4KD6A

Crystal structure of a enoyl-coa hydratase/isomerase from burkholderia graminis c4d1m
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
215
Chain Sequence
b'DVLFSNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGNRAFSAGQDLSWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQPEINAGIASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDEDKVFDKALEIATELAAKPPVAMRLDKQRFREMTEPGFIDCIEAGERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase
publication title Crystal structure of a Enoyl-CoA hydratase/isomerase from Burkholderia graminis C4D1M
rcsb
source organism Burkholderia graminis
molecule tags Isomerase
total genus 70
structure length 215
sequence length 227
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4kd6A00
5MGBA 5DU6A 2X58A 2VSSE 4DI1A 3V5IA 4NNQA 4FNDA 1XO6A 4JJTA 2FW2A 2VX2A 3I47A 5G1QA 3KTJA 3K8XA 4L8KA 1HNUA 1X0UA 4K2NA 2GTRA 4HNKA 3GLMA 2VSSA 2VSUC 3DORA 4KNPA 3U9SB 3R0OA 5INFA 2CE3A 1FC6A 1PIXA 4NEKA 4FZWC 1YG8A 4GM2A 5KDRA 5E0SA 4EMLA 3MOYA 3DJAA 1WDMA 3GF3A 2EJ5A 2C8TA 3RSIA 3QWDA 3Q0JA 2NP9A 3H0QA 2ZL0A 2PPYA 3RSTA 2J5GA 4U1AA 5IKLB 3T3WA 3NJDA 3IB9A 3ZWCA 2VSUF 4ZDCA 3ZW9A 4U0HA 1EF9A 2VSUE 3KQFA 3R9SA 3T89A 3M6NA 1HNOA 4FB8A 5E0SH 2F6QA 2F9IB 4KPKA 1J7XA 3H0JA 4JCTA 4EMPA 5KJPA 4KD6A 3PZKA 1OD4A 3T8BA 4WZ8B 2W3PA 3TRRA 3NJBA 1WDKA 4JVTA 5DUFA 5DU4A 5G1SA 4JCQA 5JBXA 4OG1A 4OMRA 3OC7A 4IZBA 1WZ8A 3OT6A 1HZDA 3T8AA 4OLQA 2F9YB 2FZSA 5JBWA 1OD2A 4Q1IA 1RJMA 4ZU2A 4JOTA 2FBMA 3G64A 4JYJA 1MJ3A 4LK5A 3LKEA 1O8UA 4FJWD 3SWXA 2J5SA 4FNBA 2F9IA 2A81A 4JWVA 4YLHA 2ZL4A 3OMEA 1XNVA 3GKBA 4K3WA 3U9TB 3KTHA 3FDUA 3U9RB 3FF6A 2ZQQA 3HLN1 5C90A 3TT7A 3ZWBA 1N6DA 4ASIA 1XX4A 3K50A 4IZDA 4L6WA 5CTBA 2IEXA 4KWBA 1N6EA 5INIA 5DKPA 4JFCA 3HRXA 1VRGA 1PJHA 4ELSA 3MT6A 1ON9A 2ZL2A 3TLFA 1TYFA 3PE8A 3P2LA 2J5GD 4FN8A 2D3TA 1N6FA 1EY3A 3TVWA 3PGQA 4B3JA 4JCSA 3Q7HA 1YG6A 3QXZA 3QXIA 3VIVA 2PBPA 1JXZA 3HP0A 3ZWAA 3QYRA 3H0SA 4I42A 3QK8A 3HINA 2PG8A 4WYOB 3PEAA 3ST9A 1UIYA 4IZCA 1UYTA 2QQ3A 4MXIA 5DZKA 3TZ3A 4RCNA 4B3IA 1UYVA 1FC7A 2VSUA 3T88A 3H81A 5FIFA 2DEOA 3QREA 3Q1TA 4MOUA 4FZWA 5G1RA 1Q52A 2DUBA 3M6MA 3QKAA 5DZKH 1NZYB 4Z0MA 4I52A 4ZDBA 2F6IA 3SLLA 3ISAA 3P85A 2HW5A 4I4ZA 2Q34A 4JCRA 3N6RB 2A7KA 3TVUA 3R6HA 2VSSF 5DUCA 4ELXA 3RRVA 4EMMA 2CBYA 3Q0GA 3H0UA 4U19A 3P5MA 1UYSA 1ON3A 3BF0A 4K29A 3TT6A 2Q2XA 4ZDDA 4Q0GA 1XNYA 2F9YA 4QIJA 3R9TA 1SG4A 4RYFA 3GF7A 3QMJA 2J5II 5C9GA 5E0NX 1NZYA 3BEZA 4ELWA 4HC8A 3HE2A 3JU1A 3TDCA 3WG5A 3ZW8A 2J5IB 4QIIA 4ZDEA 3IAVA 4WCZA 1FCFA 1DUBA 4RYFH 5DL1A 3V5EA 2WTBA 5DTWA 4U0GA 5DU8A 3STAA 2ZL3A 3L3SA 2ZQRA 3LAOA 2UZFA 3MFMA 2A7SA 4G2RA 3TV5A 1Q51A 1WDLA 4MI2A 3H02A 3IBBA 1K32A 2Q35A 4JSBA 4U0GH 1XNWA 4U18A 4FN7A 1EF8A 1K39A 3KTIA 2J5IA 1RJNA 2BZRA 3R9QA 5FUSA 3BPPA 3GMAA 1W2XA 5INGA 3KTGA 1TG6A 2X24A 5DTPA 1SZOA 4F47A 1DCIA 1UYRA 1FC9A 4ZDFA 2VREA 1Y7OA 4B3HA 4JYLA 5KDRB 3KTKA 5CTCA 4QFEA 3MYBA 4GHNA
chains in the Genus database with same CATH superfamily
5MGBA 5DU6A 4J2UA 2X58A 2VSSE 4DI1A 3V5IA 4NNQA 4FNDA 1XO6A 4JJTA 2FW2A 2VX2A 3I47A 5G1QA 3KTJA 3K8XA 4L8KA 1HNUA 1X0UA 4K2NA 2GTRA 4HNKA 3GLMA 2VSSA 2VSUC 3DORA 4KNPA 3U9SB 3R0OA 5INFA 2CE3A 1FC6A 1PIXA 4NEKA 4FZWC 1YG8A 4GM2A 5KDRA 5E0SA 4EMLA 3MOYA 3DJAA 1WDMA 3GF3A 2EJ5A 2C8TA 3RSIA 3QWDA 3Q0JA 2NP9A 3H0QA 2ZL0A 2PPYA 3RSTA 2J5GA 4U1AA 5IKLB 3T3WA 3NJDA 3IB9A 3ZWCA 2VSUF 4ZDCA 3ZW9A 4U0HA 1EF9A 2VSUE 3KQFA 3R9SA 3T89A 3M6NA 1HNOA 4FB8A 5E0SH 2F6QA 2F9IB 4KPKA 1J7XA 3H0JA 4JCTA 4EMPA 5KJPA 3BPTA 4KD6A 3PZKA 1OD4A 3T8BA 4WZ8B 2W3PA 3TRRA 3NJBA 1WDKA 4JVTA 5DUFA 5DU4A 5G1SA 4JCQA 5JBXA 4OG1A 4OMRA 3OC7A 4IZBA 1WZ8A 3OT6A 1HZDA 3T8AA 4OLQA 2F9YB 2FZSA 5JBWA 1OD2A 4Q1IA 1RJMA 4ZU2A 4JOTA 2FBMA 3G64A 4JYJA 1MJ3A 4LK5A 3LKEA 1O8UA 4FJWD 3SWXA 2J5SA 4FNBA 2F9IA 2A81A 4JWVA 4YLHA 2ZL4A 3OMEA 1XNVA 3GKBA 4K3WA 3U9TB 3KTHA 3FDUA 3U9RB 3FF6A 2ZQQA 3HLN1 5C90A 3TT7A 3ZWBA 1N6DA 4ASIA 1XX4A 3K50A 4IZDA 4L6WA 5CTBA 2IEXA 4KWBA 1N6EA 5INIA 5DKPA 4JFCA 3HRXA 1VRGA 1PJHA 4ELSA 3MT6A 1ON9A 2ZL2A 3TLFA 1TYFA 3PE8A 3P2LA 2J5GD 4FN8A 2D3TA 3TVWA 1N6FA 1EY3A 3PGQA 4B3JA 4JCSA 3Q7HA 1YG6A 3QXZA 3QXIA 3VIVA 2PBPA 1JXZA 3HP0A 3ZWAA 3QYRA 3H0SA 4I42A 3QK8A 3HINA 2PG8A 4WYOB 3PEAA 3ST9A 1UIYA 4IZCA 1UYTA 2QQ3A 4MXIA 5DZKA 3TZ3A 4RCNA 4B3IA 1UYVA 1FC7A 2VSUA 3T88A 3H81A 5FIFA 2DEOA 3QREA 3Q1TA 4MOUA 4FZWA 5G1RA 1Q52A 2DUBA 3M6MA 3QKAA 5DZKH 1NZYB 4Z0MA 4I52A 4ZDBA 2F6IA 3SLLA 3ISAA 3P85A 2HW5A 4I4ZA 2Q34A 4JCRA 3N6RB 2A7KA 3TVUA 3R6HA 2VSSF 5DUCA 4ELXA 3RRVA 4EMMA 2CBYA 3Q0GA 3H0UA 4U19A 3P5MA 1UYSA 1ON3A 3BF0A 4K29A 3TT6A 2Q2XA 4ZDDA 4Q0GA 1XNYA 3R9TA 2F9YA 4QIJA 2YJGA 1SG4A 4RYFA 3GF7A 3QMJA 2J5II 5C9GA 5E0NX 1NZYA 3BEZA 4ELWA 4HC8A 4NARA 3HE2A 3JU1A 3TDCA 3WG5A 3ZW8A 2J5IB 4QIIA 4ZDEA 3IAVA 4WCZA 1FCFA 1DUBA 4RYFH 5DL1A 3V5EA 2WTBA 5DTWA 4U0GA 5DU8A 3STAA 2ZL3A 3L3SA 2ZQRA 3LAOA 2UZFA 3MFMA 2A7SA 5HUQA 4G2RA 3TV5A 1Q51A 1WDLA 4MI2A 3H02A 3IBBA 1K32A 2Q35A 4JSBA 4U0GH 1XNWA 4U18A 4FN7A 1EF8A 1K39A 3KTIA 2J5IA 1RJNA 2BZRA 3R9QA 5FUSA 3BPPA 3GMAA 1W2XA 5INGA 3KTGA 1TG6A 2X24A 5DTPA 1SZOA 4F47A 1DCIA 1UYRA 1FC9A 4ZDFA 2VREA 1Y7OA 4B3HA 4JYLA 5KDRB 3KTKA 5CTCA 4QFEA 4HDTA 3MYBA 4GHNA
chains in the Genus database with same CATH topology
5MGBA 5DU6A 4J2UA 2X58A 2VSSE 4DI1A 3V5IA 4NNQA 4FNDA 1XO6A 4JJTA 2FW2A 2VX2A 3I47A 5G1QA 3KTJA 3K8XA 4L8KA 1HNUA 1X0UA 4K2NA 2GTRA 4HNKA 3GLMA 2VSSA 2VSUC 3DORA 4KNPA 3U9SB 3R0OA 5INFA 2CE3A 1FC6A 1PIXA 4NEKA 4FZWC 1YG8A 4GM2A 5KDRA 5E0SA 4EMLA 3MOYA 3DJAA 1WDMA 3GF3A 2EJ5A 2C8TA 3RSIA 3QWDA 3Q0JA 2NP9A 3H0QA 2ZL0A 2PPYA 3RSTA 2J5GA 4U1AA 5IKLB 3T3WA 3NJDA 3IB9A 3ZWCA 2VSUF 4ZDCA 3ZW9A 4U0HA 1EF9A 2VSUE 3KQFA 3R9SA 3T89A 3M6NA 1HNOA 4FB8A 5E0SH 2F6QA 2F9IB 4KPKA 1J7XA 3H0JA 4JCTA 4EMPA 5KJPA 3BPTA 4KD6A 3PZKA 1OD4A 3T8BA 4WZ8B 2W3PA 3TRRA 3NJBA 1WDKA 4JVTA 5DUFA 5DU4A 5G1SA 4JCQA 5JBXA 4OG1A 4OMRA 3OC7A 4IZBA 1WZ8A 3OT6A 1HZDA 3T8AA 4OLQA 2F9YB 2FZSA 5JBWA 1OD2A 4Q1IA 1RJMA 4ZU2A 4JOTA 2FBMA 3G64A 4JYJA 1MJ3A 4LK5A 3LKEA 1O8UA 4FJWD 3SWXA 2J5SA 4FNBA 2F9IA 2A81A 4JWVA 4YLHA 2ZL4A 3OMEA 1XNVA 3GKBA 4K3WA 3U9TB 3KTHA 3FDUA 3U9RB 3FF6A 2ZQQA 3HLN1 5C90A 3TT7A 3ZWBA 1N6DA 4ASIA 1XX4A 3K50A 4IZDA 4L6WA 5CTBA 2IEXA 4KWBA 1N6EA 5INIA 5DKPA 4JFCA 3HRXA 1VRGA 1PJHA 4ELSA 3MT6A 1ON9A 2ZL2A 3TLFA 1TYFA 3PE8A 3P2LA 2J5GD 4FN8A 2D3TA 3TVWA 1N6FA 1EY3A 3PGQA 4B3JA 4JCSA 3Q7HA 1YG6A 3QXZA 3QXIA 3VIVA 2PBPA 1JXZA 3HP0A 3ZWAA 3QYRA 3H0SA 4I42A 3QK8A 3HINA 2PG8A 4WYOB 3PEAA 3ST9A 1UIYA 4IZCA 1UYTA 2QQ3A 4MXIA 5DZKA 3TZ3A 4RCNA 4B3IA 1UYVA 1FC7A 2VSUA 3T88A 3H81A 5FIFA 2DEOA 3QREA 3Q1TA 4MOUA 4FZWA 5G1RA 1Q52A 2DUBA 3M6MA 3QKAA 5DZKH 1NZYB 4Z0MA 4I52A 4ZDBA 2F6IA 3SLLA 3ISAA 3P85A 2HW5A 4I4ZA 2Q34A 4JCRA 3N6RB 2A7KA 3TVUA 3R6HA 2VSSF 5DUCA 4ELXA 3RRVA 4EMMA 2CBYA 3Q0GA 3H0UA 4U19A 3P5MA 1UYSA 1ON3A 3BF0A 4K29A 3TT6A 2Q2XA 4ZDDA 4Q0GA 1XNYA 3R9TA 2F9YA 4QIJA 2YJGA 1SG4A 4RYFA 3GF7A 3QMJA 2J5II 5C9GA 5E0NX 1NZYA 3BEZA 4ELWA 4HC8A 4NARA 3HE2A 3JU1A 3TDCA 3WG5A 3ZW8A 2J5IB 4QIIA 4ZDEA 3IAVA 4WCZA 1FCFA 1DUBA 4RYFH 5DL1A 3V5EA 2WTBA 5DTWA 4U0GA 5DU8A 3STAA 2ZL3A 3L3SA 2ZQRA 3LAOA 2UZFA 3MFMA 2A7SA 5HUQA 4G2RA 3TV5A 1Q51A 1WDLA 4MI2A 3H02A 3IBBA 1K32A 2Q35A 4JSBA 4U0GH 1XNWA 4U18A 4FN7A 1EF8A 1K39A 3KTIA 2J5IA 1RJNA 2BZRA 3R9QA 5FUSA 3BPPA 3GMAA 1W2XA 5INGA 3KTGA 1TG6A 2X24A 5DTPA 1SZOA 4F47A 1DCIA 1UYRA 1FC9A 4ZDFA 2VREA 1Y7OA 4B3HA 4JYLA 5KDRB 3KTKA 5CTCA 4QFEA 4HDTA 3MYBA 4GHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MGB A;  5DU6 A;  2X58 A;  2VSS E;  4DI1 A;  3V5I A;  4NNQ A;  4FND A;  1XO6 A;  4JJT A;  2FW2 A;  2VX2 A;  3I47 A;  5G1Q A;  3KTJ A;  3K8X A;  4L8K A;  1HNU A;  1X0U A;  4K2N A;  2GTR A;  4HNK A;  3GLM A;  2VSS A;  2VSU C;  3DOR A;  4KNP A;  3U9S B;  3R0O A;  5INF A;  2CE3 A;  1FC6 A;  1PIX A;  4NEK A;  4FZW C;  1YG8 A;  4GM2 A;  5KDR A;  5E0S A;  4EML A;  3MOY A;  3DJA A;  1WDM A;  3GF3 A;  2EJ5 A;  2C8T A;  3RSI A;  3QWD A;  3Q0J A;  2NP9 A;  3H0Q A;  2ZL0 A;  2PPY A;  3RST A;  2J5G A;  4U1A A;  5IKL B;  3T3W A;  3NJD A;  3IB9 A;  3ZWC A;  2VSU F;  4ZDC A;  3ZW9 A;  4U0H A;  1EF9 A;  2VSU E;  3KQF A;  3R9S A;  3T89 A;  3M6N A;  1HNO A;  4FB8 A;  5E0S H;  2F6Q A;  2F9I B;  4KPK A;  1J7X A;  3H0J A;  4JCT A;  4EMP A;  5KJP A;  4KD6 A;  3PZK A;  1OD4 A;  3T8B A;  4WZ8 B;  2W3P A;  3TRR A;  3NJB A;  1WDK A;  4JVT A;  5DUF A;  5DU4 A;  5G1S A;  4JCQ A;  5JBX A;  4OG1 A;  4OMR A;  3OC7 A;  4IZB A;  1WZ8 A;  3OT6 A;  1HZD A;  3T8A A;  4OLQ A;  2F9Y B;  2FZS A;  5JBW A;  1OD2 A;  4Q1I A;  1RJM A;  4ZU2 A;  4JOT A;  2FBM A;  3G64 A;  4JYJ A;  1MJ3 A;  4LK5 A;  3LKE A;  1O8U A;  4FJW D;  3SWX A;  2J5S A;  4FNB A;  2F9I A;  2A81 A;  4JWV A;  4YLH A;  2ZL4 A;  3OME A;  1XNV A;  3GKB A;  4K3W A;  3U9T B;  3KTH A;  3FDU A;  3U9R B;  3FF6 A;  2ZQQ A;  3HLN 1;  5C90 A;  3TT7 A;  3ZWB A;  1N6D A;  4ASI A;  1XX4 A;  3K50 A;  4IZD A;  4L6W A;  5CTB A;  2IEX A;  4KWB A;  1N6E A;  5INI A;  5DKP A;  4JFC A;  3HRX A;  1VRG A;  1PJH A;  4ELS A;  3MT6 A;  1ON9 A;  2ZL2 A;  3TLF A;  1TYF A;  3PE8 A;  3P2L A;  2J5G D;  4FN8 A;  2D3T A;  1N6F A;  1EY3 A;  3TVW A;  3PGQ A;  4B3J A;  4JCS A;  3Q7H A;  1YG6 A;  3QXZ A;  3QXI A;  3VIV A;  2PBP A;  1JXZ A;  3HP0 A;  3ZWA A;  3QYR A;  3H0S A;  4I42 A;  3QK8 A;  3HIN A;  2PG8 A;  4WYO B;  3PEA A;  3ST9 A;  1UIY A;  4IZC A;  1UYT A;  2QQ3 A;  4MXI A;  5DZK A;  3TZ3 A;  4RCN A;  4B3I A;  1UYV A;  1FC7 A;  2VSU A;  3T88 A;  3H81 A;  5FIF A;  2DEO A;  3QRE A;  3Q1T A;  4MOU A;  4FZW A;  5G1R A;  1Q52 A;  2DUB A;  3M6M A;  3QKA A;  5DZK H;  1NZY B;  4Z0M A;  4I52 A;  4ZDB A;  2F6I A;  3SLL A;  3ISA A;  3P85 A;  2HW5 A;  4I4Z A;  2Q34 A;  4JCR A;  3N6R B;  2A7K A;  3TVU A;  3R6H A;  2VSS F;  5DUC A;  4ELX A;  3RRV A;  4EMM A;  2CBY A;  3Q0G A;  3H0U A;  4U19 A;  3P5M A;  1UYS A;  1ON3 A;  3BF0 A;  4K29 A;  3TT6 A;  2Q2X A;  4ZDD A;  4Q0G A;  1XNY A;  2F9Y A;  4QIJ A;  3R9T A;  1SG4 A;  4RYF A;  3GF7 A;  3QMJ A;  2J5I I;  5C9G A;  5E0N X;  1NZY A;  3BEZ A;  4ELW A;  4HC8 A;  3HE2 A;  3JU1 A;  3TDC A;  3WG5 A;  3ZW8 A;  2J5I B;  4QII A;  4ZDE A;  3IAV A;  4WCZ A;  1FCF A;  1DUB A;  4RYF H;  5DL1 A;  3V5E A;  2WTB A;  5DTW A;  4U0G A;  5DU8 A;  3STA A;  2ZL3 A;  3L3S A;  2ZQR A;  3LAO A;  2UZF A;  3MFM A;  2A7S A;  4G2R A;  3TV5 A;  1Q51 A;  1WDL A;  4MI2 A;  3H02 A;  3IBB A;  1K32 A;  2Q35 A;  4JSB A;  4U0G H;  1XNW A;  4U18 A;  4FN7 A;  1EF8 A;  1K39 A;  3KTI A;  2J5I A;  1RJN A;  2BZR A;  3R9Q A;  5FUS A;  3BPP A;  3GMA A;  1W2X A;  5ING A;  3KTG A;  1TG6 A;  2X24 A;  5DTP A;  1SZO A;  4F47 A;  1DCI A;  1UYR A;  1FC9 A;  4ZDF A;  2VRE A;  1Y7O A;  4B3H A;  4JYL A;  5KDR B;  3KTK A;  5CTC A;  4QFE A;  3MYB A;  4GHN A; 
#chains in the Genus database with same CATH topology
 5MGB A;  5DU6 A;  4J2U A;  2X58 A;  2VSS E;  4DI1 A;  3V5I A;  4NNQ A;  4FND A;  1XO6 A;  4JJT A;  2FW2 A;  2VX2 A;  3I47 A;  5G1Q A;  3KTJ A;  3K8X A;  4L8K A;  1HNU A;  1X0U A;  4K2N A;  2GTR A;  4HNK A;  3GLM A;  2VSS A;  2VSU C;  3DOR A;  4KNP A;  3U9S B;  3R0O A;  5INF A;  2CE3 A;  1FC6 A;  1PIX A;  4NEK A;  4FZW C;  1YG8 A;  4GM2 A;  5KDR A;  5E0S A;  4EML A;  3MOY A;  3DJA A;  1WDM A;  3GF3 A;  2EJ5 A;  2C8T A;  3RSI A;  3QWD A;  3Q0J A;  2NP9 A;  3H0Q A;  2ZL0 A;  2PPY A;  3RST A;  2J5G A;  4U1A A;  5IKL B;  3T3W A;  3NJD A;  3IB9 A;  3ZWC A;  2VSU F;  4ZDC A;  3ZW9 A;  4U0H A;  1EF9 A;  2VSU E;  3KQF A;  3R9S A;  3T89 A;  3M6N A;  1HNO A;  4FB8 A;  5E0S H;  2F6Q A;  2F9I B;  4KPK A;  1J7X A;  3H0J A;  4JCT A;  4EMP A;  5KJP A;  3BPT A;  4KD6 A;  3PZK A;  1OD4 A;  3T8B A;  4WZ8 B;  2W3P A;  3TRR A;  3NJB A;  1WDK A;  4JVT A;  5DUF A;  5DU4 A;  5G1S A;  4JCQ A;  5JBX A;  4OG1 A;  4OMR A;  3OC7 A;  4IZB A;  1WZ8 A;  3OT6 A;  1HZD A;  3T8A A;  4OLQ A;  2F9Y B;  2FZS A;  5JBW A;  1OD2 A;  4Q1I A;  1RJM A;  4ZU2 A;  4JOT A;  2FBM A;  3G64 A;  4JYJ A;  1MJ3 A;  4LK5 A;  3LKE A;  1O8U A;  4FJW D;  3SWX A;  2J5S A;  4FNB A;  2F9I A;  2A81 A;  4JWV A;  4YLH A;  2ZL4 A;  3OME A;  1XNV A;  3GKB A;  4K3W A;  3U9T B;  3KTH A;  3FDU A;  3U9R B;  3FF6 A;  2ZQQ A;  3HLN 1;  5C90 A;  3TT7 A;  3ZWB A;  1N6D A;  4ASI A;  1XX4 A;  3K50 A;  4IZD A;  4L6W A;  5CTB A;  2IEX A;  4KWB A;  1N6E A;  5INI A;  5DKP A;  4JFC A;  3HRX A;  1VRG A;  1PJH A;  4ELS A;  3MT6 A;  1ON9 A;  2ZL2 A;  3TLF A;  1TYF A;  3PE8 A;  3P2L A;  2J5G D;  4FN8 A;  2D3T A;  3TVW A;  1N6F A;  1EY3 A;  3PGQ A;  4B3J A;  4JCS A;  3Q7H A;  1YG6 A;  3QXZ A;  3QXI A;  3VIV A;  2PBP A;  1JXZ A;  3HP0 A;  3ZWA A;  3QYR A;  3H0S A;  4I42 A;  3QK8 A;  3HIN A;  2PG8 A;  4WYO B;  3PEA A;  3ST9 A;  1UIY A;  4IZC A;  1UYT A;  2QQ3 A;  4MXI A;  5DZK A;  3TZ3 A;  4RCN A;  4B3I A;  1UYV A;  1FC7 A;  2VSU A;  3T88 A;  3H81 A;  5FIF A;  2DEO A;  3QRE A;  3Q1T A;  4MOU A;  4FZW A;  5G1R A;  1Q52 A;  2DUB A;  3M6M A;  3QKA A;  5DZK H;  1NZY B;  4Z0M A;  4I52 A;  4ZDB A;  2F6I A;  3SLL A;  3ISA A;  3P85 A;  2HW5 A;  4I4Z A;  2Q34 A;  4JCR A;  3N6R B;  2A7K A;  3TVU A;  3R6H A;  2VSS F;  5DUC A;  4ELX A;  3RRV A;  4EMM A;  2CBY A;  3Q0G A;  3H0U A;  4U19 A;  3P5M A;  1UYS A;  1ON3 A;  3BF0 A;  4K29 A;  3TT6 A;  2Q2X A;  4ZDD A;  4Q0G A;  1XNY A;  3R9T A;  2F9Y A;  4QIJ A;  2YJG A;  1SG4 A;  4RYF A;  3GF7 A;  3QMJ A;  2J5I I;  5C9G A;  5E0N X;  1NZY A;  3BEZ A;  4ELW A;  4HC8 A;  4NAR A;  3HE2 A;  3JU1 A;  3TDC A;  3WG5 A;  3ZW8 A;  2J5I B;  4QII A;  4ZDE A;  3IAV A;  4WCZ A;  1FCF A;  1DUB A;  4RYF H;  5DL1 A;  3V5E A;  2WTB A;  5DTW A;  4U0G A;  5DU8 A;  3STA A;  2ZL3 A;  3L3S A;  2ZQR A;  3LAO A;  2UZF A;  3MFM A;  2A7S A;  5HUQ A;  4G2R A;  3TV5 A;  1Q51 A;  1WDL A;  4MI2 A;  3H02 A;  3IBB A;  1K32 A;  2Q35 A;  4JSB A;  4U0G H;  1XNW A;  4U18 A;  4FN7 A;  1EF8 A;  1K39 A;  3KTI A;  2J5I A;  1RJN A;  2BZR A;  3R9Q A;  5FUS A;  3BPP A;  3GMA A;  1W2X A;  5ING A;  3KTG A;  1TG6 A;  2X24 A;  5DTP A;  1SZO A;  4F47 A;  1DCI A;  1UYR A;  1FC9 A;  4ZDF A;  2VRE A;  1Y7O A;  4B3H A;  4JYL A;  5KDR B;  3KTK A;  5CTC A;  4QFE A;  4HDT A;  3MYB A;  4GHN A; 
#chains in the Genus database with same CATH homology
 5MGB A;  5DU6 A;  4J2U A;  2X58 A;  2VSS E;  4DI1 A;  3V5I A;  4NNQ A;  4FND A;  1XO6 A;  4JJT A;  2FW2 A;  2VX2 A;  3I47 A;  5G1Q A;  3KTJ A;  3K8X A;  4L8K A;  1HNU A;  1X0U A;  4K2N A;  2GTR A;  4HNK A;  3GLM A;  2VSS A;  2VSU C;  3DOR A;  4KNP A;  3U9S B;  3R0O A;  5INF A;  2CE3 A;  1FC6 A;  1PIX A;  4NEK A;  4FZW C;  1YG8 A;  4GM2 A;  5KDR A;  5E0S A;  4EML A;  3MOY A;  3DJA A;  1WDM A;  3GF3 A;  2EJ5 A;  2C8T A;  3RSI A;  3QWD A;  3Q0J A;  2NP9 A;  3H0Q A;  2ZL0 A;  2PPY A;  3RST A;  2J5G A;  4U1A A;  5IKL B;  3T3W A;  3NJD A;  3IB9 A;  3ZWC A;  2VSU F;  4ZDC A;  3ZW9 A;  4U0H A;  1EF9 A;  2VSU E;  3KQF A;  3R9S A;  3T89 A;  3M6N A;  1HNO A;  4FB8 A;  5E0S H;  2F6Q A;  2F9I B;  4KPK A;  1J7X A;  3H0J A;  4JCT A;  4EMP A;  5KJP A;  3BPT A;  4KD6 A;  3PZK A;  1OD4 A;  3T8B A;  4WZ8 B;  2W3P A;  3TRR A;  3NJB A;  1WDK A;  4JVT A;  5DUF A;  5DU4 A;  5G1S A;  4JCQ A;  5JBX A;  4OG1 A;  4OMR A;  3OC7 A;  4IZB A;  1WZ8 A;  3OT6 A;  1HZD A;  3T8A A;  4OLQ A;  2F9Y B;  2FZS A;  5JBW A;  1OD2 A;  4Q1I A;  1RJM A;  4ZU2 A;  4JOT A;  2FBM A;  3G64 A;  4JYJ A;  1MJ3 A;  4LK5 A;  3LKE A;  1O8U A;  4FJW D;  3SWX A;  2J5S A;  4FNB A;  2F9I A;  2A81 A;  4JWV A;  4YLH A;  2ZL4 A;  3OME A;  1XNV A;  3GKB A;  4K3W A;  3U9T B;  3KTH A;  3FDU A;  3U9R B;  3FF6 A;  2ZQQ A;  3HLN 1;  5C90 A;  3TT7 A;  3ZWB A;  1N6D A;  4ASI A;  1XX4 A;  3K50 A;  4IZD A;  4L6W A;  5CTB A;  2IEX A;  4KWB A;  1N6E A;  5INI A;  5DKP A;  4JFC A;  3HRX A;  1VRG A;  1PJH A;  4ELS A;  3MT6 A;  1ON9 A;  2ZL2 A;  3TLF A;  1TYF A;  3PE8 A;  3P2L A;  2J5G D;  4FN8 A;  2D3T A;  3TVW A;  1N6F A;  1EY3 A;  3PGQ A;  4B3J A;  4JCS A;  3Q7H A;  1YG6 A;  3QXZ A;  3QXI A;  3VIV A;  2PBP A;  1JXZ A;  3HP0 A;  3ZWA A;  3QYR A;  3H0S A;  4I42 A;  3QK8 A;  3HIN A;  2PG8 A;  4WYO B;  3PEA A;  3ST9 A;  1UIY A;  4IZC A;  1UYT A;  2QQ3 A;  4MXI A;  5DZK A;  3TZ3 A;  4RCN A;  4B3I A;  1UYV A;  1FC7 A;  2VSU A;  3T88 A;  3H81 A;  5FIF A;  2DEO A;  3QRE A;  3Q1T A;  4MOU A;  4FZW A;  5G1R A;  1Q52 A;  2DUB A;  3M6M A;  3QKA A;  5DZK H;  1NZY B;  4Z0M A;  4I52 A;  4ZDB A;  2F6I A;  3SLL A;  3ISA A;  3P85 A;  2HW5 A;  4I4Z A;  2Q34 A;  4JCR A;  3N6R B;  2A7K A;  3TVU A;  3R6H A;  2VSS F;  5DUC A;  4ELX A;  3RRV A;  4EMM A;  2CBY A;  3Q0G A;  3H0U A;  4U19 A;  3P5M A;  1UYS A;  1ON3 A;  3BF0 A;  4K29 A;  3TT6 A;  2Q2X A;  4ZDD A;  4Q0G A;  1XNY A;  3R9T A;  2F9Y A;  4QIJ A;  2YJG A;  1SG4 A;  4RYF A;  3GF7 A;  3QMJ A;  2J5I I;  5C9G A;  5E0N X;  1NZY A;  3BEZ A;  4ELW A;  4HC8 A;  4NAR A;  3HE2 A;  3JU1 A;  3TDC A;  3WG5 A;  3ZW8 A;  2J5I B;  4QII A;  4ZDE A;  3IAV A;  4WCZ A;  1FCF A;  1DUB A;  4RYF H;  5DL1 A;  3V5E A;  2WTB A;  5DTW A;  4U0G A;  5DU8 A;  3STA A;  2ZL3 A;  3L3S A;  2ZQR A;  3LAO A;  2UZF A;  3MFM A;  2A7S A;  5HUQ A;  4G2R A;  3TV5 A;  1Q51 A;  1WDL A;  4MI2 A;  3H02 A;  3IBB A;  1K32 A;  2Q35 A;  4JSB A;  4U0G H;  1XNW A;  4U18 A;  4FN7 A;  1EF8 A;  1K39 A;  3KTI A;  2J5I A;  1RJN A;  2BZR A;  3R9Q A;  5FUS A;  3BPP A;  3GMA A;  1W2X A;  5ING A;  3KTG A;  1TG6 A;  2X24 A;  5DTP A;  1SZO A;  4F47 A;  1DCI A;  1UYR A;  1FC9 A;  4ZDF A;  2VRE A;  1Y7O A;  4B3H A;  4JYL A;  5KDR B;  3KTK A;  5CTC A;  4QFE A;  4HDT A;  3MYB A;  4GHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...