4KD6A

Crystal structure of a enoyl-coa hydratase/isomerase from burkholderia graminis c4d1m
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
227
structure length
215
Chain Sequence
DVLFSNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGNRAFSAGQDLSWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQPEINAGIASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDEDKVFDKALEIATELAAKPPVAMRLDKQRFREMTEPGFIDCIEAGERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Enoyl-CoA hydratase/isomerase from Burkholderia graminis C4D1M
rcsb
source organism Burkholderia graminis
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/isomerase
total genus 70
structure length 215
sequence length 227
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4kd6A00
4ZDFA 1TG6A 4L8KA 4JCRA 1WDMA 2VSSF 4JSBA 4ZDEA 3IBBA 3T89A 3TVWA 4B3HA 3ST9A 2A7KA 3GF7A 3G64A 4YLHA 1WDKA 4U0GA 5G1RA 5CTCA 5E0NX 3SWXA 3RRVA 4U1AA 3TLFA 3ZWCA 3GF3A 3TV5A 2F9IB 4GM2A 1XX4A 4FZWC 4WYOB 2BZRA 3QREA 1VRGA 4I42A 5DL1A 5MGBA 4JJTA 3P5MA 3L3SA 3DORA 3DJAA 2F9YB 1DCIA 2ZL3A 2J5II 1Q52A 4ELWA 4OG1A 3T8AA 4JCTA 1HZDA 3LAOA 2VX2A 3FF6A 4ZDBA 2VSUE 4K29A 4MOUA 4MXIA 4U18A 2NP9A 3TT7A 2VSUF 3QK8A 5DUFA 1RJMA 3R9SA 4I4ZA 3OT6A 1SG4A 2VSUA 2PPYA 1HNUA 3H0QA 4Q1IA 4DI1A 1FC9A 4JWVA 4U19A 3T88A 1OD4A 5DU4A 3Q7HA 5E0SH 2QQ3A 1ON3A 1UIYA 2FBMA 1UYRA 2PG8A 2DUBA 5DZKA 3IB9A 1J7XA 3VIVA 1N6FA 1X0UA 3R9TA 4LK5A 3ZW8A 1HNOA 2ZL4A 2ZL0A 5DU6A 3R9QA 2VSSA 3KTHA 5INFA 4FZWA 5INGA 3GLMA 3P85A 4IZDA 4K2NA 4ELSA 5KDRB 3Q1TA 4QIIA 3HE2A 5G1QA 3BEZA 3U9RB 3R0OA 3N6RB 3H0JA 1OD2A 3IAVA 2DEOA 3KQFA 3BPPA 2FZSA 4FB8A 1FC6A 3KTKA 1EF9A 1FC7A 3SLLA 1EY3A 3QMJA 3ZW9A 3KTJA 4I52A 5IKLB 3STAA 1Q51A 4FN8A 2UZFA 4KNPA 1K32A 4JYJA 5G1SA 4IZCA 3OMEA 4NEKA 4MI2A 3HINA 3HRXA 4JCSA 3U9SB 4WZ8B 1WZ8A 4L6WA 3ZWBA 4FJWD 3H0UA 1DUBA 2J5IA 4NNQA 4OMRA 4FN7A 3V5IA 3GKBA 3MOYA 3Q0JA 1SZOA 4GHNA 1XNYA 2EJ5A 3QWDA 3MFMA 3V5EA 4IZBA 4KD6A 2W3PA 4JOTA 4RYFA 1EF8A 2VREA 3K8XA 3TDCA 3T8BA 1N6EA 1N6DA 4ASIA 4F47A 5DTPA 4RYFH 1K39A 3M6MA 1TYFA 2CBYA 2J5GD 4ZDCA 2J5SA 3QXZA 4ZU2A 4Q0GA 4QFEA 4B3IA 3MT6A 3HP0A 1XNWA 1W2XA 3KTIA 3BF0A 1UYSA 4FNDA 2X58A 4QIJA 2A7SA 3U9TB 3NJBA 1MJ3A 2IEXA 3NJDA 3H81A 2HW5A 5E0SA 3TT6A 5JBXA 2J5GA 3PE8A 5DUCA 5JBWA 2F9IA 1WDLA 2Q35A 2VSUC 2PBPA 3MYBA 5DU8A 3QYRA 1FCFA 1NZYB 1JXZA 4RCNA 5DZKH 1YG8A 3Q0GA 3P2LA 5C90A 4K3WA 4EMLA 1UYTA 3M6NA 1Y7OA 4EMPA 1XNVA 4ZDDA 3TRRA 3ISAA 2F6IA 4G2RA 2Q2XA 4JVTA 2VSSE 4FNBA 3H02A 3GMAA 2ZL2A 1RJNA 1XO6A 4OLQA 3LKEA 2WTBA 2A81A 3PGQA 3QXIA 4ELXA 1O8UA 3ZWAA 1ON9A 3RSTA 2X24A 3HLN1 2F9YA 4U0GH 3T3WA 4EMMA 1UYVA 4KPKA 2D3TA 3K50A 3I47A 2Q34A 3PZKA 5FUSA 3RSIA 3TZ3A 3WG5A 1NZYA 4U0HA 4HC8A 2ZQRA 2C8TA 3TVUA 5C9GA 4HNKA 3QKAA 3KTGA 4JFCA 2FW2A 5CTBA 3FDUA 1PIXA 3OC7A 1PJHA 2J5IB 2CE3A 5DTWA 4JCQA 4WCZA 5KDRA 1YG6A 5KJPA 3H0SA 3R6HA 2GTRA 5DKPA 4B3JA 3PEAA 3JU1A 2ZQQA 4JYLA 4KWBA 2F6QA 4Z0MA 5INIA 5FIFA
chains in the Genus database with same CATH superfamily
4ZDFA 1TG6A 4L8KA 4JCRA 1WDMA 2VSSF 4JSBA 4ZDEA 3IBBA 3T89A 3TVWA 4B3HA 3ST9A 2A7KA 3GF7A 3G64A 4YLHA 1WDKA 4U0GA 5G1RA 2YJGA 5CTCA 5E0NX 3SWXA 3RRVA 4U1AA 3TLFA 3ZWCA 3GF3A 3TV5A 2F9IB 4GM2A 1XX4A 4FZWC 4WYOB 2BZRA 3QREA 1VRGA 4I42A 5DL1A 5MGBA 4JJTA 3P5MA 3L3SA 3DORA 3DJAA 2F9YB 1DCIA 2ZL3A 2J5II 1Q52A 4ELWA 4OG1A 3T8AA 4JCTA 1HZDA 3LAOA 2VX2A 3FF6A 4ZDBA 2VSUE 4K29A 4MOUA 4MXIA 4U18A 2NP9A 3TT7A 2VSUF 3QK8A 5DUFA 1RJMA 3R9SA 4I4ZA 3OT6A 1SG4A 2VSUA 2PPYA 1HNUA 3H0QA 4Q1IA 4DI1A 1FC9A 4JWVA 4U19A 3T88A 1OD4A 5DU4A 3Q7HA 5E0SH 2QQ3A 1ON3A 1UIYA 2FBMA 1UYRA 2PG8A 2DUBA 5DZKA 3IB9A 1J7XA 3VIVA 1N6FA 4NARA 1X0UA 4HDTA 4LK5A 3R9TA 3ZW8A 1HNOA 2ZL4A 2ZL0A 5DU6A 3R9QA 5HUQA 2VSSA 3KTHA 5INFA 4FZWA 5INGA 3GLMA 3P85A 4IZDA 4K2NA 4ELSA 5KDRB 3Q1TA 4QIIA 3HE2A 5G1QA 3BEZA 3U9RB 3R0OA 3N6RB 3H0JA 1OD2A 3IAVA 2DEOA 3KQFA 3BPPA 2FZSA 4FB8A 1FC6A 3KTKA 1EF9A 1FC7A 3SLLA 1EY3A 3QMJA 3ZW9A 3KTJA 4I52A 5IKLB 3STAA 1Q51A 4FN8A 2UZFA 4KNPA 1K32A 4JYJA 5G1SA 4IZCA 3OMEA 4NEKA 4MI2A 3HINA 3HRXA 4JCSA 3U9SB 4WZ8B 1WZ8A 4L6WA 3ZWBA 4FJWD 3H0UA 1DUBA 2J5IA 4NNQA 4OMRA 4FN7A 3V5IA 3GKBA 3MOYA 3Q0JA 1SZOA 4GHNA 1XNYA 2EJ5A 3QWDA 3MFMA 3V5EA 4IZBA 4KD6A 2W3PA 4JOTA 4RYFA 1EF8A 2VREA 3K8XA 3TDCA 3T8BA 1N6EA 1N6DA 4ASIA 4F47A 5DTPA 4RYFH 1K39A 3M6MA 1TYFA 2CBYA 2J5GD 4ZDCA 2J5SA 3QXZA 4ZU2A 4Q0GA 4QFEA 4B3IA 3MT6A 3HP0A 1XNWA 1W2XA 3KTIA 3BF0A 1UYSA 4FNDA 2X58A 4QIJA 2A7SA 3U9TB 3NJBA 1MJ3A 2IEXA 3NJDA 3H81A 2HW5A 5E0SA 3TT6A 5JBXA 2J5GA 3PE8A 5DUCA 5JBWA 2F9IA 1WDLA 2Q35A 2VSUC 2PBPA 3MYBA 5DU8A 3QYRA 1FCFA 1NZYB 1JXZA 4RCNA 5DZKH 1YG8A 3Q0GA 3P2LA 5C90A 4K3WA 4EMLA 1UYTA 3M6NA 1Y7OA 4EMPA 1XNVA 4ZDDA 3TRRA 3ISAA 2F6IA 4G2RA 2Q2XA 4JVTA 2VSSE 4FNBA 3H02A 3GMAA 2ZL2A 1RJNA 1XO6A 4OLQA 3LKEA 2WTBA 2A81A 3PGQA 3QXIA 4ELXA 3BPTA 1O8UA 3ZWAA 1ON9A 3RSTA 2X24A 3HLN1 2F9YA 4U0GH 3T3WA 4J2UA 4EMMA 1UYVA 4KPKA 2D3TA 3K50A 3I47A 2Q34A 3PZKA 5FUSA 3RSIA 3TZ3A 3WG5A 1NZYA 4U0HA 4HC8A 2ZQRA 2C8TA 3TVUA 5C9GA 4HNKA 3QKAA 3KTGA 4JFCA 2FW2A 5CTBA 3FDUA 1PIXA 3OC7A 1PJHA 2J5IB 2CE3A 5DTWA 4JCQA 4WCZA 5KDRA 1YG6A 5KJPA 3H0SA 3R6HA 2GTRA 5DKPA 4B3JA 3PEAA 3JU1A 2ZQQA 4JYLA 4KWBA 2F6QA 4Z0MA 5INIA 5FIFA
chains in the Genus database with same CATH topology
4ZDFA 1TG6A 4L8KA 4JCRA 1WDMA 2VSSF 4JSBA 4ZDEA 3IBBA 3T89A 3TVWA 4B3HA 3ST9A 2A7KA 3GF7A 3G64A 4YLHA 1WDKA 4U0GA 5G1RA 2YJGA 5CTCA 5E0NX 3SWXA 3RRVA 4U1AA 3TLFA 3ZWCA 3GF3A 3TV5A 2F9IB 4GM2A 1XX4A 4FZWC 4WYOB 2BZRA 3QREA 1VRGA 4I42A 5DL1A 5MGBA 4JJTA 3P5MA 3L3SA 3DORA 3DJAA 2F9YB 1DCIA 2ZL3A 2J5II 1Q52A 4ELWA 4OG1A 3T8AA 4JCTA 1HZDA 3LAOA 2VX2A 3FF6A 4ZDBA 2VSUE 4K29A 4MOUA 4MXIA 4U18A 2NP9A 3TT7A 2VSUF 3QK8A 5DUFA 1RJMA 3R9SA 4I4ZA 3OT6A 1SG4A 2VSUA 2PPYA 1HNUA 3H0QA 4Q1IA 4DI1A 1FC9A 4JWVA 4U19A 3T88A 1OD4A 5DU4A 3Q7HA 5E0SH 2QQ3A 1ON3A 1UIYA 2FBMA 1UYRA 2PG8A 2DUBA 5DZKA 3IB9A 1J7XA 3VIVA 1N6FA 4NARA 1X0UA 4HDTA 4LK5A 3R9TA 3ZW8A 1HNOA 2ZL4A 2ZL0A 5DU6A 3R9QA 5HUQA 2VSSA 3KTHA 5INFA 4FZWA 5INGA 3GLMA 3P85A 4IZDA 4K2NA 4ELSA 5KDRB 3Q1TA 4QIIA 3HE2A 5G1QA 3BEZA 3U9RB 3R0OA 3N6RB 3H0JA 1OD2A 3IAVA 2DEOA 3KQFA 3BPPA 2FZSA 4FB8A 1FC6A 3KTKA 1EF9A 1FC7A 3SLLA 1EY3A 3QMJA 3ZW9A 3KTJA 4I52A 5IKLB 3STAA 1Q51A 4FN8A 2UZFA 4KNPA 1K32A 4JYJA 5G1SA 4IZCA 3OMEA 4NEKA 4MI2A 3HINA 3HRXA 4JCSA 3U9SB 4WZ8B 1WZ8A 4L6WA 3ZWBA 4FJWD 3H0UA 1DUBA 2J5IA 4NNQA 4OMRA 4FN7A 3V5IA 3GKBA 3MOYA 3Q0JA 1SZOA 4GHNA 1XNYA 2EJ5A 3QWDA 3MFMA 3V5EA 4IZBA 4KD6A 2W3PA 4JOTA 4RYFA 1EF8A 2VREA 3K8XA 3TDCA 3T8BA 1N6EA 1N6DA 4ASIA 4F47A 5DTPA 4RYFH 1K39A 3M6MA 1TYFA 2CBYA 2J5GD 4ZDCA 2J5SA 3QXZA 4ZU2A 4Q0GA 4QFEA 4B3IA 3MT6A 3HP0A 1XNWA 1W2XA 3KTIA 3BF0A 1UYSA 4FNDA 2X58A 4QIJA 2A7SA 3U9TB 3NJBA 1MJ3A 2IEXA 3NJDA 3H81A 2HW5A 5E0SA 3TT6A 5JBXA 2J5GA 3PE8A 5DUCA 5JBWA 2F9IA 1WDLA 2Q35A 2VSUC 2PBPA 3MYBA 5DU8A 3QYRA 1FCFA 1NZYB 1JXZA 4RCNA 5DZKH 1YG8A 3Q0GA 3P2LA 5C90A 4K3WA 4EMLA 1UYTA 3M6NA 1Y7OA 4EMPA 1XNVA 4ZDDA 3TRRA 3ISAA 2F6IA 4G2RA 2Q2XA 4JVTA 2VSSE 4FNBA 3H02A 3GMAA 2ZL2A 1RJNA 1XO6A 4OLQA 3LKEA 2WTBA 2A81A 3PGQA 3QXIA 4ELXA 3BPTA 1O8UA 3ZWAA 1ON9A 3RSTA 2X24A 3HLN1 2F9YA 4U0GH 3T3WA 4J2UA 4EMMA 1UYVA 4KPKA 2D3TA 3K50A 3I47A 2Q34A 3PZKA 5FUSA 3RSIA 3TZ3A 3WG5A 1NZYA 4U0HA 4HC8A 2ZQRA 2C8TA 3TVUA 5C9GA 4HNKA 3QKAA 3KTGA 4JFCA 2FW2A 5CTBA 3FDUA 1PIXA 3OC7A 1PJHA 2J5IB 2CE3A 5DTWA 4JCQA 4WCZA 5KDRA 1YG6A 5KJPA 3H0SA 3R6HA 2GTRA 5DKPA 4B3JA 3PEAA 3JU1A 2ZQQA 4JYLA 4KWBA 2F6QA 4Z0MA 5INIA 5FIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDF A;  1TG6 A;  4L8K A;  4JCR A;  1WDM A;  2VSS F;  4JSB A;  4ZDE A;  3IBB A;  3T89 A;  3TVW A;  4B3H A;  3ST9 A;  2A7K A;  3GF7 A;  3G64 A;  4YLH A;  1WDK A;  4U0G A;  5G1R A;  5CTC A;  5E0N X;  3SWX A;  3RRV A;  4U1A A;  3TLF A;  3ZWC A;  3GF3 A;  3TV5 A;  2F9I B;  4GM2 A;  1XX4 A;  4FZW C;  4WYO B;  2BZR A;  3QRE A;  1VRG A;  4I42 A;  5DL1 A;  5MGB A;  4JJT A;  3P5M A;  3L3S A;  3DOR A;  3DJA A;  2F9Y B;  1DCI A;  2ZL3 A;  2J5I I;  1Q52 A;  4ELW A;  4OG1 A;  3T8A A;  4JCT A;  1HZD A;  3LAO A;  2VX2 A;  3FF6 A;  4ZDB A;  2VSU E;  4K29 A;  4MOU A;  4MXI A;  4U18 A;  2NP9 A;  3TT7 A;  2VSU F;  3QK8 A;  5DUF A;  1RJM A;  3R9S A;  4I4Z A;  3OT6 A;  1SG4 A;  2VSU A;  2PPY A;  1HNU A;  3H0Q A;  4Q1I A;  4DI1 A;  1FC9 A;  4JWV A;  4U19 A;  3T88 A;  1OD4 A;  5DU4 A;  3Q7H A;  5E0S H;  2QQ3 A;  1ON3 A;  1UIY A;  2FBM A;  1UYR A;  2PG8 A;  2DUB A;  5DZK A;  3IB9 A;  1J7X A;  3VIV A;  1N6F A;  1X0U A;  3R9T A;  4LK5 A;  3ZW8 A;  1HNO A;  2ZL4 A;  2ZL0 A;  5DU6 A;  3R9Q A;  2VSS A;  3KTH A;  5INF A;  4FZW A;  5ING A;  3GLM A;  3P85 A;  4IZD A;  4K2N A;  4ELS A;  5KDR B;  3Q1T A;  4QII A;  3HE2 A;  5G1Q A;  3BEZ A;  3U9R B;  3R0O A;  3N6R B;  3H0J A;  1OD2 A;  3IAV A;  2DEO A;  3KQF A;  3BPP A;  2FZS A;  4FB8 A;  1FC6 A;  3KTK A;  1EF9 A;  1FC7 A;  3SLL A;  1EY3 A;  3QMJ A;  3ZW9 A;  3KTJ A;  4I52 A;  5IKL B;  3STA A;  1Q51 A;  4FN8 A;  2UZF A;  4KNP A;  1K32 A;  4JYJ A;  5G1S A;  4IZC A;  3OME A;  4NEK A;  4MI2 A;  3HIN A;  3HRX A;  4JCS A;  3U9S B;  4WZ8 B;  1WZ8 A;  4L6W A;  3ZWB A;  4FJW D;  3H0U A;  1DUB A;  2J5I A;  4NNQ A;  4OMR A;  4FN7 A;  3V5I A;  3GKB A;  3MOY A;  3Q0J A;  1SZO A;  4GHN A;  1XNY A;  2EJ5 A;  3QWD A;  3MFM A;  3V5E A;  4IZB A;  4KD6 A;  2W3P A;  4JOT A;  4RYF A;  1EF8 A;  2VRE A;  3K8X A;  3TDC A;  3T8B A;  1N6E A;  1N6D A;  4ASI A;  4F47 A;  5DTP A;  4RYF H;  1K39 A;  3M6M A;  1TYF A;  2CBY A;  2J5G D;  4ZDC A;  2J5S A;  3QXZ A;  4ZU2 A;  4Q0G A;  4QFE A;  4B3I A;  3MT6 A;  3HP0 A;  1XNW A;  1W2X A;  3KTI A;  3BF0 A;  1UYS A;  4FND A;  2X58 A;  4QIJ A;  2A7S A;  3U9T B;  3NJB A;  1MJ3 A;  2IEX A;  3NJD A;  3H81 A;  2HW5 A;  5E0S A;  3TT6 A;  5JBX A;  2J5G A;  3PE8 A;  5DUC A;  5JBW A;  2F9I A;  1WDL A;  2Q35 A;  2VSU C;  2PBP A;  3MYB A;  5DU8 A;  3QYR A;  1FCF A;  1NZY B;  1JXZ A;  4RCN A;  5DZK H;  1YG8 A;  3Q0G A;  3P2L A;  5C90 A;  4K3W A;  4EML A;  1UYT A;  3M6N A;  1Y7O A;  4EMP A;  1XNV A;  4ZDD A;  3TRR A;  3ISA A;  2F6I A;  4G2R A;  2Q2X A;  4JVT A;  2VSS E;  4FNB A;  3H02 A;  3GMA A;  2ZL2 A;  1RJN A;  1XO6 A;  4OLQ A;  3LKE A;  2WTB A;  2A81 A;  3PGQ A;  3QXI A;  4ELX A;  1O8U A;  3ZWA A;  1ON9 A;  3RST A;  2X24 A;  3HLN 1;  2F9Y A;  4U0G H;  3T3W A;  4EMM A;  1UYV A;  4KPK A;  2D3T A;  3K50 A;  3I47 A;  2Q34 A;  3PZK A;  5FUS A;  3RSI A;  3TZ3 A;  3WG5 A;  1NZY A;  4U0H A;  4HC8 A;  2ZQR A;  2C8T A;  3TVU A;  5C9G A;  4HNK A;  3QKA A;  3KTG A;  4JFC A;  2FW2 A;  5CTB A;  3FDU A;  1PIX A;  3OC7 A;  1PJH A;  2J5I B;  2CE3 A;  5DTW A;  4JCQ A;  4WCZ A;  5KDR A;  1YG6 A;  5KJP A;  3H0S A;  3R6H A;  2GTR A;  5DKP A;  4B3J A;  3PEA A;  3JU1 A;  2ZQQ A;  4JYL A;  4KWB A;  2F6Q A;  4Z0M A;  5INI A;  5FIF A; 
#chains in the Genus database with same CATH topology
 4ZDF A;  1TG6 A;  4L8K A;  4JCR A;  1WDM A;  2VSS F;  4JSB A;  4ZDE A;  3IBB A;  3T89 A;  3TVW A;  4B3H A;  3ST9 A;  2A7K A;  3GF7 A;  3G64 A;  4YLH A;  1WDK A;  4U0G A;  5G1R A;  2YJG A;  5CTC A;  5E0N X;  3SWX A;  3RRV A;  4U1A A;  3TLF A;  3ZWC A;  3GF3 A;  3TV5 A;  2F9I B;  4GM2 A;  1XX4 A;  4FZW C;  4WYO B;  2BZR A;  3QRE A;  1VRG A;  4I42 A;  5DL1 A;  5MGB A;  4JJT A;  3P5M A;  3L3S A;  3DOR A;  3DJA A;  2F9Y B;  1DCI A;  2ZL3 A;  2J5I I;  1Q52 A;  4ELW A;  4OG1 A;  3T8A A;  4JCT A;  1HZD A;  3LAO A;  2VX2 A;  3FF6 A;  4ZDB A;  2VSU E;  4K29 A;  4MOU A;  4MXI A;  4U18 A;  2NP9 A;  3TT7 A;  2VSU F;  3QK8 A;  5DUF A;  1RJM A;  3R9S A;  4I4Z A;  3OT6 A;  1SG4 A;  2VSU A;  2PPY A;  1HNU A;  3H0Q A;  4Q1I A;  4DI1 A;  1FC9 A;  4JWV A;  4U19 A;  3T88 A;  1OD4 A;  5DU4 A;  3Q7H A;  5E0S H;  2QQ3 A;  1ON3 A;  1UIY A;  2FBM A;  1UYR A;  2PG8 A;  2DUB A;  5DZK A;  3IB9 A;  1J7X A;  3VIV A;  1N6F A;  4NAR A;  1X0U A;  4HDT A;  4LK5 A;  3R9T A;  3ZW8 A;  1HNO A;  2ZL4 A;  2ZL0 A;  5DU6 A;  3R9Q A;  5HUQ A;  2VSS A;  3KTH A;  5INF A;  4FZW A;  5ING A;  3GLM A;  3P85 A;  4IZD A;  4K2N A;  4ELS A;  5KDR B;  3Q1T A;  4QII A;  3HE2 A;  5G1Q A;  3BEZ A;  3U9R B;  3R0O A;  3N6R B;  3H0J A;  1OD2 A;  3IAV A;  2DEO A;  3KQF A;  3BPP A;  2FZS A;  4FB8 A;  1FC6 A;  3KTK A;  1EF9 A;  1FC7 A;  3SLL A;  1EY3 A;  3QMJ A;  3ZW9 A;  3KTJ A;  4I52 A;  5IKL B;  3STA A;  1Q51 A;  4FN8 A;  2UZF A;  4KNP A;  1K32 A;  4JYJ A;  5G1S A;  4IZC A;  3OME A;  4NEK A;  4MI2 A;  3HIN A;  3HRX A;  4JCS A;  3U9S B;  4WZ8 B;  1WZ8 A;  4L6W A;  3ZWB A;  4FJW D;  3H0U A;  1DUB A;  2J5I A;  4NNQ A;  4OMR A;  4FN7 A;  3V5I A;  3GKB A;  3MOY A;  3Q0J A;  1SZO A;  4GHN A;  1XNY A;  2EJ5 A;  3QWD A;  3MFM A;  3V5E A;  4IZB A;  4KD6 A;  2W3P A;  4JOT A;  4RYF A;  1EF8 A;  2VRE A;  3K8X A;  3TDC A;  3T8B A;  1N6E A;  1N6D A;  4ASI A;  4F47 A;  5DTP A;  4RYF H;  1K39 A;  3M6M A;  1TYF A;  2CBY A;  2J5G D;  4ZDC A;  2J5S A;  3QXZ A;  4ZU2 A;  4Q0G A;  4QFE A;  4B3I A;  3MT6 A;  3HP0 A;  1XNW A;  1W2X A;  3KTI A;  3BF0 A;  1UYS A;  4FND A;  2X58 A;  4QIJ A;  2A7S A;  3U9T B;  3NJB A;  1MJ3 A;  2IEX A;  3NJD A;  3H81 A;  2HW5 A;  5E0S A;  3TT6 A;  5JBX A;  2J5G A;  3PE8 A;  5DUC A;  5JBW A;  2F9I A;  1WDL A;  2Q35 A;  2VSU C;  2PBP A;  3MYB A;  5DU8 A;  3QYR A;  1FCF A;  1NZY B;  1JXZ A;  4RCN A;  5DZK H;  1YG8 A;  3Q0G A;  3P2L A;  5C90 A;  4K3W A;  4EML A;  1UYT A;  3M6N A;  1Y7O A;  4EMP A;  1XNV A;  4ZDD A;  3TRR A;  3ISA A;  2F6I A;  4G2R A;  2Q2X A;  4JVT A;  2VSS E;  4FNB A;  3H02 A;  3GMA A;  2ZL2 A;  1RJN A;  1XO6 A;  4OLQ A;  3LKE A;  2WTB A;  2A81 A;  3PGQ A;  3QXI A;  4ELX A;  3BPT A;  1O8U A;  3ZWA A;  1ON9 A;  3RST A;  2X24 A;  3HLN 1;  2F9Y A;  4U0G H;  3T3W A;  4J2U A;  4EMM A;  1UYV A;  4KPK A;  2D3T A;  3K50 A;  3I47 A;  2Q34 A;  3PZK A;  5FUS A;  3RSI A;  3TZ3 A;  3WG5 A;  1NZY A;  4U0H A;  4HC8 A;  2ZQR A;  2C8T A;  3TVU A;  5C9G A;  4HNK A;  3QKA A;  3KTG A;  4JFC A;  2FW2 A;  5CTB A;  3FDU A;  1PIX A;  3OC7 A;  1PJH A;  2J5I B;  2CE3 A;  5DTW A;  4JCQ A;  4WCZ A;  5KDR A;  1YG6 A;  5KJP A;  3H0S A;  3R6H A;  2GTR A;  5DKP A;  4B3J A;  3PEA A;  3JU1 A;  2ZQQ A;  4JYL A;  4KWB A;  2F6Q A;  4Z0M A;  5INI A;  5FIF A; 
#chains in the Genus database with same CATH homology
 4ZDF A;  1TG6 A;  4L8K A;  4JCR A;  1WDM A;  2VSS F;  4JSB A;  4ZDE A;  3IBB A;  3T89 A;  3TVW A;  4B3H A;  3ST9 A;  2A7K A;  3GF7 A;  3G64 A;  4YLH A;  1WDK A;  4U0G A;  5G1R A;  2YJG A;  5CTC A;  5E0N X;  3SWX A;  3RRV A;  4U1A A;  3TLF A;  3ZWC A;  3GF3 A;  3TV5 A;  2F9I B;  4GM2 A;  1XX4 A;  4FZW C;  4WYO B;  2BZR A;  3QRE A;  1VRG A;  4I42 A;  5DL1 A;  5MGB A;  4JJT A;  3P5M A;  3L3S A;  3DOR A;  3DJA A;  2F9Y B;  1DCI A;  2ZL3 A;  2J5I I;  1Q52 A;  4ELW A;  4OG1 A;  3T8A A;  4JCT A;  1HZD A;  3LAO A;  2VX2 A;  3FF6 A;  4ZDB A;  2VSU E;  4K29 A;  4MOU A;  4MXI A;  4U18 A;  2NP9 A;  3TT7 A;  2VSU F;  3QK8 A;  5DUF A;  1RJM A;  3R9S A;  4I4Z A;  3OT6 A;  1SG4 A;  2VSU A;  2PPY A;  1HNU A;  3H0Q A;  4Q1I A;  4DI1 A;  1FC9 A;  4JWV A;  4U19 A;  3T88 A;  1OD4 A;  5DU4 A;  3Q7H A;  5E0S H;  2QQ3 A;  1ON3 A;  1UIY A;  2FBM A;  1UYR A;  2PG8 A;  2DUB A;  5DZK A;  3IB9 A;  1J7X A;  3VIV A;  1N6F A;  4NAR A;  1X0U A;  4HDT A;  4LK5 A;  3R9T A;  3ZW8 A;  1HNO A;  2ZL4 A;  2ZL0 A;  5DU6 A;  3R9Q A;  5HUQ A;  2VSS A;  3KTH A;  5INF A;  4FZW A;  5ING A;  3GLM A;  3P85 A;  4IZD A;  4K2N A;  4ELS A;  5KDR B;  3Q1T A;  4QII A;  3HE2 A;  5G1Q A;  3BEZ A;  3U9R B;  3R0O A;  3N6R B;  3H0J A;  1OD2 A;  3IAV A;  2DEO A;  3KQF A;  3BPP A;  2FZS A;  4FB8 A;  1FC6 A;  3KTK A;  1EF9 A;  1FC7 A;  3SLL A;  1EY3 A;  3QMJ A;  3ZW9 A;  3KTJ A;  4I52 A;  5IKL B;  3STA A;  1Q51 A;  4FN8 A;  2UZF A;  4KNP A;  1K32 A;  4JYJ A;  5G1S A;  4IZC A;  3OME A;  4NEK A;  4MI2 A;  3HIN A;  3HRX A;  4JCS A;  3U9S B;  4WZ8 B;  1WZ8 A;  4L6W A;  3ZWB A;  4FJW D;  3H0U A;  1DUB A;  2J5I A;  4NNQ A;  4OMR A;  4FN7 A;  3V5I A;  3GKB A;  3MOY A;  3Q0J A;  1SZO A;  4GHN A;  1XNY A;  2EJ5 A;  3QWD A;  3MFM A;  3V5E A;  4IZB A;  4KD6 A;  2W3P A;  4JOT A;  4RYF A;  1EF8 A;  2VRE A;  3K8X A;  3TDC A;  3T8B A;  1N6E A;  1N6D A;  4ASI A;  4F47 A;  5DTP A;  4RYF H;  1K39 A;  3M6M A;  1TYF A;  2CBY A;  2J5G D;  4ZDC A;  2J5S A;  3QXZ A;  4ZU2 A;  4Q0G A;  4QFE A;  4B3I A;  3MT6 A;  3HP0 A;  1XNW A;  1W2X A;  3KTI A;  3BF0 A;  1UYS A;  4FND A;  2X58 A;  4QIJ A;  2A7S A;  3U9T B;  3NJB A;  1MJ3 A;  2IEX A;  3NJD A;  3H81 A;  2HW5 A;  5E0S A;  3TT6 A;  5JBX A;  2J5G A;  3PE8 A;  5DUC A;  5JBW A;  2F9I A;  1WDL A;  2Q35 A;  2VSU C;  2PBP A;  3MYB A;  5DU8 A;  3QYR A;  1FCF A;  1NZY B;  1JXZ A;  4RCN A;  5DZK H;  1YG8 A;  3Q0G A;  3P2L A;  5C90 A;  4K3W A;  4EML A;  1UYT A;  3M6N A;  1Y7O A;  4EMP A;  1XNV A;  4ZDD A;  3TRR A;  3ISA A;  2F6I A;  4G2R A;  2Q2X A;  4JVT A;  2VSS E;  4FNB A;  3H02 A;  3GMA A;  2ZL2 A;  1RJN A;  1XO6 A;  4OLQ A;  3LKE A;  2WTB A;  2A81 A;  3PGQ A;  3QXI A;  4ELX A;  3BPT A;  1O8U A;  3ZWA A;  1ON9 A;  3RST A;  2X24 A;  3HLN 1;  2F9Y A;  4U0G H;  3T3W A;  4J2U A;  4EMM A;  1UYV A;  4KPK A;  2D3T A;  3K50 A;  3I47 A;  2Q34 A;  3PZK A;  5FUS A;  3RSI A;  3TZ3 A;  3WG5 A;  1NZY A;  4U0H A;  4HC8 A;  2ZQR A;  2C8T A;  3TVU A;  5C9G A;  4HNK A;  3QKA A;  3KTG A;  4JFC A;  2FW2 A;  5CTB A;  3FDU A;  1PIX A;  3OC7 A;  1PJH A;  2J5I B;  2CE3 A;  5DTW A;  4JCQ A;  4WCZ A;  5KDR A;  1YG6 A;  5KJP A;  3H0S A;  3R6H A;  2GTR A;  5DKP A;  4B3J A;  3PEA A;  3JU1 A;  2ZQQ A;  4JYL A;  4KWB A;  2F6Q A;  4Z0M A;  5INI A;  5FIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...