4KCXA

Brdt in complex with dinaciclib
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
TNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain testis-specific protein
publication title Cyclin-dependent kinase inhibitor dinaciclib interacts with the acetyl-lysine recognition site of bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/inhibitor
total genus 38
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4kcxA01
2D82A 4CURA 4LYWA 5EA1A 5EPBA 3U5JA 5EK9A 3O34A 3HMEA 5F36A 5A5PA 4UYEA 4N4FA 4NR5A 4Q0NA 4QNSA 4X2IA 3MB4A 4A9FA 5HRVA 4N4HA 4YYGA 4YY6A 4Q0OA 4BW1A 2RO1A 4NYXA 5D7XA 4LDFA 1WUMA 5H1VA 4UIYA 4CUPA 2YEKA 5CUEA 5FE6A 5D0CA 4RVRA 2OUOA 5D3TA 5HCLA 5LKUA 4YK0A 5F63A 5FFYA 4OGIA 4NRBA 3U5KA 5CY9A 5DYUA 4N4IA 1EQFA 5FH7A 2RNWA 4IR4A 5DYCA 4ZW1A 3UVYA 5E9YA 5A5OA 5L99A 5KTWA 2RNXA 5EI4A 4LYIA 4YBTA 5HQ6A 3JVLA 4IOQA 5HENA 5EWWA 4MR4A 4TT6A 3IU6A 4XUAA 4NR6A 5A5SA 5FB1A 4NXJA 5ENCA 4QB3A 5CS8A 2LSPB 2YQDA 4WHWA 5F1LA 5FE0A 4ZC9A 4QEUA 2YELA 5E7DA 5HELA 5D3HA 2I7KA 5BT3A 5I1QA 5EWDA 5EV9A 3HMHA 5CUBA 4UIWA 5ENHA 5C8GA 4QSTA 5ETDA 5CRMA 5IGMA 4O7EA 5E73A 5L98A 4O7FA 2H60A 5E3DA 4QSQA 3SVFA 4YYJA 4QEWA 4QC3A 5DYXA 5D3LA 5D3SA 3UV2A 4YYDA 5C4QA 5IGNA 5I80A 4TS8A 3GG3A 4KV1A 5CRZA 5FG6A 5G4SA 4TTEA 4QYDA 5EPSA 5E3GA 4TU6A 5FE2A 1JSPB 2MJVB 5AD2A 5EWCA 5DFDA 2OSSA 5HEMA 5ENFA 4O74A 4QSWA 3O37A 5ENBA 4A9MA 4NUEA 5LKXA 4IOOA 2YYNA 3RCWA 1WUGA 5HQ7A 3U5MA 5DFBA 5LUUA 3UVXA 5D25A 5EP7A 4O78A 4HBVA 3U5OA 5CQTA 4A9OA 4TYLA 3P1EA 3O36A 4NRAA 5E9LA 5CQ8A 3U5LA 4XY9A 4NQMA 4IR5A 5IIDA 5C87A 5EQ1A 4LZSA 3LXJA 5G4RA 5H1TA 3MUKA 4HXMA 3JVKA 5CUCA 2N9GA 5A85A 5E9KA 3UVDA 4MEOA 2R0SA 4O72A 2E3KA 2RI7A 4MEQA 1X0JA 5I88A 4UYDA 4HXNA 5DYAA 4Z1SA 4MR5A 4ALGA 5K29A 5F62A 5FFWA 4C67A 2R0VA 3ZYUA 3Q2EA 4AKNA 4YH3A 3MB3A 5I7XA 4CUSA 4TQNA 5A5RA 5DLXA 5FE5A 4DONA 5E0RA 5CU8A 4QR4A 4O75A 5DBMA 5ENIA 5ACYA 4MENA 3LQIA 3P1CA 5II1A 1F68A 4CUQA 3O33A 5FFVA 4HXRA 3LJWA 3P1DA 4IR3A 5CQ3A 2OO1A 2YDWA 3QZTA 5ENJA 3MULA 5DX4A 5FE3A 4NQNA 5DW1A 5JI8A 2RNYA 5DLZA 3AADA 4WIVA 5CQ7A 5LVRA 2I8NA 5CGPA 3LQHA 3Q2FA 2GRCA 4UYFB 5LVQA 4HXLA 4Z1QA 4YC9A 4CFLA 5E74A 3AQAA 4TU4A 5A83A 4PTBA 4QZSA 5CQ6A 5TB6A 4BW2A 5FE4A 5J0DA 5KO4A 2L84A 5D3PA 4YYKA 4C66A 3QZSA 4FLPA 5TCMA 5FG5A 3MXFA 4QUTA 4QC1A 5FH8A 5CP5A 4YAXA 5HM0A 3SVHA 4A9KA 3JVJA 2DVQA 5I86A 5F25A 4UIUA 4YBMA 2WP2A 4QSPA 4LRGA 4YYHA 4UIXA 5FDZA 5DKCA 5IG6A 5EU1A 4TZ8A 4MR6A 5HFRA 5I29A 5C89A 3K2JA 4O7CA 4NR4A 3G0JA 5CUDA 3MQMA 5AMEA 5CTLA 5FE9A 3UW9A 4QEVA 5L8TA 4J3IA 4UYGA 4YYNA 2L85A 1ZS5A 2DWWA 2R10A 5FE7A 5ENGA 5FH6A 2DVRA 3DAIA 4UIZA 4PY6A 4N4GA 5EICA 4J0SA 5II2A 4CLBA 5L8UA 2YW5A 4A9NA 5BT4A 2R0YA 2DVSA 5ENEA 4ALHA 4LR6A 4CUUA 4Z6HA 5A7CA 2RS9B 4E96A 2WP1A 5D26A 5EPRA 3SVGA 4QUUA 2F6JA 3G0LA 5CUGA 5DW2A 5A5NA 5E9IA 4HBYA 5LKTA 3ONIA 3UVWA 4QY4A 5EGUA 4A9JA 4A9EA 5LJ1A 2YEMA 2KTBB 3IU5A 4HBXA 4QYLA 4YYIA 2F6NA 4A9HA 5EWHA 5KU3A 4NS5A 2NXBA 5LKZA 4PCIA 5EVAA 5EWVA 2RFJA 4NYVA 4WHUA 4XYAA 5F5ZA 4Z6IA 1E6IA 5A82A 5DFCA 4UYHA 4QSUA 5D3NA 4QSSA 4YYMA 4NR9A 4UITA 5COIA 3HMFA 4CFKA 4LZ2A 5E9VA 4BHWA 4NYWA 4QR3A 5LJ2A 3NXBA 5CFWA 5HQ5A 5F61A 4PKLA 3FKMX 4CUTA 5KHMA 4LYSA 4KV4A 4F3IA 4O71A 4IORA 4YBSA 1JM4B 5CQAA 4YADA 5D3RA 4PCEA 5C7NA 5KTXA 4YY4A 4J1PA 5H1UA 4QSRA 5I7YA 3UV4A 5JWMA 5E9MA 5L96A 5HRWA 4QR5A 4A9IA 4NR8A 2FSAA 4OUFA 3I3JA 4YABA 2E7OA 1N72A 4NRCA 4NR7A 4NUCA 5F60A 5DY7A 5D24A 5FB0A 5F2PA 5LJ0A 4LZRA 5L97A 5EM3A 5IBNA 5FBXA 2DVVA 4IR6A 5F1HA 4HXKA 4HXSA 4Z93A 3DWYA 4LC2A 4XUBA 5CUAA 4NUDA 4KCXA 4O77A 5IGLA 5I83A 4O7BA 4HXPA 4YH4A 4J0RA 4OGJA 5F3AA 3U5NA 5CZGA 4BW3A 4XY8A 3QZVA 2L5EA 3UV5A 5HRXA 5HFQA 5DKHA 5KTUA 4QSVA 4QBMA 5DKDA 5AD3A 3P1FA 4O76A 3O35A 2D9EA 5A5QA 5CQ5A 5I89A 3LQJA 5I40A 5H85A 5ETBA 2G4AA 4ZQLA 5A81A 5IGKA 5FG4A 5D3JA 5BT5A 4TZ2A 4BJXA 3D7CA 4HBWA 3TLPA 4QSXA 4MEPA 5CPEA 4O70A 4CL9A 5AMFA 3S91A 5FE8A 3U5PA 5FE1A 2DKWA 2DATA 4YATA 3P5OA 4GPJA 4MR3A 4TT4A 5HJCA 4TT2A 5C85A 4PS5A 3S92A 4UIVA 4BW4A 5CQ4A 4A9LA 4UYFA 3JVMA 4Y03A 5EISA 5HLSA 2E7NA 4O7AA 4HXOA 4N3WA
chains in the Genus database with same CATH superfamily
2D82A 4CURA 4LYWA 5EA1A 5EPBA 3U5JA 5EK9A 3O34A 3HMEA 5F36A 5A5PA 4UYEA 4N4FA 4AKGA 4NR5A 4Q0NA 4QNSA 4X2IA 3MB4A 4A9FA 5HRVA 4N4HA 4YYGA 4YY6A 4Q0OA 4BW1A 2RO1A 4NYXA 5D7XA 4LDFA 1WUMA 5H1VA 4UIYA 4CUPA 2YEKA 5CUEA 5FE6A 5D0CA 4RVRA 2OUOA 5D3TA 5HCLA 5LKUA 4YK0A 5F63A 2EJNA 5FFYA 4OGIA 4NRBA 3U5KA 5CY9A 5DYUA 4N4IA 1EQFA 5FH7A 2RNWA 4IR4A 5DYCA 4ZW1A 3UVYA 5E9YA 5A5OA 5L99A 5KTWA 2RNXA 5EI4A 4LYIA 4YBTA 5HQ6A 3JVLA 4IOQA 5HENA 5EWWA 4MR4A 4TT6A 3IU6A 4XUAA 4NR6A 5A5SA 5FB1A 4NXJA 5ENCA 4QB3A 5CS8A 2LSPB 2YQDA 4WHWA 5F1LA 5FE0A 4ZC9A 4QEUA 2YELA 5E7DA 5HELA 5D3HA 2I7KA 5BT3A 5I1QA 5EWDA 5EV9A 3HMHA 5CUBA 4UIWA 5ENHA 5C8GA 4QSTA 5ETDA 5CRMA 5IGMA 4O7EA 5E73A 5L98A 4O7FA 2H60A 5E3DA 4QSQA 3SVFA 4YYJA 4QEWA 4QC3A 5DYXA 5D3LA 5D3SA 3UV2A 4YYDA 5C4QA 5IGNA 5I80A 4TS8A 3GG3A 4KV1A 4AKHA 5CRZA 5FG6A 5G4SA 4TTEA 4QYDA 5EPSA 5E3GA 4TU6A 5FE2A 1JSPB 2MJVB 5AD2A 5EWCA 5DFDA 2OSSA 5HEMA 5ENFA 4O74A 4QSWA 3O37A 5ENBA 4A9MA 4NUEA 5LKXA 4IOOA 2YYNA 3RCWA 1WUGA 5HQ7A 3U5MA 5DFBA 5LUUA 3UVXA 5D25A 5EP7A 4O78A 4HBVA 3U5OA 5CQTA 4A9OA 4TYLA 3P1EA 3O36A 4NRAA 5E9LA 5CQ8A 3U5LA 4XY9A 4NQMA 4IR5A 5IIDA 5C87A 5EQ1A 4LZSA 3LXJA 5G4RA 5H1TA 3MUKA 4HXMA 3JVKA 5CUCA 2N9GA 5A85A 5E9KA 3UVDA 4MEOA 2R0SA 4O72A 4AKIA 2E3KA 2RI7A 4MEQA 1X0JA 5I88A 4UYDA 4HXNA 5DYAA 4Z1SA 4MR5A 4ALGA 5K29A 5F62A 5FFWA 4C67A 2R0VA 3ZYUA 3Q2EA 4AKNA 4YH3A 3MB3A 5I7XA 4CUSA 4TQNA 5A5RA 5DLXA 5FE5A 4DONA 5E0RA 5CU8A 4QR4A 4O75A 5DBMA 5ENIA 5ACYA 4MENA 3LQIA 3P1CA 5II1A 1F68A 4CUQA 3O33A 5FFVA 4HXRA 3LJWA 3P1DA 4IR3A 5CQ3A 2OO1A 2YDWA 3QZTA 3VKGA 5ENJA 3MULA 5DX4A 5FE3A 4NQNA 5DW1A 5JI8A 2RNYA 5DLZA 3AADA 4WIVA 1ZKRA 5CQ7A 5LVRA 2I8NA 5CGPA 3LQHA 3Q2FA 2GRCA 4UYFB 5LVQA 4HXLA 3VKHA 4Z1QA 4YC9A 4CFLA 5E74A 3AQAA 4TU4A 5A83A 4PTBA 4QZSA 5CQ6A 5TB6A 4BW2A 5FE4A 5J0DA 5KO4A 2L84A 5D3PA 4YYKA 4C66A 3QZSA 4FLPA 5TCMA 5FG5A 3MXFA 4QUTA 4QC1A 5FH8A 5CP5A 4YAXA 5HM0A 3SVHA 4A9KA 3JVJA 2DVQA 5I86A 5F25A 4UIUA 4YBMA 2WP2A 4QSPA 4LRGA 4YYHA 4UIXA 5FDZA 5DKCA 5IG6A 5EU1A 4TZ8A 4MR6A 5HFRA 5I29A 5C89A 3K2JA 4O7CA 4NR4A 3G0JA 5CUDA 3MQMA 5AMEA 5CTLA 5FE9A 3UW9A 4QEVA 5L8TA 4J3IA 4UYGA 4YYNA 2L85A 1ZS5A 2DWWA 2R10A 5FE7A 5ENGA 5FH6A 2DVRA 3DAIA 4UIZA 4PY6A 4N4GA 5EICA 4J0SA 5II2A 4CLBA 5L8UA 2YW5A 4A9NA 4AI6A 5BT4A 2R0YA 2DVSA 5ENEA 4ALHA 4LR6A 4CUUA 4Z6HA 5A7CA 2RS9B 4E96A 2WP1A 5D26A 5EPRA 3SVGA 4QUUA 2F6JA 3G0LA 5CUGA 5DW2A 5A5NA 5E9IA 4HBYA 5LKTA 3ONIA 3UVWA 4QY4A 5EGUA 4A9JA 4A9EA 5LJ1A 2YEMA 2KTBB 3IU5A 4HBXA 4QYLA 4YYIA 2F6NA 4A9HA 5EWHA 5KU3A 4NS5A 2NXBA 5LKZA 4PCIA 5EVAA 5EWVA 2RFJA 4NYVA 4WHUA 4XYAA 5F5ZA 4Z6IA 1E6IA 5A82A 4UYHA 5DFCA 4QSUA 5D3NA 4QSSA 4YYMA 4NR9A 4UITA 5COIA 3HMFA 4CFKA 4LZ2A 5E9VA 4BHWA 4NYWA 4QR3A 5LJ2A 3NXBA 5CFWA 5HQ5A 5F61A 4PKLA 3FKMX 4CUTA 5KHMA 4LYSA 4KV4A 4F3IA 4O71A 4IORA 4YBSA 1JM4B 5CQAA 4YADA 3D1BA 5D3RA 4PCEA 5C7NA 5KTXA 4YY4A 4J1PA 5H1UA 4QSRA 5I7YA 3UV4A 5JWMA 5E9MA 5L96A 5HRWA 4QR5A 4A9IA 4NR8A 2FSAA 4OUFA 3I3JA 4YABA 2E7OA 1N72A 4NRCA 4NR7A 4NUCA 5F60A 5DY7A 3ERRA 5D24A 5FB0A 5F2PA 5LJ0A 4LZRA 5L97A 5EM3A 5IBNA 5FBXA 2DVVA 4IR6A 5F1HA 4HXKA 4HXSA 4Z93A 3DWYA 4LC2A 4XUBA 5CUAA 4NUDA 4KCXA 4O77A 5IGLA 5I83A 4O7BA 4HXPA 4YH4A 4J0RA 4OGJA 5F3AA 3U5NA 5CZGA 4BW3A 4XY8A 3QZVA 2L5EA 3UV5A 5HRXA 5HFQA 5DKHA 5KTUA 4QSVA 4QBMA 5DKDA 5AD3A 3P1FA 4O76A 3O35A 2D9EA 5A5QA 5CQ5A 5I89A 3LQJA 5I40A 5H85A 5ETBA 2G4AA 4ZQLA 5A81A 5IGKA 5FG4A 5D3JA 5BT5A 4TZ2A 4BJXA 3D7CA 4HBWA 3TLPA 4QSXA 4MEPA 3D1DA 5CPEA 4O70A 4CL9A 5AMFA 3S91A 5FE8A 3U5PA 5FE1A 2DKWA 2DATA 4YATA 3P5OA 1PUOA 4GPJA 4MR3A 4TT4A 5HJCA 4TT2A 5C85A 4PS5A 3S92A 4UIVA 4BW4A 5CQ4A 4A9LA 4UYFA 3JVMA 4Y03A 5EISA 5HLSA 2E7NA 4O7AA 4HXOA 4N3WA
chains in the Genus database with same CATH topology
2D82A 4CURA 4LYWA 5EA1A 5EPBA 3U5JA 5EK9A 3O34A 3HMEA 5F36A 5A5PA 4UYEA 4N4FA 4NR5A 4Q0NA 4QNSA 4X2IA 3MB4A 4A9FA 5HRVA 4N4HA 4YYGA 4YY6A 4Q0OA 4BW1A 2RO1A 4NYXA 5D7XA 4LDFA 1WUMA 5H1VA 4UIYA 4CUPA 2YEKA 5CUEA 5FE6A 5D0CA 4RVRA 2OUOA 5D3TA 5HCLA 5LKUA 4YK0A 5F63A 5FFYA 4OGIA 4NRBA 3U5KA 5CY9A 5DYUA 4N4IA 1EQFA 5FH7A 2RNWA 4IR4A 5DYCA 4ZW1A 3UVYA 5E9YA 5A5OA 5L99A 5KTWA 2RNXA 5EI4A 4LYIA 4YBTA 5HQ6A 3JVLA 4IOQA 5HENA 5EWWA 4MR4A 4TT6A 3IU6A 4XUAA 4NR6A 5A5SA 5FB1A 4NXJA 5ENCA 4QB3A 5CS8A 2LSPB 2YQDA 4WHWA 5F1LA 5FE0A 4ZC9A 4QEUA 2YELA 5E7DA 5HELA 5D3HA 2I7KA 5BT3A 5I1QA 5EWDA 5EV9A 3HMHA 5CUBA 4UIWA 5ENHA 5C8GA 4QSTA 5ETDA 5CRMA 5IGMA 4O7EA 5E73A 5L98A 4O7FA 2H60A 5E3DA 4QSQA 3SVFA 4YYJA 4QEWA 4QC3A 5DYXA 5D3LA 5D3SA 3UV2A 4YYDA 5C4QA 5IGNA 5I80A 4TS8A 3GG3A 4KV1A 5CRZA 5FG6A 5G4SA 4TTEA 4QYDA 5EPSA 5E3GA 4TU6A 5FE2A 1JSPB 2MJVB 5AD2A 5EWCA 5DFDA 2OSSA 5HEMA 5ENFA 4O74A 4QSWA 3O37A 5ENBA 4A9MA 4NUEA 5LKXA 4IOOA 2YYNA 3RCWA 1WUGA 5HQ7A 3U5MA 5DFBA 5LUUA 3UVXA 5D25A 5EP7A 4O78A 4HBVA 3U5OA 5CQTA 4A9OA 4TYLA 3P1EA 3O36A 4NRAA 5E9LA 5CQ8A 3U5LA 4XY9A 4NQMA 4IR5A 5IIDA 5C87A 5EQ1A 4LZSA 3LXJA 5G4RA 5H1TA 3MUKA 4HXMA 3JVKA 5CUCA 2N9GA 5A85A 5E9KA 3UVDA 4MEOA 2R0SA 4O72A 2E3KA 2RI7A 4MEQA 1X0JA 5I88A 4UYDA 4HXNA 5DYAA 4Z1SA 4MR5A 4ALGA 5K29A 5F62A 5FFWA 4C67A 2R0VA 3ZYUA 3Q2EA 4AKNA 4YH3A 3MB3A 5I7XA 4CUSA 4TQNA 5A5RA 5DLXA 5FE5A 4DONA 5E0RA 5CU8A 4QR4A 4O75A 5DBMA 5ENIA 5ACYA 4MENA 3LQIA 3P1CA 5II1A 1F68A 4CUQA 3O33A 5FFVA 4HXRA 3LJWA 3P1DA 4IR3A 5CQ3A 2OO1A 2YDWA 3QZTA 5ENJA 3MULA 5DX4A 5FE3A 4NQNA 5DW1A 5JI8A 2RNYA 5DLZA 3AADA 4WIVA 5CQ7A 5LVRA 2I8NA 5CGPA 3LQHA 3Q2FA 2GRCA 4UYFB 5LVQA 4HXLA 4Z1QA 4YC9A 4CFLA 5E74A 3AQAA 4TU4A 5A83A 4PTBA 4QZSA 5CQ6A 5TB6A 4BW2A 5FE4A 5J0DA 5KO4A 2L84A 5D3PA 4YYKA 4C66A 3QZSA 4FLPA 5TCMA 5FG5A 3MXFA 4QUTA 4QC1A 5FH8A 5CP5A 4YAXA 5HM0A 3SVHA 4A9KA 3JVJA 2DVQA 5I86A 5F25A 4UIUA 4YBMA 2WP2A 4QSPA 4LRGA 4YYHA 4UIXA 5FDZA 5DKCA 5IG6A 5EU1A 4TZ8A 4MR6A 5HFRA 5I29A 5C89A 3K2JA 4O7CA 4NR4A 3G0JA 5CUDA 3MQMA 5AMEA 5CTLA 5FE9A 3UW9A 4QEVA 5L8TA 4J3IA 4UYGA 4YYNA 2L85A 1ZS5A 2DWWA 2R10A 5FE7A 5ENGA 5FH6A 2DVRA 3DAIA 4UIZA 4PY6A 4N4GA 5EICA 4J0SA 5II2A 4CLBA 5L8UA 2YW5A 4A9NA 5BT4A 2R0YA 2DVSA 5ENEA 4ALHA 4LR6A 4CUUA 4Z6HA 5A7CA 2RS9B 4E96A 2WP1A 5D26A 5EPRA 3SVGA 4QUUA 2F6JA 3G0LA 5CUGA 5DW2A 5A5NA 5E9IA 4HBYA 5LKTA 3ONIA 3UVWA 4QY4A 5EGUA 4A9JA 4A9EA 5LJ1A 2YEMA 2KTBB 3IU5A 4HBXA 4QYLA 4YYIA 2F6NA 4A9HA 5EWHA 5KU3A 4NS5A 2NXBA 5LKZA 4PCIA 5EVAA 5EWVA 2RFJA 4NYVA 4WHUA 4XYAA 5F5ZA 4Z6IA 1E6IA 5A82A 5DFCA 4UYHA 4QSUA 5D3NA 4QSSA 4YYMA 4NR9A 4UITA 5COIA 3HMFA 4CFKA 4LZ2A 5E9VA 4BHWA 4NYWA 4QR3A 5LJ2A 3NXBA 5CFWA 5HQ5A 5F61A 4PKLA 3FKMX 4CUTA 5KHMA 4LYSA 4KV4A 4F3IA 4O71A 4IORA 4YBSA 1JM4B 5CQAA 4YADA 5D3RA 4PCEA 5C7NA 5KTXA 4YY4A 4J1PA 5H1UA 4QSRA 5I7YA 3UV4A 5JWMA 5E9MA 5L96A 5HRWA 4QR5A 4A9IA 4NR8A 2FSAA 4OUFA 3I3JA 4YABA 2E7OA 1N72A 4NRCA 4NR7A 4NUCA 5F60A 5DY7A 5D24A 5FB0A 5F2PA 5LJ0A 4LZRA 5L97A 5EM3A 5IBNA 5FBXA 2DVVA 4IR6A 5F1HA 4HXKA 4HXSA 4Z93A 3DWYA 4LC2A 4XUBA 5CUAA 4NUDA 4KCXA 4O77A 5IGLA 5I83A 4O7BA 4HXPA 4YH4A 4J0RA 4OGJA 5F3AA 3U5NA 5CZGA 4BW3A 4XY8A 3QZVA 2L5EA 3UV5A 5HRXA 5HFQA 5DKHA 5KTUA 4QSVA 4QBMA 5DKDA 5AD3A 3P1FA 4O76A 3O35A 2D9EA 5A5QA 5CQ5A 5I89A 3LQJA 5I40A 5H85A 5ETBA 2G4AA 4ZQLA 5A81A 5IGKA 5FG4A 5D3JA 5BT5A 4TZ2A 4BJXA 3D7CA 4HBWA 3TLPA 4QSXA 4MEPA 5CPEA 4O70A 4CL9A 5AMFA 3S91A 5FE8A 3U5PA 5FE1A 2DKWA 2DATA 4YATA 3P5OA 4GPJA 4MR3A 4TT4A 5HJCA 4TT2A 5C85A 4PS5A 3S92A 4UIVA 4BW4A 5CQ4A 4A9LA 4UYFA 3JVMA 4Y03A 5EISA 5HLSA 2E7NA 4O7AA 4HXOA 4N3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D82 A;  4CUR A;  4LYW A;  5EA1 A;  5EPB A;  3U5J A;  5EK9 A;  3O34 A;  3HME A;  5F36 A;  5A5P A;  4UYE A;  4N4F A;  4NR5 A;  4Q0N A;  4QNS A;  4X2I A;  3MB4 A;  4A9F A;  5HRV A;  4N4H A;  4YYG A;  4YY6 A;  4Q0O A;  4BW1 A;  2RO1 A;  4NYX A;  5D7X A;  4LDF A;  1WUM A;  5H1V A;  4UIY A;  4CUP A;  2YEK A;  5CUE A;  5FE6 A;  5D0C A;  4RVR A;  2OUO A;  5D3T A;  5HCL A;  5LKU A;  4YK0 A;  5F63 A;  5FFY A;  4OGI A;  4NRB A;  3U5K A;  5CY9 A;  5DYU A;  4N4I A;  1EQF A;  5FH7 A;  2RNW A;  4IR4 A;  5DYC A;  4ZW1 A;  3UVY A;  5E9Y A;  5A5O A;  5L99 A;  5KTW A;  2RNX A;  5EI4 A;  4LYI A;  4YBT A;  5HQ6 A;  3JVL A;  4IOQ A;  5HEN A;  5EWW A;  4MR4 A;  4TT6 A;  3IU6 A;  4XUA A;  4NR6 A;  5A5S A;  5FB1 A;  4NXJ A;  5ENC A;  4QB3 A;  5CS8 A;  2LSP B;  2YQD A;  4WHW A;  5F1L A;  5FE0 A;  4ZC9 A;  4QEU A;  2YEL A;  5E7D A;  5HEL A;  5D3H A;  2I7K A;  5BT3 A;  5I1Q A;  5EWD A;  5EV9 A;  3HMH A;  5CUB A;  4UIW A;  5ENH A;  5C8G A;  4QST A;  5ETD A;  5CRM A;  5IGM A;  4O7E A;  5E73 A;  5L98 A;  4O7F A;  2H60 A;  5E3D A;  4QSQ A;  3SVF A;  4YYJ A;  4QEW A;  4QC3 A;  5DYX A;  5D3L A;  5D3S A;  3UV2 A;  4YYD A;  5C4Q A;  5IGN A;  5I80 A;  4TS8 A;  3GG3 A;  4KV1 A;  5CRZ A;  5FG6 A;  5G4S A;  4TTE A;  4QYD A;  5EPS A;  5E3G A;  4TU6 A;  5FE2 A;  1JSP B;  2MJV B;  5AD2 A;  5EWC A;  5DFD A;  2OSS A;  5HEM A;  5ENF A;  4O74 A;  4QSW A;  3O37 A;  5ENB A;  4A9M A;  4NUE A;  5LKX A;  4IOO A;  2YYN A;  3RCW A;  1WUG A;  5HQ7 A;  3U5M A;  5DFB A;  5LUU A;  3UVX A;  5D25 A;  5EP7 A;  4O78 A;  4HBV A;  3U5O A;  5CQT A;  4A9O A;  4TYL A;  3P1E A;  3O36 A;  4NRA A;  5E9L A;  5CQ8 A;  3U5L A;  4XY9 A;  4NQM A;  4IR5 A;  5IID A;  5C87 A;  5EQ1 A;  4LZS A;  3LXJ A;  5G4R A;  5H1T A;  3MUK A;  4HXM A;  3JVK A;  5CUC A;  2N9G A;  5A85 A;  5E9K A;  3UVD A;  4MEO A;  2R0S A;  4O72 A;  2E3K A;  2RI7 A;  4MEQ A;  1X0J A;  5I88 A;  4UYD A;  4HXN A;  5DYA A;  4Z1S A;  4MR5 A;  4ALG A;  5K29 A;  5F62 A;  5FFW A;  4C67 A;  2R0V A;  3ZYU A;  3Q2E A;  4AKN A;  4YH3 A;  3MB3 A;  5I7X A;  4CUS A;  4TQN A;  5A5R A;  5DLX A;  5FE5 A;  4DON A;  5E0R A;  5CU8 A;  4QR4 A;  4O75 A;  5DBM A;  5ENI A;  5ACY A;  4MEN A;  3LQI A;  3P1C A;  5II1 A;  1F68 A;  4CUQ A;  3O33 A;  5FFV A;  4HXR A;  3LJW A;  3P1D A;  4IR3 A;  5CQ3 A;  2OO1 A;  2YDW A;  3QZT A;  5ENJ A;  3MUL A;  5DX4 A;  5FE3 A;  4NQN A;  5DW1 A;  5JI8 A;  2RNY A;  5DLZ A;  3AAD A;  4WIV A;  5CQ7 A;  5LVR A;  2I8N A;  5CGP A;  3LQH A;  3Q2F A;  2GRC A;  4UYF B;  5LVQ A;  4HXL A;  4Z1Q A;  4YC9 A;  4CFL A;  5E74 A;  3AQA A;  4TU4 A;  5A83 A;  4PTB A;  4QZS A;  5CQ6 A;  5TB6 A;  4BW2 A;  5FE4 A;  5J0D A;  5KO4 A;  2L84 A;  5D3P A;  4YYK A;  4C66 A;  3QZS A;  4FLP A;  5TCM A;  5FG5 A;  3MXF A;  4QUT A;  4QC1 A;  5FH8 A;  5CP5 A;  4YAX A;  5HM0 A;  3SVH A;  4A9K A;  3JVJ A;  2DVQ A;  5I86 A;  5F25 A;  4UIU A;  4YBM A;  2WP2 A;  4QSP A;  4LRG A;  4YYH A;  4UIX A;  5FDZ A;  5DKC A;  5IG6 A;  5EU1 A;  4TZ8 A;  4MR6 A;  5HFR A;  5I29 A;  5C89 A;  3K2J A;  4O7C A;  4NR4 A;  3G0J A;  5CUD A;  3MQM A;  5AME A;  5CTL A;  5FE9 A;  3UW9 A;  4QEV A;  5L8T A;  4J3I A;  4UYG A;  4YYN A;  2L85 A;  1ZS5 A;  2DWW A;  2R10 A;  5FE7 A;  5ENG A;  5FH6 A;  2DVR A;  3DAI A;  4UIZ A;  4PY6 A;  4N4G A;  5EIC A;  4J0S A;  5II2 A;  4CLB A;  5L8U A;  2YW5 A;  4A9N A;  5BT4 A;  2R0Y A;  2DVS A;  5ENE A;  4ALH A;  4LR6 A;  4CUU A;  4Z6H A;  5A7C A;  2RS9 B;  4E96 A;  2WP1 A;  5D26 A;  5EPR A;  3SVG A;  4QUU A;  2F6J A;  3G0L A;  5CUG A;  5DW2 A;  5A5N A;  5E9I A;  4HBY A;  5LKT A;  3ONI A;  3UVW A;  4QY4 A;  5EGU A;  4A9J A;  4A9E A;  5LJ1 A;  2YEM A;  2KTB B;  3IU5 A;  4HBX A;  4QYL A;  4YYI A;  2F6N A;  4A9H A;  5EWH A;  5KU3 A;  4NS5 A;  2NXB A;  5LKZ A;  4PCI A;  5EVA A;  5EWV A;  2RFJ A;  4NYV A;  4WHU A;  4XYA A;  5F5Z A;  4Z6I A;  1E6I A;  5A82 A;  5DFC A;  4UYH A;  4QSU A;  5D3N A;  4QSS A;  4YYM A;  4NR9 A;  4UIT A;  5COI A;  3HMF A;  4CFK A;  4LZ2 A;  5E9V A;  4BHW A;  4NYW A;  4QR3 A;  5LJ2 A;  3NXB A;  5CFW A;  5HQ5 A;  5F61 A;  4PKL A;  3FKM X;  4CUT A;  5KHM A;  4LYS A;  4KV4 A;  4F3I A;  4O71 A;  4IOR A;  4YBS A;  1JM4 B;  5CQA A;  4YAD A;  5D3R A;  4PCE A;  5C7N A;  5KTX A;  4YY4 A;  4J1P A;  5H1U A;  4QSR A;  5I7Y A;  3UV4 A;  5JWM A;  5E9M A;  5L96 A;  5HRW A;  4QR5 A;  4A9I A;  4NR8 A;  2FSA A;  4OUF A;  3I3J A;  4YAB A;  2E7O A;  1N72 A;  4NRC A;  4NR7 A;  4NUC A;  5F60 A;  5DY7 A;  5D24 A;  5FB0 A;  5F2P A;  5LJ0 A;  4LZR A;  5L97 A;  5EM3 A;  5IBN A;  5FBX A;  2DVV A;  4IR6 A;  5F1H A;  4HXK A;  4HXS A;  4Z93 A;  3DWY A;  4LC2 A;  4XUB A;  5CUA A;  4NUD A;  4KCX A;  4O77 A;  5IGL A;  5I83 A;  4O7B A;  4HXP A;  4YH4 A;  4J0R A;  4OGJ A;  5F3A A;  3U5N A;  5CZG A;  4BW3 A;  4XY8 A;  3QZV A;  2L5E A;  3UV5 A;  5HRX A;  5HFQ A;  5DKH A;  5KTU A;  4QSV A;  4QBM A;  5DKD A;  5AD3 A;  3P1F A;  4O76 A;  3O35 A;  2D9E A;  5A5Q A;  5CQ5 A;  5I89 A;  3LQJ A;  5I40 A;  5H85 A;  5ETB A;  2G4A A;  4ZQL A;  5A81 A;  5IGK A;  5FG4 A;  5D3J A;  5BT5 A;  4TZ2 A;  4BJX A;  3D7C A;  4HBW A;  3TLP A;  4QSX A;  4MEP A;  5CPE A;  4O70 A;  4CL9 A;  5AMF A;  3S91 A;  5FE8 A;  3U5P A;  5FE1 A;  2DKW A;  2DAT A;  4YAT A;  3P5O A;  4GPJ A;  4MR3 A;  4TT4 A;  5HJC A;  4TT2 A;  5C85 A;  4PS5 A;  3S92 A;  4UIV A;  4BW4 A;  5CQ4 A;  4A9L A;  4UYF A;  3JVM A;  4Y03 A;  5EIS A;  5HLS A;  2E7N A;  4O7A A;  4HXO A;  4N3W A; 
#chains in the Genus database with same CATH topology
 2D82 A;  4CUR A;  4LYW A;  5EA1 A;  5EPB A;  3U5J A;  5EK9 A;  3O34 A;  3HME A;  5F36 A;  5A5P A;  4UYE A;  4N4F A;  4AKG A;  4NR5 A;  4Q0N A;  4QNS A;  4X2I A;  3MB4 A;  4A9F A;  5HRV A;  4N4H A;  4YYG A;  4YY6 A;  4Q0O A;  4BW1 A;  2RO1 A;  4NYX A;  5D7X A;  4LDF A;  1WUM A;  5H1V A;  4UIY A;  4CUP A;  2YEK A;  5CUE A;  5FE6 A;  5D0C A;  4RVR A;  2OUO A;  5D3T A;  5HCL A;  5LKU A;  4YK0 A;  5F63 A;  2EJN A;  5FFY A;  4OGI A;  4NRB A;  3U5K A;  5CY9 A;  5DYU A;  4N4I A;  1EQF A;  5FH7 A;  2RNW A;  4IR4 A;  5DYC A;  4ZW1 A;  3UVY A;  5E9Y A;  5A5O A;  5L99 A;  5KTW A;  2RNX A;  5EI4 A;  4LYI A;  4YBT A;  5HQ6 A;  3JVL A;  4IOQ A;  5HEN A;  5EWW A;  4MR4 A;  4TT6 A;  3IU6 A;  4XUA A;  4NR6 A;  5A5S A;  5FB1 A;  4NXJ A;  5ENC A;  4QB3 A;  5CS8 A;  2LSP B;  2YQD A;  4WHW A;  5F1L A;  5FE0 A;  4ZC9 A;  4QEU A;  2YEL A;  5E7D A;  5HEL A;  5D3H A;  2I7K A;  5BT3 A;  5I1Q A;  5EWD A;  5EV9 A;  3HMH A;  5CUB A;  4UIW A;  5ENH A;  5C8G A;  4QST A;  5ETD A;  5CRM A;  5IGM A;  4O7E A;  5E73 A;  5L98 A;  4O7F A;  2H60 A;  5E3D A;  4QSQ A;  3SVF A;  4YYJ A;  4QEW A;  4QC3 A;  5DYX A;  5D3L A;  5D3S A;  3UV2 A;  4YYD A;  5C4Q A;  5IGN A;  5I80 A;  4TS8 A;  3GG3 A;  4KV1 A;  4AKH A;  5CRZ A;  5FG6 A;  5G4S A;  4TTE A;  4QYD A;  5EPS A;  5E3G A;  4TU6 A;  5FE2 A;  1JSP B;  2MJV B;  5AD2 A;  5EWC A;  5DFD A;  2OSS A;  5HEM A;  5ENF A;  4O74 A;  4QSW A;  3O37 A;  5ENB A;  4A9M A;  4NUE A;  5LKX A;  4IOO A;  2YYN A;  3RCW A;  1WUG A;  5HQ7 A;  3U5M A;  5DFB A;  5LUU A;  3UVX A;  5D25 A;  5EP7 A;  4O78 A;  4HBV A;  3U5O A;  5CQT A;  4A9O A;  4TYL A;  3P1E A;  3O36 A;  4NRA A;  5E9L A;  5CQ8 A;  3U5L A;  4XY9 A;  4NQM A;  4IR5 A;  5IID A;  5C87 A;  5EQ1 A;  4LZS A;  3LXJ A;  5G4R A;  5H1T A;  3MUK A;  4HXM A;  3JVK A;  5CUC A;  2N9G A;  5A85 A;  5E9K A;  3UVD A;  4MEO A;  2R0S A;  4O72 A;  4AKI A;  2E3K A;  2RI7 A;  4MEQ A;  1X0J A;  5I88 A;  4UYD A;  4HXN A;  5DYA A;  4Z1S A;  4MR5 A;  4ALG A;  5K29 A;  5F62 A;  5FFW A;  4C67 A;  2R0V A;  3ZYU A;  3Q2E A;  4AKN A;  4YH3 A;  3MB3 A;  5I7X A;  4CUS A;  4TQN A;  5A5R A;  5DLX A;  5FE5 A;  4DON A;  5E0R A;  5CU8 A;  4QR4 A;  4O75 A;  5DBM A;  5ENI A;  5ACY A;  4MEN A;  3LQI A;  3P1C A;  5II1 A;  1F68 A;  4CUQ A;  3O33 A;  5FFV A;  4HXR A;  3LJW A;  3P1D A;  4IR3 A;  5CQ3 A;  2OO1 A;  2YDW A;  3QZT A;  3VKG A;  5ENJ A;  3MUL A;  5DX4 A;  5FE3 A;  4NQN A;  5DW1 A;  5JI8 A;  2RNY A;  5DLZ A;  3AAD A;  4WIV A;  1ZKR A;  5CQ7 A;  5LVR A;  2I8N A;  5CGP A;  3LQH A;  3Q2F A;  2GRC A;  4UYF B;  5LVQ A;  4HXL A;  3VKH A;  4Z1Q A;  4YC9 A;  4CFL A;  5E74 A;  3AQA A;  4TU4 A;  5A83 A;  4PTB A;  4QZS A;  5CQ6 A;  5TB6 A;  4BW2 A;  5FE4 A;  5J0D A;  5KO4 A;  2L84 A;  5D3P A;  4YYK A;  4C66 A;  3QZS A;  4FLP A;  5TCM A;  5FG5 A;  3MXF A;  4QUT A;  4QC1 A;  5FH8 A;  5CP5 A;  4YAX A;  5HM0 A;  3SVH A;  4A9K A;  3JVJ A;  2DVQ A;  5I86 A;  5F25 A;  4UIU A;  4YBM A;  2WP2 A;  4QSP A;  4LRG A;  4YYH A;  4UIX A;  5FDZ A;  5DKC A;  5IG6 A;  5EU1 A;  4TZ8 A;  4MR6 A;  5HFR A;  5I29 A;  5C89 A;  3K2J A;  4O7C A;  4NR4 A;  3G0J A;  5CUD A;  3MQM A;  5AME A;  5CTL A;  5FE9 A;  3UW9 A;  4QEV A;  5L8T A;  4J3I A;  4UYG A;  4YYN A;  2L85 A;  1ZS5 A;  2DWW A;  2R10 A;  5FE7 A;  5ENG A;  5FH6 A;  2DVR A;  3DAI A;  4UIZ A;  4PY6 A;  4N4G A;  5EIC A;  4J0S A;  5II2 A;  4CLB A;  5L8U A;  2YW5 A;  4A9N A;  4AI6 A;  5BT4 A;  2R0Y A;  2DVS A;  5ENE A;  4ALH A;  4LR6 A;  4CUU A;  4Z6H A;  5A7C A;  2RS9 B;  4E96 A;  2WP1 A;  5D26 A;  5EPR A;  3SVG A;  4QUU A;  2F6J A;  3G0L A;  5CUG A;  5DW2 A;  5A5N A;  5E9I A;  4HBY A;  5LKT A;  3ONI A;  3UVW A;  4QY4 A;  5EGU A;  4A9J A;  4A9E A;  5LJ1 A;  2YEM A;  2KTB B;  3IU5 A;  4HBX A;  4QYL A;  4YYI A;  2F6N A;  4A9H A;  5EWH A;  5KU3 A;  4NS5 A;  2NXB A;  5LKZ A;  4PCI A;  5EVA A;  5EWV A;  2RFJ A;  4NYV A;  4WHU A;  4XYA A;  5F5Z A;  4Z6I A;  1E6I A;  5A82 A;  4UYH A;  5DFC A;  4QSU A;  5D3N A;  4QSS A;  4YYM A;  4NR9 A;  4UIT A;  5COI A;  3HMF A;  4CFK A;  4LZ2 A;  5E9V A;  4BHW A;  4NYW A;  4QR3 A;  5LJ2 A;  3NXB A;  5CFW A;  5HQ5 A;  5F61 A;  4PKL A;  3FKM X;  4CUT A;  5KHM A;  4LYS A;  4KV4 A;  4F3I A;  4O71 A;  4IOR A;  4YBS A;  1JM4 B;  5CQA A;  4YAD A;  3D1B A;  5D3R A;  4PCE A;  5C7N A;  5KTX A;  4YY4 A;  4J1P A;  5H1U A;  4QSR A;  5I7Y A;  3UV4 A;  5JWM A;  5E9M A;  5L96 A;  5HRW A;  4QR5 A;  4A9I A;  4NR8 A;  2FSA A;  4OUF A;  3I3J A;  4YAB A;  2E7O A;  1N72 A;  4NRC A;  4NR7 A;  4NUC A;  5F60 A;  5DY7 A;  3ERR A;  5D24 A;  5FB0 A;  5F2P A;  5LJ0 A;  4LZR A;  5L97 A;  5EM3 A;  5IBN A;  5FBX A;  2DVV A;  4IR6 A;  5F1H A;  4HXK A;  4HXS A;  4Z93 A;  3DWY A;  4LC2 A;  4XUB A;  5CUA A;  4NUD A;  4KCX A;  4O77 A;  5IGL A;  5I83 A;  4O7B A;  4HXP A;  4YH4 A;  4J0R A;  4OGJ A;  5F3A A;  3U5N A;  5CZG A;  4BW3 A;  4XY8 A;  3QZV A;  2L5E A;  3UV5 A;  5HRX A;  5HFQ A;  5DKH A;  5KTU A;  4QSV A;  4QBM A;  5DKD A;  5AD3 A;  3P1F A;  4O76 A;  3O35 A;  2D9E A;  5A5Q A;  5CQ5 A;  5I89 A;  3LQJ A;  5I40 A;  5H85 A;  5ETB A;  2G4A A;  4ZQL A;  5A81 A;  5IGK A;  5FG4 A;  5D3J A;  5BT5 A;  4TZ2 A;  4BJX A;  3D7C A;  4HBW A;  3TLP A;  4QSX A;  4MEP A;  3D1D A;  5CPE A;  4O70 A;  4CL9 A;  5AMF A;  3S91 A;  5FE8 A;  3U5P A;  5FE1 A;  2DKW A;  2DAT A;  4YAT A;  3P5O A;  1PUO A;  4GPJ A;  4MR3 A;  4TT4 A;  5HJC A;  4TT2 A;  5C85 A;  4PS5 A;  3S92 A;  4UIV A;  4BW4 A;  5CQ4 A;  4A9L A;  4UYF A;  3JVM A;  4Y03 A;  5EIS A;  5HLS A;  2E7N A;  4O7A A;  4HXO A;  4N3W A; 
#chains in the Genus database with same CATH homology
 2D82 A;  4CUR A;  4LYW A;  5EA1 A;  5EPB A;  3U5J A;  5EK9 A;  3O34 A;  3HME A;  5F36 A;  5A5P A;  4UYE A;  4N4F A;  4NR5 A;  4Q0N A;  4QNS A;  4X2I A;  3MB4 A;  4A9F A;  5HRV A;  4N4H A;  4YYG A;  4YY6 A;  4Q0O A;  4BW1 A;  2RO1 A;  4NYX A;  5D7X A;  4LDF A;  1WUM A;  5H1V A;  4UIY A;  4CUP A;  2YEK A;  5CUE A;  5FE6 A;  5D0C A;  4RVR A;  2OUO A;  5D3T A;  5HCL A;  5LKU A;  4YK0 A;  5F63 A;  5FFY A;  4OGI A;  4NRB A;  3U5K A;  5CY9 A;  5DYU A;  4N4I A;  1EQF A;  5FH7 A;  2RNW A;  4IR4 A;  5DYC A;  4ZW1 A;  3UVY A;  5E9Y A;  5A5O A;  5L99 A;  5KTW A;  2RNX A;  5EI4 A;  4LYI A;  4YBT A;  5HQ6 A;  3JVL A;  4IOQ A;  5HEN A;  5EWW A;  4MR4 A;  4TT6 A;  3IU6 A;  4XUA A;  4NR6 A;  5A5S A;  5FB1 A;  4NXJ A;  5ENC A;  4QB3 A;  5CS8 A;  2LSP B;  2YQD A;  4WHW A;  5F1L A;  5FE0 A;  4ZC9 A;  4QEU A;  2YEL A;  5E7D A;  5HEL A;  5D3H A;  2I7K A;  5BT3 A;  5I1Q A;  5EWD A;  5EV9 A;  3HMH A;  5CUB A;  4UIW A;  5ENH A;  5C8G A;  4QST A;  5ETD A;  5CRM A;  5IGM A;  4O7E A;  5E73 A;  5L98 A;  4O7F A;  2H60 A;  5E3D A;  4QSQ A;  3SVF A;  4YYJ A;  4QEW A;  4QC3 A;  5DYX A;  5D3L A;  5D3S A;  3UV2 A;  4YYD A;  5C4Q A;  5IGN A;  5I80 A;  4TS8 A;  3GG3 A;  4KV1 A;  5CRZ A;  5FG6 A;  5G4S A;  4TTE A;  4QYD A;  5EPS A;  5E3G A;  4TU6 A;  5FE2 A;  1JSP B;  2MJV B;  5AD2 A;  5EWC A;  5DFD A;  2OSS A;  5HEM A;  5ENF A;  4O74 A;  4QSW A;  3O37 A;  5ENB A;  4A9M A;  4NUE A;  5LKX A;  4IOO A;  2YYN A;  3RCW A;  1WUG A;  5HQ7 A;  3U5M A;  5DFB A;  5LUU A;  3UVX A;  5D25 A;  5EP7 A;  4O78 A;  4HBV A;  3U5O A;  5CQT A;  4A9O A;  4TYL A;  3P1E A;  3O36 A;  4NRA A;  5E9L A;  5CQ8 A;  3U5L A;  4XY9 A;  4NQM A;  4IR5 A;  5IID A;  5C87 A;  5EQ1 A;  4LZS A;  3LXJ A;  5G4R A;  5H1T A;  3MUK A;  4HXM A;  3JVK A;  5CUC A;  2N9G A;  5A85 A;  5E9K A;  3UVD A;  4MEO A;  2R0S A;  4O72 A;  2E3K A;  2RI7 A;  4MEQ A;  1X0J A;  5I88 A;  4UYD A;  4HXN A;  5DYA A;  4Z1S A;  4MR5 A;  4ALG A;  5K29 A;  5F62 A;  5FFW A;  4C67 A;  2R0V A;  3ZYU A;  3Q2E A;  4AKN A;  4YH3 A;  3MB3 A;  5I7X A;  4CUS A;  4TQN A;  5A5R A;  5DLX A;  5FE5 A;  4DON A;  5E0R A;  5CU8 A;  4QR4 A;  4O75 A;  5DBM A;  5ENI A;  5ACY A;  4MEN A;  3LQI A;  3P1C A;  5II1 A;  1F68 A;  4CUQ A;  3O33 A;  5FFV A;  4HXR A;  3LJW A;  3P1D A;  4IR3 A;  5CQ3 A;  2OO1 A;  2YDW A;  3QZT A;  5ENJ A;  3MUL A;  5DX4 A;  5FE3 A;  4NQN A;  5DW1 A;  5JI8 A;  2RNY A;  5DLZ A;  3AAD A;  4WIV A;  5CQ7 A;  5LVR A;  2I8N A;  5CGP A;  3LQH A;  3Q2F A;  2GRC A;  4UYF B;  5LVQ A;  4HXL A;  4Z1Q A;  4YC9 A;  4CFL A;  5E74 A;  3AQA A;  4TU4 A;  5A83 A;  4PTB A;  4QZS A;  5CQ6 A;  5TB6 A;  4BW2 A;  5FE4 A;  5J0D A;  5KO4 A;  2L84 A;  5D3P A;  4YYK A;  4C66 A;  3QZS A;  4FLP A;  5TCM A;  5FG5 A;  3MXF A;  4QUT A;  4QC1 A;  5FH8 A;  5CP5 A;  4YAX A;  5HM0 A;  3SVH A;  4A9K A;  3JVJ A;  2DVQ A;  5I86 A;  5F25 A;  4UIU A;  4YBM A;  2WP2 A;  4QSP A;  4LRG A;  4YYH A;  4UIX A;  5FDZ A;  5DKC A;  5IG6 A;  5EU1 A;  4TZ8 A;  4MR6 A;  5HFR A;  5I29 A;  5C89 A;  3K2J A;  4O7C A;  4NR4 A;  3G0J A;  5CUD A;  3MQM A;  5AME A;  5CTL A;  5FE9 A;  3UW9 A;  4QEV A;  5L8T A;  4J3I A;  4UYG A;  4YYN A;  2L85 A;  1ZS5 A;  2DWW A;  2R10 A;  5FE7 A;  5ENG A;  5FH6 A;  2DVR A;  3DAI A;  4UIZ A;  4PY6 A;  4N4G A;  5EIC A;  4J0S A;  5II2 A;  4CLB A;  5L8U A;  2YW5 A;  4A9N A;  5BT4 A;  2R0Y A;  2DVS A;  5ENE A;  4ALH A;  4LR6 A;  4CUU A;  4Z6H A;  5A7C A;  2RS9 B;  4E96 A;  2WP1 A;  5D26 A;  5EPR A;  3SVG A;  4QUU A;  2F6J A;  3G0L A;  5CUG A;  5DW2 A;  5A5N A;  5E9I A;  4HBY A;  5LKT A;  3ONI A;  3UVW A;  4QY4 A;  5EGU A;  4A9J A;  4A9E A;  5LJ1 A;  2YEM A;  2KTB B;  3IU5 A;  4HBX A;  4QYL A;  4YYI A;  2F6N A;  4A9H A;  5EWH A;  5KU3 A;  4NS5 A;  2NXB A;  5LKZ A;  4PCI A;  5EVA A;  5EWV A;  2RFJ A;  4NYV A;  4WHU A;  4XYA A;  5F5Z A;  4Z6I A;  1E6I A;  5A82 A;  5DFC A;  4UYH A;  4QSU A;  5D3N A;  4QSS A;  4YYM A;  4NR9 A;  4UIT A;  5COI A;  3HMF A;  4CFK A;  4LZ2 A;  5E9V A;  4BHW A;  4NYW A;  4QR3 A;  5LJ2 A;  3NXB A;  5CFW A;  5HQ5 A;  5F61 A;  4PKL A;  3FKM X;  4CUT A;  5KHM A;  4LYS A;  4KV4 A;  4F3I A;  4O71 A;  4IOR A;  4YBS A;  1JM4 B;  5CQA A;  4YAD A;  5D3R A;  4PCE A;  5C7N A;  5KTX A;  4YY4 A;  4J1P A;  5H1U A;  4QSR A;  5I7Y A;  3UV4 A;  5JWM A;  5E9M A;  5L96 A;  5HRW A;  4QR5 A;  4A9I A;  4NR8 A;  2FSA A;  4OUF A;  3I3J A;  4YAB A;  2E7O A;  1N72 A;  4NRC A;  4NR7 A;  4NUC A;  5F60 A;  5DY7 A;  5D24 A;  5FB0 A;  5F2P A;  5LJ0 A;  4LZR A;  5L97 A;  5EM3 A;  5IBN A;  5FBX A;  2DVV A;  4IR6 A;  5F1H A;  4HXK A;  4HXS A;  4Z93 A;  3DWY A;  4LC2 A;  4XUB A;  5CUA A;  4NUD A;  4KCX A;  4O77 A;  5IGL A;  5I83 A;  4O7B A;  4HXP A;  4YH4 A;  4J0R A;  4OGJ A;  5F3A A;  3U5N A;  5CZG A;  4BW3 A;  4XY8 A;  3QZV A;  2L5E A;  3UV5 A;  5HRX A;  5HFQ A;  5DKH A;  5KTU A;  4QSV A;  4QBM A;  5DKD A;  5AD3 A;  3P1F A;  4O76 A;  3O35 A;  2D9E A;  5A5Q A;  5CQ5 A;  5I89 A;  3LQJ A;  5I40 A;  5H85 A;  5ETB A;  2G4A A;  4ZQL A;  5A81 A;  5IGK A;  5FG4 A;  5D3J A;  5BT5 A;  4TZ2 A;  4BJX A;  3D7C A;  4HBW A;  3TLP A;  4QSX A;  4MEP A;  5CPE A;  4O70 A;  4CL9 A;  5AMF A;  3S91 A;  5FE8 A;  3U5P A;  5FE1 A;  2DKW A;  2DAT A;  4YAT A;  3P5O A;  4GPJ A;  4MR3 A;  4TT4 A;  5HJC A;  4TT2 A;  5C85 A;  4PS5 A;  3S92 A;  4UIV A;  4BW4 A;  5CQ4 A;  4A9L A;  4UYF A;  3JVM A;  4Y03 A;  5EIS A;  5HLS A;  2E7N A;  4O7A A;  4HXO A;  4N3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...