4KCXA

Brdt in complex with dinaciclib
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
TNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain testis-specific protein
publication title Cyclin-dependent kinase inhibitor dinaciclib interacts with the acetyl-lysine recognition site of bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/inhibitor
total genus 38
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4kcxA01
4PS5A 5FE9A 5D3TA 5G4SA 4YADA 5EGUA 5DFCA 2RNYA 5HRWA 4YATA 4A9OA 3D7CA 5II2A 4YK0A 5HM0A 4OGJA 4IR4A 4OUFA 5CRZA 5CUGA 4QR4A 5D3RA 5DX4A 5I88A 5D25A 3TLPA 4MR4A 4NR5A 4TYLA 5EQ1A 5FH7A 4YYHA 3S92A 5I80A 4QSVA 5E9IA 2N9GA 4A9HA 5CUAA 3QZSA 4AKNA 5CQ4A 4QNSA 5CQ7A 4Z93A 5CU8A 2H60A 3U5OA 5ETBA 5EU1A 5FH8A 3UW9A 2FSAA 5CPEA 5FE5A 2OO1A 4YBTA 5CS8A 5AD3A 4J1PA 5FE0A 4CUPA 4IR5A 4KV1A 4HBWA 3LQJA 2E7OA 1N72A 4NUDA 4CUSA 5F63A 5J0DA 4YYGA 5DW2A 4CUQA 4J0RA 5A5SA 5HCLA 4NS5A 5I83A 5F3AA 5H1UA 5E0RA 3AQAA 4RVRA 3UV5A 4QR5A 2E7NA 5F25A 5EISA 5CUEA 4PTBA 5E73A 4C67A 4QZSA 4O7AA 4QYLA 5CQ6A 4UYGA 5F62A 2D9EA 5I29A 5F1HA 5LKZA 2YQDA 3SVHA 4A9NA 3G0LA 4LDFA 3O37A 5A82A 2YELA 5EI4A 2RS9B 2RNWA 4IOQA 5FE4A 4C66A 5CQAA 4CFKA 3P1FA 4LR6A 4A9FA 5E3DA 3Q2FA 4J3IA 5LJ2A 1X0JA 5FE1A 5DFBA 4UYFB 3LXJA 4TQNA 2F6JA 5EWWA 5L99A 3LJWA 2E3KA 4XY8A 5F1LA 5EM3A 3QZVA 5EWDA 4YYKA 4XUBA 4A9KA 3UVDA 5FE3A 5DBMA 5E74A 2YW5A 4QSUA 3FKMX 3SVFA 4A9MA 4LZRA 2I7KA 4ZC9A 4TZ8A 5FDZA 5BT3A 1JSPB 2R0YA 5IGLA 4HBYA 3P1DA 4NYWA 5KO4A 4XY9A 2KTBB 5EICA 5DYUA 4YYDA 5LKUA 4QEWA 3RCWA 2OSSA 5A83A 5AMFA 4QUUA 4UIVA 4O71A 4QY4A 4LZ2A 4A9JA 5H1VA 4A9IA 2WP2A 4TS8A 5L8TA 3U5MA 4NUCA 4O78A 4UIUA 1JM4B 4O7FA 5ENHA 5KU3A 5D3HA 4NRCA 4NR9A 5C8GA 1WUMA 3U5KA 5EPRA 5D3SA 4LYIA 5HLSA 2YEMA 4F3IA 1ZS5A 4N3WA 5LVRA 4ZQLA 5ENIA 4YABA 5H85A 5FH6A 5KTUA 4CL9A 3UVYA 2R0SA 3JVLA 2RI7A 5ENBA 4NQNA 5F5ZA 3HMEA 3U5LA 4CUUA 4O75A 5F36A 3SVGA 5FE8A 5EPSA 4UIWA 4WHWA 3UV4A 4NRBA 5ENJA 4QUTA 5ETDA 4CFLA 2DVRA 2NXBA 3O33A 5E9YA 5HELA 5A5NA 4TTEA 4BJXA 4CURA 4O77A 4UIXA 5HENA 4QC3A 4Z1SA 5EWHA 5EPBA 4YYNA 5HQ7A 4ALHA 3NXBA 5EWVA 4QYDA 4KV4A 4X2IA 5FE2A 2DATA 4HXPA 4N4FA 5CRMA 5FFYA 5CUBA 5CTLA 4QR3A 3QZTA 5C85A 2R0VA 2RNXA 4HXKA 5FFWA 5JWMA 3MB3A 2RO1A 4YBMA 4Z6IA 5FG6A 4O74A 4YAXA 5ENGA 5E9LA 1E6IA 3JVMA 5L97A 4Q0OA 5DKCA 4FLPA 4XYAA 5CGPA 5EK9A 4N4IA 4BW1A 2DWWA 4TU4A 5I40A 4IORA 2L5EA 4DONA 4O76A 3UV2A 4UYFA 2R10A 5A5PA 5HRVA 4QB3A 2YDWA 2WP1A 1WUGA 2YYNA 4GPJA 3ZYUA 2D82A 3LQIA 5A7CA 5G4RA 4PY6A 3Q2EA 4TU6A 4MR5A 4TT6A 5CQ5A 4LYSA 4Z6HA 4HXRA 4NYVA 4HXSA 4QSRA 5EA1A 5LJ0A 3UVXA 4HBVA 5CUCA 5HEMA 1F68A 4QSXA 5E7DA 5DW1A 5D0CA 5LKTA 1EQFA 4UYHA 3MQMA 5EV9A 5DYXA 4NRAA 5I1QA 4CLBA 4XUAA 5DFDA 4HXNA 4LYWA 4MEOA 4E96A 4UITA 4Y03A 4QSWA 2GRCA 5CZGA 4HXLA 4YY4A 5C87A 5EWCA 5FE7A 4NXJA 5CFWA 2DVVA 5ENEA 4YYMA 4Q0NA 4MR6A 3S91A 5A5QA 2OUOA 2L85A 4TT4A 4HXMA 5I89A 5HQ6A 2LSPB 5KTWA 4A9LA 4IOOA 4O7EA 4BW4A 3LQHA 4A9EA 5I7YA 3P1CA 3U5JA 4IR6A 5A5OA 5F61A 5HFRA 4ALGA 4MEQA 3GG3A 5FG4A 4N4GA 5DKDA 5AD2A 5E9MA 5DYCA 5KTXA 4MR3A 4Z1QA 5TCMA 3MXFA 5D7XA 5CQTA 4QC1A 5DLZA 5L96A 5C4QA 3U5NA 3O36A 5D24A 5ENFA 5FG5A 2L84A 3HMFA 3IU5A 5IGMA 3HMHA 5LVQA 2DVSA 4UYDA 5H1TA 5CQ8A 5E9VA 5DKHA 4NUEA 4QSPA 2G4AA 4NR4A 5L98A 4O72A 5IIDA 4NQMA 4O7BA 3MULA 5A5RA 4LZSA 5A81A 5EVAA 3I3JA 5D3NA 2I8NA 5IBNA 2DKWA 4NYXA 3JVKA 5C89A 4YH3A 4O70A 4YC9A 5JI8A 3U5PA 3P1EA 5KHMA 5EP7A 2YEKA 4TT2A 4OGIA 3MB4A 5HFQA 5CP5A 5I7XA 2F6NA 3G0JA 5LUUA 4YYJA 2MJVB 4MEPA 5TB6A 4N4HA 4NR8A 4YBSA 3DAIA 4IR3A 5DY7A 4ZW1A 5F2PA 5HRXA 4QSSA 2RFJA 4NR7A 5IGKA 5FB0A 4J0SA 4QEVA 5DYAA 5DLXA 3K2JA 4CUTA 5FB1A 4KCXA 4UIZA 5BT4A 5LKXA 4QEUA 5HQ5A 5E3GA 4YYIA 5AMEA 5FE6A 4NR6A 4O7CA 5D3JA 2DVQA 3P5OA 5K29A 4WHUA 5CQ3A 5IGNA 5F60A 4PCEA 5D3LA 4UIYA 5FFVA 4BHWA 4PKLA 5D26A 4QSTA 5COIA 3O35A 5CUDA 5II1A 3AADA 3MUKA 5CY9A 5HJCA 5I86A 5LJ1A 4TZ2A 5E9KA 5D3PA 5IG6A 4YY6A 4PCIA 4UYEA 5ACYA 4BW2A 5L8UA 5C7NA 5A85A 4QSQA 5FBXA 4MENA 4BW3A 4LC2A 3JVJA 3ONIA 3DWYA 3UVWA 5ENCA 4QBMA 3O34A 4LRGA 4YH4A 4HBXA 4HXOA 3IU6A 5BT5A 4WIVA
chains in the Genus database with same CATH superfamily
4PS5A 5FE9A 5D3TA 5G4SA 4YADA 4AKGA 5EGUA 3ERRA 5DFCA 2RNYA 5HRWA 4YATA 4A9OA 3D7CA 5II2A 4YK0A 5HM0A 4OGJA 4IR4A 4OUFA 5CRZA 5CUGA 4QR4A 5D3RA 5DX4A 5I88A 5D25A 3TLPA 4MR4A 4NR5A 4TYLA 5EQ1A 5FH7A 4YYHA 3S92A 5I80A 4QSVA 5E9IA 2N9GA 4A9HA 5CUAA 3QZSA 4AKNA 5CQ4A 4QNSA 5CQ7A 4Z93A 5CU8A 2H60A 3U5OA 5ETBA 5EU1A 5FH8A 3UW9A 2FSAA 5CPEA 5FE5A 2OO1A 4YBTA 5CS8A 5AD3A 4J1PA 5FE0A 4CUPA 4IR5A 4KV1A 4HBWA 3LQJA 2E7OA 1N72A 4NUDA 4CUSA 5F63A 5J0DA 4YYGA 5DW2A 4CUQA 4J0RA 5A5SA 5HCLA 4NS5A 5I83A 5F3AA 5H1UA 5E0RA 3AQAA 4RVRA 3UV5A 4QR5A 2E7NA 5F25A 5EISA 5CUEA 4PTBA 5E73A 4C67A 4QZSA 4O7AA 4QYLA 5CQ6A 4UYGA 5F62A 2D9EA 5I29A 5F1HA 5LKZA 2YQDA 3SVHA 4A9NA 3G0LA 4LDFA 3O37A 5A82A 2YELA 5EI4A 2RS9B 2RNWA 4IOQA 5FE4A 4C66A 5CQAA 4CFKA 3P1FA 4LR6A 4A9FA 5E3DA 3Q2FA 4J3IA 3VKGA 5LJ2A 1X0JA 5FE1A 5DFBA 4UYFB 3LXJA 4TQNA 2F6JA 5EWWA 5L99A 3LJWA 2E3KA 4XY8A 5F1LA 5EM3A 3QZVA 5EWDA 4YYKA 4XUBA 4A9KA 3UVDA 5FE3A 5DBMA 5E74A 2YW5A 4QSUA 3FKMX 3SVFA 4A9MA 4LZRA 2I7KA 4ZC9A 4TZ8A 5FDZA 5BT3A 1JSPB 2R0YA 5IGLA 4HBYA 3P1DA 4NYWA 5KO4A 4XY9A 2KTBB 5EICA 5DYUA 4YYDA 5LKUA 4QEWA 3RCWA 2OSSA 5A83A 5AMFA 4QUUA 4UIVA 4O71A 4QY4A 4LZ2A 4A9JA 4AKHA 5H1VA 4A9IA 2WP2A 4TS8A 5L8TA 3U5MA 4NUCA 4O78A 4UIUA 1JM4B 4O7FA 5ENHA 5KU3A 5D3HA 4NRCA 4NR9A 5C8GA 1WUMA 3U5KA 5EPRA 5D3SA 4LYIA 5HLSA 2YEMA 4F3IA 1ZS5A 4N3WA 5LVRA 4ZQLA 5ENIA 4YABA 5H85A 5FH6A 5KTUA 4CL9A 3UVYA 2R0SA 3JVLA 2RI7A 5ENBA 4NQNA 5F5ZA 3HMEA 3U5LA 4CUUA 4O75A 5F36A 3SVGA 5FE8A 5EPSA 4UIWA 4WHWA 3UV4A 4NRBA 5ENJA 4QUTA 5ETDA 4CFLA 2DVRA 2NXBA 3O33A 5E9YA 5HELA 5A5NA 4TTEA 4BJXA 4CURA 4O77A 4UIXA 5HENA 4QC3A 4Z1SA 5EWHA 5EPBA 4YYNA 3VKHA 5HQ7A 4ALHA 3NXBA 5EWVA 4QYDA 4KV4A 4X2IA 5FE2A 2DATA 4HXPA 4N4FA 5CRMA 5FFYA 5CUBA 5CTLA 4QR3A 3QZTA 5C85A 2R0VA 2RNXA 4HXKA 5FFWA 5JWMA 3MB3A 2RO1A 4YBMA 4Z6IA 5FG6A 4O74A 4YAXA 5ENGA 5E9LA 1E6IA 3JVMA 5L97A 4Q0OA 5DKCA 4FLPA 4XYAA 5CGPA 5EK9A 4N4IA 4BW1A 2DWWA 4TU4A 5I40A 4IORA 2L5EA 4DONA 4O76A 3UV2A 3D1DA 4UYFA 2R10A 5A5PA 5HRVA 4QB3A 2YDWA 2WP1A 1WUGA 2YYNA 4GPJA 3ZYUA 2D82A 3LQIA 5A7CA 5G4RA 4PY6A 4AKIA 3Q2EA 4TU6A 4MR5A 4TT6A 5CQ5A 4LYSA 4Z6HA 4HXRA 4NYVA 4HXSA 4QSRA 5EA1A 5LJ0A 3UVXA 4HBVA 5CUCA 5HEMA 1F68A 4QSXA 5E7DA 5DW1A 5D0CA 5LKTA 1EQFA 4UYHA 3MQMA 5EV9A 5DYXA 4NRAA 5I1QA 4CLBA 4XUAA 5DFDA 4HXNA 4LYWA 4MEOA 4E96A 4UITA 4Y03A 4QSWA 2GRCA 5CZGA 4HXLA 4YY4A 5C87A 1ZKRA 5EWCA 5FE7A 4NXJA 5CFWA 2DVVA 5ENEA 4YYMA 4Q0NA 4MR6A 3S91A 5A5QA 2OUOA 2L85A 4TT4A 4HXMA 5I89A 5HQ6A 2LSPB 5KTWA 4A9LA 4IOOA 4O7EA 4BW4A 3LQHA 4A9EA 5I7YA 3P1CA 3U5JA 4IR6A 5A5OA 5F61A 5HFRA 4ALGA 4MEQA 3GG3A 5FG4A 4N4GA 5DKDA 5AD2A 5E9MA 5DYCA 5KTXA 4MR3A 4Z1QA 5TCMA 3MXFA 5D7XA 2EJNA 5CQTA 4QC1A 5DLZA 5L96A 4AI6A 5C4QA 3U5NA 3O36A 5D24A 5ENFA 5FG5A 2L84A 3HMFA 3IU5A 5IGMA 3HMHA 5LVQA 2DVSA 4UYDA 5H1TA 5CQ8A 5E9VA 5DKHA 4NUEA 4QSPA 1PUOA 2G4AA 4NR4A 5L98A 4O72A 5IIDA 4NQMA 4O7BA 3MULA 5A5RA 4LZSA 5A81A 5EVAA 3I3JA 5D3NA 2I8NA 5IBNA 2DKWA 4NYXA 3JVKA 5C89A 4YH3A 4O70A 4YC9A 5JI8A 3U5PA 3P1EA 5KHMA 5EP7A 2YEKA 4TT2A 4OGIA 3MB4A 5HFQA 5CP5A 5I7XA 2F6NA 3G0JA 5LUUA 4YYJA 2MJVB 4MEPA 5TB6A 4N4HA 4NR8A 4YBSA 3DAIA 4IR3A 5DY7A 4ZW1A 5F2PA 5HRXA 4QSSA 2RFJA 4NR7A 5IGKA 5FB0A 4J0SA 4QEVA 5DYAA 5DLXA 3K2JA 4CUTA 5FB1A 4KCXA 4UIZA 5BT4A 5LKXA 4QEUA 5HQ5A 5E3GA 4YYIA 5AMEA 5FE6A 4NR6A 4O7CA 5D3JA 2DVQA 3P5OA 5K29A 4WHUA 5CQ3A 5IGNA 5F60A 4PCEA 5D3LA 4UIYA 5FFVA 4BHWA 4PKLA 5D26A 4QSTA 5COIA 3O35A 5CUDA 5II1A 3AADA 3MUKA 5CY9A 5HJCA 5I86A 5LJ1A 4TZ2A 5E9KA 3D1BA 5D3PA 5IG6A 4YY6A 4PCIA 4UYEA 5ACYA 4BW2A 5L8UA 5C7NA 5A85A 4QSQA 5FBXA 4MENA 4BW3A 4LC2A 3JVJA 3ONIA 3DWYA 3UVWA 5ENCA 4QBMA 3O34A 4LRGA 4YH4A 4HBXA 4HXOA 3IU6A 5BT5A 4WIVA
chains in the Genus database with same CATH topology
4PS5A 5FE9A 5D3TA 5G4SA 4YADA 5EGUA 5DFCA 2RNYA 5HRWA 4YATA 4A9OA 3D7CA 5II2A 4YK0A 5HM0A 4OGJA 4IR4A 4OUFA 5CRZA 5CUGA 4QR4A 5D3RA 5DX4A 5I88A 5D25A 3TLPA 4MR4A 4NR5A 4TYLA 5EQ1A 5FH7A 4YYHA 3S92A 5I80A 4QSVA 5E9IA 2N9GA 4A9HA 5CUAA 3QZSA 4AKNA 5CQ4A 4QNSA 5CQ7A 4Z93A 5CU8A 2H60A 3U5OA 5ETBA 5EU1A 5FH8A 3UW9A 2FSAA 5CPEA 5FE5A 2OO1A 4YBTA 5CS8A 5AD3A 4J1PA 5FE0A 4CUPA 4IR5A 4KV1A 4HBWA 3LQJA 2E7OA 1N72A 4NUDA 4CUSA 5F63A 5J0DA 4YYGA 5DW2A 4CUQA 4J0RA 5A5SA 5HCLA 4NS5A 5I83A 5F3AA 5H1UA 5E0RA 3AQAA 4RVRA 3UV5A 4QR5A 2E7NA 5F25A 5EISA 5CUEA 4PTBA 5E73A 4C67A 4QZSA 4O7AA 4QYLA 5CQ6A 4UYGA 5F62A 2D9EA 5I29A 5F1HA 5LKZA 2YQDA 3SVHA 4A9NA 3G0LA 4LDFA 3O37A 5A82A 2YELA 5EI4A 2RS9B 2RNWA 4IOQA 5FE4A 4C66A 5CQAA 4CFKA 3P1FA 4LR6A 4A9FA 5E3DA 3Q2FA 4J3IA 5LJ2A 1X0JA 5FE1A 5DFBA 4UYFB 3LXJA 4TQNA 2F6JA 5EWWA 5L99A 3LJWA 2E3KA 4XY8A 5F1LA 5EM3A 3QZVA 5EWDA 4YYKA 4XUBA 4A9KA 3UVDA 5FE3A 5DBMA 5E74A 2YW5A 4QSUA 3FKMX 3SVFA 4A9MA 4LZRA 2I7KA 4ZC9A 4TZ8A 5FDZA 5BT3A 1JSPB 2R0YA 5IGLA 4HBYA 3P1DA 4NYWA 5KO4A 4XY9A 2KTBB 5EICA 5DYUA 4YYDA 5LKUA 4QEWA 3RCWA 2OSSA 5A83A 5AMFA 4QUUA 4UIVA 4O71A 4QY4A 4LZ2A 4A9JA 5H1VA 4A9IA 2WP2A 4TS8A 5L8TA 3U5MA 4NUCA 4O78A 4UIUA 1JM4B 4O7FA 5ENHA 5KU3A 5D3HA 4NRCA 4NR9A 5C8GA 1WUMA 3U5KA 5EPRA 5D3SA 4LYIA 5HLSA 2YEMA 4F3IA 1ZS5A 4N3WA 5LVRA 4ZQLA 5ENIA 4YABA 5H85A 5FH6A 5KTUA 4CL9A 3UVYA 2R0SA 3JVLA 2RI7A 5ENBA 4NQNA 5F5ZA 3HMEA 3U5LA 4CUUA 4O75A 5F36A 3SVGA 5FE8A 5EPSA 4UIWA 4WHWA 3UV4A 4NRBA 5ENJA 4QUTA 5ETDA 4CFLA 2DVRA 2NXBA 3O33A 5E9YA 5HELA 5A5NA 4TTEA 4BJXA 4CURA 4O77A 4UIXA 5HENA 4QC3A 4Z1SA 5EWHA 5EPBA 4YYNA 5HQ7A 4ALHA 3NXBA 5EWVA 4QYDA 4KV4A 4X2IA 5FE2A 2DATA 4HXPA 4N4FA 5CRMA 5FFYA 5CUBA 5CTLA 4QR3A 3QZTA 5C85A 2R0VA 2RNXA 4HXKA 5FFWA 5JWMA 3MB3A 2RO1A 4YBMA 4Z6IA 5FG6A 4O74A 4YAXA 5ENGA 5E9LA 1E6IA 3JVMA 5L97A 4Q0OA 5DKCA 4FLPA 4XYAA 5CGPA 5EK9A 4N4IA 4BW1A 2DWWA 4TU4A 5I40A 4IORA 2L5EA 4DONA 4O76A 3UV2A 4UYFA 2R10A 5A5PA 5HRVA 4QB3A 2YDWA 2WP1A 1WUGA 2YYNA 4GPJA 3ZYUA 2D82A 3LQIA 5A7CA 5G4RA 4PY6A 3Q2EA 4TU6A 4MR5A 4TT6A 5CQ5A 4LYSA 4Z6HA 4HXRA 4NYVA 4HXSA 4QSRA 5EA1A 5LJ0A 3UVXA 4HBVA 5CUCA 5HEMA 1F68A 4QSXA 5E7DA 5DW1A 5D0CA 5LKTA 1EQFA 4UYHA 3MQMA 5EV9A 5DYXA 4NRAA 5I1QA 4CLBA 4XUAA 5DFDA 4HXNA 4LYWA 4MEOA 4E96A 4UITA 4Y03A 4QSWA 2GRCA 5CZGA 4HXLA 4YY4A 5C87A 5EWCA 5FE7A 4NXJA 5CFWA 2DVVA 5ENEA 4YYMA 4Q0NA 4MR6A 3S91A 5A5QA 2OUOA 2L85A 4TT4A 4HXMA 5I89A 5HQ6A 2LSPB 5KTWA 4A9LA 4IOOA 4O7EA 4BW4A 3LQHA 4A9EA 5I7YA 3P1CA 3U5JA 4IR6A 5A5OA 5F61A 5HFRA 4ALGA 4MEQA 3GG3A 5FG4A 4N4GA 5DKDA 5AD2A 5E9MA 5DYCA 5KTXA 4MR3A 4Z1QA 5TCMA 3MXFA 5D7XA 5CQTA 4QC1A 5DLZA 5L96A 5C4QA 3U5NA 3O36A 5D24A 5ENFA 5FG5A 2L84A 3HMFA 3IU5A 5IGMA 3HMHA 5LVQA 2DVSA 4UYDA 5H1TA 5CQ8A 5E9VA 5DKHA 4NUEA 4QSPA 2G4AA 4NR4A 5L98A 4O72A 5IIDA 4NQMA 4O7BA 3MULA 5A5RA 4LZSA 5A81A 5EVAA 3I3JA 5D3NA 2I8NA 5IBNA 2DKWA 4NYXA 3JVKA 5C89A 4YH3A 4O70A 4YC9A 5JI8A 3U5PA 3P1EA 5KHMA 5EP7A 2YEKA 4TT2A 4OGIA 3MB4A 5HFQA 5CP5A 5I7XA 2F6NA 3G0JA 5LUUA 4YYJA 2MJVB 4MEPA 5TB6A 4N4HA 4NR8A 4YBSA 3DAIA 4IR3A 5DY7A 4ZW1A 5F2PA 5HRXA 4QSSA 2RFJA 4NR7A 5IGKA 5FB0A 4J0SA 4QEVA 5DYAA 5DLXA 3K2JA 4CUTA 5FB1A 4KCXA 4UIZA 5BT4A 5LKXA 4QEUA 5HQ5A 5E3GA 4YYIA 5AMEA 5FE6A 4NR6A 4O7CA 5D3JA 2DVQA 3P5OA 5K29A 4WHUA 5CQ3A 5IGNA 5F60A 4PCEA 5D3LA 4UIYA 5FFVA 4BHWA 4PKLA 5D26A 4QSTA 5COIA 3O35A 5CUDA 5II1A 3AADA 3MUKA 5CY9A 5HJCA 5I86A 5LJ1A 4TZ2A 5E9KA 5D3PA 5IG6A 4YY6A 4PCIA 4UYEA 5ACYA 4BW2A 5L8UA 5C7NA 5A85A 4QSQA 5FBXA 4MENA 4BW3A 4LC2A 3JVJA 3ONIA 3DWYA 3UVWA 5ENCA 4QBMA 3O34A 4LRGA 4YH4A 4HBXA 4HXOA 3IU6A 5BT5A 4WIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PS5 A;  5FE9 A;  5D3T A;  5G4S A;  4YAD A;  5EGU A;  5DFC A;  2RNY A;  5HRW A;  4YAT A;  4A9O A;  3D7C A;  5II2 A;  4YK0 A;  5HM0 A;  4OGJ A;  4IR4 A;  4OUF A;  5CRZ A;  5CUG A;  4QR4 A;  5D3R A;  5DX4 A;  5I88 A;  5D25 A;  3TLP A;  4MR4 A;  4NR5 A;  4TYL A;  5EQ1 A;  5FH7 A;  4YYH A;  3S92 A;  5I80 A;  4QSV A;  5E9I A;  2N9G A;  4A9H A;  5CUA A;  3QZS A;  4AKN A;  5CQ4 A;  4QNS A;  5CQ7 A;  4Z93 A;  5CU8 A;  2H60 A;  3U5O A;  5ETB A;  5EU1 A;  5FH8 A;  3UW9 A;  2FSA A;  5CPE A;  5FE5 A;  2OO1 A;  4YBT A;  5CS8 A;  5AD3 A;  4J1P A;  5FE0 A;  4CUP A;  4IR5 A;  4KV1 A;  4HBW A;  3LQJ A;  2E7O A;  1N72 A;  4NUD A;  4CUS A;  5F63 A;  5J0D A;  4YYG A;  5DW2 A;  4CUQ A;  4J0R A;  5A5S A;  5HCL A;  4NS5 A;  5I83 A;  5F3A A;  5H1U A;  5E0R A;  3AQA A;  4RVR A;  3UV5 A;  4QR5 A;  2E7N A;  5F25 A;  5EIS A;  5CUE A;  4PTB A;  5E73 A;  4C67 A;  4QZS A;  4O7A A;  4QYL A;  5CQ6 A;  4UYG A;  5F62 A;  2D9E A;  5I29 A;  5F1H A;  5LKZ A;  2YQD A;  3SVH A;  4A9N A;  3G0L A;  4LDF A;  3O37 A;  5A82 A;  2YEL A;  5EI4 A;  2RS9 B;  2RNW A;  4IOQ A;  5FE4 A;  4C66 A;  5CQA A;  4CFK A;  3P1F A;  4LR6 A;  4A9F A;  5E3D A;  3Q2F A;  4J3I A;  5LJ2 A;  1X0J A;  5FE1 A;  5DFB A;  4UYF B;  3LXJ A;  4TQN A;  2F6J A;  5EWW A;  5L99 A;  3LJW A;  2E3K A;  4XY8 A;  5F1L A;  5EM3 A;  3QZV A;  5EWD A;  4YYK A;  4XUB A;  4A9K A;  3UVD A;  5FE3 A;  5DBM A;  5E74 A;  2YW5 A;  4QSU A;  3FKM X;  3SVF A;  4A9M A;  4LZR A;  2I7K A;  4ZC9 A;  4TZ8 A;  5FDZ A;  5BT3 A;  1JSP B;  2R0Y A;  5IGL A;  4HBY A;  3P1D A;  4NYW A;  5KO4 A;  4XY9 A;  2KTB B;  5EIC A;  5DYU A;  4YYD A;  5LKU A;  4QEW A;  3RCW A;  2OSS A;  5A83 A;  5AMF A;  4QUU A;  4UIV A;  4O71 A;  4QY4 A;  4LZ2 A;  4A9J A;  5H1V A;  4A9I A;  2WP2 A;  4TS8 A;  5L8T A;  3U5M A;  4NUC A;  4O78 A;  4UIU A;  1JM4 B;  4O7F A;  5ENH A;  5KU3 A;  5D3H A;  4NRC A;  4NR9 A;  5C8G A;  1WUM A;  3U5K A;  5EPR A;  5D3S A;  4LYI A;  5HLS A;  2YEM A;  4F3I A;  1ZS5 A;  4N3W A;  5LVR A;  4ZQL A;  5ENI A;  4YAB A;  5H85 A;  5FH6 A;  5KTU A;  4CL9 A;  3UVY A;  2R0S A;  3JVL A;  2RI7 A;  5ENB A;  4NQN A;  5F5Z A;  3HME A;  3U5L A;  4CUU A;  4O75 A;  5F36 A;  3SVG A;  5FE8 A;  5EPS A;  4UIW A;  4WHW A;  3UV4 A;  4NRB A;  5ENJ A;  4QUT A;  5ETD A;  4CFL A;  2DVR A;  2NXB A;  3O33 A;  5E9Y A;  5HEL A;  5A5N A;  4TTE A;  4BJX A;  4CUR A;  4O77 A;  4UIX A;  5HEN A;  4QC3 A;  4Z1S A;  5EWH A;  5EPB A;  4YYN A;  5HQ7 A;  4ALH A;  3NXB A;  5EWV A;  4QYD A;  4KV4 A;  4X2I A;  5FE2 A;  2DAT A;  4HXP A;  4N4F A;  5CRM A;  5FFY A;  5CUB A;  5CTL A;  4QR3 A;  3QZT A;  5C85 A;  2R0V A;  2RNX A;  4HXK A;  5FFW A;  5JWM A;  3MB3 A;  2RO1 A;  4YBM A;  4Z6I A;  5FG6 A;  4O74 A;  4YAX A;  5ENG A;  5E9L A;  1E6I A;  3JVM A;  5L97 A;  4Q0O A;  5DKC A;  4FLP A;  4XYA A;  5CGP A;  5EK9 A;  4N4I A;  4BW1 A;  2DWW A;  4TU4 A;  5I40 A;  4IOR A;  2L5E A;  4DON A;  4O76 A;  3UV2 A;  4UYF A;  2R10 A;  5A5P A;  5HRV A;  4QB3 A;  2YDW A;  2WP1 A;  1WUG A;  2YYN A;  4GPJ A;  3ZYU A;  2D82 A;  3LQI A;  5A7C A;  5G4R A;  4PY6 A;  3Q2E A;  4TU6 A;  4MR5 A;  4TT6 A;  5CQ5 A;  4LYS A;  4Z6H A;  4HXR A;  4NYV A;  4HXS A;  4QSR A;  5EA1 A;  5LJ0 A;  3UVX A;  4HBV A;  5CUC A;  5HEM A;  1F68 A;  4QSX A;  5E7D A;  5DW1 A;  5D0C A;  5LKT A;  1EQF A;  4UYH A;  3MQM A;  5EV9 A;  5DYX A;  4NRA A;  5I1Q A;  4CLB A;  4XUA A;  5DFD A;  4HXN A;  4LYW A;  4MEO A;  4E96 A;  4UIT A;  4Y03 A;  4QSW A;  2GRC A;  5CZG A;  4HXL A;  4YY4 A;  5C87 A;  5EWC A;  5FE7 A;  4NXJ A;  5CFW A;  2DVV A;  5ENE A;  4YYM A;  4Q0N A;  4MR6 A;  3S91 A;  5A5Q A;  2OUO A;  2L85 A;  4TT4 A;  4HXM A;  5I89 A;  5HQ6 A;  2LSP B;  5KTW A;  4A9L A;  4IOO A;  4O7E A;  4BW4 A;  3LQH A;  4A9E A;  5I7Y A;  3P1C A;  3U5J A;  4IR6 A;  5A5O A;  5F61 A;  5HFR A;  4ALG A;  4MEQ A;  3GG3 A;  5FG4 A;  4N4G A;  5DKD A;  5AD2 A;  5E9M A;  5DYC A;  5KTX A;  4MR3 A;  4Z1Q A;  5TCM A;  3MXF A;  5D7X A;  5CQT A;  4QC1 A;  5DLZ A;  5L96 A;  5C4Q A;  3U5N A;  3O36 A;  5D24 A;  5ENF A;  5FG5 A;  2L84 A;  3HMF A;  3IU5 A;  5IGM A;  3HMH A;  5LVQ A;  2DVS A;  4UYD A;  5H1T A;  5CQ8 A;  5E9V A;  5DKH A;  4NUE A;  4QSP A;  2G4A A;  4NR4 A;  5L98 A;  4O72 A;  5IID A;  4NQM A;  4O7B A;  3MUL A;  5A5R A;  4LZS A;  5A81 A;  5EVA A;  3I3J A;  5D3N A;  2I8N A;  5IBN A;  2DKW A;  4NYX A;  3JVK A;  5C89 A;  4YH3 A;  4O70 A;  4YC9 A;  5JI8 A;  3U5P A;  3P1E A;  5KHM A;  5EP7 A;  2YEK A;  4TT2 A;  4OGI A;  3MB4 A;  5HFQ A;  5CP5 A;  5I7X A;  2F6N A;  3G0J A;  5LUU A;  4YYJ A;  2MJV B;  4MEP A;  5TB6 A;  4N4H A;  4NR8 A;  4YBS A;  3DAI A;  4IR3 A;  5DY7 A;  4ZW1 A;  5F2P A;  5HRX A;  4QSS A;  2RFJ A;  4NR7 A;  5IGK A;  5FB0 A;  4J0S A;  4QEV A;  5DYA A;  5DLX A;  3K2J A;  4CUT A;  5FB1 A;  4KCX A;  4UIZ A;  5BT4 A;  5LKX A;  4QEU A;  5HQ5 A;  5E3G A;  4YYI A;  5AME A;  5FE6 A;  4NR6 A;  4O7C A;  5D3J A;  2DVQ A;  3P5O A;  5K29 A;  4WHU A;  5CQ3 A;  5IGN A;  5F60 A;  4PCE A;  5D3L A;  4UIY A;  5FFV A;  4BHW A;  4PKL A;  5D26 A;  4QST A;  5COI A;  3O35 A;  5CUD A;  5II1 A;  3AAD A;  3MUK A;  5CY9 A;  5HJC A;  5I86 A;  5LJ1 A;  4TZ2 A;  5E9K A;  5D3P A;  5IG6 A;  4YY6 A;  4PCI A;  4UYE A;  5ACY A;  4BW2 A;  5L8U A;  5C7N A;  5A85 A;  4QSQ A;  5FBX A;  4MEN A;  4BW3 A;  4LC2 A;  3JVJ A;  3ONI A;  3DWY A;  3UVW A;  5ENC A;  4QBM A;  3O34 A;  4LRG A;  4YH4 A;  4HBX A;  4HXO A;  3IU6 A;  5BT5 A;  4WIV A; 
#chains in the Genus database with same CATH topology
 4PS5 A;  5FE9 A;  5D3T A;  5G4S A;  4YAD A;  4AKG A;  5EGU A;  3ERR A;  5DFC A;  2RNY A;  5HRW A;  4YAT A;  4A9O A;  3D7C A;  5II2 A;  4YK0 A;  5HM0 A;  4OGJ A;  4IR4 A;  4OUF A;  5CRZ A;  5CUG A;  4QR4 A;  5D3R A;  5DX4 A;  5I88 A;  5D25 A;  3TLP A;  4MR4 A;  4NR5 A;  4TYL A;  5EQ1 A;  5FH7 A;  4YYH A;  3S92 A;  5I80 A;  4QSV A;  5E9I A;  2N9G A;  4A9H A;  5CUA A;  3QZS A;  4AKN A;  5CQ4 A;  4QNS A;  5CQ7 A;  4Z93 A;  5CU8 A;  2H60 A;  3U5O A;  5ETB A;  5EU1 A;  5FH8 A;  3UW9 A;  2FSA A;  5CPE A;  5FE5 A;  2OO1 A;  4YBT A;  5CS8 A;  5AD3 A;  4J1P A;  5FE0 A;  4CUP A;  4IR5 A;  4KV1 A;  4HBW A;  3LQJ A;  2E7O A;  1N72 A;  4NUD A;  4CUS A;  5F63 A;  5J0D A;  4YYG A;  5DW2 A;  4CUQ A;  4J0R A;  5A5S A;  5HCL A;  4NS5 A;  5I83 A;  5F3A A;  5H1U A;  5E0R A;  3AQA A;  4RVR A;  3UV5 A;  4QR5 A;  2E7N A;  5F25 A;  5EIS A;  5CUE A;  4PTB A;  5E73 A;  4C67 A;  4QZS A;  4O7A A;  4QYL A;  5CQ6 A;  4UYG A;  5F62 A;  2D9E A;  5I29 A;  5F1H A;  5LKZ A;  2YQD A;  3SVH A;  4A9N A;  3G0L A;  4LDF A;  3O37 A;  5A82 A;  2YEL A;  5EI4 A;  2RS9 B;  2RNW A;  4IOQ A;  5FE4 A;  4C66 A;  5CQA A;  4CFK A;  3P1F A;  4LR6 A;  4A9F A;  5E3D A;  3Q2F A;  4J3I A;  3VKG A;  5LJ2 A;  1X0J A;  5FE1 A;  5DFB A;  4UYF B;  3LXJ A;  4TQN A;  2F6J A;  5EWW A;  5L99 A;  3LJW A;  2E3K A;  4XY8 A;  5F1L A;  5EM3 A;  3QZV A;  5EWD A;  4YYK A;  4XUB A;  4A9K A;  3UVD A;  5FE3 A;  5DBM A;  5E74 A;  2YW5 A;  4QSU A;  3FKM X;  3SVF A;  4A9M A;  4LZR A;  2I7K A;  4ZC9 A;  4TZ8 A;  5FDZ A;  5BT3 A;  1JSP B;  2R0Y A;  5IGL A;  4HBY A;  3P1D A;  4NYW A;  5KO4 A;  4XY9 A;  2KTB B;  5EIC A;  5DYU A;  4YYD A;  5LKU A;  4QEW A;  3RCW A;  2OSS A;  5A83 A;  5AMF A;  4QUU A;  4UIV A;  4O71 A;  4QY4 A;  4LZ2 A;  4A9J A;  4AKH A;  5H1V A;  4A9I A;  2WP2 A;  4TS8 A;  5L8T A;  3U5M A;  4NUC A;  4O78 A;  4UIU A;  1JM4 B;  4O7F A;  5ENH A;  5KU3 A;  5D3H A;  4NRC A;  4NR9 A;  5C8G A;  1WUM A;  3U5K A;  5EPR A;  5D3S A;  4LYI A;  5HLS A;  2YEM A;  4F3I A;  1ZS5 A;  4N3W A;  5LVR A;  4ZQL A;  5ENI A;  4YAB A;  5H85 A;  5FH6 A;  5KTU A;  4CL9 A;  3UVY A;  2R0S A;  3JVL A;  2RI7 A;  5ENB A;  4NQN A;  5F5Z A;  3HME A;  3U5L A;  4CUU A;  4O75 A;  5F36 A;  3SVG A;  5FE8 A;  5EPS A;  4UIW A;  4WHW A;  3UV4 A;  4NRB A;  5ENJ A;  4QUT A;  5ETD A;  4CFL A;  2DVR A;  2NXB A;  3O33 A;  5E9Y A;  5HEL A;  5A5N A;  4TTE A;  4BJX A;  4CUR A;  4O77 A;  4UIX A;  5HEN A;  4QC3 A;  4Z1S A;  5EWH A;  5EPB A;  4YYN A;  3VKH A;  5HQ7 A;  4ALH A;  3NXB A;  5EWV A;  4QYD A;  4KV4 A;  4X2I A;  5FE2 A;  2DAT A;  4HXP A;  4N4F A;  5CRM A;  5FFY A;  5CUB A;  5CTL A;  4QR3 A;  3QZT A;  5C85 A;  2R0V A;  2RNX A;  4HXK A;  5FFW A;  5JWM A;  3MB3 A;  2RO1 A;  4YBM A;  4Z6I A;  5FG6 A;  4O74 A;  4YAX A;  5ENG A;  5E9L A;  1E6I A;  3JVM A;  5L97 A;  4Q0O A;  5DKC A;  4FLP A;  4XYA A;  5CGP A;  5EK9 A;  4N4I A;  4BW1 A;  2DWW A;  4TU4 A;  5I40 A;  4IOR A;  2L5E A;  4DON A;  4O76 A;  3UV2 A;  3D1D A;  4UYF A;  2R10 A;  5A5P A;  5HRV A;  4QB3 A;  2YDW A;  2WP1 A;  1WUG A;  2YYN A;  4GPJ A;  3ZYU A;  2D82 A;  3LQI A;  5A7C A;  5G4R A;  4PY6 A;  4AKI A;  3Q2E A;  4TU6 A;  4MR5 A;  4TT6 A;  5CQ5 A;  4LYS A;  4Z6H A;  4HXR A;  4NYV A;  4HXS A;  4QSR A;  5EA1 A;  5LJ0 A;  3UVX A;  4HBV A;  5CUC A;  5HEM A;  1F68 A;  4QSX A;  5E7D A;  5DW1 A;  5D0C A;  5LKT A;  1EQF A;  4UYH A;  3MQM A;  5EV9 A;  5DYX A;  4NRA A;  5I1Q A;  4CLB A;  4XUA A;  5DFD A;  4HXN A;  4LYW A;  4MEO A;  4E96 A;  4UIT A;  4Y03 A;  4QSW A;  2GRC A;  5CZG A;  4HXL A;  4YY4 A;  5C87 A;  1ZKR A;  5EWC A;  5FE7 A;  4NXJ A;  5CFW A;  2DVV A;  5ENE A;  4YYM A;  4Q0N A;  4MR6 A;  3S91 A;  5A5Q A;  2OUO A;  2L85 A;  4TT4 A;  4HXM A;  5I89 A;  5HQ6 A;  2LSP B;  5KTW A;  4A9L A;  4IOO A;  4O7E A;  4BW4 A;  3LQH A;  4A9E A;  5I7Y A;  3P1C A;  3U5J A;  4IR6 A;  5A5O A;  5F61 A;  5HFR A;  4ALG A;  4MEQ A;  3GG3 A;  5FG4 A;  4N4G A;  5DKD A;  5AD2 A;  5E9M A;  5DYC A;  5KTX A;  4MR3 A;  4Z1Q A;  5TCM A;  3MXF A;  5D7X A;  2EJN A;  5CQT A;  4QC1 A;  5DLZ A;  5L96 A;  4AI6 A;  5C4Q A;  3U5N A;  3O36 A;  5D24 A;  5ENF A;  5FG5 A;  2L84 A;  3HMF A;  3IU5 A;  5IGM A;  3HMH A;  5LVQ A;  2DVS A;  4UYD A;  5H1T A;  5CQ8 A;  5E9V A;  5DKH A;  4NUE A;  4QSP A;  1PUO A;  2G4A A;  4NR4 A;  5L98 A;  4O72 A;  5IID A;  4NQM A;  4O7B A;  3MUL A;  5A5R A;  4LZS A;  5A81 A;  5EVA A;  3I3J A;  5D3N A;  2I8N A;  5IBN A;  2DKW A;  4NYX A;  3JVK A;  5C89 A;  4YH3 A;  4O70 A;  4YC9 A;  5JI8 A;  3U5P A;  3P1E A;  5KHM A;  5EP7 A;  2YEK A;  4TT2 A;  4OGI A;  3MB4 A;  5HFQ A;  5CP5 A;  5I7X A;  2F6N A;  3G0J A;  5LUU A;  4YYJ A;  2MJV B;  4MEP A;  5TB6 A;  4N4H A;  4NR8 A;  4YBS A;  3DAI A;  4IR3 A;  5DY7 A;  4ZW1 A;  5F2P A;  5HRX A;  4QSS A;  2RFJ A;  4NR7 A;  5IGK A;  5FB0 A;  4J0S A;  4QEV A;  5DYA A;  5DLX A;  3K2J A;  4CUT A;  5FB1 A;  4KCX A;  4UIZ A;  5BT4 A;  5LKX A;  4QEU A;  5HQ5 A;  5E3G A;  4YYI A;  5AME A;  5FE6 A;  4NR6 A;  4O7C A;  5D3J A;  2DVQ A;  3P5O A;  5K29 A;  4WHU A;  5CQ3 A;  5IGN A;  5F60 A;  4PCE A;  5D3L A;  4UIY A;  5FFV A;  4BHW A;  4PKL A;  5D26 A;  4QST A;  5COI A;  3O35 A;  5CUD A;  5II1 A;  3AAD A;  3MUK A;  5CY9 A;  5HJC A;  5I86 A;  5LJ1 A;  4TZ2 A;  5E9K A;  3D1B A;  5D3P A;  5IG6 A;  4YY6 A;  4PCI A;  4UYE A;  5ACY A;  4BW2 A;  5L8U A;  5C7N A;  5A85 A;  4QSQ A;  5FBX A;  4MEN A;  4BW3 A;  4LC2 A;  3JVJ A;  3ONI A;  3DWY A;  3UVW A;  5ENC A;  4QBM A;  3O34 A;  4LRG A;  4YH4 A;  4HBX A;  4HXO A;  3IU6 A;  5BT5 A;  4WIV A; 
#chains in the Genus database with same CATH homology
 4PS5 A;  5FE9 A;  5D3T A;  5G4S A;  4YAD A;  5EGU A;  5DFC A;  2RNY A;  5HRW A;  4YAT A;  4A9O A;  3D7C A;  5II2 A;  4YK0 A;  5HM0 A;  4OGJ A;  4IR4 A;  4OUF A;  5CRZ A;  5CUG A;  4QR4 A;  5D3R A;  5DX4 A;  5I88 A;  5D25 A;  3TLP A;  4MR4 A;  4NR5 A;  4TYL A;  5EQ1 A;  5FH7 A;  4YYH A;  3S92 A;  5I80 A;  4QSV A;  5E9I A;  2N9G A;  4A9H A;  5CUA A;  3QZS A;  4AKN A;  5CQ4 A;  4QNS A;  5CQ7 A;  4Z93 A;  5CU8 A;  2H60 A;  3U5O A;  5ETB A;  5EU1 A;  5FH8 A;  3UW9 A;  2FSA A;  5CPE A;  5FE5 A;  2OO1 A;  4YBT A;  5CS8 A;  5AD3 A;  4J1P A;  5FE0 A;  4CUP A;  4IR5 A;  4KV1 A;  4HBW A;  3LQJ A;  2E7O A;  1N72 A;  4NUD A;  4CUS A;  5F63 A;  5J0D A;  4YYG A;  5DW2 A;  4CUQ A;  4J0R A;  5A5S A;  5HCL A;  4NS5 A;  5I83 A;  5F3A A;  5H1U A;  5E0R A;  3AQA A;  4RVR A;  3UV5 A;  4QR5 A;  2E7N A;  5F25 A;  5EIS A;  5CUE A;  4PTB A;  5E73 A;  4C67 A;  4QZS A;  4O7A A;  4QYL A;  5CQ6 A;  4UYG A;  5F62 A;  2D9E A;  5I29 A;  5F1H A;  5LKZ A;  2YQD A;  3SVH A;  4A9N A;  3G0L A;  4LDF A;  3O37 A;  5A82 A;  2YEL A;  5EI4 A;  2RS9 B;  2RNW A;  4IOQ A;  5FE4 A;  4C66 A;  5CQA A;  4CFK A;  3P1F A;  4LR6 A;  4A9F A;  5E3D A;  3Q2F A;  4J3I A;  5LJ2 A;  1X0J A;  5FE1 A;  5DFB A;  4UYF B;  3LXJ A;  4TQN A;  2F6J A;  5EWW A;  5L99 A;  3LJW A;  2E3K A;  4XY8 A;  5F1L A;  5EM3 A;  3QZV A;  5EWD A;  4YYK A;  4XUB A;  4A9K A;  3UVD A;  5FE3 A;  5DBM A;  5E74 A;  2YW5 A;  4QSU A;  3FKM X;  3SVF A;  4A9M A;  4LZR A;  2I7K A;  4ZC9 A;  4TZ8 A;  5FDZ A;  5BT3 A;  1JSP B;  2R0Y A;  5IGL A;  4HBY A;  3P1D A;  4NYW A;  5KO4 A;  4XY9 A;  2KTB B;  5EIC A;  5DYU A;  4YYD A;  5LKU A;  4QEW A;  3RCW A;  2OSS A;  5A83 A;  5AMF A;  4QUU A;  4UIV A;  4O71 A;  4QY4 A;  4LZ2 A;  4A9J A;  5H1V A;  4A9I A;  2WP2 A;  4TS8 A;  5L8T A;  3U5M A;  4NUC A;  4O78 A;  4UIU A;  1JM4 B;  4O7F A;  5ENH A;  5KU3 A;  5D3H A;  4NRC A;  4NR9 A;  5C8G A;  1WUM A;  3U5K A;  5EPR A;  5D3S A;  4LYI A;  5HLS A;  2YEM A;  4F3I A;  1ZS5 A;  4N3W A;  5LVR A;  4ZQL A;  5ENI A;  4YAB A;  5H85 A;  5FH6 A;  5KTU A;  4CL9 A;  3UVY A;  2R0S A;  3JVL A;  2RI7 A;  5ENB A;  4NQN A;  5F5Z A;  3HME A;  3U5L A;  4CUU A;  4O75 A;  5F36 A;  3SVG A;  5FE8 A;  5EPS A;  4UIW A;  4WHW A;  3UV4 A;  4NRB A;  5ENJ A;  4QUT A;  5ETD A;  4CFL A;  2DVR A;  2NXB A;  3O33 A;  5E9Y A;  5HEL A;  5A5N A;  4TTE A;  4BJX A;  4CUR A;  4O77 A;  4UIX A;  5HEN A;  4QC3 A;  4Z1S A;  5EWH A;  5EPB A;  4YYN A;  5HQ7 A;  4ALH A;  3NXB A;  5EWV A;  4QYD A;  4KV4 A;  4X2I A;  5FE2 A;  2DAT A;  4HXP A;  4N4F A;  5CRM A;  5FFY A;  5CUB A;  5CTL A;  4QR3 A;  3QZT A;  5C85 A;  2R0V A;  2RNX A;  4HXK A;  5FFW A;  5JWM A;  3MB3 A;  2RO1 A;  4YBM A;  4Z6I A;  5FG6 A;  4O74 A;  4YAX A;  5ENG A;  5E9L A;  1E6I A;  3JVM A;  5L97 A;  4Q0O A;  5DKC A;  4FLP A;  4XYA A;  5CGP A;  5EK9 A;  4N4I A;  4BW1 A;  2DWW A;  4TU4 A;  5I40 A;  4IOR A;  2L5E A;  4DON A;  4O76 A;  3UV2 A;  4UYF A;  2R10 A;  5A5P A;  5HRV A;  4QB3 A;  2YDW A;  2WP1 A;  1WUG A;  2YYN A;  4GPJ A;  3ZYU A;  2D82 A;  3LQI A;  5A7C A;  5G4R A;  4PY6 A;  3Q2E A;  4TU6 A;  4MR5 A;  4TT6 A;  5CQ5 A;  4LYS A;  4Z6H A;  4HXR A;  4NYV A;  4HXS A;  4QSR A;  5EA1 A;  5LJ0 A;  3UVX A;  4HBV A;  5CUC A;  5HEM A;  1F68 A;  4QSX A;  5E7D A;  5DW1 A;  5D0C A;  5LKT A;  1EQF A;  4UYH A;  3MQM A;  5EV9 A;  5DYX A;  4NRA A;  5I1Q A;  4CLB A;  4XUA A;  5DFD A;  4HXN A;  4LYW A;  4MEO A;  4E96 A;  4UIT A;  4Y03 A;  4QSW A;  2GRC A;  5CZG A;  4HXL A;  4YY4 A;  5C87 A;  5EWC A;  5FE7 A;  4NXJ A;  5CFW A;  2DVV A;  5ENE A;  4YYM A;  4Q0N A;  4MR6 A;  3S91 A;  5A5Q A;  2OUO A;  2L85 A;  4TT4 A;  4HXM A;  5I89 A;  5HQ6 A;  2LSP B;  5KTW A;  4A9L A;  4IOO A;  4O7E A;  4BW4 A;  3LQH A;  4A9E A;  5I7Y A;  3P1C A;  3U5J A;  4IR6 A;  5A5O A;  5F61 A;  5HFR A;  4ALG A;  4MEQ A;  3GG3 A;  5FG4 A;  4N4G A;  5DKD A;  5AD2 A;  5E9M A;  5DYC A;  5KTX A;  4MR3 A;  4Z1Q A;  5TCM A;  3MXF A;  5D7X A;  5CQT A;  4QC1 A;  5DLZ A;  5L96 A;  5C4Q A;  3U5N A;  3O36 A;  5D24 A;  5ENF A;  5FG5 A;  2L84 A;  3HMF A;  3IU5 A;  5IGM A;  3HMH A;  5LVQ A;  2DVS A;  4UYD A;  5H1T A;  5CQ8 A;  5E9V A;  5DKH A;  4NUE A;  4QSP A;  2G4A A;  4NR4 A;  5L98 A;  4O72 A;  5IID A;  4NQM A;  4O7B A;  3MUL A;  5A5R A;  4LZS A;  5A81 A;  5EVA A;  3I3J A;  5D3N A;  2I8N A;  5IBN A;  2DKW A;  4NYX A;  3JVK A;  5C89 A;  4YH3 A;  4O70 A;  4YC9 A;  5JI8 A;  3U5P A;  3P1E A;  5KHM A;  5EP7 A;  2YEK A;  4TT2 A;  4OGI A;  3MB4 A;  5HFQ A;  5CP5 A;  5I7X A;  2F6N A;  3G0J A;  5LUU A;  4YYJ A;  2MJV B;  4MEP A;  5TB6 A;  4N4H A;  4NR8 A;  4YBS A;  3DAI A;  4IR3 A;  5DY7 A;  4ZW1 A;  5F2P A;  5HRX A;  4QSS A;  2RFJ A;  4NR7 A;  5IGK A;  5FB0 A;  4J0S A;  4QEV A;  5DYA A;  5DLX A;  3K2J A;  4CUT A;  5FB1 A;  4KCX A;  4UIZ A;  5BT4 A;  5LKX A;  4QEU A;  5HQ5 A;  5E3G A;  4YYI A;  5AME A;  5FE6 A;  4NR6 A;  4O7C A;  5D3J A;  2DVQ A;  3P5O A;  5K29 A;  4WHU A;  5CQ3 A;  5IGN A;  5F60 A;  4PCE A;  5D3L A;  4UIY A;  5FFV A;  4BHW A;  4PKL A;  5D26 A;  4QST A;  5COI A;  3O35 A;  5CUD A;  5II1 A;  3AAD A;  3MUK A;  5CY9 A;  5HJC A;  5I86 A;  5LJ1 A;  4TZ2 A;  5E9K A;  5D3P A;  5IG6 A;  4YY6 A;  4PCI A;  4UYE A;  5ACY A;  4BW2 A;  5L8U A;  5C7N A;  5A85 A;  4QSQ A;  5FBX A;  4MEN A;  4BW3 A;  4LC2 A;  3JVJ A;  3ONI A;  3DWY A;  3UVW A;  5ENC A;  4QBM A;  3O34 A;  4LRG A;  4YH4 A;  4HBX A;  4HXO A;  3IU6 A;  5BT5 A;  4WIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...