4KDDA

Structure of mycobacterium tuberculosis ribosome recycling factor in presence of detergent
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kddA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kddA02
3FOEA 1XXAA 4G0WA 2Y3PA 4KAWX 4JLRC 3OEPA 3FOFA 3L4KA 3NUHA 1EK8A 3CAGA 2XCRB 2RGRA 1ISEA 1WQFA 2PHCB 4KB2A 3OREA 2ZFZA 4FM9A 3ERED 2KWAA 3LHPS 3MMLB 4KB4A 4GFQA 1B4BA 5JVOA 3L4JA 4OYDB 3BUEA 1WIHA 4KDDA 5JSNB 1EH1A 1B4AA 3OPFA 3QX3A 3V4GA 5CJ9A 1IS1A 1BGWA 3LF9A 3LAPA 1F9NA 4J3NA 5MLC9 1XXCA 1GE9A 1Y698 4G0VA 3LAJA 1DD5A 1BJTA 1WQHA 3LPXA 4DDQA 3VA7A 4G0UA 2P5MA 5JSBB 2XCQA 2XCOA 1AB4A 4L8IA 1WQGA 3FHZA 4KC6A 1ZVUA 1XXBA
chains in the Genus database with same CATH superfamily
3GTOA 1Y1WK 1V9MA 2O5JD 3M4OK 4OIQA 5C3EK 3GTGA 5C9HA 1IE0A 3MMLB 3N3YA 1I6VD 1C0AA 3GTPA 5IYBC 2O5JA 1I50K 4JK1A 4A3DK 1WOOA 3WVOA 2R93A 5HL8A 3LAJA 2E2IA 1K4TA 2XCOA 3HOXC 3T00A 4A3KC 2GSUA 3K5NA 2NVYK 4OIPA 4A3GC 3PO2C 2CW0A 1I6HK 1MIUA 1TWFC 5IP9K 3S2DC 2PA8D 3RZOC 3ERED 4GTEA 4ZH4A 5C4XK 5C44C 4KDDA 4GTLA 1VH2A 5IYDK 2A6HD 3HOWC 1K83A 1TWGA 1L0WA 2NVXK 2NVYA 1O2BA 4A3MK 5FLMC 3GEIA 4QJVA 4G0VA 1BJTA 3GSIA 5EGHA 1WQGA 3T02A 3CQZK 1Y1VC 1I50C 1YNND 4P5AA 4JLRC 2CFAB 4FGUA 3I4NC 1I6VA 3SJRA 4BBSC 1K83K 4YFNA 3S17K 3L4JA 3PO2K 3GTKA 3QX3A 4QIWD 1O26A 5C4JC 1TWCA 3AQPA 1A35A 1KQ4A 2GSNA 5IYCK 3S1MK 3GTMA 2V6UA 2B9SB 2PMZD 2E2HA 4AH6A 3HOZC 3H0GC 3HKZA 4FM9A 4KM8A 4M1XA 5JFEA 1JQWA 4Q5VA 3HKZL 4Q5SA 1RR8C 3GTGC 3HOYK 3GIRA 1IL2A 4P5BA 4GTCA 4QJVB 4BBRC 4MEYA 3GTJA 1ZYRA 1R9TA 3BUEA 3RZDC 2GAGC 4QIWL 1B4AA 1J6XA 3GTMK 2E2HK 4C3IK 4D3ZA 1IW7A 4LJZA 4BBSK 3HOVC 5TJ3A 1K4SA 3LPXA 4G0UA 1HQMA 1XXBA 3GEHA 4MQ9A 3HOUC 2JA6K 3OEPA 4YFXA 3SZYA 4A3CC 1ISEA 4MEXA 4AYBA 4EJ3A 3IAYA 3A8JA 1HQMD 3LHPS 4OYDB 5JSNB 2A68A 2BE5A 4FZBA 2B63A 4A3FC 1F7UA 4BXXK 1BGWA 3GTGK 2R92C 2YU9C 3K5MA 1XXCA 1GE9A 3Q3QA 1WSRA 5M3MK 4A3LC 3GTOC 1X31C 3HXAA 3S15K 1I50A 3FHZA 4KC6A 4A3EK 4QCLA 4BY1C 3PO3K 1EI6A 2JA5A 3K58A 3OREA 1Y1VA 1TWAC 4LQYA 4NOLA 4LOWA 1NH3A 2NVTK 1Y1WC 4C2MA 1VGXA 3V4GA 5IOQA 4OINA 3M4OC 5M3FK 3LF9A 3AH5A 1F93A 5C4XC 1Y698 4X6AK 1USOA 2A69D 4GTFA 5IYDC 2PMZL 5M5WK 3GTQK 3S1NC 3A8IA 2Y0SA 2R7ZK 4IP8A 4A3DC 3A8KA 1SMYA 2A68D 2BE5D 2XCRB 3TFIA 5CQGA 4KMHA 1IBAA 4KB2A 1R9TC 2A69A 1TWCK 3S15C 3HOXK 3DU5A 1V5VA 1BDFA 3FKIC 1XZPB 4A3EC 1VLOA 2NVYC 4A3GK 4KMAA 1INNA 2P8TA 2WB1L 5CJ9A 1ZBSA 3I4MC 1WOPA 3S14C 4KMUA 3S2DK 2R7ZA 3K5OA 3S17C 1O28A 1A31A 5L46A 1WQHA 2NVTC 1RU0A 2P5MA 4C45A 2V6TA 1HI9A 3M3YC 1AB4A 3S16K 2EBBA 4PABA 5C4JK 3S2HK 4LR2A 1XXAA 1TWHC 4BKWA 1LPQA 3L4KA 1O25A 3GTKC 3G4CA 4KB4A 4GFQA 1WCMK 3K57A 2B63C 1XZPA 3K7AK 1SFOC 3P9AA 3G4AA 3HKZD 3H0GA 1R9TK 5C3EC 1TWHA 1ZQ1C 2W7VA 1IQ0A 3IPJA 5M5YK 3S1QK 2E2HC 2PMZA 1J98A 4C3IC 3GTLK 4GTDA 2R93K 3AQOA 1YCLA 4GT9A 4RMFA 5M5XK 2E2IK 3NUHA 2R4GA 4A93C 4Y7NK 2VUMC 3AD9C 5EGEA 5IOSA 3M3YK 3S16C 2ZUEA 4C2MC 1EH1A 2JA5C 1TWHK 3OPFA 1IS1A 1G51A 4A3CK 4J3NA 1EJ9A 4A3BK 5MLC9 3GTLA 1YNJA 3BP3A 3MAQA 3RZOK 1O2AA 1TWGC 4C3JC 5C44K 4OIRA 1I3QC 3WODA 4YFKA 2YU9K 1A36A 4WJ4A 2A6ED 3HOWK 1PJ7A 2R92A 2NVQC 4A3IC 5IP7C 1WIHA 3GTLC 2WAQA 3HOUK 3PO3C 4KASA 2E2IC 4NOIA 2FQTA 4G7ZA 3CQZC 4LMOA 1Y1VK 4G7HA 1TWFK 4LK1A 5IP9C 1DCOA 2CFAA 3S1RK 2YU9A 1I3QA 1TWAK 2PPBA 5TMFA 1DD5A 2JA7K 3VA7A 3T01A 5IOTA 1O24A 1EFWA 1RRJA 1ZVUA 1O27A 3GDZA 4H3TA 4KAWX 4P9SA 1XPPA 4A3MC 4Y52K 5FLMK 3CAGA 2RGRA 4X6AC 2PHCB 3GTJC 2ZFZA 3GTQA 3ADAC 1TWFA 3H3VL 1TWAA 4QIWA 1I3QK 3AD7C 2ZUFA 1Q8IA 4F3EA 3DXJA 4XCHA 2WAQL 1YNJD 1F9NA 2JA8C 2GSOA 2NVQK 3GEEA 1PJ5A 4GTBA 1PJ6A 4IP9A 5CHPA 2WB1D 1R49A 1J6WA 2CW0D 1VJEA 3S1RC 2JH3A 2WAQD 3EQLA 1WQFA 1ZYRD 2JA7C 4NOMA 4OIOA 3H3VD 4FXDA 1WORA 3HOZK 3H0GK 4XLNA 3GTPC 1TGOA 2JA6A 3GTQC 3S1NK 3S2HC 2R7ZC 1XZQA 4G7OA 4YG2A 1WSVA 1WCMA 1TWCC 1IW7D 1SEUA 2B63K 2O5IA 3N0BA 4XSXA 4BLAA 1UV7A 3M4AA 3FOEA 5D4DA 4A3FK 2JA8K 3FOFA 1ZXOA 2FQOA 2NVXC 1F7VA 1YX2A 4A3LK 5JVOA 1Y1WA 3GTOK 3S1QC 4D3YA 1T8IA 4A3KK 5IORA 4BY1K 4ILDA 2PA8L 1SMYD 3TTGA 2F4QA 4C2MK 4KM9A 3K59A 5JSBB 2XCQA 1K83C 4BXXC 4KN4A 2R92K 2GAHC 4BY7C 1R5ZA 1EK8A 4KMDA 3JSTA 4Q4ZA 2E2JK 4C3HK 4FYDA 3FKIA 3TFJA 2KWAA 1YNNA 1TWGK 4C3JK 2NVXA 4AN8A 4WILA 2R93C 1JVIA 3DU6A 2V6SA 3I4NK 1USMA 4XLPA 4A3IK 5IP7K 2JA5K 3BP8C 1JOEA 4L8IA 3FKIK 4GTAA 1TL8A 1XZQB 3GTMC 3SZZA 4A3BC 2Y0SD 2JA7A 4O26A 4AYBL 3S14K 4GZYA 1EQRA 2A6EA 1DCPA 5TMCA 3CQZA 1SFOA 1B4BA 5IYCC 3S1MC 4A3JC 4PAAA 4XSZA 4BY7K 3AD8C 4LLGA 4Y52C 1BS2A 2A6HA 3K5LA 2RH6A 2E2JC 3LAPA 4C3HC 2JA6C 1SC7A 3HOYC 3GTKK 1WOSA 4WJ3M 5E68A 4BBRK 4DDQA 5FJ8K 4LK0A 1WCMC 3I4MK 3KYLA 3K7AC 1J6VA 3RZDK 1SFOK 4G0WA 2Y0SL 2Y3PA 5IYBK 1O29A 2VUMA 1O2FB 4AYBD 4O2DA 3HOVK 3N0CA 3S0XA 4AHCA 4KN7A 2WB1A 1DCHA 3GTJK 2D6FC 1I6HC 4KARA 4BLBA 4KATA 4A93K 3GTPK 4Y7NC 2VUMK 4A3JK 4NOKA 4Q5GA 1VRQC 3TFHA
chains in the Genus database with same CATH topology
4BLAA 3M4AA 4GTDA 3GTOA 3FOEA 1V9MA 2O5JD 3AQOA 3OEPA 4GT9A 1ZXOA 3FOFA 3NUHA 2R4GA 1ISEA 3GTGA 4AYBA 5C9HA 4EJ3A 3IAYA 5EGEA 5IOSA 1HQMD 3LHPS 3MMLB 5JVOA 1Y1WA 4OYDB 4C2MC 3N3YA 4D3YA 1EH1A 1I6VD 5JSNB 1T8IA 3GTPA 2B63A 3OPFA 4FZBA 1IS1A 1BGWA 5IORA 3K5MA 4ILDA 4J3NA 1EJ9A 5MLC9 1XXCA 3GTLA 1GE9A 3Q3QA 3WVOA 2R93A 1SMYD 3MAQA 2F4QA 3LAJA 2E2IA 4KM9A 3K59A 5JSBB 1K4TA 1O2AA 2XCQA 2XCOA 1I50A 4C3JC 3FHZA 4KC6A 2GSUA 4QCLA 3K5NA 1A36A 1MIUA 1R5ZA 2A6ED 2JA5A 1EK8A 4KMDA 3K58A 4FYDA 3OREA 3FKIA 1Y1VA 2KWAA 2R92A 3ERED 4GTEA 4LQYA 2NVXA 4NOLA 4AN8A 1NH3A 4KDDA 1WIHA 4GTLA 2WAQA 4C2MA 5IOQA 4KASA 3V4GA 2A6HD 4LMOA 3LF9A 3AH5A 3DU6A 1K83A 1TWGA 2CFAA 2YU9A 1I3QA 2NVYA 1O2BA 1Y698 4G0VA 1DD5A 1BJTA 5EGHA 3VA7A 2A69D 5IOTA 4GTFA 1O24A 1RRJA 4L8IA 1WQGA 4GTAA 1ZVUA 4P5AA 2Y0SA 1YNND 4IP8A 1O27A 4H3TA 1TL8A 4KAWX 4JLRC 2CFAB 4FGUA 2A68D 2BE5D 2JA7A 4O26A 3CAGA 2XCRB 2RGRA 3SJRA 5CQGA 2PHCB 4KMHA 4KB2A 2ZFZA 3GTQA 3CQZA 1TWFA 3DU5A 1SFOA 1B4BA 3L4JA 1TWAA 4QIWA 4KMAA 3GTKA 3QX3A 1Q8IA 4F3EA 5CJ9A 1ZBSA 1O26A 3K5LA 1TWCA 2RH6A 1YNJD 3LAPA 1F9NA 4C3HC 3AQPA 2R7ZA 1SC7A 1A35A 1KQ4A 2GSOA 3K5OA 2GSNA 1O28A 1A31A 3GTMA 1WQHA 2B9SB 4GTBA 4DDQA 2P5MA 2E2HA 1AB4A 3HKZA 4FM9A 3KYLA 4IP9A 4KM8A 4M1XA 5CHPA 4LR2A 5JFEA 4G0WA 1R49A 1XXAA 4Q5VA 2CW0D 1O29A 2Y3PA 2VUMA 4BKWA 1RR8C 1LPQA 3L4KA 2JH3A 1O25A 4P5BA 4GTCA 1WQFA 1ZYRD 4NOMA 4FXDA 3G4CA 4KB4A 4GFQA 3GTJA 3K57A 1R9TA 1TGOA 2JA6A 3BUEA 3N0CA 1B4AA 3P9AA 3S0XA 4AHCA 2WB1A 3G4AA 4D3ZA 1WCMA 3H0GA 4KARA 1IW7D 1SEUA 4BLBA 4KATA 1TWHA 5TJ3A 1K4SA 3LPXA 4G0UA 3N0BA 4NOKA 4Q5GA 1XXBA 2PMZA 4C3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOE A;  1XXA A;  4G0W A;  2Y3P A;  4KAW X;  4JLR C;  3OEP A;  3FOF A;  3L4K A;  3NUH A;  1EK8 A;  3CAG A;  2XCR B;  2RGR A;  1ISE A;  1WQF A;  2PHC B;  4KB2 A;  3ORE A;  2ZFZ A;  4FM9 A;  3ERE D;  2KWA A;  3LHP S;  3MML B;  4KB4 A;  4GFQ A;  1B4B A;  5JVO A;  3L4J A;  4OYD B;  3BUE A;  1WIH A;  4KDD A;  5JSN B;  1EH1 A;  1B4A A;  3OPF A;  3QX3 A;  3V4G A;  5CJ9 A;  1IS1 A;  1BGW A;  3LF9 A;  3LAP A;  1F9N A;  4J3N A;  5MLC 9;  1XXC A;  1GE9 A;  1Y69 8;  4G0V A;  3LAJ A;  1DD5 A;  1BJT A;  1WQH A;  3LPX A;  4DDQ A;  3VA7 A;  4G0U A;  2P5M A;  5JSB B;  2XCQ A;  2XCO A;  1AB4 A;  4L8I A;  1WQG A;  3FHZ A;  4KC6 A;  1ZVU A;  1XXB A; 
#chains in the Genus database with same CATH topology
 3GTO A;  1Y1W K;  1V9M A;  2O5J D;  3M4O K;  4OIQ A;  5C3E K;  3GTG A;  5C9H A;  1IE0 A;  3MML B;  3N3Y A;  1I6V D;  1C0A A;  3GTP A;  5IYB C;  2O5J A;  1I50 K;  4JK1 A;  4A3D K;  1WOO A;  3WVO A;  2R93 A;  5HL8 A;  3LAJ A;  2E2I A;  1K4T A;  2XCO A;  3HOX C;  3T00 A;  4A3K C;  2GSU A;  3K5N A;  2NVY K;  4OIP A;  4A3G C;  3PO2 C;  2CW0 A;  1I6H K;  1MIU A;  1TWF C;  5IP9 K;  3S2D C;  2PA8 D;  3RZO C;  3ERE D;  4GTE A;  4ZH4 A;  5C4X K;  5C44 C;  4KDD A;  4GTL A;  1VH2 A;  5IYD K;  2A6H D;  3HOW C;  1K83 A;  1TWG A;  1L0W A;  2NVX K;  2NVY A;  1O2B A;  4A3M K;  5FLM C;  3GEI A;  4QJV A;  4G0V A;  1BJT A;  3GSI A;  5EGH A;  1WQG A;  3T02 A;  3CQZ K;  1Y1V C;  1I50 C;  1YNN D;  4P5A A;  4JLR C;  2CFA B;  4FGU A;  3I4N C;  1I6V A;  3SJR A;  4BBS C;  1K83 K;  4YFN A;  3S17 K;  3L4J A;  3PO2 K;  3GTK A;  3QX3 A;  4QIW D;  1O26 A;  5C4J C;  1TWC A;  3AQP A;  1A35 A;  1KQ4 A;  2GSN A;  5IYC K;  3S1M K;  3GTM A;  2V6U A;  2B9S B;  2PMZ D;  2E2H A;  4AH6 A;  3HOZ C;  3H0G C;  3HKZ A;  4FM9 A;  4KM8 A;  4M1X A;  5JFE A;  1JQW A;  4Q5V A;  3HKZ L;  4Q5S A;  1RR8 C;  3GTG C;  3HOY K;  3GIR A;  1IL2 A;  4P5B A;  4GTC A;  4QJV B;  4BBR C;  4MEY A;  3GTJ A;  1ZYR A;  1R9T A;  3BUE A;  3RZD C;  2GAG C;  4QIW L;  1B4A A;  1J6X A;  3GTM K;  2E2H K;  4C3I K;  4D3Z A;  1IW7 A;  4LJZ A;  4BBS K;  3HOV C;  5TJ3 A;  1K4S A;  3LPX A;  4G0U A;  1HQM A;  1XXB A;  3GEH A;  4MQ9 A;  3HOU C;  2JA6 K;  3OEP A;  4YFX A;  3SZY A;  4A3C C;  1ISE A;  4MEX A;  4AYB A;  4EJ3 A;  3IAY A;  3A8J A;  1HQM D;  3LHP S;  4OYD B;  5JSN B;  2A68 A;  2BE5 A;  4FZB A;  2B63 A;  4A3F C;  1F7U A;  4BXX K;  1BGW A;  3GTG K;  2R92 C;  2YU9 C;  3K5M A;  1XXC A;  1GE9 A;  3Q3Q A;  1WSR A;  5M3M K;  4A3L C;  3GTO C;  1X31 C;  3HXA A;  3S15 K;  1I50 A;  3FHZ A;  4KC6 A;  4A3E K;  4QCL A;  4BY1 C;  3PO3 K;  1EI6 A;  2JA5 A;  3K58 A;  3ORE A;  1Y1V A;  1TWA C;  4LQY A;  4NOL A;  4LOW A;  1NH3 A;  2NVT K;  1Y1W C;  4C2M A;  1VGX A;  3V4G A;  5IOQ A;  4OIN A;  3M4O C;  5M3F K;  3LF9 A;  3AH5 A;  1F93 A;  5C4X C;  1Y69 8;  4X6A K;  1USO A;  2A69 D;  4GTF A;  5IYD C;  2PMZ L;  5M5W K;  3GTQ K;  3S1N C;  3A8I A;  2Y0S A;  2R7Z K;  4IP8 A;  4A3D C;  3A8K A;  1SMY A;  2A68 D;  2BE5 D;  2XCR B;  3TFI A;  5CQG A;  4KMH A;  1IBA A;  4KB2 A;  1R9T C;  2A69 A;  1TWC K;  3S15 C;  3HOX K;  3DU5 A;  1V5V A;  1BDF A;  3FKI C;  1XZP B;  4A3E C;  1VLO A;  2NVY C;  4A3G K;  4KMA A;  1INN A;  2P8T A;  2WB1 L;  5CJ9 A;  1ZBS A;  3I4M C;  1WOP A;  3S14 C;  4KMU A;  3S2D K;  2R7Z A;  3K5O A;  3S17 C;  1O28 A;  1A31 A;  5L46 A;  1WQH A;  2NVT C;  1RU0 A;  2P5M A;  4C45 A;  2V6T A;  1HI9 A;  3M3Y C;  1AB4 A;  3S16 K;  2EBB A;  4PAB A;  5C4J K;  3S2H K;  4LR2 A;  1XXA A;  1TWH C;  4BKW A;  1LPQ A;  3L4K A;  1O25 A;  3GTK C;  3G4C A;  4KB4 A;  4GFQ A;  1WCM K;  3K57 A;  2B63 C;  1XZP A;  3K7A K;  1SFO C;  3P9A A;  3G4A A;  3HKZ D;  3H0G A;  1R9T K;  5C3E C;  1TWH A;  1ZQ1 C;  2W7V A;  1IQ0 A;  3IPJ A;  5M5Y K;  3S1Q K;  2E2H C;  2PMZ A;  1J98 A;  4C3I C;  3GTL K;  4GTD A;  2R93 K;  3AQO A;  1YCL A;  4GT9 A;  4RMF A;  5M5X K;  2E2I K;  3NUH A;  2R4G A;  4A93 C;  4Y7N K;  2VUM C;  3AD9 C;  5EGE A;  5IOS A;  3M3Y K;  3S16 C;  2ZUE A;  4C2M C;  1EH1 A;  2JA5 C;  1TWH K;  3OPF A;  1IS1 A;  1G51 A;  4A3C K;  4J3N A;  1EJ9 A;  4A3B K;  5MLC 9;  3GTL A;  1YNJ A;  3BP3 A;  3MAQ A;  3RZO K;  1O2A A;  1TWG C;  4C3J C;  5C44 K;  4OIR A;  1I3Q C;  3WOD A;  4YFK A;  2YU9 K;  1A36 A;  4WJ4 A;  2A6E D;  3HOW K;  1PJ7 A;  2R92 A;  2NVQ C;  4A3I C;  5IP7 C;  1WIH A;  3GTL C;  2WAQ A;  3HOU K;  3PO3 C;  4KAS A;  2E2I C;  4NOI A;  2FQT A;  4G7Z A;  3CQZ C;  4LMO A;  1Y1V K;  4G7H A;  1TWF K;  4LK1 A;  5IP9 C;  1DCO A;  2CFA A;  3S1R K;  2YU9 A;  1I3Q A;  1TWA K;  2PPB A;  5TMF A;  1DD5 A;  2JA7 K;  3VA7 A;  3T01 A;  5IOT A;  1O24 A;  1EFW A;  1RRJ A;  1ZVU A;  1O27 A;  3GDZ A;  4H3T A;  4KAW X;  4P9S A;  1XPP A;  4A3M C;  4Y52 K;  5FLM K;  3CAG A;  2RGR A;  4X6A C;  2PHC B;  3GTJ C;  2ZFZ A;  3GTQ A;  3ADA C;  1TWF A;  3H3V L;  1TWA A;  4QIW A;  1I3Q K;  3AD7 C;  2ZUF A;  1Q8I A;  4F3E A;  3DXJ A;  4XCH A;  2WAQ L;  1YNJ D;  1F9N A;  2JA8 C;  2GSO A;  2NVQ K;  3GEE A;  1PJ5 A;  4GTB A;  1PJ6 A;  4IP9 A;  5CHP A;  2WB1 D;  1R49 A;  1J6W A;  2CW0 D;  1VJE A;  3S1R C;  2JH3 A;  2WAQ D;  3EQL A;  1WQF A;  1ZYR D;  2JA7 C;  4NOM A;  4OIO A;  3H3V D;  4FXD A;  1WOR A;  3HOZ K;  3H0G K;  4XLN A;  3GTP C;  1TGO A;  2JA6 A;  3GTQ C;  3S1N K;  3S2H C;  2R7Z C;  1XZQ A;  4G7O A;  4YG2 A;  1WSV A;  1WCM A;  1TWC C;  1IW7 D;  1SEU A;  2B63 K;  2O5I A;  3N0B A;  4XSX A;  4BLA A;  1UV7 A;  3M4A A;  3FOE A;  5D4D A;  4A3F K;  2JA8 K;  3FOF A;  1ZXO A;  2FQO A;  2NVX C;  1F7V A;  1YX2 A;  4A3L K;  5JVO A;  1Y1W A;  3GTO K;  3S1Q C;  4D3Y A;  1T8I A;  4A3K K;  5IOR A;  4BY1 K;  4ILD A;  2PA8 L;  1SMY D;  3TTG A;  2F4Q A;  4C2M K;  4KM9 A;  3K59 A;  5JSB B;  2XCQ A;  1K83 C;  4BXX C;  4KN4 A;  2R92 K;  2GAH C;  4BY7 C;  1R5Z A;  1EK8 A;  4KMD A;  3JST A;  4Q4Z A;  2E2J K;  4C3H K;  4FYD A;  3FKI A;  3TFJ A;  2KWA A;  1YNN A;  1TWG K;  4C3J K;  2NVX A;  4AN8 A;  4WIL A;  2R93 C;  1JVI A;  3DU6 A;  2V6S A;  3I4N K;  1USM A;  4XLP A;  4A3I K;  5IP7 K;  2JA5 K;  3BP8 C;  1JOE A;  4L8I A;  3FKI K;  4GTA A;  1TL8 A;  1XZQ B;  3GTM C;  3SZZ A;  4A3B C;  2Y0S D;  2JA7 A;  4O26 A;  4AYB L;  3S14 K;  4GZY A;  1EQR A;  2A6E A;  1DCP A;  5TMC A;  3CQZ A;  1SFO A;  1B4B A;  5IYC C;  3S1M C;  4A3J C;  4PAA A;  4XSZ A;  4BY7 K;  3AD8 C;  4LLG A;  4Y52 C;  1BS2 A;  2A6H A;  3K5L A;  2RH6 A;  2E2J C;  3LAP A;  4C3H C;  2JA6 C;  1SC7 A;  3HOY C;  3GTK K;  1WOS A;  4WJ3 M;  5E68 A;  4BBR K;  4DDQ A;  5FJ8 K;  4LK0 A;  1WCM C;  3I4M K;  3KYL A;  3K7A C;  1J6V A;  3RZD K;  1SFO K;  4G0W A;  2Y0S L;  2Y3P A;  5IYB K;  1O29 A;  2VUM A;  1O2F B;  4AYB D;  4O2D A;  3HOV K;  3N0C A;  3S0X A;  4AHC A;  4KN7 A;  2WB1 A;  1DCH A;  3GTJ K;  2D6F C;  1I6H C;  4KAR A;  4BLB A;  4KAT A;  4A93 K;  3GTP K;  4Y7N C;  2VUM K;  4A3J K;  4NOK A;  4Q5G A;  1VRQ C;  3TFH A; 
#chains in the Genus database with same CATH homology
 4BLA A;  3M4A A;  4GTD A;  3GTO A;  3FOE A;  1V9M A;  2O5J D;  3AQO A;  3OEP A;  4GT9 A;  1ZXO A;  3FOF A;  3NUH A;  2R4G A;  1ISE A;  3GTG A;  4AYB A;  5C9H A;  4EJ3 A;  3IAY A;  5EGE A;  5IOS A;  1HQM D;  3LHP S;  3MML B;  5JVO A;  1Y1W A;  4OYD B;  4C2M C;  3N3Y A;  4D3Y A;  1EH1 A;  1I6V D;  5JSN B;  1T8I A;  3GTP A;  2B63 A;  3OPF A;  4FZB A;  1IS1 A;  1BGW A;  5IOR A;  3K5M A;  4ILD A;  4J3N A;  1EJ9 A;  5MLC 9;  1XXC A;  3GTL A;  1GE9 A;  3Q3Q A;  3WVO A;  2R93 A;  1SMY D;  3MAQ A;  2F4Q A;  3LAJ A;  2E2I A;  4KM9 A;  3K59 A;  5JSB B;  1K4T A;  1O2A A;  2XCQ A;  2XCO A;  1I50 A;  4C3J C;  3FHZ A;  4KC6 A;  2GSU A;  4QCL A;  3K5N A;  1A36 A;  1MIU A;  1R5Z A;  2A6E D;  2JA5 A;  1EK8 A;  4KMD A;  3K58 A;  4FYD A;  3ORE A;  3FKI A;  1Y1V A;  2KWA A;  2R92 A;  3ERE D;  4GTE A;  4LQY A;  2NVX A;  4NOL A;  4AN8 A;  1NH3 A;  4KDD A;  1WIH A;  4GTL A;  2WAQ A;  4C2M A;  5IOQ A;  4KAS A;  3V4G A;  2A6H D;  4LMO A;  3LF9 A;  3AH5 A;  3DU6 A;  1K83 A;  1TWG A;  2CFA A;  2YU9 A;  1I3Q A;  2NVY A;  1O2B A;  1Y69 8;  4G0V A;  1DD5 A;  1BJT A;  5EGH A;  3VA7 A;  2A69 D;  5IOT A;  4GTF A;  1O24 A;  1RRJ A;  4L8I A;  1WQG A;  4GTA A;  1ZVU A;  4P5A A;  2Y0S A;  1YNN D;  4IP8 A;  1O27 A;  4H3T A;  1TL8 A;  4KAW X;  4JLR C;  2CFA B;  4FGU A;  2A68 D;  2BE5 D;  2JA7 A;  4O26 A;  3CAG A;  2XCR B;  2RGR A;  3SJR A;  5CQG A;  2PHC B;  4KMH A;  4KB2 A;  2ZFZ A;  3GTQ A;  3CQZ A;  1TWF A;  3DU5 A;  1SFO A;  1B4B A;  3L4J A;  1TWA A;  4QIW A;  4KMA A;  3GTK A;  3QX3 A;  1Q8I A;  4F3E A;  5CJ9 A;  1ZBS A;  1O26 A;  3K5L A;  1TWC A;  2RH6 A;  1YNJ D;  3LAP A;  1F9N A;  4C3H C;  3AQP A;  2R7Z A;  1SC7 A;  1A35 A;  1KQ4 A;  2GSO A;  3K5O A;  2GSN A;  1O28 A;  1A31 A;  3GTM A;  1WQH A;  2B9S B;  4GTB A;  4DDQ A;  2P5M A;  2E2H A;  1AB4 A;  3HKZ A;  4FM9 A;  3KYL A;  4IP9 A;  4KM8 A;  4M1X A;  5CHP A;  4LR2 A;  5JFE A;  4G0W A;  1R49 A;  1XXA A;  4Q5V A;  2CW0 D;  1O29 A;  2Y3P A;  2VUM A;  4BKW A;  1RR8 C;  1LPQ A;  3L4K A;  2JH3 A;  1O25 A;  4P5B A;  4GTC A;  1WQF A;  1ZYR D;  4NOM A;  4FXD A;  3G4C A;  4KB4 A;  4GFQ A;  3GTJ A;  3K57 A;  1R9T A;  1TGO A;  2JA6 A;  3BUE A;  3N0C A;  1B4A A;  3P9A A;  3S0X A;  4AHC A;  2WB1 A;  3G4A A;  4D3Z A;  1WCM A;  3H0G A;  4KAR A;  1IW7 D;  1SEU A;  4BLB A;  4KAT A;  1TWH A;  5TJ3 A;  1K4S A;  3LPX A;  4G0U A;  3N0B A;  4NOK A;  4Q5G A;  1XXB A;  2PMZ A;  4C3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...