 3GY1A 4PA8A 1P0DA 1VLWA 1V8EA 3I68A 3LCIA 3UXKA 1OIMA 5FIPA 4XG1A 1R9YA 3AIWA 1N7KA 3W22A 4F9JA 2FHCA 4D6IA 3M5ZA 4HPNA 4UQDA 2EJ1A 1ZB5A 1HF6A 3N4EA 5AHMA 1MW0A 1K1DA 1BXCA 2WMIB 1GKRA 4GC4A 2NUXA 3GHRA 5BU6A 2GQ8A 5M03A 3VGEA 1EZ2A 1ENUA 1ZRQA 4LAZA 3HMCA 3LSBA 5FSEC 4MFDA 3IWPA 3IEBA 4RPPA 3GNOA 1XH2A 4IPPA 3BZJA 4HZ7A 2XJ7A 1VBJA 2MNRA 3T8LA 1E1CA 5LIXX 1QO2A 3BSMA 1NVMA 1VR6A 4TVDA 3ZLGA 2ZWYA 1MW1A 1JPDX 4Q4OA 1FHLA 4I7WA 5CC3A 3KHJA 1OGGA 2X1UA 5K4ZA 2O0TA 3QZ6A 4FLOA 5AFDA 4JY9A 1SFSA 2G3JA 2J9XA 4O1EA 4W8BA 3GWQA 3E3HA 3ANUA 3CC1A 3KRZA 2C1HA 2E9LA 4DM1A 3P2VA 3SGUA 1C92A 1EHNA 1W0MA 3QMSA 5H6HA 3W87A 3G0SA 5AC5A 3B97A 2H90A 1RQBA 4PBFA 5CZ0A 3EA3A 4OECA 4PB5A 3EDKA 4GE8A 1MSSA 4QS6A 2BHUA 3GNNA 3TWAA 2VCAA 2Z1SA 4C6BA 5K9CA 1V03A 2NVDA 2C16A 2IW0A 1RAKA 3OW1A 4QE1A 1XLCA 3A21A 1CT5A 3IV8A 1ZJIA 5IBXA 3NQVA 4GZJA 2BOFX 1CGVA 3W28A 1WZMA 1FH7A 2OKTA 1NFPA 4J40A 3ZOAA 1NQ6A 1QHPA 5DRIA 2Y24A 3VDBA 1OGSA 1QW8A 4I7UA 5XINA 4PODA 3UWQA 1ICSA 2NX9A 4DJDA 3WNNA 1C7TA 4HK7A 1OY0A 3UJ2A 4WZHA 1TA3B 2DORA 3WMCA 3RUBL 4LT9A 1ZPTA 4CN6A 2E68A 4WY0F 4MIMA 1FWNA 5D09A 2B0MA 3N2BA 3N04A 5ABGA 3DHUA 2YCJA 2G97A 4OBSA 4MB4A 2XISA 2HVOA 3RLVA 5EBUA 1R2RA 4M1BA 3VIJA 4H04A 5H91A 2J7HA 3VI2A 2W92A 1ITCA 3UCQA 4QX4A 1LRTA 4Q4MA 1YEYA 4Q8VA 2DZXA 2WZTA 3RMEA 3I3DA 3A9BA 4CQAA 1WB0A 3UA3A 2FZ8A 3SRFA 4FLRA 1R9ZA 1LQAA 1DWHM 1OZMA 4BI6A 4S3AA 3L4WA 2GJLA 2QCFA 3BXWA 2VI0A 5AOUA 1WDDA 3B9DA 3PZNA 3NNTA 2WSQA 3E96A 4XAGA 2F7FA 2QGHA 1E71M 3THQA 3U5UA 1E9IA 2ZZ5A 2YB1A 3TYBA 1ITUA 7XIMA 2PC4A 1VP5A 5AYIA 1V93A 5KSWA 3CUZA 3W23A 2ALRA 4U5KA 5A6BA 2E5BA 2QW5A 4B5XA 1NDVA 2ZXQA 3EWBX 4PRWA 2FZDA 4GIRA 2VVNA 4QTGA 3VVGA 2Y1HA 3YPIA 3H2FA 4D71A 1GTEA 4HNCA 4K39A 4DO6A 2FDSA 4CNUA 2C15A 4A3QA 4V27A 4RW5A 4UR7A 1GOIA 1TO3A 1QOPA 4IGNA 4YTUA 3WQWA 3P82A 1GHSA 1N8FA 2PMQA 3WDHA 5JVLA 4S38A 1IYXA 1K03A 2BOEX 3CZGA 4QFUA 4QGCA 2I9UA 4BKNA 2CWNA 1QWKA 3GS6A 4N0RA 1P5BA 2V3DA 1CXKA 4QG6A 2VC5A 2G3IA 1MUCA 1RLCL 1OIFA 3TYUA 3R89A 4L6OA 4YS1A 1P7TB 4CD7A 3NGFA 1FWWA 2PF0A 3VZXA 5I78A 2X30A 2D2JA 1IEVA 3WFAA 3MSYA 4HN4A 3ICJA 1TCDA 4WUIA 2E09A 4KWOA 4B5TA 4FLQA 5FF2A 1XICA 1XSIA 4DJEA 5DMYA 4LW7A 1OK6A 2XZ7A 2J8GA 1VCGA 5AVHA 2VWSA 4O0ZA 5DBUA 4GGBA 1PCKA 1UBSA 3POCA 4RUBA 3P81A 3E1F1 2BVWA 1G69A 1Y5XA 2YXOA 4KWWA 1UR3M 1UP0A 2E5CA 2PDQA 1JDCA 4E5TA 3EBVA 2BGSA 3WLTA 5C8BB 4M19A 2Q3OA 2OZ3A 4PTDA 1K4HA 1H41A 1SW3A 2NV1A 3LXCA 4UC5A 4ZEPA 3U57A 3UXIA 3OIXA 3CAKA 1V6WA 3CUFA 2XU2A 4PMDA 3VZYA 2HXUA 2F9RA 2GGGA 3UXLA 2HMCA 4IT1A 2BOGX 1H1ZA 4MWAB 2AQWA 3BLKA 1A47A 3VOJA 1NY1A 1XPGA 3TNBA 1MWOA 2QXWA 3KTXA 1KV5A 2NWSA 2HQAA 4JYDA 3WUBA 4KW2A 3ZYZA 1SJCA 1SFTA 3A64A 1YDOA 4XAFA 5DT5A 4Z2LA 4DJFD 4R88A 3W72A 5HXMA 1V0NA 3WH7A 2XSBA 3CHEA 5GNYA 1JCYA 1PTGA 2OZ0A 4RNIA 3PZMA 4EPDC 3UG5A 3ITXA 4JD4A 4IJBA 4PULA 3LB0A 2IPFA 3QTPA 3ZO9A 4DLFA 4WDTA 1P6BA 1PKLA 3CZEA 1XLKA 1BVZA 1WYIA 3QZAA 1A5NC 2VCBA 3HPXA 2QAFA 2GGJA 3VDGA 3L4UA 2XH2A 1KLYA 2PD9A 4WDWA 4HA4A 3MB9A 2J47A 1T99A 1S2VA 3KXQA 1E4MM 2QVHA 3BUVA 5HJYA 1XIEA 1ZAIA 3MVIA 2FVKA 3NSXA 3FJ4A 2GPTA 4A6GA 1Q63A 4CGTA 4F9DA 2GK1B 4CNTA 1Q7QA 1R3RA 4BEQA 1LZOA 1TKKA 2YKKA 4B4FA 3WF1A 4E4UA 2VTFA 4AZCB 4OT7A 4LEQA 4P2VA 2VX5A 4PUEA 2CPUA 4Q4RA 1R7OA 3UPWA 1UYQA 1B3WA 2J7DA 1SPQA 1X7FA 3QV9A 4X0VA 1UCWA 2QMJA 3VFCA 4FLSA 1JPMA 4P8WA 1CGYA 3MUXA 4IWWA 3QW4B 4F79A 1XGZA 3TN4A 5G5IA 1XLIA 2DJLA 3QJAA 1EB3A 1JYXA 3BLOA 4O50A 2RDWA 4LQ1A 4NAFA 3GYEA 4UTFA 2P50A 3A23A 4LNYA 5A6KA 4ORMA 3LN3A 2NXIA 3BGGA 2UWFA 4QE4A 4J3SA 2W0UA 1RVKA 1UKSA 3ZJ7A 1X1NA 4IISA 1TCMA 4ZQPA 1Q4NX 4LVFA 2CK3G 2XVPA 2C18A 3MKCA 4LAOA 1LRNA 5DCEA 1ZJAA 3OHMB 2QJNA 5GJPA 2EPMX 4J4KA 5GQBA 3THAA 4ZGYA 1X7IA 2Q02A 5D4YA 2A1YA 1YNPA 3H2AA 1ZFJA 2WMJA 3MKVA 2UZ9A 5E0CA 1W1IE 4GZIA 4B5SA 1QFEA 1A5LC 3T4WA 4OWGA 3KDOA 3SCSA 5L9FA 4QJ1A 5LSMA 1C93A 1VF8A 4R3UA 1GQKA 5IRPA 2CU0A 4C1KA 1XYAA 5F1UA 1AQHA 2V5CA 1W1B1 4QJ3B 1EOKA 1XRFA 4NYYA 1IEWA 1XX1A 4W7VA 1L6GA 3TZNA 4KCTA 5I06A 4S3BA 4JNZA 1W0JG 3G3DA 1B1YA 5G2HA 3VKKA 3CUXA 1VJZA 1LDCA 2WCAA 5E5CA 3O7UA 4KWUA 1ZTVA 4JIPA 2GDQA 5I3GA 3WFZA 3TTOA 3F5JA 2WLYA 4NNAA 4YYFA 4J2PA 4IP4A 1JZ8A 3SW6A 4R34A 2J24A 2ZADA 2XFWA 2BLEA 3QF0A 2ZUSA 3WDIA 4ZQRA 1PWMA 3TOPA 4KIRA 1HL8A 2WNQA 5E0FA 1LQ2A 4ZCWA 4BWLC 3OP2A 4F2UA 3PG9A 3LEPA 4RZ6A 1A0CA 3WNMA 5LNRA 3EWYA 4H8HA 4AHPA 5HJLA 3EOLA 1VZWA 1DQWA 1WBJA 1JQXA 7ODCA 1KRAC 3VKCA 1WZLA 1XJBA 2J6XA 2Z1XA 1ZP3A 1WNOA 1X1ZA 1UQYA 1K3UA 2CBUA 2OLHA 1YXYA 5C7HA 3FAXA 3E49A 3W82A 1KBBA 4B9ZA 3WNPA 2QQ6A 1IT0A 5DCBA 1FCUA 1QPKA 3L66A 3CJPA 4DO7A 1SZFA 3PZ9A 3W1UA 3WJZA 1TV2A 5FSDC 5CZTA 3THDA 2VVSA 1E70M 4H9MA 2X1SA 4NRRA 4OBTA 3TLLA 3VCNA 4RXGA 4I5XA 3L2IA 4LSBA 4NNBA 3REQA 3M6YA 4KH2A 2NSOA 3FVMA 1E6XM 1F3EA 5KINA 4IIDA 1VFHA 2F6UA 2BGQA 3CZLA 1SFLA 3HG4A 5DQPA 3HGSA 5DN1A 3IJDA 3FSTA 8TIMA 3KDNA 5FJUA 4HKPA 2VMFA 4DF2A 3IJIA 3OU8A 1HJSA 3WL0A 5LHEA 5C9ZA 4KEZA 1SW7A 1XIMA 4O12A 3S9ZA 4GK8A 1BGGA 3HQNA 4H4IA 2V6AA 1UHVA 3ARXA 2PUZA 3CU2A 2HEJA 1FWIC 3AYSA 1MXSA 1X6UA 3KEHA 4HMCA 3GBEA 3KOXA 3MV11 5CH9A 1EC8A 3TJXA 2V81A 3IAQA 5G1TA 4L1WA 3M5YA 3W37A 1R5YA 3PZVA 3SSJA 3WH6A 4LEFA 3S5YA 4NKCA 1OK4A 4POCA 4JCMA 4NZ3A 2I16A 3PJTA 3GNDA 3AZRA 3DYPA 3TQKA 4L7ZA 3UERA 3GDTA 4HD5A 1U1HA 4OIFA 4HHHA 3IPWA 1UR8A 4IUGA 1US3A 4GBDA 3KBWA 3O9NA 2DUZA 3ARUA 2HV5A 3OBEA 4HQVA 1FKXA 1TWZA 3PWAA 5A6MA 4DWSD 3TLQA 3URBA 1JD9A 3RM9A 1DWAM 1AQMA 1NJJA 1QI4A 1SJBA 4H9UA 1DWJM 4FR6A 1NDZA 1RY8A 1EJ7L 5BRQA 1US2A 2J7BA 2OGJA 3AMKA 3M0MA 5A8PA 3QV7A 1M03A 1WBHA 2EPOA 1E3ZA 3C8NA 4J7RA 1DE6A 1V3JA 2WSPA 3GVVA 2ZUNA 4IM4A 1ML1A 2VM8A 4JTGA 4E0CA 2A6NA 3P93A 1FQ0A 1J10A 4OV4A 3DOPA 3GW0A 1XSKA 3SCWA 4QHRA 4RDVA 1M5WA 4IMDA 2CKRA 1MW2A 4FF7A 5CEWA 1UJPA 4YVXA 1M65A 4LS0A 3CB3A 4GINA 1HXJA 1W3LA 1QPRA 2PDHA 4M5PA 4A05A 4PCFA 2BVTA 3IRSA 2BXZA 3KUMA 3VGGA 2W62A 3MUCA 4ZENA 5A6AA 3WMLA 2BODX 4YN5A 1S5NA 1W5OA 3IS4A 3FKKA 4I5RA 1JYNA 2EKCA 4C6IA 4U5IA 2OSYA 3LBOA 1OB0A 1GEHA 3RO8A 1UWQA 3BJFA 5CPNA 2WV8A 3W00A 5G1MA 1YYAA 3GE7A 3EOEA 3LV5A 5F2MA 3V18A 3RXZA 4L61A 2G4JA 1E40A 1UOZA 2BVDA 5I3IA 2XIBA 4E4FA 1GQLA 3BCDA 3HIJA 2NVAA 4N4PA 2VX4A 4IG2A 2V5LA 4JQ2A 5TD4A 2ZCGA 4D8LA 3ORWA 3VC5A 1FFQA 1EPXA 1DWFM 2XFFA 2JBMA 5FJRA 5KITA 1AZ1A 3V16A 1T6MA 4FIQA 3UA4A 2NQ5A 1IEXA 3NPVA 3R11A 4UMAA 2PFHA 4REQA 2H3DA 2NX1A 1GJPA 3W2KA 4HA0A 1GG0A 1KR0A 1AZ2A 2WZHA 4MSSA 2OZ8A 1EP3A 3BO9A 1DJNA 4MUZA 3UQNA 1V0MA 3FW6A 4G9PA 2PDPA 5CSRA 3FX4A 4V33A 4ASUG 2PU0A 1BPLB 5IXEA 2C79A 1VPQA 4MNJA 2ZTJA 4RR4A 4BY3A 1JCXA 2R91A 3QEZA 1XGEA 2OT0A 1ISYA 2FZ9A 3QRHA 4QXIA 3AS0A 2X7WA 1WV2A 2VZSA 3DC8A 3PUOA 2WMIA 4NJJA 1YHTA 5T9CE 3E5PA 5C6MA 4EPKA 1EX1A 1N8IA 4HTYA 3EDEA 4QLJA 3Q45A 1JXKA 2YCKX 1FVPA 3N6JA 5FF4A 1MDRA 2F2KA 1C8QA 2OB3A 2XVNA 3ABRA 2VX7A 1DPMA 3S8HA 1FH9A 2FFIA 2NQJA 6ENLA 4CQ8A 1OVDA 2HSAA 1QPNA 1ZALA 1B3ZA 1UR2A 3FXYA 1S39A 4C1NA 3KTSA 1AQ0A 2WHKA 3EB4A 2CLFA 3STFA 4C6CA 3AU2A 2XWEA 1TUXA 2YXGA 1F3WA 1EEPA 2A7RA 3OQ8A 2PZNA 3ANYA 4DWDA 1A5KC 3FK4A 5A95A 1MFVA 2DIEA 2GJPA 3W7JA 3H21A 1TTJA 1XIBA 4O1DA 5FL0A 5FJTA 4MKVA 4PMYA 1EF2A 4XO7A 3SUVA 2BB0A 3SBFA 3DKLA 3Q65A 4M8UA 3APYA 3R94A 1UIPA 4AZGA 2Y85A 2IXUA 1Y0EA 2NUYA 4GYPA 3CL7A 2DQXA 1WOBA 4P7LA 1RR2A 4JFVA 3SN4A 1XRTA 2AMXA 1RCOB 4L1GA 1L2QA 1YADA 4Z08A 2R82A 4A8RA 3L68A 5J5RA 1FWGC 2TMDA 1S3TC 4FNQA 2BZNA 3L9CA 2C8NA 4V2XA 3SAZA 2E6FA 2P8CA 5A6TC 3CWOX 4DBWA 4BFAA 3I65A 4QSHA 4B5WA 2WSYA 3QXBA 1TA3A 3DFSA 1EGVA 3CXOA 3R13A 2E5DA 4FPSA 3GUWA 2ZUMA 3EA2A 1CXIA 3MI6A 4JKMA 2HBXA 2XGBA 3TYEA 4DBEA 4C6FA 1XD0A 3S9IA 3N14A 4JX4A 4UWMA 3L0GA 4UNIA 1KFJA 1T41A 3PNUA 4ZMGA 5JU6A 3VM5A 3PS7A 3C0LA 2I14A 4MTVA 3WK1A 4AC7C 5C71A 3WLPA 3K2GA 4BEUA 4ZOAA 3QZEA 1YTEA 4XD3A 4MWAD 4MJZA 1OCBA 5K4XA 1I8JA 3BGAA 4LB3A 2IMRA 3AHZA 5BXSA 4ADUA 1KM4A 1A5CA 1G4PA 4HU3A 2IKGA 4JN6A 1D7KA 1PAMA 1XLDA 2EAWA 2CXGA 1EZWA 3AISA 4HU8A 5I2UA 1PKMA 3GDLA 3M64A 4A3UA 3CT2A 3LNPA 3VDAA 3VABA 4A29A 4UFJA 1DV7A 3T55A 3UCCA 2VZTA 1UUMA 2YCEA 4HT3A 1WZAA 4K36A 1PZ3A 1S1PA 4Z1MG 1KGUA 1R3SA 4FMVA 1XLBA 3T7VA 3E0LA 1OD0A 3VU2A 4JN7A 4LVAA 4JTCA 4FOKA 5EFFA 1M3UA 1UR9A 3RPTA 4K2SA 4JEJA 3KS5A 3ARSA 1OQFA 2HS6A 1DIDA 2VEMA 2OELA 5G2IA 4OBRA 3VIFA 1XXXA 2J77A 2J66A 4M7SA 4Y96A 3AOFA 2GFTA 1Y8BA 1Q3NA 2Z29A 3N4FA 5G4EA 1SJDA 2V9DA 4UFMA 2X1IA 3WKZA 3DG6A 2QT3A 3FKRA 2Z28A 2ZRUA 5KZEA 3EKZA 1KQZA 1LBFA 1WKYA 2A7PA 1QHZA 3FSUA 1JEZA 1SMAA 3OPSA 4N6FA 1H0GA 3U2OA 2W3ZA 1VBHA 4UIOA 2EXOA 4XVDA 3S0CA 1P7TA 3MJMA 2DW6A 4AD3A 3RR1A 3P80A 3SQSA 3WD4A 1U30A 1C9DA 1A53A 3LQGA 3HOJA 3A22A 1FCQA 1XDLA 5JH1A 1K9EA 3KAOA 3M47A 3ELFA 1UW9A 3GG7A 4AD4A 3TZFA 2CZDA 1VFUA 2PDIA 1XHGA 3GDBA 2E40A 2GJNA 3QW3A 4UQEA 5G4WA 4DI8A 1RY0A 4PMVA 1LLWA 3I6EA 3VKJA 2QZRA 4X9YA 4W4QA 4U4MA 2QMKA 3W53A 3C86A 2D0GA 3RCNA 5CSUA 2QCLA 5K2ZA 3ECQA 4XKYB 3GXTA 4ZQNA 1W9XA 4H19A 3P8JA 9CGTA 1UD6A 1K77A 4ROQA 3CTLA 3S6DA 1PYFA 1BLIA 4WXYA 3OTRA 6XIAA 1L2UA 5M17A 4O16A 2ZQ0A 3CL6A 4H8UA 1F2JA 1PTDA 2D0HA 1X39A 4AD2A 4MWAA 4XAYA 4F3HA 1TWWA 4GQQA 3WQ5A 4RV3A 3MCOA 4UQCA 3UGRA 1OINA 4EANA 2GOKA 3EA1A 4M3PA 4ICNA 1OFRA 4C60A 2ISFA 4EVZA 3AU6A 5A5WA 1U83A 1F9CA 4LTSA 2O9PA 1JF6A 4DUVA 4CN1A 3ABOA 3W1RA 1VHCA 2ATMA 2E6YA 3I10A 4QQ3A 3MO7A 1OABA 4M6UA 2G3NA 4P61A 1TVPA 1UH4A 5AN7A 3V1HA 3NL2A 2XN1A 1E5NA 2Z4GA 1OX4A 4P7NA 3RX2A 3D0CA 1J0ZA 4A8NA 4JNYA 1G01A 5CKSA 2VGIA 4US5D 2A7NA 1PUDA 4PMXA 2WBKA 3B8DA 4N42A 4JCLA 4BF5A 1O5XA 3IJLA 1S1RA 5I00A 4M80A 1CGWA 3AWNA 3BAKA 1UZ1A 3NQCA 5EY5A 2ADAA 3HV8A 1LROA 1WCGA 4B3LA 5AZ1A 2NXHA 1Q45A 1XYBA 3V7PA 2W6JG 2GK1A 3ATYA 4XV0A 2H8XA 4AWUA 1UKTA 1VQTA 4U2YA 3NXFA 3STGA 4HYWA 4OUIA 1EP1A 3TONA 1TE1A 2F6XA 5HMDA 1YDYA 3SCQA 1PSCA 3NQ2A 3UWWA 4GYJA 2V7QG 1ONWA 1XQKA 2XFRA 1P1MA 4GFSA 3RCMA 4AMAA 2ON3A 2OODA 2QPUA 4W5UA 3STEA 3CIWA 2PLJA 2E6DA 3D5HA 2BWGA 2GQAA 1K8ZA 3MMTA 1V02E 1ZBVA 2YDAA 4ZXLA 4KRTA 1HTIA 4NAEB 4XVEA 3VNIA 4O52A 4W7UA 1XLGA 1V0LA 5FKYA 3R12A 1V08A 1KFEA 2XSXA 3CPRA 3WEMA 2R1KA 1CXLA 2DSKA 3TA6A 1QASA 2GUYA 4JFWA 4DLMA 4CNNA 3KOZA 2QS8A 5AC8A 4UFIA 4DZHA 1W3KA 1HP4A 3CUHA 5GPRA 2V2HA 1XG3A 5HR6A 1BSIA 2D22A 5M3WA 2HISA 3G1HA 2GSEA 3WLOA 3RPDA 3LV6A 2XIQA 3MSGA 3F2CA 3W7IA 2V5KA 4L65A 3N11A 4CU8A 1E9LA 3M07A 3PJXA 3AO0A 4LYPA 2HCVA 4GX9A 4C6NA 1ZCCA 4HOWA 4L1XA 4J3WA 1R3WA 1PE1A 3FVDA 1GT8A 4L5ZA 4I9TA 2JF7A 1IQ8A 3GH7A 3RJXA 3JU2A 3NQFA 1EXBA 3IVTA 4G7EB 1KM0A 3VNYA 2BMBA 1UKQA 3KOYA 3NA8A 3NFUA 3IV3A 2XH0A 3LGGA 4H9XA 1XI3A 3AHYA 3MCMA 3AS1A 3KHDA 4MLRA 3UBPC 4LX4A 1S2CA 1Y7VA 4WSKA 3R7MA 1CI1A 4BQ3A 2CZFA 4LRTA 4QNEA 3NYDA 2YL5A 1A5SA 2G4FA 3OGRA 5A6JA 4HPHA 2I5QA 4HNLA 1QAPA 1QNRA 5C7VA 1A80A 1K8CA 3LI0A 1LT8A 4DZAA 3GFYA 3TTQA 4L6HA 1VBUA 1H60A 3CAQA 1OF8A 2AGTA 3L4VA 3ZFHA 2J74A 3VOCA 4ZFMA 4LYKA 2ZYFA 3SIZA 5AY7A 1GHRA 1KM6A 2INEA 4H7VA 3KZSA 4QROA 1Q65A 1VKFA 1A5MC 4AZ6A 3CHCA 3QR3A 4QG9A 3G1YA 3ATZA 3V0TA 2RGMA 5LHFA 1REQB 2PDBA 2J6VA 2GL5A 1CECA 2VC6A 3OVGA 3VOGA 3MHUA 1VFTA 3U2CA 3DFTA 1EL3A 3C8FA 2QJMA 1CDGA 4I3GA 2V3GA 4LNCA 2V82A 2DDXA 4LPCA 1DORA 1MMFA 1N55A 1YLVA 4DYEA 4PMOA 3RLUA 4H8NA 4QIUA 4OTKA 1KM3A 1NWUA 4UZSA 4B5NA 5HUPA 4HVXA 3EOSA 1BXBA 4RE0A 1KTNA 3F5LA 3A9IA 1KGWA 2PTWA 2ZX7A 5HPOA 5F7UA 2OYLA 1FWTA 2ZRYA 3FS2A 2D20A 1AA1B 1KM5A 2VEIA 1M53A 1ONXA 4KEUA 3O06A 1W5PA 2A3LA 3QR0A 8A3HA 4B91A 1IT7A 2Z1BA 4JQ4A 4PMZA 3VNMA 4DBSA 4FX6M 3GTNA 4MJ4A 1ADDA 2PGEA 3PUDA 4MB1A 3LHYA 3G5EA 4H6EA 3VKAA 1O1HA 7A3HA 2PEVA 1BFNA 4KEVA 1U33A 4PMJA 3QH2A 1J2WA 3WBXA 1T5AA 2ABAA 1GWJA 4TMCA 1AH0A 3GO2A 3IIPA 3AICA 4IOTA 1BAGA 1GOOA 3WD2A 2F6KA 2OWWA 4HHPA 4B15A 3W7EA 2C6QA 3PBUA 4NY2A 2WHMA 1KFKA 3VGHA 3FA4A 4EPBC 1W2PA 2FQIA 3EB3A 3QHOA 4DB7A 2WNZA 4UXDA 3L12A 2HK1A 4GH3A 5E09A 2FPTA 3L2MA 3PBYA 3H2OA 4B9YA 4BQ4A 3UD6A 2VDIA 2X40A 3R0UA 3ZT6A 2VRQA 4YJ5A 4M51A 4TT3G 4R5EA 1DJHA 2HROA 3HG2A 3EB2A 5ABFA 4RE4A 5HAOA 2VYOA 3AS2A 1EJTC 4RZ5A 1UWUA 3B8TA 2NX3A 3G3MA 4LC8A 1WAWA 4NSBA 1H7RA 4HA1A 2DJXA 3TKFA 3GD6A 3QPZA 4G6CA 3OYZA 4YLWA 3CV6A 3LG3A 4D6FA 2MUCA 5AHFA 2WYSA 4JHZA 3RGTA 2IQDA 1LG2A 4GJ1A 3TXZA 3OGSA 1XLMA 1VC4A 4JYEA 4NI3A 3EWWA 4FOUA 4PZVA 1JGMA 1GYNA 3S6OA 1R2SA 2EPNA 3G1FA 3MP4A 1RBLA 3IK2A 3N9KA 3OOQA 1J6OA 2JKAA 2WPGA 1R46A 5D03A 1NQKA 3EX4A 4H9ZA 1PO9A 4FNTA 1A5AA 2F38A 4DXKA 2CERA 4K7VA 4ZQCA 4JIQA 3CLWA 2YOCA 3DH7A 1CBGA 1OM0A 4AWTA 3MBFA 4PBEA 1UC5A 3IRDA 4NASA 4LCQA 2HTMA 3VOFA 4YHEA 3OIHA 5LIYX 3QKZA 3ABQA 1Q5MA 1KTCA 5B7YA 5BOFA 2ZRXA 3H24A 3ZQ9A 2TAAA 3LNMA 3NZQA 3V5CA 5BOEA 4B2DD 6PTDA 5D9MA 1E0VA 1DBTA 3EKLA 1EC9A 2R24A 3K46A 3W2NA 4AW7A 4AAJA 5EFDA 4PL2A 4K37A 2ZZ6A 2PPGA 3S1XA 3GVQA 3URNA 3OAAG 4KS0A 3ISIX 2LLEA 4M6VA 1UROA 4HTBA 1US0A 1OGBA 1F6PA 1Z7AA 4GNJA 2A21A 1JAKA 1R3VA 1E79G 3WLJA 3B05A 3H23A 3TQ0A 3CYVA 2PTXA 5KZMA 4ZO9A 2X09A 3EPMA 3TNOA 1XM3A 3EX2A 3U7VA 1OSEA 1XBVA 2EPLX 1K9TA 3H4XA 3Q67A 4GABA 3VZZA 1W37A 3GZ3A 3K1GA 4JAWA 2JF6A 3TC7A 4RKAA 2J9ZA 1PBGA 2OO6A 3AMDA 5BRBA 3NZ1A 2WB5A 3LHZA 3MBDA 3T0BA 3IJ8A 3WD0A 4E4PA 2PGRA 1BGAA 3FA5A 4XKMA 4F0SA 2QCNA 1PX3A 3CH9A 1IEIA 3M0IA 2E8YA 1TJ2A 3IACA 4GYKA 3MWAA 4DZ5A 6CGTA 2YCLA 2WQPA 3KVKA 3TTYA 1V6TA 4IX0A 4DVOA 2EF9A 1N2VA 3M44A 2V67A 3CM4A 4L56A 1CZ1A 3OA5A 1VPYA 4K6AA 5A6SA 1PHWA 2FB2A 4LRSA 1JPIA 3E38A 2AQOA 3UEQA 1I45A 3W1LA 2DW7A 3AXXA 1K02A 4C5YA 1X6LA 1UJQA 2WJEA 2QE7G 3CASA 3GXNA 3G1DA 4G7FA 3UYCA 3GXMA 1PZ0A 2X42A 4GISA 3Q2DA 1IHIA 4DYKA 1KXHA 3F2BA 3KRSA 3W71A 1AMKA 4C5ZA 4E2OA 3KOFA 2V0TA 4O1CA 3HURA 5FCZA 3KVMA 4QEEA 4JTUA 3O2LA 4E38A 5KTLA 3CGTA 1GVFA 3B9EA 3C2YA 4KGJA 4K38A 2QPXA 2O9TA 3GG1A 2GVEA 3VE7A 1FDZA 4I8DA 1QW9A 3KWXA 3E0VA 4IX2A 1SZNA 1Y5VA 4PCTA 1U2YA 4MJMA 1GVIA 2PC8A 1JI1A 1Z42A 1MYRA 1VJIA 2BGNE 2ALDA 3CZJA 1AODA 1KR1A 4J35A 5T9BG 3T0DA 5CZKA 3SB0A 5EGRA 2G5WA 1ZJHA 2I56A 2WVTA 4HJFA 3NO1A 4BJHA 1JR1A 1FWDC 4F66A 4B2DA 3W84A 4YIWA 2FTPA 1UUQA 1ZNNA 3MHFA 4C6MA 3GBDA 4Z1YA 1LL6A 2V30A 3ITTA 1IZJA 3L5LA 2G96A 4YWIA 1E56A 2DY3A 4YXGA 3DG7A 4KERA 1KV8A 2J25A 2CKSA 2QF7A 2Q8XA 4Q4QA 1KFLA 1G6CA 1XCFA 1X8FA 3OVQA 2JDIG 3PC0A 2P88A 1GGOA 4AZ5A 2YFNA 3B0UX 3FLUA 1I4NA 3EDJA 1FCVA 4BWLA 3NM3A 2R1NA 5CZJA 3AALA 3JS3A 3H8AA 1KD0A 4EK7A 4NJGA 3W38A 1E51A 3FEQA 4UQ9A 4YTSA 1Y5WA 5IFPA 4KEMA 4E6MA 1J01A 4GVFA 3L4ZA 3SFWA 2Y5EA 1QXLA 1EGZA 3M46A 2J7GA 4CCDA 5FF7A 3R6IA 3WELA 3A3HA 3G0XA 3DDMA 4GKTA 3PN8A 1TV4A 2WM0A 3K5XA 4ZB2A 1CPUA 4AXNA 4WOZA 1QRQA 4G8TA 3SI9A 4FP1A 4O1BA 3VDCA 1LRQA 1UQZA 2QUNA 3TQVA 1MRAA 2W91A 2V38A 2CCRA 3VIOA 2FMOA 4LH8A 1TZZA 4IMFA 2G8ZA 4UMCA 3LZ5A 4IMCA 4G1NA 2XZ9A 2I57A 2PWHA 4J3VA 4JYFA 3LX9A 3LPOA 1PIIA 2R94A 3CMGA 2J27A 3ARRA 3W2UA 3GW3A 2A6LA 3BURA 3HMJG 2VQUA 4HPJA 3FGCB 3WH9A 1H62A 2INFA 2NQHA 1H0IA 1XINA 5HA7A 1QHOA 3FXGA 3GZAA 3NGJA 1AW1A 1TZ9A 4NZ4A 2JIWA 3N2OA 3USBA 5SWUA 4ZL1A 3T78A 3OLGA 2OKOA 3LRMA 1RZMA 3T2PA 2CITA 2CBVA 5CC5A 3PVFA 4WJEA 4UR9A 1AD1A 4EWJA 1XW8A 1V3LA 2ISWA 4RNHA 1VCVA 2IKIA 3M7SA 1RXOB 3IUHA 1UR1A 2HNEA 3OODA 2VRKA 2AGKA 3MSDA 3OBKA 4N2YA 3TR9A 3P5YA 2DGAA 4XBKA 4FO4A 3XIMA 3N2XA 1FKWA 5LXXA 1X97A 5DFAA 2QJIA 1XIGA 1OFEA 1O1ZA 4DAFA 1OADA 3SY8A 1V0KA 3MI3A 1GZ1A 4TX8A 4TV6A 2HPIA 5FOOA 2VURA 1TQJA 5AHIA 4H9TA 4JY8A 2X0HA 1EWDA 1HGWA 5CPMA 4GG9A 1KB3A 4JN8A 4NI8A 3ZT7A 1QR7A 3M0XA 2DZBA 1W3TA 3HPZA 3MUAA 4LUTB 1SGJA 2Y4SA 4OFCA 1AL8A 2PP1A 3I7QA 1W54A 3M5VA 2ZOXA 4XKYA 1XYZA 4MWAE 3AZSA 1K9DA 2WZIA 3CV1A 1H7WA 2WHLA 4N6EA 1HNYA 3ONBA 3IJ9A 2VHLA 4V1XA 4AUBA 3ITOA 1VIWA 1UZHA 1BWLA 4A8IA 4OUEA 1YNQA 3L4XA 2I9EA 3P60A 1FTXA 4Z2GA 2NT0A 2OPJA 5I5RA 4JTLA 3NDZA 1G67A 4GRSA 3O1NA 2HVMA 3LCLA 4JKLA 3RU6A 3TC3A 2ZVIA 1KBJA 4JOMA 3GTHA 4JFUA 4GXPA 2OCZA 2CC0A 3QHNA 1XS2A 1MZHA 2WZMA 1YMYA 1XBXA 4GO9A 1TJPA 1CXHA 4C1LA 5A3HA 1V3MA 3BH4A 3O6DA 3U2ZA 4HNVA 2B4GA 3GB6A 1SSGA 2WLZA 1R86A 1WA3A 2VFFA 4QNWA 3LI1A 3FFSA 1WUEA 4RZ4A 1HW6A 2DZAA 1TIMA 2G3MA 2PWFA 4IIFA 1M68A 5EBAA 1QI5A 1OJXA 2A3BA 1IZCA 3IIOA 1J0YA 5TAOA 2BASA 4A3HA 3UJRA 1VHNA 2QIWA 4PE8A 3N13A 2VFIA 4Q8OA 4KRUA 4BF7A 1UZ4A 2CXEA 3AIQA 1KRCC 4HZ8A 3TC6A 2H6RA 3SN1A 1WAUA 1JZ2A 1UH3A 3DECA 4GNVA 1X38A 1XF0A 4A4AA 2PODA 1IXPA 3HU7A 4B16A 4YTQA 3HM7A 3ITLA 1W9DM 1BSLA 2Z24A 1UZDA 2WXDM 3W6LA 2GQ9A 1ISXA 2GDUA 2OFJA 3W7DA 4XZLX 2VEKA 4BHYA 1KNWA 1B54A 4V15A 1P0NA 1PYMA 4DF0A 2I17A 3GDKA 1W1TA 1QI0A 1AD4A 3K1DA 3LPGA 1Q6EA 3UNDA 2Y0FA 3O07A 4M0XA 3BLIA 1GTHA 3DFHA 1EHAA 3BL3A 5IBXC 4NAEA 2Y63A 3ZM8A 5DEZA 2PCQA 1ONEA 1V6YA 1I60A 3PBVA 1PWLA 1D8CA 4W88A 3GSMA 4GQ0A 1XYFA 4DJDC 3TTEA 2DZSA 3TOYA 4UOJA 2CESA 3ZIAG 3TYZA 2YL9A 5DF0A 1V3IA 1T8XA 3WK3A 3MI2A 4Q8QA 1S5TA 4O8AA 3IGHX 2WKLA 3TJIA 3HGOA 3GR8A 4DELA 1YE6A 1TV3A 4H9VA 2VX6A 1K70A 1EO5A 4OGZA 1KTBA 1JD7A 4PCSA 3NSMA 1SZEA 3GFXA 4AB4A 4HOXA 4PFHA 1OHLA 1I2OA 2C3ZA 1CB7B 4R7OA 4HHMA 1IGSA 3S9YA 3CEPA 2W6IG 4KWVA 1UD4A 4GIEA 1EUNA 4LGXA 4G7EA 4UFKA 1VD6A 1RHCA 3CEUA 2AKMA 4GVIA 4BQ5A 3T44A 1JFXA 3WQEA 5PTDA 3AJ7A 2TPSA 1VS1A 4O4WA 4ZO8A 3GM8A 3DGBA 3PTQA 4PUJA 3IUDA 1MZRA 4JZ5A 4DPQA 2QJHA 3S47A 3P3BA 1ADOA 1K8XA 4FZIA 2RJHA 4HNTA 3E0FA 4CQBA 3W75A 3XINA 3MVTA 4WJXA 1A49A 3A3XA 1PDYA 4I7VA 2QEZA 3WNOA 2QNEA 2O92A 4Y8EA 3B06A 4HHLA 4Q8MA 5JMUA 2RUSA 4FXSA 5E6ZA 1Z3NA 3M5XA 3IIXA 2DZWA 1RA5A 1U1UA 1F6KA 2D2OA 1NIUA 4AY8A 4HB7A 5J04A 5BXRA 4MGGA 3CL8A 2EBNA 3WY1A 3UVAA 1I2RA 2A3CA 3LLXA 4GUGA 2G37A 1PX4A 1MXGA 2GJXA 4KIEA 1REQA 1ICQA 4PN2A 3S5ZA 3QV6A 3BW4A 3DYOA 1UR0A 2POTA 1OWQA 5FF0A 3CWHA 4TVCA 1OYAA 3HJEA 4BF9A 2OLSA 4XQ6A 3ZZ1A 1QU4A 2QCCA 3VD7A 3Q94A 1UWTA 2P3EA 5IDIA 1M7JA 1JCNA 1NOFA 4M56A 3E12A 3GR7A 2VZOA 4DUOA 1XH1A 3SADA 3BVJA 3OEXA 3L7RA 1GYMA 3ABZA 1KFBA 1IF2A 3J7HA 1Q66A 3TX9A 1X8CA 4A3RA 4FOJA 4CD4A 3HZ3A 3VD9A 2WWCA 4NJIA 1QO5A 3FNDA 3PUGA 4PTMA 5DXYA 4KETA 4DJEC 4NNCA 2CLKA 4IH3A 4L9XA 1B9BA 1J11A 3N6HA 2UV8G 1U5VA 1W5NA 1TE6A 1JCJA 1S38A 3PTKA 4AG0A 1WDQA 2PSNA 3G24A 3VOIA 1FWSA 4C65A 5LA0A 5EPDA 4O57A 5B80A 1FRBA 2B7NA 5HATA 4LYRA 4AXKA 4Y9OA 1JVNA 2XVLA 2XN2A 3CZKA 3H2NA 4LBSA 2Z1VA 3PTMA 3B8UA 4ZXOA 3KL5A 3GG8A 3H7UA 1NM9A 2PS2A 1ME8A 2VWTA 2HBVA 3BLFA 4O14A 1JZ6A 1VAHA 2HNHA 3CO4A 4LXFA 2GJRA 3MYOA 2Y6ZA 3C2VA 5BXTA 2VRJA 1AW5A 5HMSA 1PVNA 1B31A 2YPIA 3CUGA 5GNXA 3S2LA 1LLOA 1KM1A 3W1AA 1IWPA 3NL6A 5JBEA 3W76A 3PNZA 3B8IA 3CUJA 4IIEA 1EJXC 1VLIA 3AZTA 1AJZA 4IP5A 5JIWA 3A4AA 4DI9A 3NQAA 4EOUA 4KCVA 4DWSB 2X0SA 1S46A 3CWNA 1LWIA 1NP2A 1B4EA 3WO8A 3BGJA 3GH4A 4Q8UA 3DERA 1FX6A 1K6WA 1LTDA 2WW5A 4M81A 2O7SA 4HSNA 2G0WA 4O1AA 3ITYA 2PDMA 4INFA 3I7RA 3APTA 1DJZA 2DT0A 5D2VA 3AS3A 1W3HA 2QV5A 4C1NB 2CLEA 1V7AA 3TMQA 2IQTA 5XIAA 5JXQA 1K7XA 1TPFA 2R1PA 5DT7A 3VOHA 1U1JA 1EYWA 3CO8A 1EOMA 3LRLA 4TUFA 4S2CA 5JBDA 2PRHA 4C7FA 3BSGA 3E6EA 1ZSXA 1F73A 4QISA 2VL4A 1TTIA 4U3AA 3ID7A 4CNOA 1SJAA 5EMMA 5C55A 3EPNA 3P6LA 2VR5A 2JFEX 1FH8A 4JTQA 1HJWA 1YXCA 4F40A 1THFD 2PTDA 4W8LA 3W25A 1M01A 3BE7A 2YJQA 3B3DA 1XQLA 1EX5A 1YTDA 3TROA 4BI5A 4OE7A 3A12A 2DSUA 4ROPA 1J0JA 2TYSA 1DEDA 1VYSX 4AY7A 3PBMA 1EQCA 4WY0A 3L2LA 2CLMA 2E9BA 3PTDA 3SRDA 3JR2A 4CKQA 2ODOA 2O4MA 1AFSA 1GOQA 5D32A 4GH1A 1FWAC 4PMRA 3GTFA 1TPVA 3QSRA 2Y2WA 3DYMA 4WOQA 2CFFA 2WCGA 2C71A 2GVGA 2ONEA 3ZT5A 1AL7A 3DFYA 3LLDA 4EF8A 5HMEA 4XISA 3AWOA 3PSWA 2QDDA 4HPXA 5D2TA 4DM2A 4Q22A 1VBRA 1Q8JA 4GI6A 4MOZA 4QRNA 3NG3A 3SEPA 2QAPA 1OYCA 5LIUX 5ABEA 4A22A 3POHA 3T0TA 2ZC8A 3ENLA 4CVWA 3GFZA 1E4NA 2WCSA 2CZVA 3M6DA 2ZX5A 4MKSA 2Z7KA 4R27A 4Q4SA 1BQCA 4AEOA 1PKYA 5CJ5A 3JUGA 4X3ZA 3A24A 4F2BA 3CTTA 2J7EA 3VKDA 2BY3A 3EDFA 2ZVRA 4QAIA 2QIIA 3L4TA 3WDQA 3KZPA 3C2FA 4MB5A 2Z00A 1BG4A 1HKJA 1W31A 2PRLA 1DJWA 3AROA 4W9TA 1IR1A 3W74A 2YDRA 4XZHA 1H5VA 2B7PA 3LTSA 3T4CA 3FKSG 2ZA1A 4Q6XA 4PH6A 5D8WA 2EEXA 1KC7A 4WKFA 4GBUA 1HKKA 1JQVA 3FHQA 4PC8A 5ENLA 3BICA 1BWKA 2W6RA 3UR8A 3IIZA 1W8GA 2BY0A 1GQIA 1DJYA 1KBLA 2QDEA 3BOFA 4US6A 3N1AA 3W7CA 3VGBA 2Y7DA 4GVGA 2QVNA 2W66A 1DXIA 4ORIA 4Z2KA 3WX7A 1D3HA 1XYCA 1HVQA 2RJGA 1YTKA 5C0QA 3W88A 4EXBA 3O63A 2FZNA 3G8RA 4GKLA 1J93A 2YZRA 1SO6A 3IJ6A 5B7ZA 1NP0A 1R0MA 3UG8A 2HPMA 1PXGA 1JG9A 1E0WA 4U31A 3ZWSA 3U8GA 5MKGB 2XOKG 4XTDA 3MPGA 3OVRA 3AHTA 2WVVB 1J9YA 3HG3A 5FEWA 1LOQA 3LZ3A 2WVUA 1EPVA 2YDSA 1O60A 3PUEA 3B0VC 3CBWA 4RDYA 3F4DA 1FFRA 5DLCA 4FAMA 3AI0A 1FA2A 1HJXA 5CPSA 3UZYA 1E4LA 3CIXA 3BWWA 1JNDA 4XZNX 3GC2A 3O3RA 3AAGA 2XWDA 3KLKA 3QOKA 3S46A 4F0KA 3KLLA 2XNDG 1S2TA 1TPUA 4AVOA 3G1RA 3KBNA 1QJWA 1D7FA 4H00A 4YNGA 1MO0A 3IGSA 2Z0IA 1C90A 4FB7A 3W7KA 3LBCA 2VCCA 3LCHA 3LSCA 3LA4A 3KCLA 1OFAA 1RQEA 1AMYA 3CNYA 3N18A 1UD5A 4IMAA 2CW6A 2DZVA 4JTFA 2D24A 2YBTA 2GWNA 4G56A 5D2XA 8CGTA 1TPH1 1XDMA 1FY6A 4AMCA 5F1VA 2QDHA 2CHNA 3IANA 1OX4B 3BSHA 4JKKA 3S4TA 3W29A 4E2BA 2NQ9A 3P84A 3CH0A 3NXLA 4GJIA 4CN4A 2PWEA 3GNPA 5I0DA 3P8IA 3A13A 3FGCA 3ITCA 3UG4A 4TQTA 4C6PA 3NO5A 1B30A 3GAKA 5CPTA 3WD1A 3NDYA 2Q71A 4LY8A 1DIOA 4P5UA 3WLRA 5ECVA 3A47A 3DN5A 2OOFA 1WOAA 2PLKA 1ELSA 2JGQA 2QYGA 4WDXA 4LF1A 1RH9A 1KRBC 2EJAA 3TYAA 3TCSA 5HQEA 4IIBA 3LQLA 3VUSA 1LF1A 4HIBA 2UY2A 3SGGA 2FH6A 3WLMA 4D6GA 3WNLA 1Q6RA 3UGVA 1KCXA 1C29A 1QT1A 3HJZA 2SFPA 2YIHA 1VH7A 1TELA 2DU2A 2PLCA 3L5AA 4GPNA 3R5EA 4JX5A 1LJYA 3VFLA 1OEPA 3S1VA 2Z2AA 1OFPA 1SM9A 3WF4A 3HFTA 3QTGA 1RSCA 2JEPA 3NQBA 2EGZA 1HKWA 3MHGA 5HJXA 1AJ0A 2C1IA 4TX6A 1JZ5A 2CWXA 3OBAA 1HJUA 4PMQA 1E15A 3NR0A 2WO5A 1KXVA 3BW3A 2P76A 1Q6QA 1OD8A 1DHPA 1V4YA 3V0UA 2BS9A 3T1GA 1V02A 2E6AA 2O55A 4LUTA 1EJVC 3SCTA 2VEPA 3T2OA 3W7LA 1LG1A 4G5DA 3W9ZA 1LM1A 2O9OA 4L4PA 2HWGA 3UFYA 1F8MA 4ZTXA 4QS5A 4JFTA 3FJLA 1TPC1 5I3FA 2XUCA 1PPIA 4N02A 1RK6A 4ADSA 1XBYA 1RBOB 3HQ1A 2XSAA 1JUEA 1XLFA 3AUJA 2OGYA 1RP9A 1XH0A 5HNRA 4JDBA 3LK6A 1RP8A 3UY8A 3S5OA 4Q7IA 1Q7ZA 2QDGA 2Z26A 4DUWA 4QDMA 4ES4A 2GYIA 3P0WA 4NVTA 4DO5A 1DJXA 3PJWA 5I3KA 1ISVA 3AXIA 2YL6A 5M2FX 5D2WA 3SM0A 4IHCA 3PB2A 3V75A 2XGZA 4ZA0A 1IT8A 3N2CA 3KW3A 3FYYA 4DJFA 3A6OA 1O6IA 2OJPA 3DFNA 3ZXWA 1BRLB 4CCZA 2V2DA 1W1VA 3IIVA 1C8YA 3DEQA 2Y8KA 1NELA 1GNXA 3AIEA 5JUVA 2PDGA 3MV01 4WQ6A 1H1YA 3HPSA 4KQNA 3TN5A 1P43A 3VE9A 2J88A 3C0QA 4DAIA 3OJGA 4CNPA 3SECA 3DX5A 3KM8A 1IV8A 5EMUA 1UH2A 4LBRA 4J3TA 4PFMA 1JXJA 3OHIA 1OFDA 2WC4A 3ZIZA 3G77A 2GDVA 1E6ZA 3HV9A 4QJ4B 1XKYA 4FNSA 5AB3A 3VD4A 1XV8A 1W32A 3RAOA 2PD5A 5AHLA 1CGTA 3NTYA 1DIKA 5CG0A 1IIGA 2E7FA 1R85A 2NV9A 1ISZA 2QCEA 2ZKMX 1AVAA 2GVJA 2QUUA 1L6FA 2R14A 4NJHA 1LQ0A 3RPMA 3N73A 2DZPA 1UPPA 2QCDB 3G8EA 3R2GA 1KCLA 5LIWX 3SCOA 4FNPA 2CNCA 1D3GA 1K9FA 8XIMA 2JK2A 1GUVA 3RG6A 3LENA 4FIRA 1LOLA 1N82A 2CYGA 1Q13A 3GKFA 2ACRA 3T81A 3CB8A 1JPKA 3UWYA 3AXMA 1V51A 4MYAA 4O54A 2FDMA 1HGYA 3RN6A 3FAWA 3MS8A 3M0VA 1J5SA 4KCUA 1PKNA 3KVJA 5CBIA 4YYCA 4AIEA 3ARTA 3LPPA 3VIKA 4GVHA 4JTEA 3TAOA 3BQ5A 1SW0A 4X9SA 3WBEA 4UTKA 5FI8A 5CG7A 1FHVA 4JNMA 2R8WA 3QY8A 4HSHA 7REQB 3THCA 4DN1A 1CLKA 1JUKA 3QMTA 1T8QA 5CGTA 1SZRA 3P61A 3CQ0A 1YRRA 4E2VA 4WLCA 3ARPA 4X2PA 1NF7A 3KBMA 4H7ZA 3GG0A 3QLDA 1G0CA 3NZRA 2D0FA 2PWVA 5FEXA 3PAJA 3CHFA 1MEHA 2Y8VA 1JPHA 1SUXA 5CAKA 4OOUA 4RV8A 2PRMA 2PWUA 2R1LA 1J0KA 2PA6A 4XO6A 3LYEA 2FPVA 1P1XA 4EX4A 3ITVA 4NHVA 1BWVA 1H7PA 1C9WA 3W6YA 1LBMA 4S3FA 4Z42C 4UCGA 5FD0A 1XBZA 4PUWA 5AC7A 3KCJA 1A4MA 5ABFB 1L6WA 5ECUA 4YCPA 4UTIA 4ZB5A 4AWEA 4AQLA 4GXWA 2QGYA 4IMGA 3L65A 1K4GA 3W7MA 3BAWA 1QNOA 5DY3A 3CQIA 5BYWA 5HWMA 1UD2A 1R38A 1UIOA 5F2IA 1TMQA 1K7FA 2WAGA 1UA7A 3UVIA 4AISA 3W1QA 4ZTYA 5CBBA 2VFHA 1GVEA 4R9OA 2WKGA 3RU8X 3VMNA 4PCPA 3KE0A 3VUPA 3GDMA 3FDKA 5CLWA 1YW1A 2W5FA 4O15A 4BS0A 4MDOA 4MDPA 1NDYA 4K7YA 1IE7C 5I3DA 2VT0A 1QMLA 2NW0A 3ZJ8A 1WKDA 1VENA 5GVJA 4Y8FA 3T0AA 3BOLA 5FJIA 3DCPA 4C6QA 4IICA 1W6TA 3SCPA 2OQYA 4H6QA 1AQFA 3SJ3A 5LNSA 3EWCA 4AEEA 1YQ2A 3W7PA 1EH9A 4IQJA 5DN6G 5FACA 4Z1DA 4J9JA 1PV8A 1YKWA 2W9MA 1O95A 4MF4A 3TFCA 4H3DA 3VINA 4HK5A