4KDDA

Structure of mycobacterium tuberculosis ribosome recycling factor in presence of detergent
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Ribosome-recycling factor
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kddA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kddA02
1WQGA 5JSBB 1Y698 3FOFA 1EH1A 4KB2A 1XXAA 2XCQA 4J3NA 5JSNB 3FOEA 2XCOA 1BJTA 1IS1A 3L4KA 1ZVUA 1WQHA 4GFQA 3BUEA 4KDDA 3LPXA 2ZFZA 2XCRB 1DD5A 4FM9A 5MLC9 4G0VA 2RGRA 3LAPA 3FHZA 1B4BA 2PHCB 4KB4A 1GE9A 1AB4A 1XXBA 3QX3A 4DDQA 2KWAA 3NUHA 3VA7A 3V4GA 1B4AA 2Y3PA 4G0WA 4G0UA 4OYDB 1WQFA 4JLRC 4KC6A 3OREA 1EK8A 3MMLB 3LF9A 1WIHA 3OEPA 5CJ9A 3CAGA 5JVOA 3L4JA 3OPFA 4KAWX 1XXCA 4L8IA 1F9NA 1BGWA 2P5MA 3LHPS 3LAJA 3ERED 1ISEA
chains in the Genus database with same CATH superfamily
4A3MK 3DXJA 4A3EK 4GTLA 3GTLA 1O25A 2CFAA 2PPBA 4KDDA 4KMHA 2NVXA 2GAHC 1I6HC 4XCHA 3MAQA 3FHZA 2Y0SL 2YU9K 3S1MC 1Q8IA 5IYDC 2JA7K 2PHCB 2D6FC 2JA6K 4NOIA 4DDQA 3K5MA 1XPPA 3K5LA 1IL2A 5IOTA 3T00A 2RH6A 1WOSA 1WIHA 3GTKA 2JA5A 3I4NK 3S1RC 1L0WA 1WCMK 1Y1WK 4YFNA 3JSTA 1PJ5A 2A6ED 1EH1A 1YX2A 3BP8C 4BBSK 1TWFK 2PA8D 2A69D 3RZOK 1USMA 4KMAA 1RR8C 3GTOA 1A31A 3TTGA 2O5IA 4LLGA 5C4JK 1BS2A 4ZH4A 1G51A 3HOVC 5IYBC 3I4MK 1SFOC 2JA8K 4BXXC 3PO3K 3SZYA 4C3JK 4FXDA 3AQOA 2JA5K 3GTKK 1TWAK 1I50C 4YG2A 2Y3PA 4JK1A 4OYDB 1JVIA 3S2HK 2E2HC 2Y0SD 5JVOA 3LF9A 4LR2A 3OPFA 5M5XK 1O2AA 2JH3A 2F4QA 4PAAA 3GTOK 4A3GC 4YFKA 5IP7C 2R7ZC 5M5YK 3K58A 2PA8L 2A6EA 1SC7A 4KATA 5CQGA 4GTCA 3GTMC 3GTJC 2A6HD 4QIWA 5FLMC 2WAQD 1J98A 1C0AA 1Y1VK 1IW7A 4XSXA 4C2MC 4Y7NK 3S14C 3K57A 1WSRA 1TGOA 1XZPB 1ZXOA 3SZZA 4BBRC 1O28A 3A8JA 4Y52C 2E2IK 2NVYA 3K5OA 4KC6A 4Y52K 4A3IC 5CJ9A 1A36A 3CAGA 1ZYRA 4KAWX 2R92A 4C2MK 2ZUEA 1Y698 3HOZK 2FQTA 4WILA 3HOUC 3H3VL 1ZQ1C 2CW0A 4BKWA 3GTMK 1O29A 1ZVUA 2NVTK 1XZQB 4C3HK 3M4OC 2NVYC 3N0BA 4BY7K 4LQYA 1J6XA 4AHCA 1O2FB 2W7VA 3FKIC 3G4AA 3GEHA 3M4AA 3S15K 2E2HK 3H0GA 1TWHC 3GTPC 4KN4A 5C3EK 3GTMA 1I50K 5IYCC 5IORA 4GTBA 1TWGC 1TWFA 3PO3C 4IP9A 5C3EC 3TFIA 5IYBK 4GT9A 1NH3A 1TWHK 4KMUA 2VUMA 5EGHA 2O5JA 2E2HA 2BE5D 2RGRA 2NVYK 1Y1WC 2Y0SA 4BY7C 2EBBA 3M4OK 4GTEA 1LPQA 4C3HC 3V4GA 4QIWL 1XZQA 3S0XA 1UV7A 3TFJA 1R9TA 1SFOA 4LMOA 1K4SA 3MMLB 4KM9A 4LOWA 1VH2A 1F93A 2P5MA 2ZUFA 3LHPS 3H3VD 4LJZA 2YU9C 3A8KA 5IP9C 4GTAA 3AD7C 1PJ6A 4KASA 1HQMA 4BBRK 2XCRB 3GTPA 3H0GC 3LPXA 4A3KK 2B63K 1YCLA 3FKIA 4FYDA 4OIQA 1TWCC 3RZDK 5FLMK 3PO2C 2E2IA 3A8IA 1B4AA 3K5NA 1J6WA 3GTQA 4JLRC 3S1QK 1VLOA 4G7OA 3KYLA 3ERED 1EI6A 5IP7K 3HOYC 4XLPA 4D3ZA 2R92C 4A3DC 1SEUA 4GFQA 2B9SB 4BLBA 5M3FK 1Y1WA 4A3LK 5L46A 2JA5C 5CHPA 3GTKC 2WAQA 4OIRA 1SMYD 1SFOK 3S1NK 4BXXK 3I4MC 4KB4A 3S16C 3CQZC 4P5AA 5M3MK 5C4JC 1RRJA 4RMFA 1IE0A 5FJ8K 3LAPA 3OEPA 4A93K 3L4JA 2FQOA 1TWFC 3RZOC 4NOKA 3GTGA 4BBSC 3CQZK 4WJ4A 4AYBL 3AQPA 4OIOA 3S1NC 2WAQL 3S1RK 4J3NA 3I4NC 1TWHA 2NVQC 1I50A 4A3LC 1V9MA 2CW0D 4P5BA 5TJ3A 4AYBD 1DD5A 1WSVA 2R92K 5MLC9 4AN8A 2JA6A 1USOA 4O2DA 3HOYK 5M5WK 1B4BA 3WODA 4GTDA 1I6HK 1AB4A 4MEYA 4A3JK 4A3FC 3S1QC 3S2DK 1MIUA 1F7VA 3HXAA 2E2JC 1ISEA 3N3YA 4A3BK 3N0CA 1YNND 2B63C 3FOEA 1WOPA 1BJTA 4PABA 1ZYRD 3K59A 4A3FK 4C2MA 4Q5SA 2R7ZA 1GE9A 3QX3A 3M3YK 4BY1C 1TWCA 2VUMK 1HI9A 3OREA 4Q5VA 1I3QK 1J6VA 1ZBSA 4L8IA 2GSOA 3K7AC 4C3IK 3HKZA 4F3EA 5HL8A 3WVOA 2V6UA 4A93C 1RU0A 3DU5A 4BLAA 3L4KA 4OIPA 4D3YA 3BUEA 4A3CC 3GEEA 2A68D 3S17C 4AYBA 5C4XC 1TWGK 4EJ3A 2GSUA 2KWAA 3GTPK 5IOQA 1VRQC 1EK8A 4A3DK 4QJVB 3FKIK 1HQMD 3G4CA 1BGWA 3SJRA 3FOFA 3HKZD 4MQ9A 3HOWC 5TMCA 3GTGC 2R93C 1YNNA 4QCLA 3PO2K 2CFAB 3RZDC 4FM9A 1TWCK 2P8TA 2NVXC 1O27A 3H0GK 4A3KC 4G0WA 1INNA 4A3IK 4NOMA 5C44C 5IOSA 3GTLC 2B63A 3IPJA 5IP9K 5EGEA 3S14K 2NVXK 3LAJA 1Y1VC 3AD9C 2XCQA 1A35A 1R5ZA 4H3TA 1O26A 4ILDA 2R93K 1WQHA 3T01A 3GTGK 3GTQC 2ZFZA 1F7UA 4FGUA 4MEXA 4G0VA 4X6AK 1O24A 1JQWA 2R7ZK 3GEIA 4A3GK 4G7ZA 4GTFA 5C9HA 2V6TA 1K4TA 3GDZA 3S2HC 3T02A 1EQRA 3IAYA 1SMYA 1K83C 3AD8C 4LK0A 5JSBB 3S17K 5IYCK 1XXAA 1K83K 2JA8C 5JSNB 2BE5A 1DCHA 3CQZA 3S15C 1TL8A 3GIRA 5D4DA 1R49A 1JOEA 2A69A 1KQ4A 4FZBA 4X6AC 4NOLA 1I6VD 3GTQK 1I3QC 2NVTC 3BP3A 3TFHA 1VJEA 2VUMC 4G0UA 2PMZL 1TWGA 3M3YC 3HOUK 4AH6A 3HOZC 2JA6C 4OINA 2JA7C 3AH5A 1WQGA 2R93A 5TMFA 4KB2A 2R4GA 2XCOA 2O5JD 2E2IC 2V6SA 5C44K 3GTLK 1IW7D 4A3EC 4Y7NC 1VGXA 4C45A 3ADAC 4A3MC 1V5VA 2E2JK 4IP8A 2YU9A 4KM8A 3GTJK 1I6VA 4P9SA 3S2DC 1T8IA 4Q5GA 2GAGC 1DCOA 1DCPA 4A3JC 3HOWK 4YFXA 2WB1D 4O26A 1XXCA 1F9NA 4KN7A 5JFEA 1X31C 3HKZL 3GTOC 4WJ3M 4LK1A 4KMDA 3P9AA 1R9TC 1I3QA 2PMZA 4XLNA 1TWAC 2NVQK 4QJVA 3GTJA 5C4XK 1IBAA 4C3JC 2A6HA 4QIWD 1XZPA 3HOVK 5E68A 3HOXK 4A3CK 3VA7A 3NUHA 4XSZA 3DU6A 1BDFA 4KARA 3HOXC 3S16K 2WB1A 3EQLA 4C3IC 3K7AK 1K83A 1O2BA 1WCMC 1WOOA 1YNJA 1IQ0A 1IS1A 1WCMA 2A68A 1PJ7A 4M1XA 4BY1K 2PMZD 1R9TK 5IYDK 3S1MK 2WB1L 1Y1VA 2GSNA 4G7HA 1XXBA 3Q3QA 4GZYA 1WQFA 2JA7A 1EJ9A 1WORA 1TWAA 4A3BC 4Q4ZA 3GSIA 1YNJD 1EFWA
chains in the Genus database with same CATH topology
5JSBB 1TWFA 1XXAA 3N0CA 1YNND 4IP9A 5JSNB 4GTLA 3FOEA 1BJTA 3GTLA 4GT9A 1NH3A 1ZYRD 1O25A 2CFAA 3CQZA 3K59A 1TL8A 4KDDA 2VUMA 4KMHA 5EGHA 4C2MA 2NVXA 3MAQA 1R49A 2E2HA 2BE5D 1KQ4A 4FZBA 3FHZA 2RGRA 1Q8IA 2Y0SA 4NOLA 2PHCB 2R7ZA 1GE9A 4GTEA 1I6VD 1LPQA 4C3HC 3K5MA 3V4GA 3K5LA 4DDQA 1TWCA 3QX3A 5IOTA 3S0XA 1R9TA 1SFOA 1TWGA 4LMOA 1K4SA 1WIHA 4Q5VA 2RH6A 3MMLB 3OREA 4KM9A 3GTKA 2JA5A 1ZBSA 4L8IA 2P5MA 2GSOA 3LHPS 3AH5A 1WQGA 3HKZA 2R93A 2A6ED 1EH1A 4KB2A 4F3EA 2R4GA 3WVOA 2A69D 2XCOA 4GTAA 2O5JD 4KMAA 3DU5A 1RR8C 4KASA 3GTOA 1A31A 4BLAA 3L4KA 4D3YA 3BUEA 2XCRB 3GTPA 3LPXA 1IW7D 2A68D 3FKIA 4FYDA 4AYBA 4FXDA 3AQOA 4IP8A 2YU9A 4EJ3A 4KM8A 2GSUA 2KWAA 2E2IA 1B4AA 2Y3PA 3K5NA 4OYDB 1T8IA 3GTQA 4Q5GA 4JLRC 5IOQA 1EK8A 5JVOA 3LF9A 4LR2A 3OPFA 1O2AA 1HQMD 4O26A 1XXCA 2F4QA 1F9NA 3KYLA 1BGWA 3SJRA 2JH3A 3G4CA 5JFEA 3ERED 3FOFA 4D3ZA 3K58A 4KMDA 3P9AA 1SC7A 1SEUA 1I3QA 4KATA 5CQGA 2PMZA 4GTCA 4GFQA 2B9SB 4QCLA 4BLBA 2A6HD 4QIWA 1Y1WA 2CFAB 5CHPA 3GTJA 2WAQA 4FM9A 4C3JC 1SMYD 4C2MC 1O27A 4KB4A 3K57A 4P5AA 3VA7A 3NUHA 4G0WA 3DU6A 1TGOA 1RRJA 4NOMA 1ZXOA 4G0UA 1O28A 5IOSA 2B63A 2NVYA 3K5OA 4KC6A 3OEPA 3LAPA 3L4JA 5CJ9A 1A36A 3CAGA 4NOKA 3GTGA 4KARA 4KAWX 5EGEA 2WB1A 2R92A 3AQPA 4C3IC 3LAJA 1K83A 1O2BA 1Y698 2XCQA 1A35A 4J3NA 1TWHA 1R5ZA 4H3TA 1I50A 1V9MA 4BKWA 1IS1A 1WCMA 2CW0D 1O29A 1O26A 4P5BA 5TJ3A 1ZVUA 4ILDA 4M1XA 1WQHA 2ZFZA 1DD5A 4FGUA 3N0BA 4G0VA 5MLC9 4AN8A 2JA6A 4LQYA 1O24A 1B4BA 4AHCA 1Y1VA 2GSNA 4GTDA 4GTFA 1AB4A 1XXBA 3G4AA 5C9HA 3M4AA 3Q3QA 1K4TA 1WQFA 2JA7A 3H0GA 1EJ9A 3IAYA 1TWAA 1MIUA 3GTMA 5IORA 4GTBA 1YNJD 1ISEA 3N3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQG A;  5JSB B;  1Y69 8;  3FOF A;  1EH1 A;  4KB2 A;  1XXA A;  2XCQ A;  4J3N A;  5JSN B;  3FOE A;  2XCO A;  1BJT A;  1IS1 A;  3L4K A;  1ZVU A;  1WQH A;  4GFQ A;  3BUE A;  4KDD A;  3LPX A;  2ZFZ A;  2XCR B;  1DD5 A;  4FM9 A;  5MLC 9;  4G0V A;  2RGR A;  3LAP A;  3FHZ A;  1B4B A;  2PHC B;  4KB4 A;  1GE9 A;  1AB4 A;  1XXB A;  3QX3 A;  4DDQ A;  2KWA A;  3NUH A;  3VA7 A;  3V4G A;  1B4A A;  2Y3P A;  4G0W A;  4G0U A;  4OYD B;  1WQF A;  4JLR C;  4KC6 A;  3ORE A;  1EK8 A;  3MML B;  3LF9 A;  1WIH A;  3OEP A;  5CJ9 A;  3CAG A;  5JVO A;  3L4J A;  3OPF A;  4KAW X;  1XXC A;  4L8I A;  1F9N A;  1BGW A;  2P5M A;  3LHP S;  3LAJ A;  3ERE D;  1ISE A; 
#chains in the Genus database with same CATH topology
 4A3M K;  3DXJ A;  4A3E K;  4GTL A;  3GTL A;  1O25 A;  2CFA A;  2PPB A;  4KDD A;  4KMH A;  2NVX A;  2GAH C;  1I6H C;  4XCH A;  3MAQ A;  3FHZ A;  2Y0S L;  2YU9 K;  3S1M C;  1Q8I A;  5IYD C;  2JA7 K;  2PHC B;  2D6F C;  2JA6 K;  4NOI A;  4DDQ A;  3K5M A;  1XPP A;  3K5L A;  1IL2 A;  5IOT A;  3T00 A;  2RH6 A;  1WOS A;  1WIH A;  3GTK A;  2JA5 A;  3I4N K;  3S1R C;  1L0W A;  1WCM K;  1Y1W K;  4YFN A;  3JST A;  1PJ5 A;  2A6E D;  1EH1 A;  1YX2 A;  3BP8 C;  4BBS K;  1TWF K;  2PA8 D;  2A69 D;  3RZO K;  1USM A;  4KMA A;  1RR8 C;  3GTO A;  1A31 A;  3TTG A;  2O5I A;  4LLG A;  5C4J K;  1BS2 A;  4ZH4 A;  1G51 A;  3HOV C;  5IYB C;  3I4M K;  1SFO C;  2JA8 K;  4BXX C;  3PO3 K;  3SZY A;  4C3J K;  4FXD A;  3AQO A;  2JA5 K;  3GTK K;  1TWA K;  1I50 C;  4YG2 A;  2Y3P A;  4JK1 A;  4OYD B;  1JVI A;  3S2H K;  2E2H C;  2Y0S D;  5JVO A;  3LF9 A;  4LR2 A;  3OPF A;  5M5X K;  1O2A A;  2JH3 A;  2F4Q A;  4PAA A;  3GTO K;  4A3G C;  4YFK A;  5IP7 C;  2R7Z C;  5M5Y K;  3K58 A;  2PA8 L;  2A6E A;  1SC7 A;  4KAT A;  5CQG A;  4GTC A;  3GTM C;  3GTJ C;  2A6H D;  4QIW A;  5FLM C;  2WAQ D;  1J98 A;  1C0A A;  1Y1V K;  1IW7 A;  4XSX A;  4C2M C;  4Y7N K;  3S14 C;  3K57 A;  1WSR A;  1TGO A;  1XZP B;  1ZXO A;  3SZZ A;  4BBR C;  1O28 A;  3A8J A;  4Y52 C;  2E2I K;  2NVY A;  3K5O A;  4KC6 A;  4Y52 K;  4A3I C;  5CJ9 A;  1A36 A;  3CAG A;  1ZYR A;  4KAW X;  2R92 A;  4C2M K;  2ZUE A;  1Y69 8;  3HOZ K;  2FQT A;  4WIL A;  3HOU C;  3H3V L;  1ZQ1 C;  2CW0 A;  4BKW A;  3GTM K;  1O29 A;  1ZVU A;  2NVT K;  1XZQ B;  4C3H K;  3M4O C;  2NVY C;  3N0B A;  4BY7 K;  4LQY A;  1J6X A;  4AHC A;  1O2F B;  2W7V A;  3FKI C;  3G4A A;  3GEH A;  3M4A A;  3S15 K;  2E2H K;  3H0G A;  1TWH C;  3GTP C;  4KN4 A;  5C3E K;  3GTM A;  1I50 K;  5IYC C;  5IOR A;  4GTB A;  1TWG C;  1TWF A;  3PO3 C;  4IP9 A;  5C3E C;  3TFI A;  5IYB K;  4GT9 A;  1NH3 A;  1TWH K;  4KMU A;  2VUM A;  5EGH A;  2O5J A;  2E2H A;  2BE5 D;  2RGR A;  2NVY K;  1Y1W C;  2Y0S A;  4BY7 C;  2EBB A;  3M4O K;  4GTE A;  1LPQ A;  4C3H C;  3V4G A;  4QIW L;  1XZQ A;  3S0X A;  1UV7 A;  3TFJ A;  1R9T A;  1SFO A;  4LMO A;  1K4S A;  3MML B;  4KM9 A;  4LOW A;  1VH2 A;  1F93 A;  2P5M A;  2ZUF A;  3LHP S;  3H3V D;  4LJZ A;  2YU9 C;  3A8K A;  5IP9 C;  4GTA A;  3AD7 C;  1PJ6 A;  4KAS A;  1HQM A;  4BBR K;  2XCR B;  3GTP A;  3H0G C;  3LPX A;  4A3K K;  2B63 K;  1YCL A;  3FKI A;  4FYD A;  4OIQ A;  1TWC C;  3RZD K;  5FLM K;  3PO2 C;  2E2I A;  3A8I A;  1B4A A;  3K5N A;  1J6W A;  3GTQ A;  4JLR C;  3S1Q K;  1VLO A;  4G7O A;  3KYL A;  3ERE D;  1EI6 A;  5IP7 K;  3HOY C;  4XLP A;  4D3Z A;  2R92 C;  4A3D C;  1SEU A;  4GFQ A;  2B9S B;  4BLB A;  5M3F K;  1Y1W A;  4A3L K;  5L46 A;  2JA5 C;  5CHP A;  3GTK C;  2WAQ A;  4OIR A;  1SMY D;  1SFO K;  3S1N K;  4BXX K;  3I4M C;  4KB4 A;  3S16 C;  3CQZ C;  4P5A A;  5M3M K;  5C4J C;  1RRJ A;  4RMF A;  1IE0 A;  5FJ8 K;  3LAP A;  3OEP A;  4A93 K;  3L4J A;  2FQO A;  1TWF C;  3RZO C;  4NOK A;  3GTG A;  4BBS C;  3CQZ K;  4WJ4 A;  4AYB L;  3AQP A;  4OIO A;  3S1N C;  2WAQ L;  3S1R K;  4J3N A;  3I4N C;  1TWH A;  2NVQ C;  1I50 A;  4A3L C;  1V9M A;  2CW0 D;  4P5B A;  5TJ3 A;  4AYB D;  1DD5 A;  1WSV A;  2R92 K;  5MLC 9;  4AN8 A;  2JA6 A;  1USO A;  4O2D A;  3HOY K;  5M5W K;  1B4B A;  3WOD A;  4GTD A;  1I6H K;  1AB4 A;  4MEY A;  4A3J K;  4A3F C;  3S1Q C;  3S2D K;  1MIU A;  1F7V A;  3HXA A;  2E2J C;  1ISE A;  3N3Y A;  4A3B K;  3N0C A;  1YNN D;  2B63 C;  3FOE A;  1WOP A;  1BJT A;  4PAB A;  1ZYR D;  3K59 A;  4A3F K;  4C2M A;  4Q5S A;  2R7Z A;  1GE9 A;  3QX3 A;  3M3Y K;  4BY1 C;  1TWC A;  2VUM K;  1HI9 A;  3ORE A;  4Q5V A;  1I3Q K;  1J6V A;  1ZBS A;  4L8I A;  2GSO A;  3K7A C;  4C3I K;  3HKZ A;  4F3E A;  5HL8 A;  3WVO A;  2V6U A;  4A93 C;  1RU0 A;  3DU5 A;  4BLA A;  3L4K A;  4OIP A;  4D3Y A;  3BUE A;  4A3C C;  3GEE A;  2A68 D;  3S17 C;  4AYB A;  5C4X C;  1TWG K;  4EJ3 A;  2GSU A;  2KWA A;  3GTP K;  5IOQ A;  1VRQ C;  1EK8 A;  4A3D K;  4QJV B;  3FKI K;  1HQM D;  3G4C A;  1BGW A;  3SJR A;  3FOF A;  3HKZ D;  4MQ9 A;  3HOW C;  5TMC A;  3GTG C;  2R93 C;  1YNN A;  4QCL A;  3PO2 K;  2CFA B;  3RZD C;  4FM9 A;  1TWC K;  2P8T A;  2NVX C;  1O27 A;  3H0G K;  4A3K C;  4G0W A;  1INN A;  4A3I K;  4NOM A;  5C44 C;  5IOS A;  3GTL C;  2B63 A;  3IPJ A;  5IP9 K;  5EGE A;  3S14 K;  2NVX K;  3LAJ A;  1Y1V C;  3AD9 C;  2XCQ A;  1A35 A;  1R5Z A;  4H3T A;  1O26 A;  4ILD A;  2R93 K;  1WQH A;  3T01 A;  3GTG K;  3GTQ C;  2ZFZ A;  1F7U A;  4FGU A;  4MEX A;  4G0V A;  4X6A K;  1O24 A;  1JQW A;  2R7Z K;  3GEI A;  4A3G K;  4G7Z A;  4GTF A;  5C9H A;  2V6T A;  1K4T A;  3GDZ A;  3S2H C;  3T02 A;  1EQR A;  3IAY A;  1SMY A;  1K83 C;  3AD8 C;  4LK0 A;  5JSB B;  3S17 K;  5IYC K;  1XXA A;  1K83 K;  2JA8 C;  5JSN B;  2BE5 A;  1DCH A;  3CQZ A;  3S15 C;  1TL8 A;  3GIR A;  5D4D A;  1R49 A;  1JOE A;  2A69 A;  1KQ4 A;  4FZB A;  4X6A C;  4NOL A;  1I6V D;  3GTQ K;  1I3Q C;  2NVT C;  3BP3 A;  3TFH A;  1VJE A;  2VUM C;  4G0U A;  2PMZ L;  1TWG A;  3M3Y C;  3HOU K;  4AH6 A;  3HOZ C;  2JA6 C;  4OIN A;  2JA7 C;  3AH5 A;  1WQG A;  2R93 A;  5TMF A;  4KB2 A;  2R4G A;  2XCO A;  2O5J D;  2E2I C;  2V6S A;  5C44 K;  3GTL K;  1IW7 D;  4A3E C;  4Y7N C;  1VGX A;  4C45 A;  3ADA C;  4A3M C;  1V5V A;  2E2J K;  4IP8 A;  2YU9 A;  4KM8 A;  3GTJ K;  1I6V A;  4P9S A;  3S2D C;  1T8I A;  4Q5G A;  2GAG C;  1DCO A;  1DCP A;  4A3J C;  3HOW K;  4YFX A;  2WB1 D;  4O26 A;  1XXC A;  1F9N A;  4KN7 A;  5JFE A;  1X31 C;  3HKZ L;  3GTO C;  4WJ3 M;  4LK1 A;  4KMD A;  3P9A A;  1R9T C;  1I3Q A;  2PMZ A;  4XLN A;  1TWA C;  2NVQ K;  4QJV A;  3GTJ A;  5C4X K;  1IBA A;  4C3J C;  2A6H A;  4QIW D;  1XZP A;  3HOV K;  5E68 A;  3HOX K;  4A3C K;  3VA7 A;  3NUH A;  4XSZ A;  3DU6 A;  1BDF A;  4KAR A;  3HOX C;  3S16 K;  2WB1 A;  3EQL A;  4C3I C;  3K7A K;  1K83 A;  1O2B A;  1WCM C;  1WOO A;  1YNJ A;  1IQ0 A;  1IS1 A;  1WCM A;  2A68 A;  1PJ7 A;  4M1X A;  4BY1 K;  2PMZ D;  1R9T K;  5IYD K;  3S1M K;  2WB1 L;  1Y1V A;  2GSN A;  4G7H A;  1XXB A;  3Q3Q A;  4GZY A;  1WQF A;  2JA7 A;  1EJ9 A;  1WOR A;  1TWA A;  4A3B C;  4Q4Z A;  3GSI A;  1YNJ D;  1EFW A; 
#chains in the Genus database with same CATH homology
 5JSB B;  1TWF A;  1XXA A;  3N0C A;  1YNN D;  4IP9 A;  5JSN B;  4GTL A;  3FOE A;  1BJT A;  3GTL A;  4GT9 A;  1NH3 A;  1ZYR D;  1O25 A;  2CFA A;  3CQZ A;  3K59 A;  1TL8 A;  4KDD A;  2VUM A;  4KMH A;  5EGH A;  4C2M A;  2NVX A;  3MAQ A;  1R49 A;  2E2H A;  2BE5 D;  1KQ4 A;  4FZB A;  3FHZ A;  2RGR A;  1Q8I A;  2Y0S A;  4NOL A;  2PHC B;  2R7Z A;  1GE9 A;  4GTE A;  1I6V D;  1LPQ A;  4C3H C;  3K5M A;  3V4G A;  3K5L A;  4DDQ A;  1TWC A;  3QX3 A;  5IOT A;  3S0X A;  1R9T A;  1SFO A;  1TWG A;  4LMO A;  1K4S A;  1WIH A;  4Q5V A;  2RH6 A;  3MML B;  3ORE A;  4KM9 A;  3GTK A;  2JA5 A;  1ZBS A;  4L8I A;  2P5M A;  2GSO A;  3LHP S;  3AH5 A;  1WQG A;  3HKZ A;  2R93 A;  2A6E D;  1EH1 A;  4KB2 A;  4F3E A;  2R4G A;  3WVO A;  2A69 D;  2XCO A;  4GTA A;  2O5J D;  4KMA A;  3DU5 A;  1RR8 C;  4KAS A;  3GTO A;  1A31 A;  4BLA A;  3L4K A;  4D3Y A;  3BUE A;  2XCR B;  3GTP A;  3LPX A;  1IW7 D;  2A68 D;  3FKI A;  4FYD A;  4AYB A;  4FXD A;  3AQO A;  4IP8 A;  2YU9 A;  4EJ3 A;  4KM8 A;  2GSU A;  2KWA A;  2E2I A;  1B4A A;  2Y3P A;  3K5N A;  4OYD B;  1T8I A;  3GTQ A;  4Q5G A;  4JLR C;  5IOQ A;  1EK8 A;  5JVO A;  3LF9 A;  4LR2 A;  3OPF A;  1O2A A;  1HQM D;  4O26 A;  1XXC A;  2F4Q A;  1F9N A;  3KYL A;  1BGW A;  3SJR A;  2JH3 A;  3G4C A;  5JFE A;  3ERE D;  3FOF A;  4D3Z A;  3K58 A;  4KMD A;  3P9A A;  1SC7 A;  1SEU A;  1I3Q A;  4KAT A;  5CQG A;  2PMZ A;  4GTC A;  4GFQ A;  2B9S B;  4QCL A;  4BLB A;  2A6H D;  4QIW A;  1Y1W A;  2CFA B;  5CHP A;  3GTJ A;  2WAQ A;  4FM9 A;  4C3J C;  1SMY D;  4C2M C;  1O27 A;  4KB4 A;  3K57 A;  4P5A A;  3VA7 A;  3NUH A;  4G0W A;  3DU6 A;  1TGO A;  1RRJ A;  4NOM A;  1ZXO A;  4G0U A;  1O28 A;  5IOS A;  2B63 A;  2NVY A;  3K5O A;  4KC6 A;  3OEP A;  3LAP A;  3L4J A;  5CJ9 A;  1A36 A;  3CAG A;  4NOK A;  3GTG A;  4KAR A;  4KAW X;  5EGE A;  2WB1 A;  2R92 A;  3AQP A;  4C3I C;  3LAJ A;  1K83 A;  1O2B A;  1Y69 8;  2XCQ A;  1A35 A;  4J3N A;  1TWH A;  1R5Z A;  4H3T A;  1I50 A;  1V9M A;  4BKW A;  1IS1 A;  1WCM A;  2CW0 D;  1O29 A;  1O26 A;  4P5B A;  5TJ3 A;  1ZVU A;  4ILD A;  4M1X A;  1WQH A;  2ZFZ A;  1DD5 A;  4FGU A;  3N0B A;  4G0V A;  5MLC 9;  4AN8 A;  2JA6 A;  4LQY A;  1O24 A;  1B4B A;  4AHC A;  1Y1V A;  2GSN A;  4GTD A;  4GTF A;  1AB4 A;  1XXB A;  3G4A A;  5C9H A;  3M4A A;  3Q3Q A;  1K4T A;  1WQF A;  2JA7 A;  3H0G A;  1EJ9 A;  3IAY A;  1TWA A;  1MIU A;  3GTM A;  5IOR A;  4GTB A;  1YNJ D;  1ISE A;  3N3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...