4KDDA

Structure of mycobacterium tuberculosis ribosome recycling factor in presence of detergent
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
pubmed rcsb
molecule keywords Ribosome-recycling factor
molecule tags Translation
source organism Mycobacterium tuberculosis
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01765 RRF Ribosome recycling factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4kddA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kddA02
1WQFA 4DDQA 4G0VA 4J3NA 4KB4A 3QX3A 3LAPA 4KB2A 1EK8A 1BGWA 3CAGA 3FHZA 3LAJA 5MLC9 1WQGA 1WIHA 4L8IA 3FOEA 1B4BA 3LPXA 3L4KA 5JVOA 1EH1A 1Y698 1ISEA 3BUEA 4FM9A 1WQHA 2XCRB 2ZFZA 2Y3PA 1DD5A 3FOFA 3ERED 1F9NA 1AB4A 3LF9A 1BJTA 1XXCA 5JSBB 3OREA 1GE9A 2KWAA 2XCQA 1ZVUA 1XXBA 3OEPA 4KC6A 4G0UA 4G0WA 2RGRA 4GFQA 1IS1A 3OPFA 2P5MA 3NUHA 5CJ9A 1B4AA 3V4GA 3MMLB 4KDDA 4KAWX 4OYDB 5JSNB 2XCOA 3VA7A 2PHCB 3L4JA 3LHPS 1XXAA 4JLRC
chains in the Genus database with same CATH superfamily
5M5WK 3KYLA 1TWGA 2A68A 4KB2A 3GTJC 4BY7C 1I50A 1R49A 4XSXA 1O29A 3TTGA 2E2IC 1R5ZA 1Y1VK 2JA8K 5IP9C 4G7ZA 3BP3A 4QCLA 4C2MC 3PO2C 2R4GA 1LPQA 4BBSC 4IP8A 4M1XA 3OPFA 3GTGK 5TJ3A 1BDFA 2NVXC 1I6VA 4A93C 3S17K 1WQGA 3GTJA 3HXAA 5FJ8K 5EGEA 2ZUFA 2JA6K 2WAQD 5C4JK 5IOQA 2E2IA 1WSVA 5IYDK 4LQYA 4GTDA 1YNJA 1A31A 3AD9C 4FZBA 5C3EC 3GTQK 3HOVK 4WJ4A 4C2MA 3GTGC 4PAAA 4FXDA 1L0WA 4MEXA 4GFQA 4BBSK 2P5MA 4RMFA 2A6EA 1IBAA 4KAWX 5JSNB 3VA7A 3S17C 3GIRA 4G0WA 2NVXA 2JA6C 4GTCA 2EBBA 3IAYA 1T8IA 3GTLK 3RZOK 5IYDC 3T02A 3FOEA 3LPXA 2PMZA 2R7ZK 1K83C 3HOVC 3GTQC 2V6TA 1IQ0A 2NVYK 4A3FK 3HOUK 3I4NK 4GZYA 4X6AC 1INNA 3S1NC 4GT9A 5EGHA 4KATA 4XLNA 3GTGA 4NOIA 3A8IA 1EI6A 1IS1A 3FKIC 1WOPA 3RZOC 3GTLC 3MAQA 2E2HK 2YU9K 2CFAB 2JA7K 2JA6A 4XSZA 4KB4A 2R7ZC 4A3JK 3HOUC 4A3FC 2NVYC 1A36A 3RZDK 1K83A 1I6HK 4YG2A 1WCMC 2A68D 4A3CC 2GSNA 1TWCA 1TWHK 4LK0A 1BJTA 1XXCA 4Q5VA 4GTEA 3AQOA 3CQZC 2KWAA 2RH6A 1ZVUA 3S1RK 2YU9C 4OIRA 3S0XA 4A3EK 3FKIA 1V5VA 3GTLA 1RU0A 1USOA 3HKZA 1XXAA 3PO3K 2R7ZA 4FGUA 4D3YA 1BGWA 2NVYA 4Q5SA 2WB1A 3LAJA 3GTOK 4KN7A 4A3DK 3HKZL 4A3LC 1I6VD 1YNNA 1J6XA 5C9HA 1ZBSA 3GTMK 1WCMA 4C3HC 2WB1L 1TWAK 3S1RC 1AB4A 4QIWA 1K4TA 3OREA 4A3EC 3CQZA 3H3VL 1PJ5A 2YU9A 1Q8IA 4KMDA 4YFKA 3PO3C 5CJ9A 1PJ6A 3GTOC 1WQFA 3I4MK 4KMHA 3T00A 3TFIA 1EK8A 3FHZA 2CW0A 3GTMC 2A6ED 1EFWA 2NVTK 1TWAC 3M4AA 2R92K 4LR2A 3M4OC 3N0CA 5IP7C 4P9SA 4BY1K 4O26A 3JSTA 3K58A 2XCQA 1TL8A 2JA5K 1XXBA 4C3JK 2E2JK 2Y0SA 3K5NA 5JFEA 4C3IK 2PA8L 4C45A 4LK1A 2PHCB 4YFXA 3TFJA 4JLRC 1Y1WK 2Y0SL 1TWAA 4BY1C 1ISEA 4G7OA 1Y1VC 1EQRA 1F7UA 2JA8C 3P9AA 1KQ4A 1R9TK 3SZZA 2P8TA 4XLPA 1HQMA 2R93K 2Y3PA 4KMAA 2JA5C 4C3JC 2E2JC 4KM9A 5HL8A 1SMYD 4C3IC 2PPBA 1Y1WC 5CQGA 3TFHA 3DXJA 5TMCA 4JK1A 4J3NA 5FLMK 4BKWA 1BS2A 3T01A 2GSUA 5M5XK 1TGOA 1R9TC 5C4JC 3AD8C 2D6FC 1B4BA 4NOLA 1JQWA 1O27A 3HKZD 3S2DK 1Y1VA 1TWFK 4KASA 4WJ3M 2W7VA 3SJRA 1VLOA 2ZFZA 1IE0A 2WB1D 1HI9A 1F9NA 2V6UA 4P5BA 1WOSA 2PMZL 1YNND 5C4XK 2O5JA 1K4SA 1XZQB 1Y1WA 5FLMC 4BLBA 3HOZK 4GTAA 3HOYK 3GTKK 3N0BA 4A3IK 3M3YK 3S2DC 1R9TA 1RRJA 3I4NC 4F3EA 5JVOA 4XCHA 3K5MA 1C0AA 3GTQA 2NVQK 2A6HA 3GEEA 5C4XC 2CW0D 4LJZA 1VRQC 3GDZA 3HOWK 2V6SA 3Q3QA 3HOZC 4MQ9A 5IOSA 2E2HC 2JA7C 3GTKC 1I3QK 1F93A 1XZQA 4OIQA 1B4AA 2PA8D 3M3YC 3K7AK 1VJEA 4A3JC 4A3KK 4G0VA 1USMA 2Y0SD 3RZDC 1RR8C 3CAGA 1IW7A 1V9MA 1ZYRA 1I6HC 4L8IA 1TWGK 3HOXK 1O2FB 1TWHC 1WOOA 3HOWC 1WQHA 3SZYA 2XCRB 3H0GK 1J6VA 1ZXOA 4ILDA 4NOMA 3K7AC 5C44K 3S1QK 1J6WA 3OEPA 4AHCA 1HQMD 2E2HA 2JA7A 3GTKA 1YX2A 2GAGC 4A3KC 4KM8A 3S14K 4NOKA 1YNJD 3L4JA 4QIWL 3K5LA 4Q5GA 5M5YK 3HOXC 2GSOA 2F4QA 3LAPA 4A3DC 4A3GK 3A8KA 1EH1A 3K57A 3BUEA 2JH3A 3H0GC 1TWHA 3GTJK 4BXXK 4LLGA 1JOEA 4BBRK 3S1QC 2A69A 4KMUA 4YFNA 3S15K 3BP8C 4AH6A 3EQLA 2PMZD 3S14C 4QJVB 1ZQ1C 4GTBA 4KC6A 3PO2K 3I4MC 3V4GA 4OYDB 4A3GC 3DU6A 3IPJA 2O5JD 3GTOA 2NVTC 3ADAC 2NVXK 2R92C 1G51A 1F7VA 4BXXC 4A93K 4Y52K 3GTMA 4BBRC 2VUMK 3H0GA 3S15C 2GAHC 4FM9A 1XPPA 1O28A 4D3ZA 1SFOK 4OINA 4P5AA 1EJ9A 4BLAA 5C3EK 4G0UA 1DCPA 4QJVA 2RGRA 2A6HD 5E68A 4AYBA 3G4AA 3LHPS 4Y52C 2VUMC 4WILA 1A35A 2R92A 3GEHA 3WVOA 5MLC9 1VH2A 2BE5A 4KN4A 1PJ7A 4AYBL 1SFOC 3S1MK 4A3MK 2R93C 3A8JA 3S2HK 1XZPB 3GTPK 2ZUEA 1K83K 3AH5A 4G7HA 1IW7D 5IYCK 1ZYRD 4X6AK 2JA5A 4LOWA 5M3MK 4Q4ZA 1SEUA 4H3TA 1TWCK 3N3YA 3S1NK 4IP9A 3H3VD 4PABA 1DCHA 3MMLB 2XCOA 1O24A 4QIWD 1IL2A 3FKIK 4DDQA 5IYBK 3S1MC 2VUMA 4O2DA 4A3MC 3QX3A 3S2HC 4AN8A 4FYDA 3GTPC 3K5OA 1TWFC 5IORA 1WIHA 3L4KA 1SFOA 2R93A 5IYCC 1Y698 1WSRA 3S16K 1XZPA 4MEYA 1TWCC 1VGXA 1WCMK 5D4DA 4A3CK 5L46A 5IOTA 3G4CA 1NH3A 5IYBC 3CQZK 2A69D 3HOYC 2FQTA 4Y7NK 4A3IC 5M3FK 4OIPA 2FQOA 2WAQA 3AD7C 2B63K 3GTPA 1TWFA 5TMFA 2B9SB 3S16C 1SMYA 2NVQC 2WAQL 1O2BA 1O26A 3AQPA 4EJ3A 4A3LK 1DD5A 3WODA 1I50K 4LMOA 3LF9A 4A3BK 5JSBB 4C3HK 1YCLA 1I3QC 4Y7NC 1DCOA 3NUHA 2B63C 1WORA 2CFAA 2O5IA 4GTLA 1TWGC 1O25A 4OIOA 1JVIA 4AYBD 1I50C 4A3BC 1MIUA 3DU5A 3K59A 3FOFA 4BY7K 3ERED 4ZH4A 2BE5D 5C44C 1X31C 3M4OK 2E2IK 5IP7K 1GE9A 1I3QA 5CHPA 1UV7A 4GTFA 5IP9K 4C2MK 2B63A 1O2AA 3GEIA 4KDDA 4KARA 1J98A 3GSIA 1SC7A
chains in the Genus database with same CATH topology
3KYLA 2R7ZA 3N0BA 1TWGA 4FGUA 1A35A 4D3YA 4KB2A 2R92A 2NVYA 1BGWA 1R9TA 2WB1A 3WVOA 5MLC9 3LAJA 1RRJA 4F3EA 5JVOA 1I50A 1R49A 3K5MA 1I6VD 5C9HA 1ZBSA 1O29A 3GTQA 1WCMA 1R5ZA 3AH5A 4C3HC 1IW7D 2CW0D 1ZYRD 2JA5A 1AB4A 4QCLA 4QIWA 1K4TA 4C2MC 1SEUA 3OREA 3Q3QA 3CQZA 2R4GA 4H3TA 3N3YA 4IP9A 3G4AA 2YU9A 1Q8IA 1LPQA 4KMDA 4IP8A 5IOSA 4M1XA 3OPFA 5CJ9A 1B4AA 3MMLB 2XCOA 5TJ3A 1O24A 1WQFA 4DDQA 4G0VA 4KMHA 2VUMA 3QX3A 1RR8C 4AN8A 1EK8A 4FYDA 3K5OA 3CAGA 3FHZA 1V9MA 1WIHA 1WQGA 2A6ED 4L8IA 3GTJA 5EGEA 5IORA 1SFOA 3L4KA 2R93A 1Y698 3M4AA 5IOQA 2E2IA 1WQHA 4LR2A 4LQYA 3N0CA 2XCRB 4GTDA 4O26A 1A31A 4FZBA 4C2MA 1ZXOA 4ILDA 4NOMA 3K58A 2XCQA 1TL8A 5IOTA 3OEPA 1XXBA 3G4CA 4AHCA 1HQMD 1NH3A 4FXDA 2Y0SA 3K5NA 2E2HA 3GTKA 2JA7A 4GFQA 5JFEA 2A69D 2P5MA 4KM8A 4NOKA 1YNJD 4KAWX 5JSNB 3VA7A 3L4JA 3K5LA 2PHCB 4G0WA 4Q5GA 2NVXA 4JLRC 2WAQA 4GTCA 2GSOA 2F4QA 3LAPA 3IAYA 1T8IA 3GTPA 1TWFA 3FOEA 2B9SB 3LPXA 2PMZA 1TWAA 1EH1A 3K57A 2JH3A 1ISEA 3BUEA 1O2BA 1O26A 1TWHA 3P9AA 1KQ4A 3AQPA 4EJ3A 2Y3PA 4KMAA 1DD5A 4LMOA 4GT9A 5EGHA 4C3JC 3LF9A 4KM9A 4KATA 5JSBB 1SMYD 4C3IC 3GTGA 4GTBA 4KC6A 1IS1A 5CQGA 3NUHA 3V4GA 4OYDB 3DU6A 3MAQA 2CFAB 2JA6A 2CFAA 2O5JD 3GTOA 4GTLA 4J3NA 4KB4A 4BKWA 1O25A 2GSUA 1TGOA 1A36A 3GTMA 1B4BA 4NOLA 1K83A 3H0GA 1O27A 1Y1VA 4KASA 4FM9A 3SJRA 1MIUA 2A68D 3DU5A 2ZFZA 1O28A 4D3ZA 3K59A 4P5AA 2GSNA 1XXAA 3FOFA 1TWCA 2BE5D 1F9NA 3ERED 4P5BA 1EJ9A 1BJTA 1XXCA 4Q5VA 4GTEA 3AQOA 1GE9A 1YNND 1I3QA 4BLAA 5CHPA 2KWAA 4GTFA 2RH6A 1ZVUA 4G0UA 1K4SA 3S0XA 2RGRA 2A6HD 1Y1WA 3FKIA 2B63A 1O2AA 4BLBA 4KDDA 4AYBA 3GTLA 4KARA 4GTAA 3HKZA 3LHPS 1SC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQF A;  4DDQ A;  4G0V A;  4J3N A;  4KB4 A;  3QX3 A;  3LAP A;  4KB2 A;  1EK8 A;  1BGW A;  3CAG A;  3FHZ A;  3LAJ A;  5MLC 9;  1WQG A;  1WIH A;  4L8I A;  3FOE A;  1B4B A;  3LPX A;  3L4K A;  5JVO A;  1EH1 A;  1Y69 8;  1ISE A;  3BUE A;  4FM9 A;  1WQH A;  2XCR B;  2ZFZ A;  2Y3P A;  1DD5 A;  3FOF A;  3ERE D;  1F9N A;  1AB4 A;  3LF9 A;  1BJT A;  1XXC A;  5JSB B;  3ORE A;  1GE9 A;  2KWA A;  2XCQ A;  1ZVU A;  1XXB A;  3OEP A;  4KC6 A;  4G0U A;  4G0W A;  2RGR A;  4GFQ A;  1IS1 A;  3OPF A;  2P5M A;  3NUH A;  5CJ9 A;  1B4A A;  3V4G A;  3MML B;  4KDD A;  4KAW X;  4OYD B;  5JSN B;  2XCO A;  3VA7 A;  2PHC B;  3L4J A;  3LHP S;  1XXA A;  4JLR C; 
#chains in the Genus database with same CATH topology
 5M5W K;  3KYL A;  1TWG A;  2A68 A;  4KB2 A;  3GTJ C;  4BY7 C;  1I50 A;  1R49 A;  4XSX A;  1O29 A;  3TTG A;  2E2I C;  1R5Z A;  1Y1V K;  2JA8 K;  5IP9 C;  4G7Z A;  3BP3 A;  4QCL A;  4C2M C;  3PO2 C;  2R4G A;  1LPQ A;  4BBS C;  4IP8 A;  4M1X A;  3OPF A;  3GTG K;  5TJ3 A;  1BDF A;  2NVX C;  1I6V A;  4A93 C;  3S17 K;  1WQG A;  3GTJ A;  3HXA A;  5FJ8 K;  5EGE A;  2ZUF A;  2JA6 K;  2WAQ D;  5C4J K;  5IOQ A;  2E2I A;  1WSV A;  5IYD K;  4LQY A;  4GTD A;  1YNJ A;  1A31 A;  3AD9 C;  4FZB A;  5C3E C;  3GTQ K;  3HOV K;  4WJ4 A;  4C2M A;  3GTG C;  4PAA A;  4FXD A;  1L0W A;  4MEX A;  4GFQ A;  4BBS K;  2P5M A;  4RMF A;  2A6E A;  1IBA A;  4KAW X;  5JSN B;  3VA7 A;  3S17 C;  3GIR A;  4G0W A;  2NVX A;  2JA6 C;  4GTC A;  2EBB A;  3IAY A;  1T8I A;  3GTL K;  3RZO K;  5IYD C;  3T02 A;  3FOE A;  3LPX A;  2PMZ A;  2R7Z K;  1K83 C;  3HOV C;  3GTQ C;  2V6T A;  1IQ0 A;  2NVY K;  4A3F K;  3HOU K;  3I4N K;  4GZY A;  4X6A C;  1INN A;  3S1N C;  4GT9 A;  5EGH A;  4KAT A;  4XLN A;  3GTG A;  4NOI A;  3A8I A;  1EI6 A;  1IS1 A;  3FKI C;  1WOP A;  3RZO C;  3GTL C;  3MAQ A;  2E2H K;  2YU9 K;  2CFA B;  2JA7 K;  2JA6 A;  4XSZ A;  4KB4 A;  2R7Z C;  4A3J K;  3HOU C;  4A3F C;  2NVY C;  1A36 A;  3RZD K;  1K83 A;  1I6H K;  4YG2 A;  1WCM C;  2A68 D;  4A3C C;  2GSN A;  1TWC A;  1TWH K;  4LK0 A;  1BJT A;  1XXC A;  4Q5V A;  4GTE A;  3AQO A;  3CQZ C;  2KWA A;  2RH6 A;  1ZVU A;  3S1R K;  2YU9 C;  4OIR A;  3S0X A;  4A3E K;  3FKI A;  1V5V A;  3GTL A;  1RU0 A;  1USO A;  3HKZ A;  1XXA A;  3PO3 K;  2R7Z A;  4FGU A;  4D3Y A;  1BGW A;  2NVY A;  4Q5S A;  2WB1 A;  3LAJ A;  3GTO K;  4KN7 A;  4A3D K;  3HKZ L;  4A3L C;  1I6V D;  1YNN A;  1J6X A;  5C9H A;  1ZBS A;  3GTM K;  1WCM A;  4C3H C;  2WB1 L;  1TWA K;  3S1R C;  1AB4 A;  4QIW A;  1K4T A;  3ORE A;  4A3E C;  3CQZ A;  3H3V L;  1PJ5 A;  2YU9 A;  1Q8I A;  4KMD A;  4YFK A;  3PO3 C;  5CJ9 A;  1PJ6 A;  3GTO C;  1WQF A;  3I4M K;  4KMH A;  3T00 A;  3TFI A;  1EK8 A;  3FHZ A;  2CW0 A;  3GTM C;  2A6E D;  1EFW A;  2NVT K;  1TWA C;  3M4A A;  2R92 K;  4LR2 A;  3M4O C;  3N0C A;  5IP7 C;  4P9S A;  4BY1 K;  4O26 A;  3JST A;  3K58 A;  2XCQ A;  1TL8 A;  2JA5 K;  1XXB A;  4C3J K;  2E2J K;  2Y0S A;  3K5N A;  5JFE A;  4C3I K;  2PA8 L;  4C45 A;  4LK1 A;  2PHC B;  4YFX A;  3TFJ A;  4JLR C;  1Y1W K;  2Y0S L;  1TWA A;  4BY1 C;  1ISE A;  4G7O A;  1Y1V C;  1EQR A;  1F7U A;  2JA8 C;  3P9A A;  1KQ4 A;  1R9T K;  3SZZ A;  2P8T A;  4XLP A;  1HQM A;  2R93 K;  2Y3P A;  4KMA A;  2JA5 C;  4C3J C;  2E2J C;  4KM9 A;  5HL8 A;  1SMY D;  4C3I C;  2PPB A;  1Y1W C;  5CQG A;  3TFH A;  3DXJ A;  5TMC A;  4JK1 A;  4J3N A;  5FLM K;  4BKW A;  1BS2 A;  3T01 A;  2GSU A;  5M5X K;  1TGO A;  1R9T C;  5C4J C;  3AD8 C;  2D6F C;  1B4B A;  4NOL A;  1JQW A;  1O27 A;  3HKZ D;  3S2D K;  1Y1V A;  1TWF K;  4KAS A;  4WJ3 M;  2W7V A;  3SJR A;  1VLO A;  2ZFZ A;  1IE0 A;  2WB1 D;  1HI9 A;  1F9N A;  2V6U A;  4P5B A;  1WOS A;  2PMZ L;  1YNN D;  5C4X K;  2O5J A;  1K4S A;  1XZQ B;  1Y1W A;  5FLM C;  4BLB A;  3HOZ K;  4GTA A;  3HOY K;  3GTK K;  3N0B A;  4A3I K;  3M3Y K;  3S2D C;  1R9T A;  1RRJ A;  3I4N C;  4F3E A;  5JVO A;  4XCH A;  3K5M A;  1C0A A;  3GTQ A;  2NVQ K;  2A6H A;  3GEE A;  5C4X C;  2CW0 D;  4LJZ A;  1VRQ C;  3GDZ A;  3HOW K;  2V6S A;  3Q3Q A;  3HOZ C;  4MQ9 A;  5IOS A;  2E2H C;  2JA7 C;  3GTK C;  1I3Q K;  1F93 A;  1XZQ A;  4OIQ A;  1B4A A;  2PA8 D;  3M3Y C;  3K7A K;  1VJE A;  4A3J C;  4A3K K;  4G0V A;  1USM A;  2Y0S D;  3RZD C;  1RR8 C;  3CAG A;  1IW7 A;  1V9M A;  1ZYR A;  1I6H C;  4L8I A;  1TWG K;  3HOX K;  1O2F B;  1TWH C;  1WOO A;  3HOW C;  1WQH A;  3SZY A;  2XCR B;  3H0G K;  1J6V A;  1ZXO A;  4ILD A;  4NOM A;  3K7A C;  5C44 K;  3S1Q K;  1J6W A;  3OEP A;  4AHC A;  1HQM D;  2E2H A;  2JA7 A;  3GTK A;  1YX2 A;  2GAG C;  4A3K C;  4KM8 A;  3S14 K;  4NOK A;  1YNJ D;  3L4J A;  4QIW L;  3K5L A;  4Q5G A;  5M5Y K;  3HOX C;  2GSO A;  2F4Q A;  3LAP A;  4A3D C;  4A3G K;  3A8K A;  1EH1 A;  3K57 A;  3BUE A;  2JH3 A;  3H0G C;  1TWH A;  3GTJ K;  4BXX K;  4LLG A;  1JOE A;  4BBR K;  3S1Q C;  2A69 A;  4KMU A;  4YFN A;  3S15 K;  3BP8 C;  4AH6 A;  3EQL A;  2PMZ D;  3S14 C;  4QJV B;  1ZQ1 C;  4GTB A;  4KC6 A;  3PO2 K;  3I4M C;  3V4G A;  4OYD B;  4A3G C;  3DU6 A;  3IPJ A;  2O5J D;  3GTO A;  2NVT C;  3ADA C;  2NVX K;  2R92 C;  1G51 A;  1F7V A;  4BXX C;  4A93 K;  4Y52 K;  3GTM A;  4BBR C;  2VUM K;  3H0G A;  3S15 C;  2GAH C;  4FM9 A;  1XPP A;  1O28 A;  4D3Z A;  1SFO K;  4OIN A;  4P5A A;  1EJ9 A;  4BLA A;  5C3E K;  4G0U A;  1DCP A;  4QJV A;  2RGR A;  2A6H D;  5E68 A;  4AYB A;  3G4A A;  3LHP S;  4Y52 C;  2VUM C;  4WIL A;  1A35 A;  2R92 A;  3GEH A;  3WVO A;  5MLC 9;  1VH2 A;  2BE5 A;  4KN4 A;  1PJ7 A;  4AYB L;  1SFO C;  3S1M K;  4A3M K;  2R93 C;  3A8J A;  3S2H K;  1XZP B;  3GTP K;  2ZUE A;  1K83 K;  3AH5 A;  4G7H A;  1IW7 D;  5IYC K;  1ZYR D;  4X6A K;  2JA5 A;  4LOW A;  5M3M K;  4Q4Z A;  1SEU A;  4H3T A;  1TWC K;  3N3Y A;  3S1N K;  4IP9 A;  3H3V D;  4PAB A;  1DCH A;  3MML B;  2XCO A;  1O24 A;  4QIW D;  1IL2 A;  3FKI K;  4DDQ A;  5IYB K;  3S1M C;  2VUM A;  4O2D A;  4A3M C;  3QX3 A;  3S2H C;  4AN8 A;  4FYD A;  3GTP C;  3K5O A;  1TWF C;  5IOR A;  1WIH A;  3L4K A;  1SFO A;  2R93 A;  5IYC C;  1Y69 8;  1WSR A;  3S16 K;  1XZP A;  4MEY A;  1TWC C;  1VGX A;  1WCM K;  5D4D A;  4A3C K;  5L46 A;  5IOT A;  3G4C A;  1NH3 A;  5IYB C;  3CQZ K;  2A69 D;  3HOY C;  2FQT A;  4Y7N K;  4A3I C;  5M3F K;  4OIP A;  2FQO A;  2WAQ A;  3AD7 C;  2B63 K;  3GTP A;  1TWF A;  5TMF A;  2B9S B;  3S16 C;  1SMY A;  2NVQ C;  2WAQ L;  1O2B A;  1O26 A;  3AQP A;  4EJ3 A;  4A3L K;  1DD5 A;  3WOD A;  1I50 K;  4LMO A;  3LF9 A;  4A3B K;  5JSB B;  4C3H K;  1YCL A;  1I3Q C;  4Y7N C;  1DCO A;  3NUH A;  2B63 C;  1WOR A;  2CFA A;  2O5I A;  4GTL A;  1TWG C;  1O25 A;  4OIO A;  1JVI A;  4AYB D;  1I50 C;  4A3B C;  1MIU A;  3DU5 A;  3K59 A;  3FOF A;  4BY7 K;  3ERE D;  4ZH4 A;  2BE5 D;  5C44 C;  1X31 C;  3M4O K;  2E2I K;  5IP7 K;  1GE9 A;  1I3Q A;  5CHP A;  1UV7 A;  4GTF A;  5IP9 K;  4C2M K;  2B63 A;  1O2A A;  3GEI A;  4KDD A;  4KAR A;  1J98 A;  3GSI A;  1SC7 A; 
#chains in the Genus database with same CATH homology
 3KYL A;  2R7Z A;  3N0B A;  1TWG A;  4FGU A;  1A35 A;  4D3Y A;  4KB2 A;  2R92 A;  2NVY A;  1BGW A;  1R9T A;  2WB1 A;  3WVO A;  5MLC 9;  3LAJ A;  1RRJ A;  4F3E A;  5JVO A;  1I50 A;  1R49 A;  3K5M A;  1I6V D;  5C9H A;  1ZBS A;  1O29 A;  3GTQ A;  1WCM A;  1R5Z A;  3AH5 A;  4C3H C;  1IW7 D;  2CW0 D;  1ZYR D;  2JA5 A;  1AB4 A;  4QCL A;  4QIW A;  1K4T A;  4C2M C;  1SEU A;  3ORE A;  3Q3Q A;  3CQZ A;  2R4G A;  4H3T A;  3N3Y A;  4IP9 A;  3G4A A;  2YU9 A;  1Q8I A;  1LPQ A;  4KMD A;  4IP8 A;  5IOS A;  4M1X A;  3OPF A;  5CJ9 A;  1B4A A;  3MML B;  2XCO A;  5TJ3 A;  1O24 A;  1WQF A;  4DDQ A;  4G0V A;  4KMH A;  2VUM A;  3QX3 A;  1RR8 C;  4AN8 A;  1EK8 A;  4FYD A;  3K5O A;  3CAG A;  3FHZ A;  1V9M A;  1WIH A;  1WQG A;  2A6E D;  4L8I A;  3GTJ A;  5EGE A;  5IOR A;  1SFO A;  3L4K A;  2R93 A;  1Y69 8;  3M4A A;  5IOQ A;  2E2I A;  1WQH A;  4LR2 A;  4LQY A;  3N0C A;  2XCR B;  4GTD A;  4O26 A;  1A31 A;  4FZB A;  4C2M A;  1ZXO A;  4ILD A;  4NOM A;  3K58 A;  2XCQ A;  1TL8 A;  5IOT A;  3OEP A;  1XXB A;  3G4C A;  4AHC A;  1HQM D;  1NH3 A;  4FXD A;  2Y0S A;  3K5N A;  2E2H A;  3GTK A;  2JA7 A;  4GFQ A;  5JFE A;  2A69 D;  2P5M A;  4KM8 A;  4NOK A;  1YNJ D;  4KAW X;  5JSN B;  3VA7 A;  3L4J A;  3K5L A;  2PHC B;  4G0W A;  4Q5G A;  2NVX A;  4JLR C;  2WAQ A;  4GTC A;  2GSO A;  2F4Q A;  3LAP A;  3IAY A;  1T8I A;  3GTP A;  1TWF A;  3FOE A;  2B9S B;  3LPX A;  2PMZ A;  1TWA A;  1EH1 A;  3K57 A;  2JH3 A;  1ISE A;  3BUE A;  1O2B A;  1O26 A;  1TWH A;  3P9A A;  1KQ4 A;  3AQP A;  4EJ3 A;  2Y3P A;  4KMA A;  1DD5 A;  4LMO A;  4GT9 A;  5EGH A;  4C3J C;  3LF9 A;  4KM9 A;  4KAT A;  5JSB B;  1SMY D;  4C3I C;  3GTG A;  4GTB A;  4KC6 A;  1IS1 A;  5CQG A;  3NUH A;  3V4G A;  4OYD B;  3DU6 A;  3MAQ A;  2CFA B;  2JA6 A;  2CFA A;  2O5J D;  3GTO A;  4GTL A;  4J3N A;  4KB4 A;  4BKW A;  1O25 A;  2GSU A;  1TGO A;  1A36 A;  3GTM A;  1B4B A;  4NOL A;  1K83 A;  3H0G A;  1O27 A;  1Y1V A;  4KAS A;  4FM9 A;  3SJR A;  1MIU A;  2A68 D;  3DU5 A;  2ZFZ A;  1O28 A;  4D3Z A;  3K59 A;  4P5A A;  2GSN A;  1XXA A;  3FOF A;  1TWC A;  2BE5 D;  1F9N A;  3ERE D;  4P5B A;  1EJ9 A;  1BJT A;  1XXC A;  4Q5V A;  4GTE A;  3AQO A;  1GE9 A;  1YNN D;  1I3Q A;  4BLA A;  5CHP A;  2KWA A;  4GTF A;  2RH6 A;  1ZVU A;  4G0U A;  1K4S A;  3S0X A;  2RGR A;  2A6H D;  1Y1W A;  3FKI A;  2B63 A;  1O2A A;  4BLB A;  4KDD A;  4AYB A;  3GTL A;  4KAR A;  4GTA A;  3HKZ A;  3LHP S;  1SC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...