4KDDA

Structure of mycobacterium tuberculosis ribosome recycling factor in presence of detergent
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kddA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kddA02
3L4JA 4OYDB 3LHPS 1B4BA 3VA7A 1XXAA 1AB4A 2Y3PA 1GE9A 2XCQA 2XCOA 1IS1A 2XCRB 3L4KA 4G0WA 5JSNB 5CJ9A 4KAWX 1ISEA 3BUEA 3MMLB 1DD5A 5JVOA 2PHCB 1Y698 3FOEA 1BJTA 4FM9A 2RGRA 1XXBA 1F9NA 3NUHA 4J3NA 4L8IA 1WQHA 1B4AA 1EH1A 1EK8A 4G0VA 1WIHA 4DDQA 5JSBB 1BGWA 2P5MA 3CAGA 4KC6A 3FHZA 3QX3A 1WQFA 1WQGA 4JLRC 3LPXA 3OREA 5MLC9 3ERED 3LAJA 4KB4A 1ZVUA 1XXCA 2ZFZA 3OEPA 4GFQA 3OPFA 3FOFA 4KDDA 2KWAA 4G0UA 3LF9A 4KB2A 3LAPA 3V4GA
chains in the Genus database with same CATH superfamily
2CW0D 3AQOA 4QCLA 3SZZA 2F4QA 2PMZL 4AHCA 2CW0A 2E2JC 2PA8D 4LK0A 1R5ZA 5IYCK 3NUHA 1IBAA 3RZDC 1SFOC 4LMOA 3FHZA 1TWFK 1R49A 2WB1A 1BS2A 3S15K 1Q8IA 1VGXA 3LPXA 1J98A 4FGUA 5FLMC 4P9SA 1VH2A 1K83A 4OYDB 3HOWC 1TGOA 3GDZA 4KM9A 2P8TA 4LR2A 3MAQA 4O2DA 3I4MC 4A3FC 2Y0SL 1WORA 4A3KC 4XSXA 5M5WK 3FKIA 4C2MA 3K5MA 5MLC9 3ERED 3H0GA 2PPBA 1SC7A 3OPFA 1RR8C 4OIRA 4C3IK 2E2IK 1I50K 4OIOA 1Y1WC 1YX2A 1C0AA 2A68D 1I6VA 4Q5VA 3EQLA 3HOYC 2Y3PA 3S2DC 2ZUEA 5IYBC 3GSIA 2V6SA 5L46A 1WOOA 1UV7A 3BUEA 3GTJC 2A68A 2JA8K 5C9HA 1V5VA 1EQRA 4C3JC 3GTKA 1TWHC 2NVYC 2O5IA 5CQGA 1O24A 3SJRA 3AD9C 4F3EA 3T00A 4O26A 1O2BA 3GTLC 3HOXK 1USMA 4A3MC 4KARA 1V9MA 5IYDK 1VLOA 4BY1K 4A93K 4PABA 3G4AA 3K57A 3L4KA 3H3VL 1USOA 3S1RC 2O5JA 4GTAA 4GTDA 4A3GC 2GSUA 4A3CK 1O2FB 5C4JC 3A8IA 3AH5A 1KQ4A 1WIHA 4AYBL 3QX3A 5TJ3A 3HXAA 3GTPA 4KATA 3T02A 4KDDA 2E2IA 3GTGA 1Y1VC 2GSNA 3S1NC 1K83K 3S1MK 4KB2A 4JK1A 3LAPA 2D6FC 4IP8A 4LK1A 3HOZK 1IS1A 3GTOA 3K7AK 4C2MC 3I4NC 1YCLA 4A3EK 2RGRA 5EGHA 2JA7C 4LQYA 1TWGC 5IOTA 3IAYA 3S14C 4L8IA 1XZPB 4RMFA 3KYLA 4MEXA 4D3YA 3CAGA 4KC6A 1JQWA 1SMYD 4NOMA 3FKIK 3LAJA 1MIUA 3H0GK 2BE5D 4GFQA 4LOWA 1SMYA 5M3FK 3LF9A 2EBBA 1J6XA 5IYCC 2JA5K 2BE5A 2CFAA 1XXAA 1RU0A 2GAHC 1TWFC 3S15C 3HOVK 1F93A 2PHCB 3GTQK 1F9NA 3M4OK 4Q5SA 3GTKK 4NOLA 2WB1D 1EFWA 2YU9K 1YNND 1WCMA 3HOUK 3S17C 4WILA 5JSBB 5M3MK 4P5BA 3K5NA 4XCHA 3HKZD 1YNNA 4NOIA 4BBSK 2E2HK 1XXCA 1HQMD 2ZFZA 2R92K 2WAQL 4WJ4A 2V6UA 4G7ZA 3GTMA 2KWAA 3PO2K 4A3DK 1IW7D 3HKZA 1HQMA 4KMHA 1XZQB 3VA7A 4FXDA 1GE9A 2XCQA 4BLAA 4YFXA 3RZOK 4PAAA 1IW7A 3S16K 5IP9K 3N0CA 1R9TA 4C3HK 2GSOA 4A3IK 1X31C 4C3IC 2E2IC 3AD8C 2R7ZA 3DU6A 1B4AA 1I50C 4C45A 1SEUA 5IOQA 1O2AA 4JLRC 4ZH4A 3GTPK 5EGEA 3M4AA 1I6VD 2A69D 2JA8C 3GTGK 5IP7K 2JA5A 1WOSA 2GAGC 1F7UA 2A69A 1RRJA 5C44K 2NVXA 5JSNB 3GTOK 2VUMK 4GTCA 2FQOA 2R4GA 3GTQA 3HOXC 4A3JK 2PA8L 4X6AK 1F7VA 5CHPA 3T01A 1A35A 4Q5GA 2YU9A 1PJ7A 5IYDC 4OIQA 4BY7C 4Y52K 1WQFA 1O25A 4BY1C 4IP9A 4A93C 4AYBA 2E2HA 3FOFA 1NH3A 2B63A 4A3KK 2R92A 2NVQC 4BXXK 4G0UA 2JH3A 5IOSA 4NOKA 4YFNA 4A3CC 2O5JD 2XCOA 3A8KA 4MQ9A 4A3BK 2RH6A 1DD5A 5JVOA 3TFJA 4QIWD 4GT9A 3S1QC 3A8JA 1WCMK 1K83C 1IL2A 3GTJK 1O28A 3CQZK 4QIWA 5FJ8K 4C3JK 1VJEA 3HOZC 1TWCK 1ZBSA 3K7AC 4A3EC 1I6HK 1SFOA 3GTMK 4KN4A 2PMZD 5E68A 5CJ9A 1ISEA 3GEHA 2VUMA 3FKIC 4KN7A 1O27A 1R9TK 1XXBA 2PMZA 4OINA 3H0GC 3SZYA 4KM8A 2R7ZK 3S1RK 2P5MA 5C4XK 1L0WA 3Q3QA 3N3YA 5C3EK 3BP8C 4KB4A 1VRQC 2R93K 1TL8A 3HOVC 2A6ED 5TMFA 3GTKC 4QJVA 3PO3K 2JA6K 3HOUC 3M3YK 2A6EA 2NVXK 1G51A 1JOEA 1I3QK 4G0WA 4KASA 4GZYA 1Y1VK 1Y1WA 1WOPA 4M1XA 2Y0SD 4BBSC 3WVOA 1EJ9A 3P9AA 1WQHA 1JVIA 1EK8A 4G0VA 3PO2C 4A3DC 4DDQA 1BGWA 4Y7NK 2NVTK 2Y0SA 3GTJA 1PJ6A 1TWAK 3CQZA 1PJ5A 1YNJD 3RZOC 1TWHA 4G7HA 1TWCA 2NVYA 3N0BA 3GEEA 3TFIA 4BBRK 4A3LK 1WSRA 2B63K 3S16C 5IP9C 4XSZA 4C3HC 1YNJA 4KMUA 3L4JA 4A3IC 1K4TA 1AB4A 3GTLA 1WSVA 2FQTA 1BDFA 4XLNA 4FM9A 3TTGA 1BJTA 3S2HK 3GTPC 1ZYRD 2B9SB 3K5OA 4AH6A 1HI9A 4FZBA 3GTGC 4GTEA 1DCOA 5HL8A 5IORA 5IP7C 4KMAA 4QJVB 1ZYRA 3WODA 2E2JK 2CFAB 4LLGA 5C44C 1ZXOA 2R93A 3GTOC 2VUMC 3S17K 2W7VA 3RZDK 1SFOK 4X6AC 4A3JC 3LHPS 3H3VD 5FLMK 2JA6A 1IQ0A 4YFKA 1I3QA 3TFHA 3JSTA 4Y52C 1Y1VA 4MEYA 4GTBA 1INNA 5TMCA 3FOEA 3BP3A 4AN8A 4J3NA 3HOWK 4BXXC 2WB1L 1EH1A 4AYBD 1T8IA 4EJ3A 1WQGA 1TWAA 1J6VA 2JA7A 3AQPA 1TWGA 3I4MK 3HKZL 1J6WA 4A3FK 4A3BC 4BKWA 1K4SA 1DCHA 1A31A 2V6TA 5D4DA 1B4BA 3ADAC 4D3ZA 1WCMC 4BLBA 2ZUFA 3CQZC 1LPQA 1ZQ1C 4G7OA 1Y1WK 1O29A 1TWCC 4XLPA 3HOYK 3S2DK 1I6HC 3GTMC 3K58A 5IYBK 3AD7C 1TWFA 1O26A 3S1MC 3K59A 4OIPA 4Q4ZA 1A36A 1TWHK 1DCPA 1XPPA 2NVYK 1XZPA 5M5YK 4BY7K 1R9TC 4ILDA 4WJ3M 2R7ZC 3GTLK 5C4XC 4A3MK 3GIRA 4KAWX 2NVQK 5C3EC 1Y698 2A6HD 3DXJA 2R93C 4FYDA 2A6HA 1IE0A 3PO3C 2JA5C 3OREA 2JA6C 3IPJA 3M3YC 2NVXC 1I3QC 1EI6A 2WAQD 3S1QK 4A3GK 3K5LA 1I50A 5C4JK 3GTQC 3DU5A 3GEIA 3S0XA 2WAQA 3M4OC 4P5AA 2XCRB 2YU9C 4GTFA 5JFEA 4Y7NC 2NVTC 4YG2A 1TWAC 3MMLB 3S1NK 4H3TA 1XZQA 4BBRC 2E2HC 4QIWL 4A3LC 2B63C 2R92C 5M5XK 3G4CA 4C2MK 3I4NK 4LJZA 4GTLA 2JA7K 1ZVUA 1TWGK 3OEPA 3S14K 4KMDA 3S2HC 3V4GA
chains in the Genus database with same CATH topology
2CW0D 4IP8A 3LHPS 3AQOA 4QCLA 2O5JD 2F4QA 2XCOA 2JA6A 1IS1A 4AHCA 3GTOA 1I3QA 4C2MC 1Y1VA 1DD5A 2RH6A 4GTBA 5JVOA 3FOEA 2RGRA 5EGHA 4LQYA 1R5ZA 5IOTA 3IAYA 4AN8A 4GT9A 3NUHA 4J3NA 4L8IA 1EH1A 4LMOA 3KYLA 3FHZA 1T8IA 4D3YA 1O28A 4KC6A 2WB1A 1R49A 3CAGA 4QIWA 1Q8IA 1SMYD 1WQGA 1TWAA 4NOMA 4EJ3A 4FGUA 2JA7A 3AQPA 3LPXA 3LAJA 1MIUA 1TWGA 1ZBSA 2BE5D 4GFQA 4BKWA 1K4SA 1SFOA 1K83A 1A31A 3LF9A 4OYDB 1B4BA 2CFAA 1XXAA 4D3ZA 1TGOA 4KM9A 4BLBA 5CJ9A 4LR2A 1ISEA 3MAQA 2VUMA 2PHCB 1LPQA 1O27A 1XXBA 2PMZA 1F9NA 1O29A 4NOLA 4KM8A 1YNND 1WCMA 3K58A 1TWFA 5JSBB 2P5MA 1O26A 3Q3QA 4P5BA 3K5NA 3N3YA 3FKIA 4C2MA 3K59A 3K5MA 5MLC9 3ERED 3H0GA 1A36A 4KB4A 1SC7A 1XXCA 1HQMD 1TL8A 1RR8C 2ZFZA 3OPFA 3GTMA 2KWAA 2A6ED 1IW7D 3HKZA 4ILDA 2A68D 4KMHA 3VA7A 4Q5VA 4FXDA 2Y3PA 1GE9A 2XCQA 4BLAA 4G0WA 4KASA 4KAWX 3BUEA 1Y698 3N0CA 1R9TA 1Y1WA 5C9HA 2A6HD 4M1XA 4C3JC 3WVOA 4FYDA 1EJ9A 3P9AA 3GTKA 2GSOA 4C3IC 1WQHA 5CQGA 3DU6A 2R7ZA 1B4AA 1EK8A 3SJRA 1O24A 4G0VA 4DDQA 1BGWA 4F3EA 2Y0SA 1SEUA 3GTJA 1O2AA 5IOQA 4O26A 4JLRC 3CQZA 3OREA 1YNJD 1O2BA 1TWHA 1TWCA 2NVYA 3N0BA 3M4AA 4KARA 1I6VD 1V9MA 3K5LA 2A69D 1I50A 5EGEA 4C3HC 3DU5A 3S0XA 3L4JA 2WAQA 2JA5A 1K4TA 1AB4A 3G4AA 1RRJA 3K57A 3GTLA 4P5AA 2XCRB 2NVXA 3L4KA 5JSNB 4GTFA 5JFEA 3MMLB 4GTCA 4FM9A 4GTAA 1BJTA 4GTDA 2R4GA 3GTQA 4H3TA 1ZYRD 2B9SB 3K5OA 2GSUA 5CHPA 4FZBA 1A35A 4Q5GA 2YU9A 3G4CA 3AH5A 1KQ4A 1WIHA 4GTEA 3QX3A 5IORA 4KMAA 5TJ3A 1WQFA 1O25A 4IP9A 2CFAB 4AYBA 4GTLA 3GTPA 1ZVUA 1ZXOA 4KATA 3OEPA 2R93A 2E2HA 4KB2A 3FOFA 1NH3A 2B63A 4KDDA 2R92A 3GTGA 2E2IA 2GSNA 4KMDA 4G0UA 2JH3A 5IOSA 4NOKA 3LAPA 3V4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4J A;  4OYD B;  3LHP S;  1B4B A;  3VA7 A;  1XXA A;  1AB4 A;  2Y3P A;  1GE9 A;  2XCQ A;  2XCO A;  1IS1 A;  2XCR B;  3L4K A;  4G0W A;  5JSN B;  5CJ9 A;  4KAW X;  1ISE A;  3BUE A;  3MML B;  1DD5 A;  5JVO A;  2PHC B;  1Y69 8;  3FOE A;  1BJT A;  4FM9 A;  2RGR A;  1XXB A;  1F9N A;  3NUH A;  4J3N A;  4L8I A;  1WQH A;  1B4A A;  1EH1 A;  1EK8 A;  4G0V A;  1WIH A;  4DDQ A;  5JSB B;  1BGW A;  2P5M A;  3CAG A;  4KC6 A;  3FHZ A;  3QX3 A;  1WQF A;  1WQG A;  4JLR C;  3LPX A;  3ORE A;  5MLC 9;  3ERE D;  3LAJ A;  4KB4 A;  1ZVU A;  1XXC A;  2ZFZ A;  3OEP A;  4GFQ A;  3OPF A;  3FOF A;  4KDD A;  2KWA A;  4G0U A;  3LF9 A;  4KB2 A;  3LAP A;  3V4G A; 
#chains in the Genus database with same CATH topology
 2CW0 D;  3AQO A;  4QCL A;  3SZZ A;  2F4Q A;  2PMZ L;  4AHC A;  2CW0 A;  2E2J C;  2PA8 D;  4LK0 A;  1R5Z A;  5IYC K;  3NUH A;  1IBA A;  3RZD C;  1SFO C;  4LMO A;  3FHZ A;  1TWF K;  1R49 A;  2WB1 A;  1BS2 A;  3S15 K;  1Q8I A;  1VGX A;  3LPX A;  1J98 A;  4FGU A;  5FLM C;  4P9S A;  1VH2 A;  1K83 A;  4OYD B;  3HOW C;  1TGO A;  3GDZ A;  4KM9 A;  2P8T A;  4LR2 A;  3MAQ A;  4O2D A;  3I4M C;  4A3F C;  2Y0S L;  1WOR A;  4A3K C;  4XSX A;  5M5W K;  3FKI A;  4C2M A;  3K5M A;  5MLC 9;  3ERE D;  3H0G A;  2PPB A;  1SC7 A;  3OPF A;  1RR8 C;  4OIR A;  4C3I K;  2E2I K;  1I50 K;  4OIO A;  1Y1W C;  1YX2 A;  1C0A A;  2A68 D;  1I6V A;  4Q5V A;  3EQL A;  3HOY C;  2Y3P A;  3S2D C;  2ZUE A;  5IYB C;  3GSI A;  2V6S A;  5L46 A;  1WOO A;  1UV7 A;  3BUE A;  3GTJ C;  2A68 A;  2JA8 K;  5C9H A;  1V5V A;  1EQR A;  4C3J C;  3GTK A;  1TWH C;  2NVY C;  2O5I A;  5CQG A;  1O24 A;  3SJR A;  3AD9 C;  4F3E A;  3T00 A;  4O26 A;  1O2B A;  3GTL C;  3HOX K;  1USM A;  4A3M C;  4KAR A;  1V9M A;  5IYD K;  1VLO A;  4BY1 K;  4A93 K;  4PAB A;  3G4A A;  3K57 A;  3L4K A;  3H3V L;  1USO A;  3S1R C;  2O5J A;  4GTA A;  4GTD A;  4A3G C;  2GSU A;  4A3C K;  1O2F B;  5C4J C;  3A8I A;  3AH5 A;  1KQ4 A;  1WIH A;  4AYB L;  3QX3 A;  5TJ3 A;  3HXA A;  3GTP A;  4KAT A;  3T02 A;  4KDD A;  2E2I A;  3GTG A;  1Y1V C;  2GSN A;  3S1N C;  1K83 K;  3S1M K;  4KB2 A;  4JK1 A;  3LAP A;  2D6F C;  4IP8 A;  4LK1 A;  3HOZ K;  1IS1 A;  3GTO A;  3K7A K;  4C2M C;  3I4N C;  1YCL A;  4A3E K;  2RGR A;  5EGH A;  2JA7 C;  4LQY A;  1TWG C;  5IOT A;  3IAY A;  3S14 C;  4L8I A;  1XZP B;  4RMF A;  3KYL A;  4MEX A;  4D3Y A;  3CAG A;  4KC6 A;  1JQW A;  1SMY D;  4NOM A;  3FKI K;  3LAJ A;  1MIU A;  3H0G K;  2BE5 D;  4GFQ A;  4LOW A;  1SMY A;  5M3F K;  3LF9 A;  2EBB A;  1J6X A;  5IYC C;  2JA5 K;  2BE5 A;  2CFA A;  1XXA A;  1RU0 A;  2GAH C;  1TWF C;  3S15 C;  3HOV K;  1F93 A;  2PHC B;  3GTQ K;  1F9N A;  3M4O K;  4Q5S A;  3GTK K;  4NOL A;  2WB1 D;  1EFW A;  2YU9 K;  1YNN D;  1WCM A;  3HOU K;  3S17 C;  4WIL A;  5JSB B;  5M3M K;  4P5B A;  3K5N A;  4XCH A;  3HKZ D;  1YNN A;  4NOI A;  4BBS K;  2E2H K;  1XXC A;  1HQM D;  2ZFZ A;  2R92 K;  2WAQ L;  4WJ4 A;  2V6U A;  4G7Z A;  3GTM A;  2KWA A;  3PO2 K;  4A3D K;  1IW7 D;  3HKZ A;  1HQM A;  4KMH A;  1XZQ B;  3VA7 A;  4FXD A;  1GE9 A;  2XCQ A;  4BLA A;  4YFX A;  3RZO K;  4PAA A;  1IW7 A;  3S16 K;  5IP9 K;  3N0C A;  1R9T A;  4C3H K;  2GSO A;  4A3I K;  1X31 C;  4C3I C;  2E2I C;  3AD8 C;  2R7Z A;  3DU6 A;  1B4A A;  1I50 C;  4C45 A;  1SEU A;  5IOQ A;  1O2A A;  4JLR C;  4ZH4 A;  3GTP K;  5EGE A;  3M4A A;  1I6V D;  2A69 D;  2JA8 C;  3GTG K;  5IP7 K;  2JA5 A;  1WOS A;  2GAG C;  1F7U A;  2A69 A;  1RRJ A;  5C44 K;  2NVX A;  5JSN B;  3GTO K;  2VUM K;  4GTC A;  2FQO A;  2R4G A;  3GTQ A;  3HOX C;  4A3J K;  2PA8 L;  4X6A K;  1F7V A;  5CHP A;  3T01 A;  1A35 A;  4Q5G A;  2YU9 A;  1PJ7 A;  5IYD C;  4OIQ A;  4BY7 C;  4Y52 K;  1WQF A;  1O25 A;  4BY1 C;  4IP9 A;  4A93 C;  4AYB A;  2E2H A;  3FOF A;  1NH3 A;  2B63 A;  4A3K K;  2R92 A;  2NVQ C;  4BXX K;  4G0U A;  2JH3 A;  5IOS A;  4NOK A;  4YFN A;  4A3C C;  2O5J D;  2XCO A;  3A8K A;  4MQ9 A;  4A3B K;  2RH6 A;  1DD5 A;  5JVO A;  3TFJ A;  4QIW D;  4GT9 A;  3S1Q C;  3A8J A;  1WCM K;  1K83 C;  1IL2 A;  3GTJ K;  1O28 A;  3CQZ K;  4QIW A;  5FJ8 K;  4C3J K;  1VJE A;  3HOZ C;  1TWC K;  1ZBS A;  3K7A C;  4A3E C;  1I6H K;  1SFO A;  3GTM K;  4KN4 A;  2PMZ D;  5E68 A;  5CJ9 A;  1ISE A;  3GEH A;  2VUM A;  3FKI C;  4KN7 A;  1O27 A;  1R9T K;  1XXB A;  2PMZ A;  4OIN A;  3H0G C;  3SZY A;  4KM8 A;  2R7Z K;  3S1R K;  2P5M A;  5C4X K;  1L0W A;  3Q3Q A;  3N3Y A;  5C3E K;  3BP8 C;  4KB4 A;  1VRQ C;  2R93 K;  1TL8 A;  3HOV C;  2A6E D;  5TMF A;  3GTK C;  4QJV A;  3PO3 K;  2JA6 K;  3HOU C;  3M3Y K;  2A6E A;  2NVX K;  1G51 A;  1JOE A;  1I3Q K;  4G0W A;  4KAS A;  4GZY A;  1Y1V K;  1Y1W A;  1WOP A;  4M1X A;  2Y0S D;  4BBS C;  3WVO A;  1EJ9 A;  3P9A A;  1WQH A;  1JVI A;  1EK8 A;  4G0V A;  3PO2 C;  4A3D C;  4DDQ A;  1BGW A;  4Y7N K;  2NVT K;  2Y0S A;  3GTJ A;  1PJ6 A;  1TWA K;  3CQZ A;  1PJ5 A;  1YNJ D;  3RZO C;  1TWH A;  4G7H A;  1TWC A;  2NVY A;  3N0B A;  3GEE A;  3TFI A;  4BBR K;  4A3L K;  1WSR A;  2B63 K;  3S16 C;  5IP9 C;  4XSZ A;  4C3H C;  1YNJ A;  4KMU A;  3L4J A;  4A3I C;  1K4T A;  1AB4 A;  3GTL A;  1WSV A;  2FQT A;  1BDF A;  4XLN A;  4FM9 A;  3TTG A;  1BJT A;  3S2H K;  3GTP C;  1ZYR D;  2B9S B;  3K5O A;  4AH6 A;  1HI9 A;  4FZB A;  3GTG C;  4GTE A;  1DCO A;  5HL8 A;  5IOR A;  5IP7 C;  4KMA A;  4QJV B;  1ZYR A;  3WOD A;  2E2J K;  2CFA B;  4LLG A;  5C44 C;  1ZXO A;  2R93 A;  3GTO C;  2VUM C;  3S17 K;  2W7V A;  3RZD K;  1SFO K;  4X6A C;  4A3J C;  3LHP S;  3H3V D;  5FLM K;  2JA6 A;  1IQ0 A;  4YFK A;  1I3Q A;  3TFH A;  3JST A;  4Y52 C;  1Y1V A;  4MEY A;  4GTB A;  1INN A;  5TMC A;  3FOE A;  3BP3 A;  4AN8 A;  4J3N A;  3HOW K;  4BXX C;  2WB1 L;  1EH1 A;  4AYB D;  1T8I A;  4EJ3 A;  1WQG A;  1TWA A;  1J6V A;  2JA7 A;  3AQP A;  1TWG A;  3I4M K;  3HKZ L;  1J6W A;  4A3F K;  4A3B C;  4BKW A;  1K4S A;  1DCH A;  1A31 A;  2V6T A;  5D4D A;  1B4B A;  3ADA C;  4D3Z A;  1WCM C;  4BLB A;  2ZUF A;  3CQZ C;  1LPQ A;  1ZQ1 C;  4G7O A;  1Y1W K;  1O29 A;  1TWC C;  4XLP A;  3HOY K;  3S2D K;  1I6H C;  3GTM C;  3K58 A;  5IYB K;  3AD7 C;  1TWF A;  1O26 A;  3S1M C;  3K59 A;  4OIP A;  4Q4Z A;  1A36 A;  1TWH K;  1DCP A;  1XPP A;  2NVY K;  1XZP A;  5M5Y K;  4BY7 K;  1R9T C;  4ILD A;  4WJ3 M;  2R7Z C;  3GTL K;  5C4X C;  4A3M K;  3GIR A;  4KAW X;  2NVQ K;  5C3E C;  1Y69 8;  2A6H D;  3DXJ A;  2R93 C;  4FYD A;  2A6H A;  1IE0 A;  3PO3 C;  2JA5 C;  3ORE A;  2JA6 C;  3IPJ A;  3M3Y C;  2NVX C;  1I3Q C;  1EI6 A;  2WAQ D;  3S1Q K;  4A3G K;  3K5L A;  1I50 A;  5C4J K;  3GTQ C;  3DU5 A;  3GEI A;  3S0X A;  2WAQ A;  3M4O C;  4P5A A;  2XCR B;  2YU9 C;  4GTF A;  5JFE A;  4Y7N C;  2NVT C;  4YG2 A;  1TWA C;  3MML B;  3S1N K;  4H3T A;  1XZQ A;  4BBR C;  2E2H C;  4QIW L;  4A3L C;  2B63 C;  2R92 C;  5M5X K;  3G4C A;  4C2M K;  3I4N K;  4LJZ A;  4GTL A;  2JA7 K;  1ZVU A;  1TWG K;  3OEP A;  3S14 K;  4KMD A;  3S2H C;  3V4G A; 
#chains in the Genus database with same CATH homology
 2CW0 D;  4IP8 A;  3LHP S;  3AQO A;  4QCL A;  2O5J D;  2F4Q A;  2XCO A;  2JA6 A;  1IS1 A;  4AHC A;  3GTO A;  1I3Q A;  4C2M C;  1Y1V A;  1DD5 A;  2RH6 A;  4GTB A;  5JVO A;  3FOE A;  2RGR A;  5EGH A;  4LQY A;  1R5Z A;  5IOT A;  3IAY A;  4AN8 A;  4GT9 A;  3NUH A;  4J3N A;  4L8I A;  1EH1 A;  4LMO A;  3KYL A;  3FHZ A;  1T8I A;  4D3Y A;  1O28 A;  4KC6 A;  2WB1 A;  1R49 A;  3CAG A;  4QIW A;  1Q8I A;  1SMY D;  1WQG A;  1TWA A;  4NOM A;  4EJ3 A;  4FGU A;  2JA7 A;  3AQP A;  3LPX A;  3LAJ A;  1MIU A;  1TWG A;  1ZBS A;  2BE5 D;  4GFQ A;  4BKW A;  1K4S A;  1SFO A;  1K83 A;  1A31 A;  3LF9 A;  4OYD B;  1B4B A;  2CFA A;  1XXA A;  4D3Z A;  1TGO A;  4KM9 A;  4BLB A;  5CJ9 A;  4LR2 A;  1ISE A;  3MAQ A;  2VUM A;  2PHC B;  1LPQ A;  1O27 A;  1XXB A;  2PMZ A;  1F9N A;  1O29 A;  4NOL A;  4KM8 A;  1YNN D;  1WCM A;  3K58 A;  1TWF A;  5JSB B;  2P5M A;  1O26 A;  3Q3Q A;  4P5B A;  3K5N A;  3N3Y A;  3FKI A;  4C2M A;  3K59 A;  3K5M A;  5MLC 9;  3ERE D;  3H0G A;  1A36 A;  4KB4 A;  1SC7 A;  1XXC A;  1HQM D;  1TL8 A;  1RR8 C;  2ZFZ A;  3OPF A;  3GTM A;  2KWA A;  2A6E D;  1IW7 D;  3HKZ A;  4ILD A;  2A68 D;  4KMH A;  3VA7 A;  4Q5V A;  4FXD A;  2Y3P A;  1GE9 A;  2XCQ A;  4BLA A;  4G0W A;  4KAS A;  4KAW X;  3BUE A;  1Y69 8;  3N0C A;  1R9T A;  1Y1W A;  5C9H A;  2A6H D;  4M1X A;  4C3J C;  3WVO A;  4FYD A;  1EJ9 A;  3P9A A;  3GTK A;  2GSO A;  4C3I C;  1WQH A;  5CQG A;  3DU6 A;  2R7Z A;  1B4A A;  1EK8 A;  3SJR A;  1O24 A;  4G0V A;  4DDQ A;  1BGW A;  4F3E A;  2Y0S A;  1SEU A;  3GTJ A;  1O2A A;  5IOQ A;  4O26 A;  4JLR C;  3CQZ A;  3ORE A;  1YNJ D;  1O2B A;  1TWH A;  1TWC A;  2NVY A;  3N0B A;  3M4A A;  4KAR A;  1I6V D;  1V9M A;  3K5L A;  2A69 D;  1I50 A;  5EGE A;  4C3H C;  3DU5 A;  3S0X A;  3L4J A;  2WAQ A;  2JA5 A;  1K4T A;  1AB4 A;  3G4A A;  1RRJ A;  3K57 A;  3GTL A;  4P5A A;  2XCR B;  2NVX A;  3L4K A;  5JSN B;  4GTF A;  5JFE A;  3MML B;  4GTC A;  4FM9 A;  4GTA A;  1BJT A;  4GTD A;  2R4G A;  3GTQ A;  4H3T A;  1ZYR D;  2B9S B;  3K5O A;  2GSU A;  5CHP A;  4FZB A;  1A35 A;  4Q5G A;  2YU9 A;  3G4C A;  3AH5 A;  1KQ4 A;  1WIH A;  4GTE A;  3QX3 A;  5IOR A;  4KMA A;  5TJ3 A;  1WQF A;  1O25 A;  4IP9 A;  2CFA B;  4AYB A;  4GTL A;  3GTP A;  1ZVU A;  1ZXO A;  4KAT A;  3OEP A;  2R93 A;  2E2H A;  4KB2 A;  3FOF A;  1NH3 A;  2B63 A;  4KDD A;  2R92 A;  3GTG A;  2E2I A;  2GSN A;  4KMD A;  4G0U A;  2JH3 A;  5IOS A;  4NOK A;  3LAP A;  3V4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...