4KDDA

Structure of mycobacterium tuberculosis ribosome recycling factor in presence of detergent
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
b'MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome-recycling factor
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kddA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kddA02
3L4KA 4DDQA 1EK8A 2ZFZA 1ZVUA 4FM9A 3CAGA 1WIHA 3LAJA 5MLC9 4OYDB 4J3NA 4KB4A 1AB4A 3QX3A 1DD5A 1XXBA 2XCRB 5JSNB 1BGWA 3LAPA 3OPFA 3MMLB 4G0WA 1EH1A 4L8IA 3NUHA 1B4AA 3V4GA 3FHZA 1WQFA 1B4BA 3L4JA 3FOFA 2RGRA 1GE9A 2PHCB 4JLRC 1Y698 3ERED 4G0UA 3VA7A 4KB2A 1BJTA 2P5MA 2KWAA 3BUEA 1WQGA 1ISEA 3OREA 3LHPS 1F9NA 2XCOA 3FOEA 4G0VA 2XCQA 3LPXA 5CJ9A 1WQHA 4KDDA 5JVOA 4KAWX 3OEPA 2Y3PA 1IS1A 4KC6A 1XXAA 3LF9A 4GFQA 5JSBB 1XXCA
chains in the Genus database with same CATH superfamily
5L46A 1PJ5A 4FZBA 3WODA 1TWGK 1TWHA 1F7UA 1VH2A 3QX3A 3S1RC 5FJ8K 4NOKA 4AYBA 2R92C 4BY7K 3HOUC 1SFOK 3AQOA 4QIWD 3GTOK 3HOXK 4AHCA 4KMHA 2R93C 4A3BC 4G7HA 4AYBL 2NVXA 1Y1VK 4Y7NC 1XXCA 2E2IC 4P5AA 1EK8A 2A6EA 5JFEA 1ZVUA 4OIQA 4BXXK 3GTPA 4PABA 1IW7D 3S16C 5IP9C 2RH6A 4LLGA 5M3MK 1JVIA 2V6TA 1K83A 3H0GK 5TMFA 1EH1A 1TWGA 1WQFA 4Q4ZA 3DXJA 1I3QC 4GTLA 1R9TC 1Y698 2CFAA 3N0CA 2A68D 2JA8K 3RZOC 3A8KA 3FOEA 4RMFA 4GTEA 2NVYC 4A3EC 1JQWA 4GTAA 3GTOA 2E2HK 4Q5SA 4BY1C 3S1QC 2PA8L 3GTLC 5JSBB 3S2DK 1J6VA 1I50A 4XSZA 3K5OA 4H3TA 2GAHC 1WIHA 3GTMK 4BKWA 1AB4A 1O29A 1XXBA 5IOTA 3I4NC 5IYDC 3MMLB 1TWAK 3FKIK 2P8TA 3V4GA 5D4DA 3S1MC 4FYDA 3HOVC 5IYCK 4QJVA 1YNNA 4G7ZA 4KB2A 3S14C 4XCHA 3GEIA 2CFAB 1VLOA 3HOYC 2JA6A 4Q5VA 4KM9A 4BBRK 3AQPA 4MQ9A 1EFWA 1R5ZA 3LF9A 1DCHA 3AD9C 1I3QA 1BDFA 4YFNA 4A3KC 5HL8A 3I4MK 4QCLA 2FQTA 3S2HC 1J98A 4J3NA 3GTJK 2JA5A 2O5JA 1TL8A 1B4AA 1EI6A 3K7AC 4GTCA 3K5MA 1TWHC 2A69A 4A3IC 4QJVB 1VJEA 4G0VA 1J6WA 3LPXA 4C2MK 3AD7C 4ILDA 4A3CC 2WB1D 4DDQA 1K4SA 3A8JA 4A3JC 2NVTK 4WJ4A 4MEXA 1WSRA 2NVQC 5C9HA 3PO2K 2F4QA 1USMA 4X6AC 5JSNB 3LAPA 1V5VA 4WJ3M 2NVXC 1I6VA 3GTJA 3K5LA 4KMUA 3DU6A 1VRQC 1ZYRD 1TGOA 2BE5A 1PJ6A 3GTPC 3S1NK 1IE0A 1TWGC 2ZUEA 3EQLA 2B63K 4GFQA 4C2MA 1G51A 4C45A 3HXAA 3BP8C 5IOSA 4XLNA 4Y52K 1XZQB 1YNJA 1Y1WK 4D3YA 3GTOC 3HOXC 2A6HD 1JOEA 4KMDA 4C3JK 1I50C 4IP8A 4OIPA 2GSNA 4YFKA 2XCOA 5C4XK 1WQHA 4C3IK 5JVOA 3S17C 3HKZA 1DCPA 5EGHA 3H3VD 3HOZK 4GT9A 2WAQD 2JH3A 5FLMK 1I6HK 4LQYA 2CW0D 4LJZA 3SZZA 4FM9A 2GSOA 3HOWK 4KN4A 5M5YK 4PAAA 1TWCK 4A3MK 2JA6C 3HKZL 2PMZD 3GTKK 1USOA 1HI9A 3S1RK 1J6XA 1Y1WA 2PHCB 4WILA 3N0BA 2E2HC 4A3GK 3A8IA 1BJTA 1SEUA 4AN8A 2P5MA 4OIRA 3GTQK 1IBAA 1EJ9A 3S2DC 1SMYD 3SZYA 5M5WK 2JA5C 2Y3PA 3GTMC 4O26A 1SFOA 3K59A 2JA7K 3M3YC 2R93K 4C3HK 4A3BK 4G7OA 3WVOA 3PO3K 4Y7NK 1Y1VA 1RR8C 5IYCC 4AH6A 4A3DK 3FHZA 5M3FK 3S16K 1DCOA 4XSXA 2FQOA 4BBRC 2ZUFA 4G0UA 1TWFK 3H0GA 3GTKA 4AYBD 1O2FB 3AD8C 3I4MC 3K58A 2Y0SA 3GTQA 3GTJC 3S15K 3T00A 3RZOK 4GTFA 3L4KA 2O5IA 3ADAC 4BY1K 2E2HA 1XPPA 1F93A 1EQRA 2JA7A 1HQMA 4JK1A 1O2BA 1Q8IA 2A6ED 3TTGA 4LMOA 2Y0SL 3GTMA 5IYBK 4C2MC 5C44K 1KQ4A 4YG2A 1F7VA 3GSIA 4KM8A 3HOVK 1MIUA 1TWAA 3FKIA 5CJ9A 2NVTC 3S14K 1TWFA 1O25A 3PO2C 4KATA 1INNA 3AH5A 1O24A 3GTGK 3RZDK 1XZQA 4BBSC 4QIWA 5C4JK 3S1NC 3OPFA 2GSUA 4MEYA 4G0WA 3S2HK 3JSTA 5C3EK 2R7ZK 3KYLA 4JLRC 4A93K 3GDZA 5EGEA 3VA7A 2B63C 2E2JC 4KARA 4QIWL 3S0XA 2D6FC 1ZBSA 1IL2A 1TWHK 1IW7A 1YNND 4Y52C 1Y1WC 3T02A 2WAQL 1WCMK 1RRJA 5IORA 1XZPA 2V6SA 3M4OK 4BY7C 4C3JC 4NOIA 1V9MA 3TFHA 2A68A 1SFOC 4LK1A 2VUMK 4P5BA 1SC7A 3GTGA 3K5NA 5C4XC 1HQMD 3L4JA 4M1XA 4C3IC 2NVXK 3HOZC 4A3LK 2O5JD 1WQGA 1PJ7A 1Y1VC 4A3FK 2R7ZA 5FLMC 4FGUA 3HOWC 4KAWX 4XLPA 4BXXC 1TWCC 4YFXA 5IP7K 2A69D 2YU9K 1K83K 3SJRA 3H0GC 3GTKC 2B63A 1XZPB 3CQZK 4A3GC 1WCMA 4L8IA 3Q3QA 3GTQC 1RU0A 2JA8C 4FXDA 4EJ3A 5TMCA 2VUMA 5M5XK 3BUEA 2JA7C 1ISEA 1I6VD 3OREA 2R92K 2B9SB 1I50K 3HOUK 4C3HC 4KDDA 4KC6A 3PO3C 2BE5D 1LPQA 4BLBA 1A35A 3S17K 1NH3A 2ZFZA 4A3DC 5E68A 3CAGA 1TWAC 3FKIC 4KB4A 4KMAA 3TFJA 2YU9A 2E2IK 1O28A 1TWFC 1BS2A 2JA6K 1TWCA 5IP9K 5IOQA 3CQZA 4NOLA 1GE9A 3ERED 1YNJD 3S15C 2WB1A 1WOSA 1C0AA 1X31C 3LHPS 3M4AA 1F9NA 1I3QK 1O2AA 1WOPA 4GTDA 3K57A 1R9TK 1IS1A 3GEHA 1IQ0A 1XXAA 4LR2A 2R92A 1K4TA 4KASA 2JA5K 3IPJA 2NVYK 4A3EK 4NOMA 2WB1L 3N3YA 3HKZD 5IYBC 3S1QK 3M3YK 2PPBA 3GTLK 1ZYRA 5C44C 2XCRB 4IP9A 2R93A 1YX2A 3DU5A 2R4GA 2RGRA 2E2IA 3I4NK 5IYDK 4ZH4A 2KWAA 3S1MK 1ZXOA 1ZQ1C 2GAGC 1YCLA 3G4CA 4KN7A 2PA8D 3GIRA 3P9AA 3IAYA 3GTGC 3RZDC 5C4JC 3HOYK 2A6HA 3T01A 1R9TA 2EBBA 1A36A 4O2DA 5C3EC 4GTBA 4OYDB 2R7ZC 1WORA 1BGWA 4A93C 2NVYA 4A3KK 4F3EA 3GEEA 3GTLA 4LOWA 2W7VA 2V6UA 2WAQA 1L0WA 4GZYA 1VGXA 1A31A 2CW0A 5CHPA 4P9SA 1O26A 3K7AK 1WCMC 3OEPA 1O27A 3BP3A 3M4OC 4A3IK 2PMZA 3H3VL 2VUMC 4LK0A 3LAJA 3TFIA 5MLC9 1R49A 1WSVA 2Y0SD 5CQGA 4OINA 4A3CK 1DD5A 4A3JK 4A3LC 1T8IA 3NUHA 4A3FC 1SMYA 2NVQK 1B4BA 4BBSK 3FOFA 2PMZL 4X6AK 4D3ZA 4Q5GA 1WOOA 5IP7C 4OIOA 4BLAA 5TJ3A 1K83C 2YU9C 1UV7A 2XCQA 1I6HC 3G4AA 3GTPK 2E2JK 3MAQA 4A3MC 3CQZC
chains in the Genus database with same CATH topology
1A35A 4GTFA 4DDQA 3L4KA 1NH3A 1K4SA 2ZFZA 4FZBA 3CAGA 2E2HA 1TWHA 5C9HA 4KB4A 2JA7A 2F4QA 4KMAA 3QX3A 2YU9A 1O2BA 5JSNB 3LAPA 1Q8IA 4NOKA 1O28A 2A6ED 4LMOA 4AYBA 3GTJA 3GTMA 3K5LA 1TWCA 4C2MC 3DU6A 5IOQA 3CQZA 4NOLA 1GE9A 1ZYRD 1KQ4A 1TGOA 3AQOA 1YNJD 3ERED 2WB1A 4KM8A 1MIUA 1TWAA 3FKIA 4AHCA 3LHPS 3M4AA 1F9NA 4KMHA 1O2AA 5CJ9A 4GTDA 3K57A 1IS1A 1TWFA 1O25A 2NVXA 1XXAA 4LR2A 4KATA 2R92A 4GFQA 1K4TA 1XXCA 4KASA 4C2MA 4P5AA 1EK8A 5JFEA 1ZVUA 3AH5A 3GTPA 4NOMA 3N3YA 1O24A 1IW7D 5IOSA 2RH6A 4QIWA 4IP9A 2XCRB 4D3YA 3OPFA 1K83A 2R93A 2GSUA 1EH1A 1TWGA 2A6HD 4G0WA 3DU5A 1WQFA 2R4GA 3KYLA 4KMDA 2RGRA 2E2IA 4GTLA 4IP8A 4JLRC 1Y698 5EGEA 3VA7A 2CFAA 2GSNA 3N0CA 2A68D 2KWAA 2XCOA 1ZXOA 4KARA 3FOEA 3S0XA 4GTEA 1WQHA 3G4CA 1ZBSA 5JVOA 3HKZA 4GTAA 3P9AA 3GTOA 3IAYA 5EGHA 1YNND 4GT9A 5JSBB 2JH3A 4LQYA 1I50A 2CW0D 1R9TA 4FM9A 1A36A 3K5OA 4H3TA 2GSOA 1WIHA 1RRJA 4GTBA 4OYDB 4BKWA 5IORA 1AB4A 1O29A 4C3JC 1XXBA 1BGWA 1V9MA 5IOTA 3MMLB 2NVYA 4P5BA 3V4GA 1SC7A 3GTGA 4F3EA 3K5NA 4FYDA 3GTLA 1HQMD 3L4JA 1Y1WA 4M1XA 4C3IC 2PHCB 3N0BA 4KB2A 1BJTA 1SEUA 4AN8A 2P5MA 2WAQA 1WQGA 2O5JD 1EJ9A 2CFAB 2R7ZA 1A31A 1SMYD 2JA6A 5CHPA 4Q5VA 1O26A 4FGUA 4KAWX 3OEPA 2Y3PA 4KM9A 4O26A 1SFOA 3AQPA 1O27A 1R5ZA 3K59A 3LF9A 2A69D 2PMZA 1I3QA 3SJRA 4QCLA 3LAJA 3WVOA 5MLC9 4J3NA 1R49A 1Y1VA 2B63A 5CQGA 1DD5A 1RR8C 2JA5A 1TL8A 1WCMA 4L8IA 1T8IA 1B4AA 3NUHA 3Q3QA 3FHZA 4FXDA 1B4BA 4EJ3A 3FOFA 4GTCA 4D3ZA 4Q5GA 4G0UA 2VUMA 3H0GA 3K5MA 3GTKA 3BUEA 1ISEA 1I6VD 3OREA 4BLAA 5TJ3A 4G0VA 2B9SB 2XCQA 3LPXA 4C3HC 4KDDA 4KC6A 3K58A 3G4AA 2Y0SA 3GTQA 2BE5D 4ILDA 1LPQA 3MAQA 4BLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4K A;  4DDQ A;  1EK8 A;  2ZFZ A;  1ZVU A;  4FM9 A;  3CAG A;  1WIH A;  3LAJ A;  5MLC 9;  4OYD B;  4J3N A;  4KB4 A;  1AB4 A;  3QX3 A;  1DD5 A;  1XXB A;  2XCR B;  5JSN B;  1BGW A;  3LAP A;  3OPF A;  3MML B;  4G0W A;  1EH1 A;  4L8I A;  3NUH A;  1B4A A;  3V4G A;  3FHZ A;  1WQF A;  1B4B A;  3L4J A;  3FOF A;  2RGR A;  1GE9 A;  2PHC B;  4JLR C;  1Y69 8;  3ERE D;  4G0U A;  3VA7 A;  4KB2 A;  1BJT A;  2P5M A;  2KWA A;  3BUE A;  1WQG A;  1ISE A;  3ORE A;  3LHP S;  1F9N A;  2XCO A;  3FOE A;  4G0V A;  2XCQ A;  3LPX A;  5CJ9 A;  1WQH A;  4KDD A;  5JVO A;  4KAW X;  3OEP A;  2Y3P A;  1IS1 A;  4KC6 A;  1XXA A;  3LF9 A;  4GFQ A;  5JSB B;  1XXC A; 
#chains in the Genus database with same CATH topology
 5L46 A;  1PJ5 A;  4FZB A;  3WOD A;  1TWG K;  1TWH A;  1F7U A;  1VH2 A;  3QX3 A;  3S1R C;  5FJ8 K;  4NOK A;  4AYB A;  2R92 C;  4BY7 K;  3HOU C;  1SFO K;  3AQO A;  4QIW D;  3GTO K;  3HOX K;  4AHC A;  4KMH A;  2R93 C;  4A3B C;  4G7H A;  4AYB L;  2NVX A;  1Y1V K;  4Y7N C;  1XXC A;  2E2I C;  4P5A A;  1EK8 A;  2A6E A;  5JFE A;  1ZVU A;  4OIQ A;  4BXX K;  3GTP A;  4PAB A;  1IW7 D;  3S16 C;  5IP9 C;  2RH6 A;  4LLG A;  5M3M K;  1JVI A;  2V6T A;  1K83 A;  3H0G K;  5TMF A;  1EH1 A;  1TWG A;  1WQF A;  4Q4Z A;  3DXJ A;  1I3Q C;  4GTL A;  1R9T C;  1Y69 8;  2CFA A;  3N0C A;  2A68 D;  2JA8 K;  3RZO C;  3A8K A;  3FOE A;  4RMF A;  4GTE A;  2NVY C;  4A3E C;  1JQW A;  4GTA A;  3GTO A;  2E2H K;  4Q5S A;  4BY1 C;  3S1Q C;  2PA8 L;  3GTL C;  5JSB B;  3S2D K;  1J6V A;  1I50 A;  4XSZ A;  3K5O A;  4H3T A;  2GAH C;  1WIH A;  3GTM K;  4BKW A;  1AB4 A;  1O29 A;  1XXB A;  5IOT A;  3I4N C;  5IYD C;  3MML B;  1TWA K;  3FKI K;  2P8T A;  3V4G A;  5D4D A;  3S1M C;  4FYD A;  3HOV C;  5IYC K;  4QJV A;  1YNN A;  4G7Z A;  4KB2 A;  3S14 C;  4XCH A;  3GEI A;  2CFA B;  1VLO A;  3HOY C;  2JA6 A;  4Q5V A;  4KM9 A;  4BBR K;  3AQP A;  4MQ9 A;  1EFW A;  1R5Z A;  3LF9 A;  1DCH A;  3AD9 C;  1I3Q A;  1BDF A;  4YFN A;  4A3K C;  5HL8 A;  3I4M K;  4QCL A;  2FQT A;  3S2H C;  1J98 A;  4J3N A;  3GTJ K;  2JA5 A;  2O5J A;  1TL8 A;  1B4A A;  1EI6 A;  3K7A C;  4GTC A;  3K5M A;  1TWH C;  2A69 A;  4A3I C;  4QJV B;  1VJE A;  4G0V A;  1J6W A;  3LPX A;  4C2M K;  3AD7 C;  4ILD A;  4A3C C;  2WB1 D;  4DDQ A;  1K4S A;  3A8J A;  4A3J C;  2NVT K;  4WJ4 A;  4MEX A;  1WSR A;  2NVQ C;  5C9H A;  3PO2 K;  2F4Q A;  1USM A;  4X6A C;  5JSN B;  3LAP A;  1V5V A;  4WJ3 M;  2NVX C;  1I6V A;  3GTJ A;  3K5L A;  4KMU A;  3DU6 A;  1VRQ C;  1ZYR D;  1TGO A;  2BE5 A;  1PJ6 A;  3GTP C;  3S1N K;  1IE0 A;  1TWG C;  2ZUE A;  3EQL A;  2B63 K;  4GFQ A;  4C2M A;  1G51 A;  4C45 A;  3HXA A;  3BP8 C;  5IOS A;  4XLN A;  4Y52 K;  1XZQ B;  1YNJ A;  1Y1W K;  4D3Y A;  3GTO C;  3HOX C;  2A6H D;  1JOE A;  4KMD A;  4C3J K;  1I50 C;  4IP8 A;  4OIP A;  2GSN A;  4YFK A;  2XCO A;  5C4X K;  1WQH A;  4C3I K;  5JVO A;  3S17 C;  3HKZ A;  1DCP A;  5EGH A;  3H3V D;  3HOZ K;  4GT9 A;  2WAQ D;  2JH3 A;  5FLM K;  1I6H K;  4LQY A;  2CW0 D;  4LJZ A;  3SZZ A;  4FM9 A;  2GSO A;  3HOW K;  4KN4 A;  5M5Y K;  4PAA A;  1TWC K;  4A3M K;  2JA6 C;  3HKZ L;  2PMZ D;  3GTK K;  1USO A;  1HI9 A;  3S1R K;  1J6X A;  1Y1W A;  2PHC B;  4WIL A;  3N0B A;  2E2H C;  4A3G K;  3A8I A;  1BJT A;  1SEU A;  4AN8 A;  2P5M A;  4OIR A;  3GTQ K;  1IBA A;  1EJ9 A;  3S2D C;  1SMY D;  3SZY A;  5M5W K;  2JA5 C;  2Y3P A;  3GTM C;  4O26 A;  1SFO A;  3K59 A;  2JA7 K;  3M3Y C;  2R93 K;  4C3H K;  4A3B K;  4G7O A;  3WVO A;  3PO3 K;  4Y7N K;  1Y1V A;  1RR8 C;  5IYC C;  4AH6 A;  4A3D K;  3FHZ A;  5M3F K;  3S16 K;  1DCO A;  4XSX A;  2FQO A;  4BBR C;  2ZUF A;  4G0U A;  1TWF K;  3H0G A;  3GTK A;  4AYB D;  1O2F B;  3AD8 C;  3I4M C;  3K58 A;  2Y0S A;  3GTQ A;  3GTJ C;  3S15 K;  3T00 A;  3RZO K;  4GTF A;  3L4K A;  2O5I A;  3ADA C;  4BY1 K;  2E2H A;  1XPP A;  1F93 A;  1EQR A;  2JA7 A;  1HQM A;  4JK1 A;  1O2B A;  1Q8I A;  2A6E D;  3TTG A;  4LMO A;  2Y0S L;  3GTM A;  5IYB K;  4C2M C;  5C44 K;  1KQ4 A;  4YG2 A;  1F7V A;  3GSI A;  4KM8 A;  3HOV K;  1MIU A;  1TWA A;  3FKI A;  5CJ9 A;  2NVT C;  3S14 K;  1TWF A;  1O25 A;  3PO2 C;  4KAT A;  1INN A;  3AH5 A;  1O24 A;  3GTG K;  3RZD K;  1XZQ A;  4BBS C;  4QIW A;  5C4J K;  3S1N C;  3OPF A;  2GSU A;  4MEY A;  4G0W A;  3S2H K;  3JST A;  5C3E K;  2R7Z K;  3KYL A;  4JLR C;  4A93 K;  3GDZ A;  5EGE A;  3VA7 A;  2B63 C;  2E2J C;  4KAR A;  4QIW L;  3S0X A;  2D6F C;  1ZBS A;  1IL2 A;  1TWH K;  1IW7 A;  1YNN D;  4Y52 C;  1Y1W C;  3T02 A;  2WAQ L;  1WCM K;  1RRJ A;  5IOR A;  1XZP A;  2V6S A;  3M4O K;  4BY7 C;  4C3J C;  4NOI A;  1V9M A;  3TFH A;  2A68 A;  1SFO C;  4LK1 A;  2VUM K;  4P5B A;  1SC7 A;  3GTG A;  3K5N A;  5C4X C;  1HQM D;  3L4J A;  4M1X A;  4C3I C;  2NVX K;  3HOZ C;  4A3L K;  2O5J D;  1WQG A;  1PJ7 A;  1Y1V C;  4A3F K;  2R7Z A;  5FLM C;  4FGU A;  3HOW C;  4KAW X;  4XLP A;  4BXX C;  1TWC C;  4YFX A;  5IP7 K;  2A69 D;  2YU9 K;  1K83 K;  3SJR A;  3H0G C;  3GTK C;  2B63 A;  1XZP B;  3CQZ K;  4A3G C;  1WCM A;  4L8I A;  3Q3Q A;  3GTQ C;  1RU0 A;  2JA8 C;  4FXD A;  4EJ3 A;  5TMC A;  2VUM A;  5M5X K;  3BUE A;  2JA7 C;  1ISE A;  1I6V D;  3ORE A;  2R92 K;  2B9S B;  1I50 K;  3HOU K;  4C3H C;  4KDD A;  4KC6 A;  3PO3 C;  2BE5 D;  1LPQ A;  4BLB A;  1A35 A;  3S17 K;  1NH3 A;  2ZFZ A;  4A3D C;  5E68 A;  3CAG A;  1TWA C;  3FKI C;  4KB4 A;  4KMA A;  3TFJ A;  2YU9 A;  2E2I K;  1O28 A;  1TWF C;  1BS2 A;  2JA6 K;  1TWC A;  5IP9 K;  5IOQ A;  3CQZ A;  4NOL A;  1GE9 A;  3ERE D;  1YNJ D;  3S15 C;  2WB1 A;  1WOS A;  1C0A A;  1X31 C;  3LHP S;  3M4A A;  1F9N A;  1I3Q K;  1O2A A;  1WOP A;  4GTD A;  3K57 A;  1R9T K;  1IS1 A;  3GEH A;  1IQ0 A;  1XXA A;  4LR2 A;  2R92 A;  1K4T A;  4KAS A;  2JA5 K;  3IPJ A;  2NVY K;  4A3E K;  4NOM A;  2WB1 L;  3N3Y A;  3HKZ D;  5IYB C;  3S1Q K;  3M3Y K;  2PPB A;  3GTL K;  1ZYR A;  5C44 C;  2XCR B;  4IP9 A;  2R93 A;  1YX2 A;  3DU5 A;  2R4G A;  2RGR A;  2E2I A;  3I4N K;  5IYD K;  4ZH4 A;  2KWA A;  3S1M K;  1ZXO A;  1ZQ1 C;  2GAG C;  1YCL A;  3G4C A;  4KN7 A;  2PA8 D;  3GIR A;  3P9A A;  3IAY A;  3GTG C;  3RZD C;  5C4J C;  3HOY K;  2A6H A;  3T01 A;  1R9T A;  2EBB A;  1A36 A;  4O2D A;  5C3E C;  4GTB A;  4OYD B;  2R7Z C;  1WOR A;  1BGW A;  4A93 C;  2NVY A;  4A3K K;  4F3E A;  3GEE A;  3GTL A;  4LOW A;  2W7V A;  2V6U A;  2WAQ A;  1L0W A;  4GZY A;  1VGX A;  1A31 A;  2CW0 A;  5CHP A;  4P9S A;  1O26 A;  3K7A K;  1WCM C;  3OEP A;  1O27 A;  3BP3 A;  3M4O C;  4A3I K;  2PMZ A;  3H3V L;  2VUM C;  4LK0 A;  3LAJ A;  3TFI A;  5MLC 9;  1R49 A;  1WSV A;  2Y0S D;  5CQG A;  4OIN A;  4A3C K;  1DD5 A;  4A3J K;  4A3L C;  1T8I A;  3NUH A;  4A3F C;  1SMY A;  2NVQ K;  1B4B A;  4BBS K;  3FOF A;  2PMZ L;  4X6A K;  4D3Z A;  4Q5G A;  1WOO A;  5IP7 C;  4OIO A;  4BLA A;  5TJ3 A;  1K83 C;  2YU9 C;  1UV7 A;  2XCQ A;  1I6H C;  3G4A A;  3GTP K;  2E2J K;  3MAQ A;  4A3M C;  3CQZ C; 
#chains in the Genus database with same CATH homology
 1A35 A;  4GTF A;  4DDQ A;  3L4K A;  1NH3 A;  1K4S A;  2ZFZ A;  4FZB A;  3CAG A;  2E2H A;  1TWH A;  5C9H A;  4KB4 A;  2JA7 A;  2F4Q A;  4KMA A;  3QX3 A;  2YU9 A;  1O2B A;  5JSN B;  3LAP A;  1Q8I A;  4NOK A;  1O28 A;  2A6E D;  4LMO A;  4AYB A;  3GTJ A;  3GTM A;  3K5L A;  1TWC A;  4C2M C;  3DU6 A;  5IOQ A;  3CQZ A;  4NOL A;  1GE9 A;  1ZYR D;  1KQ4 A;  1TGO A;  3AQO A;  1YNJ D;  3ERE D;  2WB1 A;  4KM8 A;  1MIU A;  1TWA A;  3FKI A;  4AHC A;  3LHP S;  3M4A A;  1F9N A;  4KMH A;  1O2A A;  5CJ9 A;  4GTD A;  3K57 A;  1IS1 A;  1TWF A;  1O25 A;  2NVX A;  1XXA A;  4LR2 A;  4KAT A;  2R92 A;  4GFQ A;  1K4T A;  1XXC A;  4KAS A;  4C2M A;  4P5A A;  1EK8 A;  5JFE A;  1ZVU A;  3AH5 A;  3GTP A;  4NOM A;  3N3Y A;  1O24 A;  1IW7 D;  5IOS A;  2RH6 A;  4QIW A;  4IP9 A;  2XCR B;  4D3Y A;  3OPF A;  1K83 A;  2R93 A;  2GSU A;  1EH1 A;  1TWG A;  2A6H D;  4G0W A;  3DU5 A;  1WQF A;  2R4G A;  3KYL A;  4KMD A;  2RGR A;  2E2I A;  4GTL A;  4IP8 A;  4JLR C;  1Y69 8;  5EGE A;  3VA7 A;  2CFA A;  2GSN A;  3N0C A;  2A68 D;  2KWA A;  2XCO A;  1ZXO A;  4KAR A;  3FOE A;  3S0X A;  4GTE A;  1WQH A;  3G4C A;  1ZBS A;  5JVO A;  3HKZ A;  4GTA A;  3P9A A;  3GTO A;  3IAY A;  5EGH A;  1YNN D;  4GT9 A;  5JSB B;  2JH3 A;  4LQY A;  1I50 A;  2CW0 D;  1R9T A;  4FM9 A;  1A36 A;  3K5O A;  4H3T A;  2GSO A;  1WIH A;  1RRJ A;  4GTB A;  4OYD B;  4BKW A;  5IOR A;  1AB4 A;  1O29 A;  4C3J C;  1XXB A;  1BGW A;  1V9M A;  5IOT A;  3MML B;  2NVY A;  4P5B A;  3V4G A;  1SC7 A;  3GTG A;  4F3E A;  3K5N A;  4FYD A;  3GTL A;  1HQM D;  3L4J A;  1Y1W A;  4M1X A;  4C3I C;  2PHC B;  3N0B A;  4KB2 A;  1BJT A;  1SEU A;  4AN8 A;  2P5M A;  2WAQ A;  1WQG A;  2O5J D;  1EJ9 A;  2CFA B;  2R7Z A;  1A31 A;  1SMY D;  2JA6 A;  5CHP A;  4Q5V A;  1O26 A;  4FGU A;  4KAW X;  3OEP A;  2Y3P A;  4KM9 A;  4O26 A;  1SFO A;  3AQP A;  1O27 A;  1R5Z A;  3K59 A;  3LF9 A;  2A69 D;  2PMZ A;  1I3Q A;  3SJR A;  4QCL A;  3LAJ A;  3WVO A;  5MLC 9;  4J3N A;  1R49 A;  1Y1V A;  2B63 A;  5CQG A;  1DD5 A;  1RR8 C;  2JA5 A;  1TL8 A;  1WCM A;  4L8I A;  1T8I A;  1B4A A;  3NUH A;  3Q3Q A;  3FHZ A;  4FXD A;  1B4B A;  4EJ3 A;  3FOF A;  4GTC A;  4D3Z A;  4Q5G A;  4G0U A;  2VUM A;  3H0G A;  3K5M A;  3GTK A;  3BUE A;  1ISE A;  1I6V D;  3ORE A;  4BLA A;  5TJ3 A;  4G0V A;  2B9S B;  2XCQ A;  3LPX A;  4C3H C;  4KDD A;  4KC6 A;  3K58 A;  3G4A A;  2Y0S A;  3GTQ A;  2BE5 D;  4ILD A;  1LPQ A;  3MAQ A;  4BLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...