4KDDA

Structure of mycobacterium tuberculosis ribosome recycling factor in presence of detergent
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kddA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kddA02
1ZVUA 4L8IA 3OEPA 5CJ9A 3L4JA 5MLC9 2XCRB 3OREA 3OPFA 5JSNB 3LAJA 4KC6A 1ISEA 3QX3A 3LF9A 4G0WA 1AB4A 1DD5A 2Y3PA 5JSBB 1B4AA 3FOEA 1XXAA 2PHCB 4OYDB 4J3NA 1F9NA 1GE9A 1BGWA 2KWAA 2XCOA 1EH1A 5JVOA 1WQGA 1EK8A 1WQHA 1WQFA 1IS1A 3LAPA 4KB2A 4DDQA 3NUHA 2RGRA 3VA7A 3L4KA 4G0VA 4G0UA 3V4GA 3FHZA 3ERED 2ZFZA 4GFQA 4JLRC 3BUEA 4KB4A 2XCQA 3LPXA 1XXCA 1WIHA 1XXBA 1BJTA 3CAGA 4KDDA 4KAWX 1Y698 2P5MA 3FOFA 4FM9A 1B4BA 3LHPS 3MMLB
chains in the Genus database with same CATH superfamily
4KMDA 3EQLA 3OEPA 4C3IC 5JFEA 3OPFA 1XZQA 4BKWA 4GTAA 1O2BA 4G0WA 5C4XC 4BBRC 5C3EC 3I4NC 5EGHA 4OYDB 5EGEA 2Y0SD 1SEUA 2KWAA 2NVXA 2NVXK 1SC7A 2V6UA 4C3IK 1DCPA 5M3MK 3VA7A 2PPBA 3S2HC 2GSOA 3HOVC 2NVTC 1EFWA 1XXBA 1BJTA 3FOFA 4A3CC 1BS2A 5C4XK 3HKZL 3T00A 1INNA 4BBRK 5C3EK 3I4NK 5M5YK 2XCRB 3GTQK 1TWCC 4YG2A 3QX3A 3N3YA 2GAGC 3S2HK 1SFOC 1I50A 1ZBSA 3GEIA 3HOVK 2NVTK 2O5IA 1TWGC 4AHCA 2Y0SA 4A3CK 3HOXC 1EK8A 4A3FC 4KATA 2BE5D 3FKIC 1O24A 1TWCK 4KMUA 4M1XA 1XXCA 4FM9A 1R9TA 1O29A 4C3JC 3H3VL 1SFOA 1SFOK 2E2IC 1TWGA 1J6XA 2R4GA 3HOXK 4QIWL 1Y1VC 3FKIK 2JA7K 3GTOC 2R92A 1XXAA 3S0XA 1BGWA 3A8IA 2E2IK 1HQMD 2BE5A 1MIUA 4XCHA 2O5JD 3SJRA 1Y1VK 1HI9A 4OIOA 3GTOA 3GTOK 2E2HC 3GTLC 4A3GK 1TWAA 2Y0SL 4LK0A 3K5OA 4P9SA 3HOWK 5C4JC 4G7ZA 4KC6A 3TFJA 3FOEA 2WB1A 1Y1WC 3M3YC 1G51A 3AD9C 4KN4A 4FZBA 1EH1A 4MQ9A 2PMZD 2E2HK 3GTLK 1JVIA 4FYDA 3ADAC 3GTPC 3K5NA 4PAAA 3L4KA 1IQ0A 1ZYRD 1Q8IA 5C4JK 2ZUFA 2O5JA 2GSNA 5TJ3A 4Y52C 3ERED 2P5MA 4KMAA 1ZVUA 4LK1A 3DU6A 3DU5A 3L4JA 5MLC9 1Y1WA 5IYCC 1Y1WK 3IPJA 3M3YK 4QJVB 1PJ5A 3GTPA 1ISEA 2JA6C 3GTPK 4A3BC 1T8IA 3S2DC 2V6TA 2R7ZC 2YU9A 5M5XK 3TFHA 4KMHA 4Y52K 2PMZA 4AYBD 4DDQA 3GTJK 5IYCK 4OIPA 4YFKA 3P9AA 1ZYRA 2GAHC 1K4TA 4Q4ZA 3FHZA 2JA6A 3LPXA 2JA6K 4KDDA 4A3BK 3S17C 3S2DK 4Y7NC 2R7ZA 2R7ZK 3N0CA 4L8IA 4C2MA 1O27A 5IP9C 2R93C 2PA8D 3LAJA 3PO3C 1I6HC 5IORA 1I3QA 4OIRA 2PHCB 5CQGA 3S1NC 4A3JK 4ILDA 3S17K 4Y7NK 3HOZC 4C3HC 4AYBA 1EI6A 5IP9K 4G0UA 2R93A 2R93K 1V5VA 4IP9A 4NOLA 1I50C 1O25A 2P8TA 1RRJA 1F93A 4A3DC 3PO3K 3SZYA 3LHPS 1I6HK 2CW0D 1RR8C 3S1NK 3K5MA 1VGXA 2PMZL 3HOZK 4JK1A 3K5LA 3LF9A 4GTLA 3M4OC 1YX2A 1R9TC 4LJZA 2F4QA 1I50K 4KM8A 1K83C 4A3MC 4A3DK 1J6VA 3TTGA 5HL8A 4GTBA 4LR2A 1TWHC 1L0WA 2R92C 5IOSA 4A3EC 4KB4A 1JQWA 2ZUEA 3M4OK 1VRQC 1LPQA 1B4BA 1R9TK 1A31A 1TWFC 1O28A 1K83A 1K83K 2CW0A 4A3MK 1IE0A 1TWGK 2B63A 1V9MA 5M3FK 1UV7A 1SMYA 1R5ZA 2FQOA 1IBAA 4Q5GA 4A3FK 3WVOA 1TWHA 1TWHK 5TMFA 2R92K 4LLGA 5IYDC 4A3EK 5IOQA 3RZOC 2WB1D 1GE9A 1TWAC 1USMA 3H0GC 1EJ9A 1WOSA 4C3JK 1TWFA 1TWFK 1IL2A 1J6WA 3RZDC 3S14C 2A69D 1WSRA 4JLRC 3AH5A 2JA5C 3SZZA 5D4DA 5IYDK 1USOA 4KN7A 3RZOK 2CFAB 2WAQD 1TWAK 3H0GA 3H0GK 3GEHA 2GSUA 4AH6A 4XSXA 4A3KC 3RZDK 3S14K 2Y3PA 4J3NA 2JA5A 2JA5K 1EQRA 4H3TA 4XLNA 4O26A 3M4AA 1BDFA 2D6FC 1O26A 3S16C 3S1RC 3A8JA 2A69A 2YU9C 4GZYA 1YNND 5IYBC 4A3KK 1O2AA 5IP7C 1NH3A 1X31C 4RMFA 2WAQA 3OREA 5JSNB 3AQPA 4OINA 4GT9A 1YNJD 4Q5VA 3HKZD 3S16K 3S1RK 4P5BA 4A93C 1K4SA 2YU9K 2VUMC 4WJ3M 5IYBK 4C2MC 5IOTA 1TGOA 5IP7K 1IS1A 4GTCA 4G7HA 2E2JC 2RGRA 2W7VA 3MAQA 1WOOA 4MEYA 4BLAA 3K59A 4LMOA 1I3QC 4GTEA 1WIHA 1YNNA 4A93K 2WB1L 2VUMA 2VUMK 5FJ8K 4C2MK 5FLMC 4FXDA 3AD8C 2E2JK 3H3VD 1F7VA 5E68A 1YNJA 3HKZA 3S1QC 3IAYA 4PABA 1I3QK 1ZQ1C 1KQ4A 5TMCA 4QIWD 1XZPB 4BXXC 3K58A 4O2DA 5C9HA 4A3IC 2WAQL 4ZH4A 2ZFZA 5FLMK 1C0AA 4XLPA 3S1QK 4KASA 2FQTA 5CJ9A 4D3ZA 4BXXK 1SMYD 4A3IK 1AB4A 4C3HK 1VJEA 1B4AA 2RH6A 3GTQC 4X6AC 4QIWA 3T01A 2B63C 4EJ3A 4LOWA 4D3YA 2JH3A 3BUEA 4XSZA 1I6VA 1VH2A 2EBBA 3MMLB 1A36A 1XZQB 3G4AA 1J98A 3GTQA 3DXJA 1IW7D 4X6AK 4LQYA 2B63K 4YFNA 4KM9A 2CFAA 2V6SA 3BP8C 4AYBL 3GTKC 3BP3A 5JSBB 4IP8A 1PJ6A 1F7UA 3T02A 1ZXOA 2A6ED 2XCOA 4Q5SA 1DCOA 2JA7C 1TWCA 4WJ4A 2A68D 1A35A 2PA8L 3HOUC 4QCLA 1RU0A 3GTKA 3GTKK 4GTFA 2B9SB 1DCHA 4F3EA 4OIQA 5C44C 3I4MC 4BY1C 1IW7A 3FKIA 2JA7A 5CHPA 3CQZC 4AN8A 4A3GC 4QJVA 1TL8A 3WODA 4P5AA 1F9NA 3HOUK 3HOWC 1R49A 2A6HD 3AQOA 2E2IA 2A6EA 1WQGA 1WQFA 4FGUA 4C45A 5C44K 3NUHA 4BBSC 3I4MK 4BY1K 1JOEA 2A68A 4GFQA 1Y1VA 2XCQA 3HXAA 1PJ7A 2JA8C 3K57A 3CQZA 4KAWX 3CQZK 3LAPA 4YFXA 1WORA 3JSTA 1YCLA 3Q3QA 4BLBA 3PO2C 4MEXA 4BBSK 3GTGC 2JA8K 4NOKA 3KYLA 2E2HA 3GTLA 2A6HA 3S1MC 4A3LC 1WQHA 1HQMA 5L46A 4KB2A 4G0VA 3GIRA 3PO2K 3G4CA 1XZPA 1WCMC 3GEEA 4GTDA 3GSIA 2NVQC 2NVYC 1O2FB 4G7OA 1VLOA 3AD7C 3GTMC 1WOPA 3GTGA 3K7AC 3GTJC 3GTGK 4NOIA 3HOYC 4BY7C 1XPPA 1WSVA 5M5WK 3S1MK 4A3LK 3N0BA 3S15C 3A8KA 4KARA 1DD5A 1WCMA 1WCMK 2NVQK 3GDZA 2NVYA 2NVYK 3GTMA 5JVOA 3GTMK 3GTJA 3K7AK 4WILA 3HOYK 4BY7K 3V4GA 4A3JC 3TFIA 1I6VD 3CAGA 3S15K 4NOMA 1Y698 2NVXC
chains in the Genus database with same CATH topology
4KMDA 1ZVUA 3OEPA 1A36A 3G4AA 3DU6A 3DU5A 4C3IC 5MLC9 3GTQA 1Y1WA 2CFAB 5JFEA 3L4JA 1IW7D 3H0GA 3OPFA 4LQYA 3GTPA 1ISEA 2GSUA 4KM9A 2CFAA 4BKWA 4GTAA 1O2BA 4G0WA 1T8IA 2Y3PA 5JSBB 4IP8A 2YU9A 5EGHA 4OYDB 4J3NA 2JA5A 5EGEA 4KMHA 1ZXOA 1SEUA 2A6ED 2KWAA 2XCOA 4H3TA 2NVXA 4O26A 3M4AA 2PMZA 1SC7A 4DDQA 1O26A 1TWCA 3VA7A 2A68D 1A35A 3P9AA 2GSOA 3FHZA 1K4TA 2JA6A 3LPXA 4QCLA 1XXBA 1BJTA 3FOFA 1YNND 4KDDA 3GTKA 1O2AA 4GTFA 2B9SB 2R7ZA 3N0CA 4L8IA 4F3EA 4C2MA 1O27A 1NH3A 2XCRB 2WAQA 3OREA 5JSNB 3LAJA 3FKIA 2JA7A 3AQPA 3QX3A 4GT9A 5CHPA 3N3YA 1YNJD 4Q5VA 4AN8A 1I50A 1ZBSA 1I3QA 1TL8A 5IORA 2PHCB 4P5BA 4P5AA 1K4SA 5CQGA 1F9NA 1R49A 2A6HD 4AHCA 3AQOA 2Y0SA 2E2IA 4ILDA 4C2MC 1WQGA 5IOTA 1TGOA 1EK8A 1WQFA 4FGUA 1IS1A 2BE5D 4GTCA 4KATA 4C3HC 3NUHA 4AYBA 1O24A 3MAQA 2RGRA 4G0UA 2R93A 4IP9A 4BLAA 4GFQA 1Y1VA 4NOLA 4LMOA 3K59A 1O25A 2XCQA 4GTEA 1RRJA 3K57A 1WIHA 1XXCA 3CQZA 4KAWX 1R9TA 1O29A 3LAPA 4FM9A 4C3JC 1SFOA 3LHPS 3Q3QA 2CW0D 1TWGA 1RR8C 2VUMA 4BLBA 3K5MA 2R4GA 3K5LA 4FXDA 3LF9A 4GTLA 3HKZA 2R92A 3IAYA 2F4QA 1XXAA 4KM8A 3S0XA 1KQ4A 1BGWA 4NOKA 3KYLA 2E2HA 3GTLA 3K58A 1WQHA 1HQMD 5C9HA 4KB2A 4GTBA 4LR2A 4M1XA 4G0VA 3G4CA 4GTDA 1MIUA 2ZFZA 2O5JD 5IOSA 4KB4A 3SJRA 3GTOA 1LPQA 1B4BA 3GTGA 4KASA 1A31A 1O28A 1K83A 1TWAA 5CJ9A 3K5OA 2B63A 1V9MA 4D3ZA 4KC6A 1R5ZA 1SMYD 4Q5GA 3N0BA 3WVOA 4KARA 1AB4A 1DD5A 1TWHA 1WCMA 1B4AA 2RH6A 3FOEA 2WB1A 5IOQA 2NVYA 1GE9A 4FZBA 1EH1A 1EJ9A 3GTMA 4QIWA 5JVOA 4EJ3A 3GTJA 4D3YA 4FYDA 2JH3A 1TWFA 3K5NA 3L4KA 1ZYRD 3V4GA 1Q8IA 2A69D 4JLRC 3AH5A 3BUEA 2GSNA 1I6VD 3CAGA 5TJ3A 4NOMA 1Y698 3ERED 2P5MA 4KMAA 3MMLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVU A;  4L8I A;  3OEP A;  5CJ9 A;  3L4J A;  5MLC 9;  2XCR B;  3ORE A;  3OPF A;  5JSN B;  3LAJ A;  4KC6 A;  1ISE A;  3QX3 A;  3LF9 A;  4G0W A;  1AB4 A;  1DD5 A;  2Y3P A;  5JSB B;  1B4A A;  3FOE A;  1XXA A;  2PHC B;  4OYD B;  4J3N A;  1F9N A;  1GE9 A;  1BGW A;  2KWA A;  2XCO A;  1EH1 A;  5JVO A;  1WQG A;  1EK8 A;  1WQH A;  1WQF A;  1IS1 A;  3LAP A;  4KB2 A;  4DDQ A;  3NUH A;  2RGR A;  3VA7 A;  3L4K A;  4G0V A;  4G0U A;  3V4G A;  3FHZ A;  3ERE D;  2ZFZ A;  4GFQ A;  4JLR C;  3BUE A;  4KB4 A;  2XCQ A;  3LPX A;  1XXC A;  1WIH A;  1XXB A;  1BJT A;  3CAG A;  4KDD A;  4KAW X;  1Y69 8;  2P5M A;  3FOF A;  4FM9 A;  1B4B A;  3LHP S;  3MML B; 
#chains in the Genus database with same CATH topology
 4KMD A;  3EQL A;  3OEP A;  4C3I C;  5JFE A;  3OPF A;  1XZQ A;  4BKW A;  4GTA A;  1O2B A;  4G0W A;  5C4X C;  4BBR C;  5C3E C;  3I4N C;  5EGH A;  4OYD B;  5EGE A;  2Y0S D;  1SEU A;  2KWA A;  2NVX A;  2NVX K;  1SC7 A;  2V6U A;  4C3I K;  1DCP A;  5M3M K;  3VA7 A;  2PPB A;  3S2H C;  2GSO A;  3HOV C;  2NVT C;  1EFW A;  1XXB A;  1BJT A;  3FOF A;  4A3C C;  1BS2 A;  5C4X K;  3HKZ L;  3T00 A;  1INN A;  4BBR K;  5C3E K;  3I4N K;  5M5Y K;  2XCR B;  3GTQ K;  1TWC C;  4YG2 A;  3QX3 A;  3N3Y A;  2GAG C;  3S2H K;  1SFO C;  1I50 A;  1ZBS A;  3GEI A;  3HOV K;  2NVT K;  2O5I A;  1TWG C;  4AHC A;  2Y0S A;  4A3C K;  3HOX C;  1EK8 A;  4A3F C;  4KAT A;  2BE5 D;  3FKI C;  1O24 A;  1TWC K;  4KMU A;  4M1X A;  1XXC A;  4FM9 A;  1R9T A;  1O29 A;  4C3J C;  3H3V L;  1SFO A;  1SFO K;  2E2I C;  1TWG A;  1J6X A;  2R4G A;  3HOX K;  4QIW L;  1Y1V C;  3FKI K;  2JA7 K;  3GTO C;  2R92 A;  1XXA A;  3S0X A;  1BGW A;  3A8I A;  2E2I K;  1HQM D;  2BE5 A;  1MIU A;  4XCH A;  2O5J D;  3SJR A;  1Y1V K;  1HI9 A;  4OIO A;  3GTO A;  3GTO K;  2E2H C;  3GTL C;  4A3G K;  1TWA A;  2Y0S L;  4LK0 A;  3K5O A;  4P9S A;  3HOW K;  5C4J C;  4G7Z A;  4KC6 A;  3TFJ A;  3FOE A;  2WB1 A;  1Y1W C;  3M3Y C;  1G51 A;  3AD9 C;  4KN4 A;  4FZB A;  1EH1 A;  4MQ9 A;  2PMZ D;  2E2H K;  3GTL K;  1JVI A;  4FYD A;  3ADA C;  3GTP C;  3K5N A;  4PAA A;  3L4K A;  1IQ0 A;  1ZYR D;  1Q8I A;  5C4J K;  2ZUF A;  2O5J A;  2GSN A;  5TJ3 A;  4Y52 C;  3ERE D;  2P5M A;  4KMA A;  1ZVU A;  4LK1 A;  3DU6 A;  3DU5 A;  3L4J A;  5MLC 9;  1Y1W A;  5IYC C;  1Y1W K;  3IPJ A;  3M3Y K;  4QJV B;  1PJ5 A;  3GTP A;  1ISE A;  2JA6 C;  3GTP K;  4A3B C;  1T8I A;  3S2D C;  2V6T A;  2R7Z C;  2YU9 A;  5M5X K;  3TFH A;  4KMH A;  4Y52 K;  2PMZ A;  4AYB D;  4DDQ A;  3GTJ K;  5IYC K;  4OIP A;  4YFK A;  3P9A A;  1ZYR A;  2GAH C;  1K4T A;  4Q4Z A;  3FHZ A;  2JA6 A;  3LPX A;  2JA6 K;  4KDD A;  4A3B K;  3S17 C;  3S2D K;  4Y7N C;  2R7Z A;  2R7Z K;  3N0C A;  4L8I A;  4C2M A;  1O27 A;  5IP9 C;  2R93 C;  2PA8 D;  3LAJ A;  3PO3 C;  1I6H C;  5IOR A;  1I3Q A;  4OIR A;  2PHC B;  5CQG A;  3S1N C;  4A3J K;  4ILD A;  3S17 K;  4Y7N K;  3HOZ C;  4C3H C;  4AYB A;  1EI6 A;  5IP9 K;  4G0U A;  2R93 A;  2R93 K;  1V5V A;  4IP9 A;  4NOL A;  1I50 C;  1O25 A;  2P8T A;  1RRJ A;  1F93 A;  4A3D C;  3PO3 K;  3SZY A;  3LHP S;  1I6H K;  2CW0 D;  1RR8 C;  3S1N K;  3K5M A;  1VGX A;  2PMZ L;  3HOZ K;  4JK1 A;  3K5L A;  3LF9 A;  4GTL A;  3M4O C;  1YX2 A;  1R9T C;  4LJZ A;  2F4Q A;  1I50 K;  4KM8 A;  1K83 C;  4A3M C;  4A3D K;  1J6V A;  3TTG A;  5HL8 A;  4GTB A;  4LR2 A;  1TWH C;  1L0W A;  2R92 C;  5IOS A;  4A3E C;  4KB4 A;  1JQW A;  2ZUE A;  3M4O K;  1VRQ C;  1LPQ A;  1B4B A;  1R9T K;  1A31 A;  1TWF C;  1O28 A;  1K83 A;  1K83 K;  2CW0 A;  4A3M K;  1IE0 A;  1TWG K;  2B63 A;  1V9M A;  5M3F K;  1UV7 A;  1SMY A;  1R5Z A;  2FQO A;  1IBA A;  4Q5G A;  4A3F K;  3WVO A;  1TWH A;  1TWH K;  5TMF A;  2R92 K;  4LLG A;  5IYD C;  4A3E K;  5IOQ A;  3RZO C;  2WB1 D;  1GE9 A;  1TWA C;  1USM A;  3H0G C;  1EJ9 A;  1WOS A;  4C3J K;  1TWF A;  1TWF K;  1IL2 A;  1J6W A;  3RZD C;  3S14 C;  2A69 D;  1WSR A;  4JLR C;  3AH5 A;  2JA5 C;  3SZZ A;  5D4D A;  5IYD K;  1USO A;  4KN7 A;  3RZO K;  2CFA B;  2WAQ D;  1TWA K;  3H0G A;  3H0G K;  3GEH A;  2GSU A;  4AH6 A;  4XSX A;  4A3K C;  3RZD K;  3S14 K;  2Y3P A;  4J3N A;  2JA5 A;  2JA5 K;  1EQR A;  4H3T A;  4XLN A;  4O26 A;  3M4A A;  1BDF A;  2D6F C;  1O26 A;  3S16 C;  3S1R C;  3A8J A;  2A69 A;  2YU9 C;  4GZY A;  1YNN D;  5IYB C;  4A3K K;  1O2A A;  5IP7 C;  1NH3 A;  1X31 C;  4RMF A;  2WAQ A;  3ORE A;  5JSN B;  3AQP A;  4OIN A;  4GT9 A;  1YNJ D;  4Q5V A;  3HKZ D;  3S16 K;  3S1R K;  4P5B A;  4A93 C;  1K4S A;  2YU9 K;  2VUM C;  4WJ3 M;  5IYB K;  4C2M C;  5IOT A;  1TGO A;  5IP7 K;  1IS1 A;  4GTC A;  4G7H A;  2E2J C;  2RGR A;  2W7V A;  3MAQ A;  1WOO A;  4MEY A;  4BLA A;  3K59 A;  4LMO A;  1I3Q C;  4GTE A;  1WIH A;  1YNN A;  4A93 K;  2WB1 L;  2VUM A;  2VUM K;  5FJ8 K;  4C2M K;  5FLM C;  4FXD A;  3AD8 C;  2E2J K;  3H3V D;  1F7V A;  5E68 A;  1YNJ A;  3HKZ A;  3S1Q C;  3IAY A;  4PAB A;  1I3Q K;  1ZQ1 C;  1KQ4 A;  5TMC A;  4QIW D;  1XZP B;  4BXX C;  3K58 A;  4O2D A;  5C9H A;  4A3I C;  2WAQ L;  4ZH4 A;  2ZFZ A;  5FLM K;  1C0A A;  4XLP A;  3S1Q K;  4KAS A;  2FQT A;  5CJ9 A;  4D3Z A;  4BXX K;  1SMY D;  4A3I K;  1AB4 A;  4C3H K;  1VJE A;  1B4A A;  2RH6 A;  3GTQ C;  4X6A C;  4QIW A;  3T01 A;  2B63 C;  4EJ3 A;  4LOW A;  4D3Y A;  2JH3 A;  3BUE A;  4XSZ A;  1I6V A;  1VH2 A;  2EBB A;  3MML B;  1A36 A;  1XZQ B;  3G4A A;  1J98 A;  3GTQ A;  3DXJ A;  1IW7 D;  4X6A K;  4LQY A;  2B63 K;  4YFN A;  4KM9 A;  2CFA A;  2V6S A;  3BP8 C;  4AYB L;  3GTK C;  3BP3 A;  5JSB B;  4IP8 A;  1PJ6 A;  1F7U A;  3T02 A;  1ZXO A;  2A6E D;  2XCO A;  4Q5S A;  1DCO A;  2JA7 C;  1TWC A;  4WJ4 A;  2A68 D;  1A35 A;  2PA8 L;  3HOU C;  4QCL A;  1RU0 A;  3GTK A;  3GTK K;  4GTF A;  2B9S B;  1DCH A;  4F3E A;  4OIQ A;  5C44 C;  3I4M C;  4BY1 C;  1IW7 A;  3FKI A;  2JA7 A;  5CHP A;  3CQZ C;  4AN8 A;  4A3G C;  4QJV A;  1TL8 A;  3WOD A;  4P5A A;  1F9N A;  3HOU K;  3HOW C;  1R49 A;  2A6H D;  3AQO A;  2E2I A;  2A6E A;  1WQG A;  1WQF A;  4FGU A;  4C45 A;  5C44 K;  3NUH A;  4BBS C;  3I4M K;  4BY1 K;  1JOE A;  2A68 A;  4GFQ A;  1Y1V A;  2XCQ A;  3HXA A;  1PJ7 A;  2JA8 C;  3K57 A;  3CQZ A;  4KAW X;  3CQZ K;  3LAP A;  4YFX A;  1WOR A;  3JST A;  1YCL A;  3Q3Q A;  4BLB A;  3PO2 C;  4MEX A;  4BBS K;  3GTG C;  2JA8 K;  4NOK A;  3KYL A;  2E2H A;  3GTL A;  2A6H A;  3S1M C;  4A3L C;  1WQH A;  1HQM A;  5L46 A;  4KB2 A;  4G0V A;  3GIR A;  3PO2 K;  3G4C A;  1XZP A;  1WCM C;  3GEE A;  4GTD A;  3GSI A;  2NVQ C;  2NVY C;  1O2F B;  4G7O A;  1VLO A;  3AD7 C;  3GTM C;  1WOP A;  3GTG A;  3K7A C;  3GTJ C;  3GTG K;  4NOI A;  3HOY C;  4BY7 C;  1XPP A;  1WSV A;  5M5W K;  3S1M K;  4A3L K;  3N0B A;  3S15 C;  3A8K A;  4KAR A;  1DD5 A;  1WCM A;  1WCM K;  2NVQ K;  3GDZ A;  2NVY A;  2NVY K;  3GTM A;  5JVO A;  3GTM K;  3GTJ A;  3K7A K;  4WIL A;  3HOY K;  4BY7 K;  3V4G A;  4A3J C;  3TFI A;  1I6V D;  3CAG A;  3S15 K;  4NOM A;  1Y69 8;  2NVX C; 
#chains in the Genus database with same CATH homology
 4KMD A;  1ZVU A;  3OEP A;  1A36 A;  3G4A A;  3DU6 A;  3DU5 A;  4C3I C;  5MLC 9;  3GTQ A;  1Y1W A;  2CFA B;  5JFE A;  3L4J A;  1IW7 D;  3H0G A;  3OPF A;  4LQY A;  3GTP A;  1ISE A;  2GSU A;  4KM9 A;  2CFA A;  4BKW A;  4GTA A;  1O2B A;  4G0W A;  1T8I A;  2Y3P A;  5JSB B;  4IP8 A;  2YU9 A;  5EGH A;  4OYD B;  4J3N A;  2JA5 A;  5EGE A;  4KMH A;  1ZXO A;  1SEU A;  2A6E D;  2KWA A;  2XCO A;  4H3T A;  2NVX A;  4O26 A;  3M4A A;  2PMZ A;  1SC7 A;  4DDQ A;  1O26 A;  1TWC A;  3VA7 A;  2A68 D;  1A35 A;  3P9A A;  2GSO A;  3FHZ A;  1K4T A;  2JA6 A;  3LPX A;  4QCL A;  1XXB A;  1BJT A;  3FOF A;  1YNN D;  4KDD A;  3GTK A;  1O2A A;  4GTF A;  2B9S B;  2R7Z A;  3N0C A;  4L8I A;  4F3E A;  4C2M A;  1O27 A;  1NH3 A;  2XCR B;  2WAQ A;  3ORE A;  5JSN B;  3LAJ A;  3FKI A;  2JA7 A;  3AQP A;  3QX3 A;  4GT9 A;  5CHP A;  3N3Y A;  1YNJ D;  4Q5V A;  4AN8 A;  1I50 A;  1ZBS A;  1I3Q A;  1TL8 A;  5IOR A;  2PHC B;  4P5B A;  4P5A A;  1K4S A;  5CQG A;  1F9N A;  1R49 A;  2A6H D;  4AHC A;  3AQO A;  2Y0S A;  2E2I A;  4ILD A;  4C2M C;  1WQG A;  5IOT A;  1TGO A;  1EK8 A;  1WQF A;  4FGU A;  1IS1 A;  2BE5 D;  4GTC A;  4KAT A;  4C3H C;  3NUH A;  4AYB A;  1O24 A;  3MAQ A;  2RGR A;  4G0U A;  2R93 A;  4IP9 A;  4BLA A;  4GFQ A;  1Y1V A;  4NOL A;  4LMO A;  3K59 A;  1O25 A;  2XCQ A;  4GTE A;  1RRJ A;  3K57 A;  1WIH A;  1XXC A;  3CQZ A;  4KAW X;  1R9T A;  1O29 A;  3LAP A;  4FM9 A;  4C3J C;  1SFO A;  3LHP S;  3Q3Q A;  2CW0 D;  1TWG A;  1RR8 C;  2VUM A;  4BLB A;  3K5M A;  2R4G A;  3K5L A;  4FXD A;  3LF9 A;  4GTL A;  3HKZ A;  2R92 A;  3IAY A;  2F4Q A;  1XXA A;  4KM8 A;  3S0X A;  1KQ4 A;  1BGW A;  4NOK A;  3KYL A;  2E2H A;  3GTL A;  3K58 A;  1WQH A;  1HQM D;  5C9H A;  4KB2 A;  4GTB A;  4LR2 A;  4M1X A;  4G0V A;  3G4C A;  4GTD A;  1MIU A;  2ZFZ A;  2O5J D;  5IOS A;  4KB4 A;  3SJR A;  3GTO A;  1LPQ A;  1B4B A;  3GTG A;  4KAS A;  1A31 A;  1O28 A;  1K83 A;  1TWA A;  5CJ9 A;  3K5O A;  2B63 A;  1V9M A;  4D3Z A;  4KC6 A;  1R5Z A;  1SMY D;  4Q5G A;  3N0B A;  3WVO A;  4KAR A;  1AB4 A;  1DD5 A;  1TWH A;  1WCM A;  1B4A A;  2RH6 A;  3FOE A;  2WB1 A;  5IOQ A;  2NVY A;  1GE9 A;  4FZB A;  1EH1 A;  1EJ9 A;  3GTM A;  4QIW A;  5JVO A;  4EJ3 A;  3GTJ A;  4D3Y A;  4FYD A;  2JH3 A;  1TWF A;  3K5N A;  3L4K A;  1ZYR D;  3V4G A;  1Q8I A;  2A69 D;  4JLR C;  3AH5 A;  3BUE A;  2GSN A;  1I6V D;  3CAG A;  5TJ3 A;  4NOM A;  1Y69 8;  3ERE D;  2P5M A;  4KMA A;  3MML B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...