4KDIC

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
65
Chain Sequence
KLKVTGAGINQVVTLKQDATLNDLIEHINVDVKTMRFGYPPQRINLQQTQLDELGINSGEKITIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 11
structure length 65
sequence length 72
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kdiC00
2C5LC 5G2NA 1WGRA 3ZDTA 1P1AA 5J2RA 4NY0A 4KZCA 1V9JA 2BWFA 3APCA 4LCDE 3RUIB 2K6QA 3VH4B 2IO3B 1TBEA 2NBVB 3PS6A 3VUXA 1YX5B 2N7EA 5TR5A 4PS7A 4DDID 3ZIMA 3ML9A 3QQ8B 2XEWA 1WMHB 5KHOA 4GSWA 2JUOA 3VVWB 4GDKA 4IW0A 1AARA 3L16A 2FIFA 3ZNGC 2D10A 2K6DB 1L7YA 1UD7A 2N9EB 4PYZA 4NJ7A 4EZKA 4ANVA 3SD5A 4WWPA 4ZRKA 3RT3B 3ZNZB 2PEAA 5GMVA 3JW0X 4F8CB 5JHBA 4CYEA 3B1LX 2J7QB 3V6CB 3U30A 4DBGA 1L2NA 2ZZPB 2KQSA 3TBLD 1EF1A 2L76A 2IYDB 1WR1A 3H7SA 4AJYB 1ZGUB 4JIOU 1UBQA 4ZRJA 4GDKB 2NR2A 2ZPNA 1PQSA 4JLCA 3AU4A 2KANA 2C9WB 4XC2A 2FAZA 3TCAA 1OEYA 2Z0DB 4W9FA 2A4ZA 2IY0B 2YLMA 1OQYA 2MP2A 4ICVA 4ANWA 1LQBA 4E74A 3WAOA 2KOXA 3D32A 2GBJA 1J8CA 2J0JA 2N1VA 4HK2A 4MGYE 4LJOB 3KYCD 4II2B 2HD5B 2DYMA 4I6PA 2G4SA 1LM8B 2BYEA 3ZNHB 4BKGA 3H7PA 1V5TA 2RSUA 4NNJB 2RD0A 5CX3A 3PGEA 3HIZA 3VUYA 2WX0A 3DVNV 3MJWA 2ASQA 4W9EA 3EFUA 1YD8U 1WZ3A 2KHWB 1Z2MA 5IA7A 2BF8B 4A3OA 3CSTA 1K8RB 4ZDVA 2CHZA 4TKNA 3PSEB 4EZLA 4HDOA 4DHZE 3DBLI 3GZNI 4EKUA 1E8YA 1KJTA 3WAPA 2K39A 4MDKE 2DAFA 3P2BA 2JT4B 4W9HA 4GDLB 3A33B 3N30A 3RCZA 2BKFA 3IBEA 3KUCB 1R4NI 3H7PB 4BBNF 4MSQB 2ZCBA 1WGGA 3WAMA 1XT9B 3MHSD 4OVUA 3Q3FA 3GOEA 1WE6A 4G3XB 2EMSA 1H8CA 3IHPC 2GBMA 1C3TA 3M95A 3R66C 1TTNA 3V62A 3VHTC 3JSVB 3ENEA 2N9PC 4E71A 1V2YA 3RULA 2NPTA 1SGHA 2KN5A 1V86A 1E8WA 3Q3JA 3DDCB 2DZKA 2G45B 3C0RB 3OJ3A 1A5RA 3PTFC 1WXVA 3PPAA 4J6IA 4TUUA 3L17A 2KNBA 3AU5A 2FUHB 1V5OA 2NBWB 3VFKA 4CO7A 3U7DA 4F1SA 4BKSD 2I1KA 5E6NA 2LGXA 2DX5B 1WXSA 2KC2A 4KDIC 2LUEA 1VD2A 2R2OA 3CF6E 4MJSB 2LVOA 2MX2A 3PRMB 2LGDA 4ANUA 1EO6A 4NAWA 2LI5A 4HCNB 1V80A 2RR9A 4NPNA 2N1WA 2K8BA 3HM6X 2LZ6A 3LDZE 4FJYA 2KZRA 2BYFA 3A4SC 5DPTA 4URKA 5D6JB 2LASA 3M3JA 3VXWA 1ISNA 4KSLC 3M63B 2BGFA 5JHAA 4B6WA 4IM0A 1XQQA 5JZEB 1ZW7A 2AEHA 1S1QB 2KFJA 4WWNA 1P3QU 3L08A 4DHJD 3DBRI 4TQ0A 4W9CA 3V60A 2ZPYA 3DCGA 4NQLB 1WX7A 2GOWA 3KW5B 1GG3A 2V1YA 3L0WB 4NAWB 2KTRA 3QHTA 1RFAA 1WRDB 2LWPA 1E90A 1OGWA 1YIWA 3DVGX 3PRZA 3TL5A 3ZLZA 2KDEB 4JQWC 5KHQA 2V3SA 2KJRA 2DENB 3B08A 3EECA 4EOYA 1D3ZA 5J18A 1CMXB 2PE6B 2O6VD 3WA0A 1V49A 1MG8A 4NQKE 4IC7B 2N9XA 3CMMB 1UELA 2MBEA 5D7GA 3ZRFA 5LXHA 5DPRA 2KD0A 3HM3A 2M4NA 4BBNC 2BPSA 5HKHA 3PVLA 2MQJA 2JVCA 3QX1A 1I42A 2DYBA 2KTRB 5E6OA 3EC8A 3RYTA 2IZVB 5IAAC 3NZSA 2XBBC 4B9KA 3ZTDA 4FBJB 3UIOB 4ICUA 1RLFA 1WYWB 3UQBA 4LDTB 1SIFA 2KDIA 1WY8A 3ZW3A 2G4DB 3ZRCA 2JZZA 4EEWA 4FADA 1BT0A 2FNJB 3QIJA 4GU2A 1GJZA 3ZVVA 3R7QA 4MSMB 4HPMB 4AP4C 3UQAA 3N3KB 2MRPA 2JF5A 2MW5A 4HPLB 3OLMD 4K1RB 3W1SA 3L10B 1KOTA 1TGZB 2KX0A 2WX1A 1HE8A 2OOBB 3MTNB 4P7IA 1WXMA 2AYOB 4HCPB 2ZCCA 2L05A 2NS5A 2MBOA 1WI0A 5L83A 2G3QB 4K81A 1GC7A 4KZ0A 4MGZE 3ZDMC 2GBKA 3TJPA 3DPDA 1E7UA 2W9NA 3UF8A 4HWIB 5BO4B 4DXAB 3APDA 2MP2B 3I3TB 2CS4A 1ZKHA 2KKCA 3DBHI 4HDQA 4KIKA 2KWUB 2KJ6A 5CTRC 2KK8A 3VTWA 3NS8A 3VAWA 4G0NB 1TZ1A 2AL3A 3ZUNA 3VQIA 1WF9A 2MCNB 2MSED 1Q1OA 4FLHA 3KUZA 4PS8A 1J19A 2GBNA 4PS3A 4AWJA 3IFWB 2KWVB 2XK5A 2O6VA 2RPQA 1GUAB 3A9KA 4IWQA 3WIMA 1F9JA 3QARA 4RM8A 2IO0B 3EHVA 4KSKC 4F7ZA 2KXJA 2KFKA 2JPHA 2NCNA 2CHXA 1WXAA 5AZGA 5AZHA 2UWQA 1WJNA 4IM3A 2I1JA 4FHJA 1WJ4A 3R3MA 1YJ1A 1V81A 2ZVNA 4FHKA 4TQ1A 1WM3A 1E5WA 2GBRA 4WJNA 4CHKA 2EMTA 2MWSB 1LFDA 3TIXA 5CHWA 4RM9A 2R2QA 2A5UA 3M62B 1NBFC 4II3B 3ZO5B 4EZJA 1XD3B 3A4RA 1EF5A 1WGDA 3ECIA 3O65B 3QAQA 5D94A 4X57B 5C1ZA 2NPTB 2KMCA 4AJWA 4FA6A 2RGFA 4FULA 4A3PA 2KVRA 3BINA 2IBIB 2ZVOA 2J0KA 2BKRB 1NI2A 4I6LB 1T0YA 1Q0WB 1WIAA 3KUDB 2L00B 2KJHB 1UH6A 3QWZB 2O2VA 3ZNID 3APFA 4FJVB 4IWOA 3K9PB 2DAJA 4AOFA 1WGYA 2FCMA 1V6EA 3V61A 1WE7A 2L0TA 1YQBA 2K1FA 2K8HA 1LXDA 2K25A 2B3AA 2PJHA 2REXA 2IO2B 1S3SG 2LXAA 4W9JA 1WMHA 1WM2A 2AL6A 3PREA 5LLIA 1UBIA 3UINB 4GMVA 4DK5A 5LXIB 4ZRIA 2AWTA 1U4AA 2KC1A 3WALA 1SE9A 1FXTB 3PHXB 2K8CA 3H1UA 1G6JA 3QA8A 3A1QA 3PLVA 2HE7A 1IPGA 1Q5WB 2LXCA 4HLEA 4IUMB 5D2MB 2L0FA 3QK0A 2CKHB 3OAWA 3X0WA 1Y8RC 3KH0A 1UZXB 2C7HA 2FCNA 2QHOA 1P98A 3HHMA 1WH3A 2YVCA 5L95C 2LRWA 4YL8A 4MGIE 1E8XA 4WQOB 2KLCA 1E7VA 1WJ6A 2MBQA 2VRRB 4TV3A 4BOZB 1NDDA 2MBHA 2EKEC 4N9F4 1M94A 4XZ4A 1RAXA 1JRUA 1P9DU 4W9DA 1WX8A 5EDSA 4ASWC 2FCSA 4MELA 1J0GA 3W1SC 4BKSA 1WGHA 1GNUA 4MM3A 4RMAA 3B0AA 2DZMA 4DHZB 2JWZA 4FN2A 1RRBA 3A1QB 2KTFA 4M8NA 4BOSC 2PPHA 2ZEQA 3PHWB 4KDLB 2JRIB 3JVZX 4M0WB 3KVFB 5G55A 2NBUA 1QZEA 2BWES 3AULA 4BKTA 2N7DA 1OTRB 3AI5A 2LRUA 2WDTB 2D2QA 3W1YA 3UGBB 2DZJA 1WZ0A 4WJQA 3QJZA 1IP9A 4GGQA 2KO3A 4HVBA 3QC8B 2C7NB 5FR6A 3ALBA 3ONSA 3T9LA 4BFRA 3NHEB 1VCBA 4HJKA 1H4RA 2D11A 3NZUA 4MH0E 3K9OB 3PV1A 2ZNVC 4GXBA 4W9GA 4GDLA 2OJRA 2WWZA 4W9IA 3PZDA 4E3CA 2C7MB 3ZKJC 2LGYA 2M0XA 1EUVB 2LVQA 4WJOA 2KMAA 4GIVA 4G50A 2JXXA 3RZFA 2GMIC 1Z5SB 3L54A 3OJ4B 2M8SA 5CHVC 2KWCA 1KM7A 3PT2B 3DVGY 4IG7B 2D07B 4WAAA 2HTHA 4EFOA 2HJ8A 1WX9A 3JSVA 3L13A 1WR6E 4GB9A 3QCAA 3T8MA 3SDLC 2MA9B 4DHJB 2KQ7A 5DCNA 4W9LA 1P0RA 4ZYNA 3UIPB 3NOBA 3S2AA 4ANXA 4JGHB 4KIKB 2Z59B 2J0MA 3DBSA 3X23A 3NY5A 4LDTD 4BVUC 4GN1A 4DWFA 3N32A 2L3ZA 4MEMA 5DPWA 2LJ5A 3BY4B 5C23A 2C60A 2Z0EB 1E8ZA 2UYZB 2JY6A 3LJ3A 3VTUA 3PLUA 2Y5BB 4AUQC 1KLVA 2M1MA 3AXCA 4MJSA 3ML8A 1WFYA 2BYVE 3VUWA 2DHZA 3SU8X 2ZNVB 4KVGB 4DDGD 5J17A 3VH3B 2PE9A 3JYUA 5E6PA 2MBBB 2XK5B 5AZFA 1X1MA 2KX3A 2O6VB 3A9KB 2FCQA 2JRHA 1GC6A 3DQVA 1OEYJ 1UGMA 1YX6B 4I6NB 2V4LA 4HXDA 4G11A 2CU1A 5DPSA 3R7RA 3WANA 2WYQA 4LJPB 1WJUA 2KLGA 4IWPA 2JZ3B 2NVUI 5CHFA 3DOWA 3CSFA 3IG3A 2IY1B 1IYFA 4IM2A 3RZWC 5AEKB 2KFKB 1R4MI 4XX5A 3U8ZA 4K7UA 3IVFA 2CHWA 3V6EB 4PYUA 2L7RA 2DZIA 4W9KA 2M17A 4B95A 3A9JA 3KYDD 4NJ6A 3TMPB 4A20A 2KDBA 3HK0A 2KDFB 2L8JA 3VDZA 2LD9A 3H6NA 2ZJDA 2IO1B 4MGKE 4WJPA 4WWOA 2LVPA 2FIDA 3SHQA 2MLBA 3ZTCA 1I35A 3VTVA 5JH5C 2DYOA 4JL9A 4OVVA 4K7SA 4KV2A 2D3GA 2CR5A 3DVNU 1C1YB 4K7WA 3RD2A 4FJZA 3H9DA 3PRPB 4EUTA 4M8MA 3A9JB 2O2VB 2N4FA 4GOCA
chains in the Genus database with same CATH superfamily
5J2RA 2BW2A 3ZJVA 1V9JA 4LCDE 3RUIB 3VH4B 2IO3B 3PS6A 3VUXA 2QC8A 5TR5A 2WXHA 3ML9A 2INNE 3AE3B 3ZJUA 4JWSC 4JWUC 3BYTB 3ZJTA 3BZDB 4P1BC 1E6EB 3CIRB 3E56A 3T3OA 1L7YA 3OWEB 2YEPF 2E6XA 2Y5PA 4NJ7A 4EZKA 4WWPA 1ZE3D 2J7QB 2ZZPB 5EE1A 4P16A 2IYDB 1WR1A 4AJYB 1ZGUB 2IGHA 2NR2A 2ZPNA 4JLCA 1TS3A 2KQ4X 5HI1A 3NVYA 3C19A 2KOXA 1J8CA 5BYQA 3ZXRA 3KYCD 3I57A 2FBWB 5JXVA 3H7PA 1V5TA 2D3BA 4M02A 3PGEA 3HIZA 4W9EA 3MJWA 3RNEC 2HDEA 2KHWB 4A3OA 1C9FA 1JWAD 4EZLA 1T3QA 4C4VB 3GZNI 3P2BA 2JT4B 4GDLB 1BMLC 4RH6A 3ABVB 3N30A 3RCZA 4LNNA 1SF0A 4XE0A 1R4NI 4BBNF 1R4MB 2ZCBA 4MSQB 3WAMA 1XT9B 3IAS1 3Q3FA 1NYQA 1RYJA 1KLGD 3J9CA 3R66C 3V62A 3VHTC 1V2YA 2NPTA 3DDCB 1YQ4B 2DZKA 2G45B 3C0RB 1E7PB 1IBXB 4CO7A 2WXNA 1MVKA 2LGXA 2BB6A 4MJSB 1VD2A 4HKQA 4NAWA 1XXGA 3U2SC 4NPNA 2N1WA 2LZ6A 1N5XA 2NMQA 1B9RA 1I7HA 1D4BA 3VXWA 1F77A 3M63B 2BGFA 4L23A 4IM0A 1MFWA 1GB1A 2ZPYA 3DCGA 1WX7A 2V1YA 2E3TA 2KTRA 2ZW1A 4LLGM 1VZ8A 2LWPA 1E90A 1YIWA 3DVGX 2KJRA 2DENB 3EECA 2OJWA 3RNBC 1CMXB 1UELA 3TEZA 4BBNC 2KD0A 3PVLA 4RGNA 2KVZA 3C8YA 1XLQA 2CJNA 1T0SC 2XBBC 1SE4A 2JZPA 1WYWB 2MEKA 4FADA 1L0YB 2FNJB 4PK1A 1GJZA 2WXRA 4AP4C 1KRHA 4MT5A 2JF5A 4HPLB 3W1SA 3L10B 1TGZB 3DBLB 1EU4A 1ET9A 1D5ZC 5C2TB 2OOBB 3IT6B 2Z8LA 1ROEA 4HCPB 2ZCCA 2L05A 3CWIA 1XEEA 2G3QB 4KZ0A 4MGZE 3GS2A 1CK1A 1E7UA 1HTOA 2W9NA 4KKJA 5BO4B 4DXAB 3AE4B 3APDA 3Q8AA 4KIKA 2KJ6A 2N7JA 3P42A 2KK8A 1VRAB 1KFYB 4G0NB 3VAWA 2DNFA 2MCNB 2MSED 3KWLA 4PS3A 4KKIA 3W9CB 2RPQA 1YNTE 2WU5B 2JYTA 1YJJA 2RDBC 4KSKC 4F7ZA 2LMCA 2KFKA 2NCNA 5AZGA 4USAA 1WJNA 3O13A 3SEBA 4IM3A 1UWMA 3R3MA 1YJ1A 1WM3A 4WJNA 1LFDA 2GB1A 1I4QA 4EZJA 3A4RA 4ZOHC 3ECIA 5D94A 2KMCA 4FA6A 2GI9A 3KLSX 2WXMA 1T0YA 1Q0WB 2X38A 1MJDA 3AEDB 2KJHB 3RMKC 1UH6A 1F2RI 3ZNID 3APFA 1WWTA 1TKGA 1WGYA 1V6EA 3V61A 2L0TA 1C76A 1D5MC 2B3AA 2PJHA 1KTKA 4W9JA 4DK5A 3PREA 1J7CA 3BK2A 3BK1A 4ZRIA 2AWTA 2WXKA 1G6JA 3A1QA 1Q5WB 2LXCA 5D2MB 3X0WA 2C7HA 2I38A 2V3NA 4C7YA 4MGIE 1E7VA 1F0ZA 2LFIA 4BOZB 2EKEC 5EE9A 1M94A 4ASWC 1PGXA 3AEAB 1FNWA 1WGHA 1GNUA 2RPVA 4RMAA 1MHHE 3Q8CA 4M8NA 2V9HA 4BOSC 2ZEQA 4L2YA 3PHWB 1HTQA 4KGSA 1TKYA 1YN3A 4YWGG 2EKIA 1TS2A 2WGSA 3RNGC 2WDTB 2DZJA 4LNOA 2PMVA 1GOZA 1RM6C 1VZ6A 3N20C 3T9LA 4ZHPA 1SIJA 4ZHOA 1H4RA 3N9YC 4MH0E 4W9GA 1R7SA 2OJRA 2WWZA 3P4RB 1QOBA 2LGYA 3V3XA 4ARCA 2LVQA 3AB5A 2JXXA 5CHVC 3GE8C 1KM7A 2D07B 1WX9A 3JSVA 4GB9A 3DWGC 2W3SA 3NOBA 1UUPA 2WXQA 2Z59B 2LJ5A 5C23A 2C60A 2Z0EB 3LJ3A 1QLBB 2Y5BB 2R61A 4RFBA 3AXCA 1WFYA 3VH3B 2BS3B 5E6PA 2MBBB 3ETRA 2O6VB 3A9KB 3DQVA 1GC6A 1NVID 1YX6B 4G11A 1SJED 4LJPB 4IWPA 2NVUI 2KDMA 1JCKB 1IYFA 2IY1B 4B0EA 3RZWC 4XX5A 2V3PA 2CJOA 4PYUA 4H2AA 2WDQB 4RF0A 1MG4A 4B95A 3TMPB 4A20A 2KDBA 3HK0A 3FKYA 3AN1A 3DHIC 1A70A 2IO1B 2LVPA 3SHQA 2MLBA 5JH5C 1FFVA 3HVZA 1WGKA 4OW0A 5C3JB 2QJLA 1C1YB 4JPSA 5H92C 3RD2A 2HTME 4FJZA 1GAQB 3LB8C 4GOCA 4L1BA 3ZDTA 1P1AA 3W5VB 2BWFA 2KT7A 1TBEA 2D5GA 2NBVB 3AECB 3GP7A 2XEWA 1FCLA 4GDKA 1AARA 4ZRPA 1Q10A 1PGBA 1SXTA 1ZUD2 4F8CB 4ZRKA 3BVGA 1DYQA 3B1LX 3AMZA 2SEBD 3DHHC 3TBLD 3ZGZA 4RGOS 2JX5A 4P1CC 4JIOU 1C4AA 2WXGA 4ZRJA 1I42A 2LUMA 2JSVX 2Y5CA 2FAZA 3TCAA 1OEYA 3AE2B 2A4ZA 1OQYA 2MP2A 4ANWA 4E74A 3ZYYX 2N1VA 4MGYE 4ZRQA 3U4EG 1I4HA 2WNMA 4I6PA 5IN7A 3GZNB 1LM8B 2AX5A 3ZNHB 3N1ZC 4BKGA 2RD0A 2H89B 2WX0A 3DVNV 1VZ7A 2ASQA 2QCZA 1YD8U 5IA7A 3CSTA 1K8RB 4ZDVA 1R4NB 2QEJC 4TKNA 4N6EB 5D3DA 4EKUA 1XF5L 4MDKE 2DAFA 4W9HA 3KUCB 3H7PB 1WGGA 3AE8B 3ZQ4A 3MHSD 1PYWD 4G3XB 1C4CA 3IHPC 1I4PA 3M95A 3RPFC 3PO0A 2KN4A 4LK0M 3Q14C 1WYGA 3AH7A 1JW9D 1A5RA 3PPAA 4J6IA 2FUHB 2NBWB 4YTPB 4F1SA 5E6NA 1I4GA 1XCTL 1JWMD 2R2OA 3PRMB 4ANUA 1V80A 1JWSD 1UGJA 2K8BA 3NVVA 4FJYA 1OQQA 3V05A 5DPTA 3AE1B 4LNFA 5D6JB 3M3JA 1ISNA 3I5JC 3TEWA 5JHAA 1K52A 2AEHA 1P3QU 3DBRI 4KX6B 5BMIA 3Q3NC 2YEPB 1GG3A 3KW5B 3L0WB 4NAWB 2V4IB 4US9A 1WRDB 3TL5A 2BT6A 3ZLZA 4S0RA 2KDEB 4JQWC 1QQRA 1D3ZA 5J18A 2G1EA 2PE6B 2O6VD 1AYFA 3WA0A 1V49A 2X8XX 4XDCA 4OVZA 4RGMA 2K3UA 2QIEB 5DPRA 2M4NA 5HKHA 1C4PA 2LJIA 2JVCA 3QX1A 2KTRB 5E6OA 5HHDG 4B9KA 3UIOB 4ICUA 3UQBA 1L4DB 1N62A 2KDIA 2JZZA 4EEWA 4K3BA 4GU2A 1WRIA 2MJ3A 3UQAA 3N3KB 2MRPA 2VH1A 1DOYA 1YN5A 4ARIA 3H8HA 2MW5A 3OLMD 3NRZA 1KOTA 4J3OD 2KX0A 2WX1A 3HUIA 1HE8A 4C56C 2AYOB 3EFCA 2KWDA 4AQ7A 3MHZA 2KYWA 3DPDA 1YQ3B 3UF8A 2WDVB 2CS4A 1ZKHA 1FO4A 3DBHI 4JX1C 5MPOA 1CQVA 1TZ1A 2M19A 4ZYSA 3VQIA 2SAKA 4PS8A 2KWVB 1GUAB 4IWQA 3Q6BA 1D5XC 2CHXA 1WXAA 4D2KA 1N60A 4FHJA 1ZPSA 1WJ4A 4OHJA 3AEGB 3DWMA 1YN4A 2EMTA 3LXFA 2CU3A 2N9LA 3ZO5B 1NBFC 1XD3B 1EF5A 1WGDA 4AJWA 4FULA 2KVRA 1L4ZB 3AEEB 1V1PB 3KUDB 1QT9A 1CJEA 3K9PB 4NAMA 2K8HA 2REXA 2LXAA 2L52A 3EUB2 5LXIB 1SE2A 1U4AA 1FMAD 3PLVA 3AEFB 4IUMB 2L0FA 3QK0A 2CKHB 3OAWA 3EA6A 1UZXB 1WH3A 2YVCA 5L95C 4TV3A 1WJ6A 3W5UB 1DOIA 4YSYB 4W9DA 4N59A 2FCSA 3W1SC 4BKSA 2OHFA 3B0AA 4DHZB 2JWZA 2GRIA 1RRBA 3A1QB 2KTFA 1RWSA 2BYTA 4KDLB 1OFFA 3MFGA 1K51A 5G55A 1C78A 1L0VB 1ET6A 1EM7A 2BWES 2N7DA 1OTRB 3AI5A 2D2QA 2LHDA 2HJ1A 1WZ0A 3QJZA 4PT5A 4HVBA 2C7NB 5FR6A 1HQRD 4BFRA 2B76B 4C4VA 1TY2A 3NHEB 2XN9C 3BYYB 2BVCA 3K9OB 3PV1A 2ZNVC 3IXSA 4GDLA 3EGRA 4W9IA 1VLBA 2L83A 1F2RC 1PUTA 3Q3OC 1JQ4A 1EUVB 3BIID 2GMIC 2KWCA 4WAAA 4EFOA 2HTHA 2N9KA 2RDHA 1TJEA 3RI7C 1UNSA 4DHJB 5DCNA 2INDC 1P0RA 3UIPB 1IBXA 4JGHB 4WURA 1KLUD 4GN1A 4IKGA 2JY6A 1ZDXA 4YTNB 4AUQC 1KLVA 4MJSA 3VUWA 4KVGB 1XLNA 2PE9A 3JYUA 2XK5B 3R8BA 1JWUD 1X1MA 5AZFA 2JRHA 4I6NB 5DPSA 2V4LA 3R7RA 2WYQA 1WJUA 2KLGA 5BYSA 3DOWA 3PZ8A 3VR9B 1R4MI 1KF6B 4K7UA 2M17A 3NJTA 3BWUD 3GB1A 4JE3B 4NJ6A 4OZAA 4R3DA 2QMTA 4JL9A 4OVVA 4KV2A 4XWWA 2CR5A 2LGIA 2W54A 4WQMA 2N4FA 4K7WA 3T3NA 2FE8A 3H9DA 1L0XB 2Q5WD 2O2VB 4WH4A 5G2NA 3B9JA 2MHJA 1OQRA 3APCA 1QOGA 2K6QA 4O1NA 1FM0D 2N7EA 4DDID 4PS7A 3ZIMA 3QQ8B 1WMHB 2JXTA 5KHOA 2JU6X 4GSWA 4DXFA 4S17A 5E6JA 3VVWB 4WIPA 4WAFA 2BBCA 4IW0A 4CQNA 3L16A 2FIFA 2KAJA 3ZNGC 2D10A 2K6DB 2LHEA 1UD7A 4HJGE 4ANVA 3SD5A 3ZNZB 1XLOA 5JHBA 4CYEA 3V6CB 3U30A 2KQSA 1HZ5A 3B2GA 3H7SA 3KWVA 1TS4A 4RCOA 4GDKB 2KANA 2C9WB 4XC2A 2Z0DB 4W9FA 3I9V1 2IY0B 2WQYB 2YLMA 4A6QA 1QF6A 3D32A 2GBJA 3Q8EA 2J0JA 4LJOB 2DYMA 2G4SA 2BYEA 3E9SA 1IUEA 5FR3A 3VUYA 2WS3B 3R2TA 3EFUA 1JWBD 1LO5D 2BF8B 2WDRB 1LGRA 1N6ZA 3PSEB 1L5PA 4HDOA 3AE5B 4DHZE 3DBLI 1E8YA 5AUKA 3WAPA 1P7FA 1FFUA 5IP4D 3LYYA 2DWQA 1JRPA 1FXIA 4OVUA 3GOEA 1WE6A 2L32A 1H8CA 2GBMA 2GLSA 2KN5A 2INPE 3Q3JA 3OJ3A 1WXVA 3AEBB 1MI0A 3L17A 2WHIA 1SB3C 2KNBA 1V5OA 5FK9C 3VFKA 2I1KA 4ACFA 2KC2A 1WXSA 4KDIC 3HRDD 1V8CA 3CF6E 2MX2A 3NZ3A 1EO6A 4HCNB 2RR9A 3RNCC 2NTSA 3HVDA 3P4QB 4YT0B 2IGDA 3L4PA 1ZW7A 1S1QB 2KFJA 4WWNA 4DHJD 2KACA 4W9CA 3V60A 2Y3AA 5BMHA 2GOWA 3BVMA 4A90A 3N1XC 3NVWA 3SFEB 1RFAA 1OGWA 1L6UA 4EOYA 3URYA 2BS2B 1MG8A 1TY0A 4IC7B 2MBEA 3ZRFA 1WSPA 3HM3A 1HZ6A 2MQJA 2DYBA 1FRDA 3EC8A 3RYTA 1MPEA 2IZVB 3OG5A 5IAAC 3NZSA 2V0GA 1PFDA 2ON8A 1F1HA 1RLFA 1N5WA 3VR8B 1K53A 1SIFA 4P6VF 3ZRCA 3QIJA 3ZVVA 2WLBA 2PTLA 4XWTA 1GPXA 4K1RB 2MJDA 1SE3A 4P7IA 1P7EA 2NS5A 5LNK1 5L83A 1GC7A 3ZDMC 4KGTA 5AUIA 2GBKA 2H88B 1TIFA 3MJ5A 4M00A 4MH8A 4RGTA 1YMHE 4BZAA 4HDQA 1TZOA 2KWUB 3VTWA 1E0ZA 4XGAB 1VDVA 3ZUNA 3Q69A 2QDFA 4FLHA 3KUZA 1GB4A 2GBNA 2O6VA 3A9KA 3WIMA 1F9JA 3QARA 4RM8A 2KXJA 3KQ4A 4FXCA 1QILA 2JPHA 5AZHA 4REZA 1SEBD 2K22A 1NI3A 4TQ1A 1E5WA 2GBRA 3FC4A 2OEDA 2PVGC 4CHKA 2MWSB 3TIXA 1AW7A 4RM9A 4IDIA 4II3B 3O65B 4X57B 5C1ZA 2NPTB 3B2FA 3AE9B 4A3PA 2PW9A 2IBIB 4YTMB 2BKRB 1NI2A 3FILA 4I6LB 3TEXA 1DGJA 1BUIC 4AOFA 1YQBA 4KGRA 2K1FA 1LXDA 1S3SG 4AS1A 1WM2A 3UINB 3FAHA 3U7ZA 5EE0A 3WALA 1SE9A 1FXTB 4YXDB 1ACCA 4HLEA 1J7BA 1Y8RC 3KH0A 4M0WA 1P98A 4YL8A 1E8XA 1QOFA 4WQOB 2MBQA 2VRRB 2MBHA 4N9F4 4HRSA 4NJCA 3DHGC 1RAXA 1JRUA 1P9DU 1WX8A 4MELA 1J0GA 4M01A 4MM3A 2EELA 3AE6B 3P4SB 2J4XA 2PVOD 2JRIB 3KVFB 2XNAC 1QZEA 4DQOC 3AULA 4BKTA 2BB5A 2LRUA 3UGBB 4WJQA 1IP9A 3GE3C 2KO3A 2DLBA 3QC8B 3ALBA 3ONSA 1EWYC 1FXAA 2D11A 4HJKA 4GXBA 5IOIA 2INCC 2KMAA 1BXTA 1UWXA 2LEKA 4BAXA 3Q8FA 3L54A 3AM9A 4IG7B 3NUHB 3DVGY 2J42A 2I2YA 2HJ8A 1WXQA 3L13A 1WR6E 3T8MA 3QCAA 2KQ7A 2IGGA 4ZYNA 4ANXA 4KIKB 2J0MA 3DBSA 4WWMA 3X23A 3NY5A 2WXPA 2WXIA 3N32A 2L3ZA 5DPWA 2QILA 1E8ZA 3PLUA 3TEYA 2M1MA 3SU8X 1YOVB 2ZNVB 1B1ZA 2ZW0A 2FCQA 1OEYJ 1UGMA 2CU1A 3WANA 4K3CA 5CHFA 4IM2A 5AEKB 2KFKB 2CHWA 5IO9A 2DZIA 1C77A 4W9KA 2BTEA 3A9JA 2WU2B 1ZOYB 2KDFB 2QSDA 1JMLA 2WXOA 4C80A 3VDZA 1FIQA 2LD9A 2ZJDA 4ITKA 2D3CA 3MC0B 3VTVA 3MC9A 1ZDVA 2DYOA 4K7SA 1ZXHA 2G9HD 4IOIE 5D3IB 2WXJA 4XDDA 4M8MA 5T8IA 4LNIA 2C5LC 1WGRA 1N61A 4NY0A 1SJHD 4KZCA 2IPKD 3VRAB 1YX5B 2AQ2B 3MP9A 3RNFC 3SFDB 1EWCA 2JUOA 1J7AA 2ONQA 4Q2JA 2FUG1 4RF1A 1NEKB 2N9EB 1ZP0B 4PYZA 3RT3B 2PEAA 5GMVA 3JW0X 5BYRA 3NG0A 4DBGA 1L2NA 1AN8A 4UDUC 5FKAC 1EU3A 1EF1A 2RDGA 2L76A 4MACA 2NTTA 2WXFA 3RNAC 1TT5B 1UBQA 1M4VA 1PQSA 3AU4A 2M0AA 4HROA 4ICVA 1LQBA 3WAOA 5IKCM 1FCCC 1PGAA 4HK2A 1T0RC 3Q3MC 2RMMA 4II2B 2HD5B 5TSSA 2RSUA 4NNJB 5CX3A 3U52E 1WZ3A 1Z2MA 1V1OA 4EE2A 2CHZA 4XYCA 1ZXIA 4A55A 1KJTA 2K0PA 2K39A 3A33B 1E10A 2BKFA 3IBEA 1F52A 5BMGA 4YSXB 1T6BX 1RFKA 2EMSA 2ICIA 1C3TA 1TTNA 3JSVB 3ENEA 2N9PC 4E71A 3RULA 1SGHA 1V86A 1TKEA 1E8WA 1CZPA 3PTFC 4TUUA 1V1PA 3AU5A 4OZCA 2W55A 3U7DA 4BKSD 4TMAB 4LNKA 2DX5B 2LUEA 2LVOA 2LGDA 3MC8A 2LI5A 3P63A 3HM6X 3RN9C 3LDZE 2KZRA 2BYFA 1T0QC 3A4SC 1FEHA 4URKA 2LASA 1KH0A 4KSLC 2K5PA 4B6WA 1XQQA 5JZEB 4TQ0A 3L08A 3PZ7A 4NQLB 3QHTA 2W82A 3ZXVA 3PRZA 5KHQA 2V3SA 1T5XD 3B08A 1JALA 2J53A 3AV8A 4NQKE 1FRRA 4C7ZA 2N9XA 3CMMB 5D7GA 1K50A 1AWDA 1SBBB 2BPSA 5G5HA 1QKZA 4FBJB 3ZTDA 2WP9B 4LDTB 2PLPA 4A9AA 1WY8A 3ZW3A 2G4DB 1BT0A 3R7QA 4MSMB 4HPMB 1NENB 2L1AA 1TYGB 3NS1A 5GXGB 3MTNB 1WXMA 2MBOA 1WI0A 4K81A 5HFYA 5G5GA 3TJPA 2VZKB 1HEZE 4HWIB 1IGCA 2MP2B 3I3TB 1UF0A 2KKCA 5CTRC 1FNVA 3NS8A 2AL3A 1DOXA 1WF9A 3IT4B 1Q1OA 1D6EC 1J19A 4AWJA 3IFWB 2XK5A 1HA5A 2TSSA 3WCQA 5EE3A 2IO0B 3EHVA 2UWQA 2I1JA 1V81A 2ZVNA 4FHKA 1VJKA 4HPPA 2J52A 2IDYA 5CHWA 2JYEA 2R2QA 2A5UA 3M62B 2AQ1B 4N58A 1VR9A 3DBRB 1FPYA 3QAQA 3P4PB 2RGFA 3BINA 3RFZB 2ZVOA 2J0KA 3IAM1 1WIAA 2L00B 3BVZA 2D3AA 3Q2AC 3QWZB 2O2VA 4FJVB 1L6VA 4IWOA 2DAJA 2IJ0A 2FCMA 1WE7A 2K25A 2IO2B 5LXHA 1WMHA 2AL6A 1YJIA 2KMMA 5LLIA 1UBIA 4GMVA 4NZLB 3UI3A 2PIAA 3N1YC 3FILB 2KC1A 2MJEA 3PHXB 2K8CA 3H1UA 2JQRB 3QA8A 2HE7A 1IPGA 2ACZB 2K9XA 2FCNA 1Y56A 2QHOA 3HHMA 1C79A 1QOAA 2LRWA 4YSZB 1TS5A 2KLCA 4DXGA 1NDDA 4A8XC 4XZ4A 2W3RA 5EDSA 4US8A 2DZMA 4OZBA 1FNUA 2JWUA 4FN2A 1ESFA 1MHXA 2PPHA 2BS4B 4QAYA 2BQQA 3NVZA 1I4RA 3JVZX 4M0WB 3VRBB 2NBUA 2PKOA 1IGDA 1FD6A 3DBHB 2MH7A 3W1YA 1I4XA 4GGQA 3Q8BA 4MM3B 3TUOA 1VCBA 1XO3A 3I63C 1NYRA 3NZUA 3W2DA 1V97A 3PZDA 5H8YE 4E3CA 2C7MB 3ZKJC 2M0XA 4C00A 4WJOA 3R2IA 4GIVA 4G50A 3RZFA 1Z5SB 3OJ4B 2M8SA 3PT2B 3P1MA 4GLSC 2DBYA 3SDLC 2MA9B 4W9LA 3AE7B 3S2AA 4BVUC 4LDTD 4DWFA 4MEMA 3BY4B 2UYZB 3VTUA 1ENFA 3ML8A 2BYVE 2DHZA 1E9MA 4DDGD 5J17A 2KX3A 4HXDA 2M56B 2AQ3B 4HEA1 2JZ3B 3CSFA 3IG3A 1JROA 4LTUA 3U8ZA 1HXYD 3IVFA 3V6EB 4RNAA 2L7RA 2VZKD 4B0MA 1XLPA 3KYDD 2N0SB 2L8JA 4TSSA 3TSSA 4WWOA 3H6NA 4MGKE 4WJPA 1STEA 2LGSA 2FIDA 4HKZE 3ZTCA 1I35A 2VH2A 1N63A 1XCQL 5I4DA 2D3GA 3DVNU 1PDXA 2UU7A 3SR6A 5HG2A 1SSNA 3PRPB 4EUTA 3A9JB 2WXLA
chains in the Genus database with same CATH topology
2C5LC 5G2NA 1WGRA 3ZDTA 1P1AA 5J2RA 4NY0A 4KZCA 1V9JA 2BWFA 3APCA 4LCDE 3RUIB 2K6QA 3VH4B 2IO3B 1TBEA 2NBVB 3PS6A 3VUXA 1YX5B 2N7EA 5TR5A 4PS7A 4DDID 3ZIMA 3ML9A 3QQ8B 2XEWA 1WMHB 5KHOA 4GSWA 2JUOA 3VVWB 4GDKA 4IW0A 1AARA 3L16A 2FIFA 3ZNGC 2D10A 2K6DB 1L7YA 1UD7A 2N9EB 4PYZA 4NJ7A 4EZKA 4ANVA 3SD5A 4WWPA 4ZRKA 3RT3B 3ZNZB 2PEAA 5GMVA 3JW0X 4F8CB 5JHBA 4CYEA 3B1LX 2J7QB 3V6CB 3U30A 4DBGA 1L2NA 2ZZPB 2KQSA 3TBLD 1EF1A 2L76A 2IYDB 1WR1A 3H7SA 4AJYB 1ZGUB 4JIOU 1UBQA 4ZRJA 4GDKB 2NR2A 2ZPNA 1PQSA 4JLCA 3AU4A 2KANA 2C9WB 4XC2A 2FAZA 3TCAA 1OEYA 2Z0DB 4W9FA 2A4ZA 2IY0B 2YLMA 1OQYA 2MP2A 4ICVA 4ANWA 1LQBA 4E74A 3WAOA 2KOXA 3D32A 2GBJA 1J8CA 2J0JA 2N1VA 4HK2A 4MGYE 4LJOB 3KYCD 4II2B 2HD5B 2DYMA 4I6PA 2G4SA 1LM8B 2BYEA 3ZNHB 4BKGA 3H7PA 1V5TA 2RSUA 4NNJB 2RD0A 5CX3A 3PGEA 3HIZA 3VUYA 2WX0A 3DVNV 3MJWA 2ASQA 4W9EA 3EFUA 1YD8U 1WZ3A 2KHWB 1Z2MA 5IA7A 2BF8B 4A3OA 3CSTA 1K8RB 4ZDVA 2CHZA 4TKNA 3PSEB 4EZLA 4HDOA 4DHZE 3DBLI 3GZNI 4EKUA 1E8YA 1KJTA 3WAPA 2K39A 4MDKE 2DAFA 3P2BA 2JT4B 4W9HA 4GDLB 3A33B 3N30A 3RCZA 2BKFA 3IBEA 3KUCB 1R4NI 3H7PB 4BBNF 4MSQB 2ZCBA 1WGGA 3WAMA 1XT9B 3MHSD 4OVUA 3Q3FA 3GOEA 1WE6A 4G3XB 2EMSA 1H8CA 3IHPC 2GBMA 1C3TA 3M95A 3R66C 1TTNA 3V62A 3VHTC 3JSVB 3ENEA 2N9PC 4E71A 1V2YA 3RULA 2NPTA 1SGHA 2KN5A 1V86A 1E8WA 3Q3JA 3DDCB 2DZKA 2G45B 3C0RB 3OJ3A 1A5RA 3PTFC 1WXVA 3PPAA 4J6IA 4TUUA 3L17A 2KNBA 3AU5A 2FUHB 1V5OA 2NBWB 3VFKA 4CO7A 3U7DA 4F1SA 4BKSD 2I1KA 5E6NA 2LGXA 2DX5B 1WXSA 2KC2A 4KDIC 2LUEA 1VD2A 2R2OA 3CF6E 4MJSB 2LVOA 2MX2A 3PRMB 2LGDA 4ANUA 1EO6A 4NAWA 2LI5A 4HCNB 1V80A 2RR9A 4NPNA 2N1WA 2K8BA 3HM6X 2LZ6A 3LDZE 4FJYA 2KZRA 2BYFA 3A4SC 5DPTA 4URKA 5D6JB 2LASA 3M3JA 3VXWA 1ISNA 4KSLC 3M63B 2BGFA 5JHAA 4B6WA 4IM0A 1XQQA 5JZEB 1ZW7A 2AEHA 1S1QB 2KFJA 4WWNA 1P3QU 3L08A 4DHJD 3DBRI 4TQ0A 4W9CA 3V60A 2ZPYA 3DCGA 4NQLB 1WX7A 2GOWA 3KW5B 1GG3A 2V1YA 3L0WB 4NAWB 2KTRA 3QHTA 1RFAA 1WRDB 2LWPA 1E90A 1OGWA 1YIWA 3DVGX 3PRZA 3TL5A 3ZLZA 2KDEB 4JQWC 5KHQA 2V3SA 2KJRA 2DENB 3B08A 3EECA 4EOYA 1D3ZA 5J18A 1CMXB 2PE6B 2O6VD 3WA0A 1V49A 1MG8A 4NQKE 4IC7B 2N9XA 3CMMB 1UELA 2MBEA 5D7GA 3ZRFA 5LXHA 5DPRA 2KD0A 3HM3A 2M4NA 4BBNC 2BPSA 5HKHA 3PVLA 2MQJA 2JVCA 3QX1A 1I42A 2DYBA 2KTRB 5E6OA 3EC8A 3RYTA 2IZVB 5IAAC 3NZSA 2XBBC 4B9KA 3ZTDA 4FBJB 3UIOB 4ICUA 1RLFA 1WYWB 3UQBA 4LDTB 1SIFA 2KDIA 1WY8A 3ZW3A 2G4DB 3ZRCA 2JZZA 4EEWA 4FADA 1BT0A 2FNJB 3QIJA 4GU2A 1GJZA 3ZVVA 3R7QA 4MSMB 4HPMB 4AP4C 3UQAA 3N3KB 2MRPA 2JF5A 2MW5A 4HPLB 3OLMD 4K1RB 3W1SA 3L10B 1KOTA 1TGZB 2KX0A 2WX1A 1HE8A 2OOBB 3MTNB 4P7IA 1WXMA 2AYOB 4HCPB 2ZCCA 2L05A 2NS5A 2MBOA 1WI0A 5L83A 2G3QB 4K81A 1GC7A 4KZ0A 4MGZE 3ZDMC 2GBKA 3TJPA 3DPDA 1E7UA 2W9NA 3UF8A 4HWIB 5BO4B 4DXAB 3APDA 2MP2B 3I3TB 2CS4A 1ZKHA 2KKCA 3DBHI 4HDQA 4KIKA 2KWUB 2KJ6A 5CTRC 2KK8A 3VTWA 3NS8A 3VAWA 4G0NB 1TZ1A 2AL3A 3ZUNA 3VQIA 1WF9A 2MCNB 2MSED 1Q1OA 4FLHA 3KUZA 4PS8A 1J19A 2GBNA 4PS3A 4AWJA 3IFWB 2KWVB 2XK5A 2O6VA 2RPQA 1GUAB 3A9KA 4IWQA 3WIMA 1F9JA 3QARA 4RM8A 2IO0B 3EHVA 4KSKC 4F7ZA 2KXJA 2KFKA 2JPHA 2NCNA 2CHXA 1WXAA 5AZGA 5AZHA 2UWQA 1WJNA 4IM3A 2I1JA 4FHJA 1WJ4A 3R3MA 1YJ1A 1V81A 2ZVNA 4FHKA 4TQ1A 1WM3A 1E5WA 2GBRA 4WJNA 4CHKA 2EMTA 2MWSB 1LFDA 3TIXA 5CHWA 4RM9A 2R2QA 2A5UA 3M62B 1NBFC 4II3B 3ZO5B 4EZJA 1XD3B 3A4RA 1EF5A 1WGDA 3ECIA 3O65B 3QAQA 5D94A 4X57B 5C1ZA 2NPTB 2KMCA 4AJWA 4FA6A 2RGFA 4FULA 4A3PA 2KVRA 3BINA 2IBIB 2ZVOA 2J0KA 2BKRB 1NI2A 4I6LB 1T0YA 1Q0WB 1WIAA 3KUDB 2L00B 2KJHB 1UH6A 3QWZB 2O2VA 3ZNID 3APFA 4FJVB 4IWOA 3K9PB 2DAJA 4AOFA 1WGYA 2FCMA 1V6EA 3V61A 1WE7A 2L0TA 1YQBA 2K1FA 2K8HA 1LXDA 2K25A 2B3AA 2PJHA 2REXA 2IO2B 1S3SG 2LXAA 4W9JA 1WMHA 1WM2A 2AL6A 3PREA 5LLIA 1UBIA 3UINB 4GMVA 4DK5A 5LXIB 4ZRIA 2AWTA 1U4AA 2KC1A 3WALA 1SE9A 1FXTB 3PHXB 2K8CA 3H1UA 1G6JA 3QA8A 3A1QA 3PLVA 2HE7A 1IPGA 1Q5WB 2LXCA 4HLEA 4IUMB 5D2MB 2L0FA 3QK0A 2CKHB 3OAWA 3X0WA 1Y8RC 3KH0A 1UZXB 2C7HA 2FCNA 2QHOA 1P98A 3HHMA 1WH3A 2YVCA 5L95C 2LRWA 4YL8A 4MGIE 1E8XA 4WQOB 2KLCA 1E7VA 1WJ6A 2MBQA 2VRRB 4TV3A 4BOZB 1NDDA 2MBHA 2EKEC 4N9F4 1M94A 4XZ4A 1RAXA 1JRUA 1P9DU 4W9DA 1WX8A 5EDSA 4ASWC 2FCSA 4MELA 1J0GA 3W1SC 4BKSA 1WGHA 1GNUA 4MM3A 4RMAA 3B0AA 2DZMA 4DHZB 2JWZA 4FN2A 1RRBA 3A1QB 2KTFA 4M8NA 4BOSC 2PPHA 2ZEQA 3PHWB 4KDLB 2JRIB 3JVZX 4M0WB 3KVFB 5G55A 2NBUA 1QZEA 2BWES 3AULA 4BKTA 2N7DA 1OTRB 3AI5A 2LRUA 2WDTB 2D2QA 3W1YA 3UGBB 2DZJA 1WZ0A 4WJQA 3QJZA 1IP9A 4GGQA 2KO3A 4HVBA 3QC8B 2C7NB 5FR6A 3ALBA 3ONSA 3T9LA 4BFRA 3NHEB 1VCBA 4HJKA 1H4RA 2D11A 3NZUA 4MH0E 3K9OB 3PV1A 2ZNVC 4GXBA 4W9GA 4GDLA 2OJRA 2WWZA 4W9IA 3PZDA 4E3CA 2C7MB 3ZKJC 2LGYA 2M0XA 1EUVB 2LVQA 4WJOA 2KMAA 4GIVA 4G50A 2JXXA 3RZFA 2GMIC 1Z5SB 3L54A 3OJ4B 2M8SA 5CHVC 2KWCA 1KM7A 3PT2B 3DVGY 4IG7B 2D07B 4WAAA 2HTHA 4EFOA 2HJ8A 1WX9A 3JSVA 3L13A 1WR6E 4GB9A 3QCAA 3T8MA 3SDLC 2MA9B 4DHJB 2KQ7A 5DCNA 4W9LA 1P0RA 4ZYNA 3UIPB 3NOBA 3S2AA 4ANXA 4JGHB 4KIKB 2Z59B 2J0MA 3DBSA 3X23A 3NY5A 4LDTD 4BVUC 4GN1A 4DWFA 3N32A 2L3ZA 4MEMA 5DPWA 2LJ5A 3BY4B 5C23A 2C60A 2Z0EB 1E8ZA 2UYZB 2JY6A 3LJ3A 3VTUA 3PLUA 2Y5BB 4AUQC 1KLVA 2M1MA 3AXCA 4MJSA 3ML8A 1WFYA 2BYVE 3VUWA 2DHZA 3SU8X 2ZNVB 4KVGB 4DDGD 5J17A 3VH3B 2PE9A 3JYUA 5E6PA 2MBBB 2XK5B 5AZFA 1X1MA 2KX3A 2O6VB 3A9KB 2FCQA 2JRHA 1GC6A 3DQVA 1OEYJ 1UGMA 1YX6B 4I6NB 2V4LA 4HXDA 4G11A 2CU1A 5DPSA 3R7RA 3WANA 2WYQA 4LJPB 1WJUA 2KLGA 4IWPA 2JZ3B 2NVUI 5CHFA 3DOWA 3CSFA 3IG3A 2IY1B 1IYFA 4IM2A 3RZWC 5AEKB 2KFKB 1R4MI 4XX5A 3U8ZA 4K7UA 3IVFA 2CHWA 3V6EB 4PYUA 2L7RA 2DZIA 4W9KA 2M17A 4B95A 3A9JA 3KYDD 4NJ6A 3TMPB 4A20A 2KDBA 3HK0A 2KDFB 2L8JA 3VDZA 2LD9A 3H6NA 2ZJDA 2IO1B 4MGKE 4WJPA 4WWOA 2LVPA 2FIDA 3SHQA 2MLBA 3ZTCA 1I35A 3VTVA 5JH5C 2DYOA 4JL9A 4OVVA 4K7SA 4KV2A 2D3GA 2CR5A 3DVNU 1C1YB 4K7WA 3RD2A 4FJZA 3H9DA 3PRPB 4EUTA 4M8MA 3A9JB 2O2VB 2N4FA 4GOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5L C;  5G2N A;  1WGR A;  3ZDT A;  1P1A A;  5J2R A;  4NY0 A;  4KZC A;  1V9J A;  2BWF A;  3APC A;  4LCD E;  3RUI B;  2K6Q A;  3VH4 B;  2IO3 B;  1TBE A;  2NBV B;  3PS6 A;  3VUX A;  1YX5 B;  2N7E A;  5TR5 A;  4PS7 A;  4DDI D;  3ZIM A;  3ML9 A;  3QQ8 B;  2XEW A;  1WMH B;  5KHO A;  4GSW A;  2JUO A;  3VVW B;  4GDK A;  4IW0 A;  1AAR A;  3L16 A;  2FIF A;  3ZNG C;  2D10 A;  2K6D B;  1L7Y A;  1UD7 A;  2N9E B;  4PYZ A;  4NJ7 A;  4EZK A;  4ANV A;  3SD5 A;  4WWP A;  4ZRK A;  3RT3 B;  3ZNZ B;  2PEA A;  5GMV A;  3JW0 X;  4F8C B;  5JHB A;  4CYE A;  3B1L X;  2J7Q B;  3V6C B;  3U30 A;  4DBG A;  1L2N A;  2ZZP B;  2KQS A;  3TBL D;  1EF1 A;  2L76 A;  2IYD B;  1WR1 A;  3H7S A;  4AJY B;  1ZGU B;  4JIO U;  1UBQ A;  4ZRJ A;  4GDK B;  2NR2 A;  2ZPN A;  1PQS A;  4JLC A;  3AU4 A;  2KAN A;  2C9W B;  4XC2 A;  2FAZ A;  3TCA A;  1OEY A;  2Z0D B;  4W9F A;  2A4Z A;  2IY0 B;  2YLM A;  1OQY A;  2MP2 A;  4ICV A;  4ANW A;  1LQB A;  4E74 A;  3WAO A;  2KOX A;  3D32 A;  2GBJ A;  1J8C A;  2J0J A;  2N1V A;  4HK2 A;  4MGY E;  4LJO B;  3KYC D;  4II2 B;  2HD5 B;  2DYM A;  4I6P A;  2G4S A;  1LM8 B;  2BYE A;  3ZNH B;  4BKG A;  3H7P A;  1V5T A;  2RSU A;  4NNJ B;  2RD0 A;  5CX3 A;  3PGE A;  3HIZ A;  3VUY A;  2WX0 A;  3DVN V;  3MJW A;  2ASQ A;  4W9E A;  3EFU A;  1YD8 U;  1WZ3 A;  2KHW B;  1Z2M A;  5IA7 A;  2BF8 B;  4A3O A;  3CST A;  1K8R B;  4ZDV A;  2CHZ A;  4TKN A;  3PSE B;  4EZL A;  4HDO A;  4DHZ E;  3DBL I;  3GZN I;  4EKU A;  1E8Y A;  1KJT A;  3WAP A;  2K39 A;  4MDK E;  2DAF A;  3P2B A;  2JT4 B;  4W9H A;  4GDL B;  3A33 B;  3N30 A;  3RCZ A;  2BKF A;  3IBE A;  3KUC B;  1R4N I;  3H7P B;  4BBN F;  4MSQ B;  2ZCB A;  1WGG A;  3WAM A;  1XT9 B;  3MHS D;  4OVU A;  3Q3F A;  3GOE A;  1WE6 A;  4G3X B;  2EMS A;  1H8C A;  3IHP C;  2GBM A;  1C3T A;  3M95 A;  3R66 C;  1TTN A;  3V62 A;  3VHT C;  3JSV B;  3ENE A;  2N9P C;  4E71 A;  1V2Y A;  3RUL A;  2NPT A;  1SGH A;  2KN5 A;  1V86 A;  1E8W A;  3Q3J A;  3DDC B;  2DZK A;  2G45 B;  3C0R B;  3OJ3 A;  1A5R A;  3PTF C;  1WXV A;  3PPA A;  4J6I A;  4TUU A;  3L17 A;  2KNB A;  3AU5 A;  2FUH B;  1V5O A;  2NBW B;  3VFK A;  4CO7 A;  3U7D A;  4F1S A;  4BKS D;  2I1K A;  5E6N A;  2LGX A;  2DX5 B;  1WXS A;  2KC2 A;  4KDI C;  2LUE A;  1VD2 A;  2R2O A;  3CF6 E;  4MJS B;  2LVO A;  2MX2 A;  3PRM B;  2LGD A;  4ANU A;  1EO6 A;  4NAW A;  2LI5 A;  4HCN B;  1V80 A;  2RR9 A;  4NPN A;  2N1W A;  2K8B A;  3HM6 X;  2LZ6 A;  3LDZ E;  4FJY A;  2KZR A;  2BYF A;  3A4S C;  5DPT A;  4URK A;  5D6J B;  2LAS A;  3M3J A;  3VXW A;  1ISN A;  4KSL C;  3M63 B;  2BGF A;  5JHA A;  4B6W A;  4IM0 A;  1XQQ A;  5JZE B;  1ZW7 A;  2AEH A;  1S1Q B;  2KFJ A;  4WWN A;  1P3Q U;  3L08 A;  4DHJ D;  3DBR I;  4TQ0 A;  4W9C A;  3V60 A;  2ZPY A;  3DCG A;  4NQL B;  1WX7 A;  2GOW A;  3KW5 B;  1GG3 A;  2V1Y A;  3L0W B;  4NAW B;  2KTR A;  3QHT A;  1RFA A;  1WRD B;  2LWP A;  1E90 A;  1OGW A;  1YIW A;  3DVG X;  3PRZ A;  3TL5 A;  3ZLZ A;  2KDE B;  4JQW C;  5KHQ A;  2V3S A;  2KJR A;  2DEN B;  3B08 A;  3EEC A;  4EOY A;  1D3Z A;  5J18 A;  1CMX B;  2PE6 B;  2O6V D;  3WA0 A;  1V49 A;  1MG8 A;  4NQK E;  4IC7 B;  2N9X A;  3CMM B;  1UEL A;  2MBE A;  5D7G A;  3ZRF A;  5LXH A;  5DPR A;  2KD0 A;  3HM3 A;  2M4N A;  4BBN C;  2BPS A;  5HKH A;  3PVL A;  2MQJ A;  2JVC A;  3QX1 A;  1I42 A;  2DYB A;  2KTR B;  5E6O A;  3EC8 A;  3RYT A;  2IZV B;  5IAA C;  3NZS A;  2XBB C;  4B9K A;  3ZTD A;  4FBJ B;  3UIO B;  4ICU A;  1RLF A;  1WYW B;  3UQB A;  4LDT B;  1SIF A;  2KDI A;  1WY8 A;  3ZW3 A;  2G4D B;  3ZRC A;  2JZZ A;  4EEW A;  4FAD A;  1BT0 A;  2FNJ B;  3QIJ A;  4GU2 A;  1GJZ A;  3ZVV A;  3R7Q A;  4MSM B;  4HPM B;  4AP4 C;  3UQA A;  3N3K B;  2MRP A;  2JF5 A;  2MW5 A;  4HPL B;  3OLM D;  4K1R B;  3W1S A;  3L10 B;  1KOT A;  1TGZ B;  2KX0 A;  2WX1 A;  1HE8 A;  2OOB B;  3MTN B;  4P7I A;  1WXM A;  2AYO B;  4HCP B;  2ZCC A;  2L05 A;  2NS5 A;  2MBO A;  1WI0 A;  5L83 A;  2G3Q B;  4K81 A;  1GC7 A;  4KZ0 A;  4MGZ E;  3ZDM C;  2GBK A;  3TJP A;  3DPD A;  1E7U A;  2W9N A;  3UF8 A;  4HWI B;  5BO4 B;  4DXA B;  3APD A;  2MP2 B;  3I3T B;  2CS4 A;  1ZKH A;  2KKC A;  3DBH I;  4HDQ A;  4KIK A;  2KWU B;  2KJ6 A;  5CTR C;  2KK8 A;  3VTW A;  3NS8 A;  3VAW A;  4G0N B;  1TZ1 A;  2AL3 A;  3ZUN A;  3VQI A;  1WF9 A;  2MCN B;  2MSE D;  1Q1O A;  4FLH A;  3KUZ A;  4PS8 A;  1J19 A;  2GBN A;  4PS3 A;  4AWJ A;  3IFW B;  2KWV B;  2XK5 A;  2O6V A;  2RPQ A;  1GUA B;  3A9K A;  4IWQ A;  3WIM A;  1F9J A;  3QAR A;  4RM8 A;  2IO0 B;  3EHV A;  4KSK C;  4F7Z A;  2KXJ A;  2KFK A;  2JPH A;  2NCN A;  2CHX A;  1WXA A;  5AZG A;  5AZH A;  2UWQ A;  1WJN A;  4IM3 A;  2I1J A;  4FHJ A;  1WJ4 A;  3R3M A;  1YJ1 A;  1V81 A;  2ZVN A;  4FHK A;  4TQ1 A;  1WM3 A;  1E5W A;  2GBR A;  4WJN A;  4CHK A;  2EMT A;  2MWS B;  1LFD A;  3TIX A;  5CHW A;  4RM9 A;  2R2Q A;  2A5U A;  3M62 B;  1NBF C;  4II3 B;  3ZO5 B;  4EZJ A;  1XD3 B;  3A4R A;  1EF5 A;  1WGD A;  3ECI A;  3O65 B;  3QAQ A;  5D94 A;  4X57 B;  5C1Z A;  2NPT B;  2KMC A;  4AJW A;  4FA6 A;  2RGF A;  4FUL A;  4A3P A;  2KVR A;  3BIN A;  2IBI B;  2ZVO A;  2J0K A;  2BKR B;  1NI2 A;  4I6L B;  1T0Y A;  1Q0W B;  1WIA A;  3KUD B;  2L00 B;  2KJH B;  1UH6 A;  3QWZ B;  2O2V A;  3ZNI D;  3APF A;  4FJV B;  4IWO A;  3K9P B;  2DAJ A;  4AOF A;  1WGY A;  2FCM A;  1V6E A;  3V61 A;  1WE7 A;  2L0T A;  1YQB A;  2K1F A;  2K8H A;  1LXD A;  2K25 A;  2B3A A;  2PJH A;  2REX A;  2IO2 B;  1S3S G;  2LXA A;  4W9J A;  1WMH A;  1WM2 A;  2AL6 A;  3PRE A;  5LLI A;  1UBI A;  3UIN B;  4GMV A;  4DK5 A;  5LXI B;  4ZRI A;  2AWT A;  1U4A A;  2KC1 A;  3WAL A;  1SE9 A;  1FXT B;  3PHX B;  2K8C A;  3H1U A;  1G6J A;  3QA8 A;  3A1Q A;  3PLV A;  2HE7 A;  1IPG A;  1Q5W B;  2LXC A;  4HLE A;  4IUM B;  5D2M B;  2L0F A;  3QK0 A;  2CKH B;  3OAW A;  3X0W A;  1Y8R C;  3KH0 A;  1UZX B;  2C7H A;  2FCN A;  2QHO A;  1P98 A;  3HHM A;  1WH3 A;  2YVC A;  5L95 C;  2LRW A;  4YL8 A;  4MGI E;  1E8X A;  4WQO B;  2KLC A;  1E7V A;  1WJ6 A;  2MBQ A;  2VRR B;  4TV3 A;  4BOZ B;  1NDD A;  2MBH A;  2EKE C;  4N9F 4;  1M94 A;  4XZ4 A;  1RAX A;  1JRU A;  1P9D U;  4W9D A;  1WX8 A;  5EDS A;  4ASW C;  2FCS A;  4MEL A;  1J0G A;  3W1S C;  4BKS A;  1WGH A;  1GNU A;  4MM3 A;  4RMA A;  3B0A A;  2DZM A;  4DHZ B;  2JWZ A;  4FN2 A;  1RRB A;  3A1Q B;  2KTF A;  4M8N A;  4BOS C;  2PPH A;  2ZEQ A;  3PHW B;  4KDL B;  2JRI B;  3JVZ X;  4M0W B;  3KVF B;  5G55 A;  2NBU A;  1QZE A;  2BWE S;  3AUL A;  4BKT A;  2N7D A;  1OTR B;  3AI5 A;  2LRU A;  2WDT B;  2D2Q A;  3W1Y A;  3UGB B;  2DZJ A;  1WZ0 A;  4WJQ A;  3QJZ A;  1IP9 A;  4GGQ A;  2KO3 A;  4HVB A;  3QC8 B;  2C7N B;  5FR6 A;  3ALB A;  3ONS A;  3T9L A;  4BFR A;  3NHE B;  1VCB A;  4HJK A;  1H4R A;  2D11 A;  3NZU A;  4MH0 E;  3K9O B;  3PV1 A;  2ZNV C;  4GXB A;  4W9G A;  4GDL A;  2OJR A;  2WWZ A;  4W9I A;  3PZD A;  4E3C A;  2C7M B;  3ZKJ C;  2LGY A;  2M0X A;  1EUV B;  2LVQ A;  4WJO A;  2KMA A;  4GIV A;  4G50 A;  2JXX A;  3RZF A;  2GMI C;  1Z5S B;  3L54 A;  3OJ4 B;  2M8S A;  5CHV C;  2KWC A;  1KM7 A;  3PT2 B;  3DVG Y;  4IG7 B;  2D07 B;  4WAA A;  2HTH A;  4EFO A;  2HJ8 A;  1WX9 A;  3JSV A;  3L13 A;  1WR6 E;  4GB9 A;  3QCA A;  3T8M A;  3SDL C;  2MA9 B;  4DHJ B;  2KQ7 A;  5DCN A;  4W9L A;  1P0R A;  4ZYN A;  3UIP B;  3NOB A;  3S2A A;  4ANX A;  4JGH B;  4KIK B;  2Z59 B;  2J0M A;  3DBS A;  3X23 A;  3NY5 A;  4LDT D;  4BVU C;  4GN1 A;  4DWF A;  3N32 A;  2L3Z A;  4MEM A;  5DPW A;  2LJ5 A;  3BY4 B;  5C23 A;  2C60 A;  2Z0E B;  1E8Z A;  2UYZ B;  2JY6 A;  3LJ3 A;  3VTU A;  3PLU A;  2Y5B B;  4AUQ C;  1KLV A;  2M1M A;  3AXC A;  4MJS A;  3ML8 A;  1WFY A;  2BYV E;  3VUW A;  2DHZ A;  3SU8 X;  2ZNV B;  4KVG B;  4DDG D;  5J17 A;  3VH3 B;  2PE9 A;  3JYU A;  5E6P A;  2MBB B;  2XK5 B;  5AZF A;  1X1M A;  2KX3 A;  2O6V B;  3A9K B;  2FCQ A;  2JRH A;  1GC6 A;  3DQV A;  1OEY J;  1UGM A;  1YX6 B;  4I6N B;  2V4L A;  4HXD A;  4G11 A;  2CU1 A;  5DPS A;  3R7R A;  3WAN A;  2WYQ A;  4LJP B;  1WJU A;  2KLG A;  4IWP A;  2JZ3 B;  2NVU I;  5CHF A;  3DOW A;  3CSF A;  3IG3 A;  2IY1 B;  1IYF A;  4IM2 A;  3RZW C;  5AEK B;  2KFK B;  1R4M I;  4XX5 A;  3U8Z A;  4K7U A;  3IVF A;  2CHW A;  3V6E B;  4PYU A;  2L7R A;  2DZI A;  4W9K A;  2M17 A;  4B95 A;  3A9J A;  3KYD D;  4NJ6 A;  3TMP B;  4A20 A;  2KDB A;  3HK0 A;  2KDF B;  2L8J A;  3VDZ A;  2LD9 A;  3H6N A;  2ZJD A;  2IO1 B;  4MGK E;  4WJP A;  4WWO A;  2LVP A;  2FID A;  3SHQ A;  2MLB A;  3ZTC A;  1I35 A;  3VTV A;  5JH5 C;  2DYO A;  4JL9 A;  4OVV A;  4K7S A;  4KV2 A;  2D3G A;  2CR5 A;  3DVN U;  1C1Y B;  4K7W A;  3RD2 A;  4FJZ A;  3H9D A;  3PRP B;  4EUT A;  4M8M A;  3A9J B;  2O2V B;  2N4F A;  4GOC A; 
#chains in the Genus database with same CATH topology
 5J2R A;  2BW2 A;  3ZJV A;  1V9J A;  4LCD E;  3RUI B;  3VH4 B;  2IO3 B;  3PS6 A;  3VUX A;  2QC8 A;  5TR5 A;  2WXH A;  3ML9 A;  2INN E;  3AE3 B;  3ZJU A;  4JWS C;  4JWU C;  3BYT B;  3ZJT A;  3BZD B;  4P1B C;  1E6E B;  3CIR B;  3E56 A;  3T3O A;  1L7Y A;  3OWE B;  2YEP F;  2E6X A;  2Y5P A;  4NJ7 A;  4EZK A;  4WWP A;  1ZE3 D;  2J7Q B;  2ZZP B;  5EE1 A;  4P16 A;  2IYD B;  1WR1 A;  4AJY B;  1ZGU B;  2IGH A;  2NR2 A;  2ZPN A;  4JLC A;  1TS3 A;  2KQ4 X;  5HI1 A;  3NVY A;  3C19 A;  2KOX A;  1J8C A;  5BYQ A;  3ZXR A;  3KYC D;  3I57 A;  2FBW B;  5JXV A;  3H7P A;  1V5T A;  2D3B A;  4M02 A;  3PGE A;  3HIZ A;  4W9E A;  3MJW A;  3RNE C;  2HDE A;  2KHW B;  4A3O A;  1C9F A;  1JWA D;  4EZL A;  1T3Q A;  4C4V B;  3GZN I;  3P2B A;  2JT4 B;  4GDL B;  1BML C;  4RH6 A;  3ABV B;  3N30 A;  3RCZ A;  4LNN A;  1SF0 A;  4XE0 A;  1R4N I;  4BBN F;  1R4M B;  2ZCB A;  4MSQ B;  3WAM A;  1XT9 B;  3IAS 1;  3Q3F A;  1NYQ A;  1RYJ A;  1KLG D;  3J9C A;  3R66 C;  3V62 A;  3VHT C;  1V2Y A;  2NPT A;  3DDC B;  1YQ4 B;  2DZK A;  2G45 B;  3C0R B;  1E7P B;  1IBX B;  4CO7 A;  2WXN A;  1MVK A;  2LGX A;  2BB6 A;  4MJS B;  1VD2 A;  4HKQ A;  4NAW A;  1XXG A;  3U2S C;  4NPN A;  2N1W A;  2LZ6 A;  1N5X A;  2NMQ A;  1B9R A;  1I7H A;  1D4B A;  3VXW A;  1F77 A;  3M63 B;  2BGF A;  4L23 A;  4IM0 A;  1MFW A;  1GB1 A;  2ZPY A;  3DCG A;  1WX7 A;  2V1Y A;  2E3T A;  2KTR A;  2ZW1 A;  4LLG M;  1VZ8 A;  2LWP A;  1E90 A;  1YIW A;  3DVG X;  2KJR A;  2DEN B;  3EEC A;  2OJW A;  3RNB C;  1CMX B;  1UEL A;  3TEZ A;  4BBN C;  2KD0 A;  3PVL A;  4RGN A;  2KVZ A;  3C8Y A;  1XLQ A;  2CJN A;  1T0S C;  2XBB C;  1SE4 A;  2JZP A;  1WYW B;  2MEK A;  4FAD A;  1L0Y B;  2FNJ B;  4PK1 A;  1GJZ A;  2WXR A;  4AP4 C;  1KRH A;  4MT5 A;  2JF5 A;  4HPL B;  3W1S A;  3L10 B;  1TGZ B;  3DBL B;  1EU4 A;  1ET9 A;  1D5Z C;  5C2T B;  2OOB B;  3IT6 B;  2Z8L A;  1ROE A;  4HCP B;  2ZCC A;  2L05 A;  3CWI A;  1XEE A;  2G3Q B;  4KZ0 A;  4MGZ E;  3GS2 A;  1CK1 A;  1E7U A;  1HTO A;  2W9N A;  4KKJ A;  5BO4 B;  4DXA B;  3AE4 B;  3APD A;  3Q8A A;  4KIK A;  2KJ6 A;  2N7J A;  3P42 A;  2KK8 A;  1VRA B;  1KFY B;  4G0N B;  3VAW A;  2DNF A;  2MCN B;  2MSE D;  3KWL A;  4PS3 A;  4KKI A;  3W9C B;  2RPQ A;  1YNT E;  2WU5 B;  2JYT A;  1YJJ A;  2RDB C;  4KSK C;  4F7Z A;  2LMC A;  2KFK A;  2NCN A;  5AZG A;  4USA A;  1WJN A;  3O13 A;  3SEB A;  4IM3 A;  1UWM A;  3R3M A;  1YJ1 A;  1WM3 A;  4WJN A;  1LFD A;  2GB1 A;  1I4Q A;  4EZJ A;  3A4R A;  4ZOH C;  3ECI A;  5D94 A;  2KMC A;  4FA6 A;  2GI9 A;  3KLS X;  2WXM A;  1T0Y A;  1Q0W B;  2X38 A;  1MJD A;  3AED B;  2KJH B;  3RMK C;  1UH6 A;  1F2R I;  3ZNI D;  3APF A;  1WWT A;  1TKG A;  1WGY A;  1V6E A;  3V61 A;  2L0T A;  1C76 A;  1D5M C;  2B3A A;  2PJH A;  1KTK A;  4W9J A;  4DK5 A;  3PRE A;  1J7C A;  3BK2 A;  3BK1 A;  4ZRI A;  2AWT A;  2WXK A;  1G6J A;  3A1Q A;  1Q5W B;  2LXC A;  5D2M B;  3X0W A;  2C7H A;  2I38 A;  2V3N A;  4C7Y A;  4MGI E;  1E7V A;  1F0Z A;  2LFI A;  4BOZ B;  2EKE C;  5EE9 A;  1M94 A;  4ASW C;  1PGX A;  3AEA B;  1FNW A;  1WGH A;  1GNU A;  2RPV A;  4RMA A;  1MHH E;  3Q8C A;  4M8N A;  2V9H A;  4BOS C;  2ZEQ A;  4L2Y A;  3PHW B;  1HTQ A;  4KGS A;  1TKY A;  1YN3 A;  4YWG G;  2EKI A;  1TS2 A;  2WGS A;  3RNG C;  2WDT B;  2DZJ A;  4LNO A;  2PMV A;  1GOZ A;  1RM6 C;  1VZ6 A;  3N20 C;  3T9L A;  4ZHP A;  1SIJ A;  4ZHO A;  1H4R A;  3N9Y C;  4MH0 E;  4W9G A;  1R7S A;  2OJR A;  2WWZ A;  3P4R B;  1QOB A;  2LGY A;  3V3X A;  4ARC A;  2LVQ A;  3AB5 A;  2JXX A;  5CHV C;  3GE8 C;  1KM7 A;  2D07 B;  1WX9 A;  3JSV A;  4GB9 A;  3DWG C;  2W3S A;  3NOB A;  1UUP A;  2WXQ A;  2Z59 B;  2LJ5 A;  5C23 A;  2C60 A;  2Z0E B;  3LJ3 A;  1QLB B;  2Y5B B;  2R61 A;  4RFB A;  3AXC A;  1WFY A;  3VH3 B;  2BS3 B;  5E6P A;  2MBB B;  3ETR A;  2O6V B;  3A9K B;  3DQV A;  1GC6 A;  1NVI D;  1YX6 B;  4G11 A;  1SJE D;  4LJP B;  4IWP A;  2NVU I;  2KDM A;  1JCK B;  1IYF A;  2IY1 B;  4B0E A;  3RZW C;  4XX5 A;  2V3P A;  2CJO A;  4PYU A;  4H2A A;  2WDQ B;  4RF0 A;  1MG4 A;  4B95 A;  3TMP B;  4A20 A;  2KDB A;  3HK0 A;  3FKY A;  3AN1 A;  3DHI C;  1A70 A;  2IO1 B;  2LVP A;  3SHQ A;  2MLB A;  5JH5 C;  1FFV A;  3HVZ A;  1WGK A;  4OW0 A;  5C3J B;  2QJL A;  1C1Y B;  4JPS A;  5H92 C;  3RD2 A;  2HTM E;  4FJZ A;  1GAQ B;  3LB8 C;  4GOC A;  4L1B A;  3ZDT A;  1P1A A;  3W5V B;  2BWF A;  2KT7 A;  1TBE A;  2D5G A;  2NBV B;  3AEC B;  3GP7 A;  2XEW A;  1FCL A;  4GDK A;  1AAR A;  4ZRP A;  1Q10 A;  1PGB A;  1SXT A;  1ZUD 2;  4F8C B;  4ZRK A;  3BVG A;  1DYQ A;  3B1L X;  3AMZ A;  2SEB D;  3DHH C;  3TBL D;  3ZGZ A;  4RGO S;  2JX5 A;  4P1C C;  4JIO U;  1C4A A;  2WXG A;  4ZRJ A;  1I42 A;  2LUM A;  2JSV X;  2Y5C A;  2FAZ A;  3TCA A;  1OEY A;  3AE2 B;  2A4Z A;  1OQY A;  2MP2 A;  4ANW A;  4E74 A;  3ZYY X;  2N1V A;  4MGY E;  4ZRQ A;  3U4E G;  1I4H A;  2WNM A;  4I6P A;  5IN7 A;  3GZN B;  1LM8 B;  2AX5 A;  3ZNH B;  3N1Z C;  4BKG A;  2RD0 A;  2H89 B;  2WX0 A;  3DVN V;  1VZ7 A;  2ASQ A;  2QCZ A;  1YD8 U;  5IA7 A;  3CST A;  1K8R B;  4ZDV A;  1R4N B;  2QEJ C;  4TKN A;  4N6E B;  5D3D A;  4EKU A;  1XF5 L;  4MDK E;  2DAF A;  4W9H A;  3KUC B;  3H7P B;  1WGG A;  3AE8 B;  3ZQ4 A;  3MHS D;  1PYW D;  4G3X B;  1C4C A;  3IHP C;  1I4P A;  3M95 A;  3RPF C;  3PO0 A;  2KN4 A;  4LK0 M;  3Q14 C;  1WYG A;  3AH7 A;  1JW9 D;  1A5R A;  3PPA A;  4J6I A;  2FUH B;  2NBW B;  4YTP B;  4F1S A;  5E6N A;  1I4G A;  1XCT L;  1JWM D;  2R2O A;  3PRM B;  4ANU A;  1V80 A;  1JWS D;  1UGJ A;  2K8B A;  3NVV A;  4FJY A;  1OQQ A;  3V05 A;  5DPT A;  3AE1 B;  4LNF A;  5D6J B;  3M3J A;  1ISN A;  3I5J C;  3TEW A;  5JHA A;  1K52 A;  2AEH A;  1P3Q U;  3DBR I;  4KX6 B;  5BMI A;  3Q3N C;  2YEP B;  1GG3 A;  3KW5 B;  3L0W B;  4NAW B;  2V4I B;  4US9 A;  1WRD B;  3TL5 A;  2BT6 A;  3ZLZ A;  4S0R A;  2KDE B;  4JQW C;  1QQR A;  1D3Z A;  5J18 A;  2G1E A;  2PE6 B;  2O6V D;  1AYF A;  3WA0 A;  1V49 A;  2X8X X;  4XDC A;  4OVZ A;  4RGM A;  2K3U A;  2QIE B;  5DPR A;  2M4N A;  5HKH A;  1C4P A;  2LJI A;  2JVC A;  3QX1 A;  2KTR B;  5E6O A;  5HHD G;  4B9K A;  3UIO B;  4ICU A;  3UQB A;  1L4D B;  1N62 A;  2KDI A;  2JZZ A;  4EEW A;  4K3B A;  4GU2 A;  1WRI A;  2MJ3 A;  3UQA A;  3N3K B;  2MRP A;  2VH1 A;  1DOY A;  1YN5 A;  4ARI A;  3H8H A;  2MW5 A;  3OLM D;  3NRZ A;  1KOT A;  4J3O D;  2KX0 A;  2WX1 A;  3HUI A;  1HE8 A;  4C56 C;  2AYO B;  3EFC A;  2KWD A;  4AQ7 A;  3MHZ A;  2KYW A;  3DPD A;  1YQ3 B;  3UF8 A;  2WDV B;  2CS4 A;  1ZKH A;  1FO4 A;  3DBH I;  4JX1 C;  5MPO A;  1CQV A;  1TZ1 A;  2M19 A;  4ZYS A;  3VQI A;  2SAK A;  4PS8 A;  2KWV B;  1GUA B;  4IWQ A;  3Q6B A;  1D5X C;  2CHX A;  1WXA A;  4D2K A;  1N60 A;  4FHJ A;  1ZPS A;  1WJ4 A;  4OHJ A;  3AEG B;  3DWM A;  1YN4 A;  2EMT A;  3LXF A;  2CU3 A;  2N9L A;  3ZO5 B;  1NBF C;  1XD3 B;  1EF5 A;  1WGD A;  4AJW A;  4FUL A;  2KVR A;  1L4Z B;  3AEE B;  1V1P B;  3KUD B;  1QT9 A;  1CJE A;  3K9P B;  4NAM A;  2K8H A;  2REX A;  2LXA A;  2L52 A;  3EUB 2;  5LXI B;  1SE2 A;  1U4A A;  1FMA D;  3PLV A;  3AEF B;  4IUM B;  2L0F A;  3QK0 A;  2CKH B;  3OAW A;  3EA6 A;  1UZX B;  1WH3 A;  2YVC A;  5L95 C;  4TV3 A;  1WJ6 A;  3W5U B;  1DOI A;  4YSY B;  4W9D A;  4N59 A;  2FCS A;  3W1S C;  4BKS A;  2OHF A;  3B0A A;  4DHZ B;  2JWZ A;  2GRI A;  1RRB A;  3A1Q B;  2KTF A;  1RWS A;  2BYT A;  4KDL B;  1OFF A;  3MFG A;  1K51 A;  5G55 A;  1C78 A;  1L0V B;  1ET6 A;  1EM7 A;  2BWE S;  2N7D A;  1OTR B;  3AI5 A;  2D2Q A;  2LHD A;  2HJ1 A;  1WZ0 A;  3QJZ A;  4PT5 A;  4HVB A;  2C7N B;  5FR6 A;  1HQR D;  4BFR A;  2B76 B;  4C4V A;  1TY2 A;  3NHE B;  2XN9 C;  3BYY B;  2BVC A;  3K9O B;  3PV1 A;  2ZNV C;  3IXS A;  4GDL A;  3EGR A;  4W9I A;  1VLB A;  2L83 A;  1F2R C;  1PUT A;  3Q3O C;  1JQ4 A;  1EUV B;  3BII D;  2GMI C;  2KWC A;  4WAA A;  4EFO A;  2HTH A;  2N9K A;  2RDH A;  1TJE A;  3RI7 C;  1UNS A;  4DHJ B;  5DCN A;  2IND C;  1P0R A;  3UIP B;  1IBX A;  4JGH B;  4WUR A;  1KLU D;  4GN1 A;  4IKG A;  2JY6 A;  1ZDX A;  4YTN B;  4AUQ C;  1KLV A;  4MJS A;  3VUW A;  4KVG B;  1XLN A;  2PE9 A;  3JYU A;  2XK5 B;  3R8B A;  1JWU D;  1X1M A;  5AZF A;  2JRH A;  4I6N B;  5DPS A;  2V4L A;  3R7R A;  2WYQ A;  1WJU A;  2KLG A;  5BYS A;  3DOW A;  3PZ8 A;  3VR9 B;  1R4M I;  1KF6 B;  4K7U A;  2M17 A;  3NJT A;  3BWU D;  3GB1 A;  4JE3 B;  4NJ6 A;  4OZA A;  4R3D A;  2QMT A;  4JL9 A;  4OVV A;  4KV2 A;  4XWW A;  2CR5 A;  2LGI A;  2W54 A;  4WQM A;  2N4F A;  4K7W A;  3T3N A;  2FE8 A;  3H9D A;  1L0X B;  2Q5W D;  2O2V B;  4WH4 A;  5G2N A;  3B9J A;  2MHJ A;  1OQR A;  3APC A;  1QOG A;  2K6Q A;  4O1N A;  1FM0 D;  2N7E A;  4DDI D;  4PS7 A;  3ZIM A;  3QQ8 B;  1WMH B;  2JXT A;  5KHO A;  2JU6 X;  4GSW A;  4DXF A;  4S17 A;  5E6J A;  3VVW B;  4WIP A;  4WAF A;  2BBC A;  4IW0 A;  4CQN A;  3L16 A;  2FIF A;  2KAJ A;  3ZNG C;  2D10 A;  2K6D B;  2LHE A;  1UD7 A;  4HJG E;  4ANV A;  3SD5 A;  3ZNZ B;  1XLO A;  5JHB A;  4CYE A;  3V6C B;  3U30 A;  2KQS A;  1HZ5 A;  3B2G A;  3H7S A;  3KWV A;  1TS4 A;  4RCO A;  4GDK B;  2KAN A;  2C9W B;  4XC2 A;  2Z0D B;  4W9F A;  3I9V 1;  2IY0 B;  2WQY B;  2YLM A;  4A6Q A;  1QF6 A;  3D32 A;  2GBJ A;  3Q8E A;  2J0J A;  4LJO B;  2DYM A;  2G4S A;  2BYE A;  3E9S A;  1IUE A;  5FR3 A;  3VUY A;  2WS3 B;  3R2T A;  3EFU A;  1JWB D;  1LO5 D;  2BF8 B;  2WDR B;  1LGR A;  1N6Z A;  3PSE B;  1L5P A;  4HDO A;  3AE5 B;  4DHZ E;  3DBL I;  1E8Y A;  5AUK A;  3WAP A;  1P7F A;  1FFU A;  5IP4 D;  3LYY A;  2DWQ A;  1JRP A;  1FXI A;  4OVU A;  3GOE A;  1WE6 A;  2L32 A;  1H8C A;  2GBM A;  2GLS A;  2KN5 A;  2INP E;  3Q3J A;  3OJ3 A;  1WXV A;  3AEB B;  1MI0 A;  3L17 A;  2WHI A;  1SB3 C;  2KNB A;  1V5O A;  5FK9 C;  3VFK A;  2I1K A;  4ACF A;  2KC2 A;  1WXS A;  4KDI C;  3HRD D;  1V8C A;  3CF6 E;  2MX2 A;  3NZ3 A;  1EO6 A;  4HCN B;  2RR9 A;  3RNC C;  2NTS A;  3HVD A;  3P4Q B;  4YT0 B;  2IGD A;  3L4P A;  1ZW7 A;  1S1Q B;  2KFJ A;  4WWN A;  4DHJ D;  2KAC A;  4W9C A;  3V60 A;  2Y3A A;  5BMH A;  2GOW A;  3BVM A;  4A90 A;  3N1X C;  3NVW A;  3SFE B;  1RFA A;  1OGW A;  1L6U A;  4EOY A;  3URY A;  2BS2 B;  1MG8 A;  1TY0 A;  4IC7 B;  2MBE A;  3ZRF A;  1WSP A;  3HM3 A;  1HZ6 A;  2MQJ A;  2DYB A;  1FRD A;  3EC8 A;  3RYT A;  1MPE A;  2IZV B;  3OG5 A;  5IAA C;  3NZS A;  2V0G A;  1PFD A;  2ON8 A;  1F1H A;  1RLF A;  1N5W A;  3VR8 B;  1K53 A;  1SIF A;  4P6V F;  3ZRC A;  3QIJ A;  3ZVV A;  2WLB A;  2PTL A;  4XWT A;  1GPX A;  4K1R B;  2MJD A;  1SE3 A;  4P7I A;  1P7E A;  2NS5 A;  5LNK 1;  5L83 A;  1GC7 A;  3ZDM C;  4KGT A;  5AUI A;  2GBK A;  2H88 B;  1TIF A;  3MJ5 A;  4M00 A;  4MH8 A;  4RGT A;  1YMH E;  4BZA A;  4HDQ A;  1TZO A;  2KWU B;  3VTW A;  1E0Z A;  4XGA B;  1VDV A;  3ZUN A;  3Q69 A;  2QDF A;  4FLH A;  3KUZ A;  1GB4 A;  2GBN A;  2O6V A;  3A9K A;  3WIM A;  1F9J A;  3QAR A;  4RM8 A;  2KXJ A;  3KQ4 A;  4FXC A;  1QIL A;  2JPH A;  5AZH A;  4REZ A;  1SEB D;  2K22 A;  1NI3 A;  4TQ1 A;  1E5W A;  2GBR A;  3FC4 A;  2OED A;  2PVG C;  4CHK A;  2MWS B;  3TIX A;  1AW7 A;  4RM9 A;  4IDI A;  4II3 B;  3O65 B;  4X57 B;  5C1Z A;  2NPT B;  3B2F A;  3AE9 B;  4A3P A;  2PW9 A;  2IBI B;  4YTM B;  2BKR B;  1NI2 A;  3FIL A;  4I6L B;  3TEX A;  1DGJ A;  1BUI C;  4AOF A;  1YQB A;  4KGR A;  2K1F A;  1LXD A;  1S3S G;  4AS1 A;  1WM2 A;  3UIN B;  3FAH A;  3U7Z A;  5EE0 A;  3WAL A;  1SE9 A;  1FXT B;  4YXD B;  1ACC A;  4HLE A;  1J7B A;  1Y8R C;  3KH0 A;  4M0W A;  1P98 A;  4YL8 A;  1E8X A;  1QOF A;  4WQO B;  2MBQ A;  2VRR B;  2MBH A;  4N9F 4;  4HRS A;  4NJC A;  3DHG C;  1RAX A;  1JRU A;  1P9D U;  1WX8 A;  4MEL A;  1J0G A;  4M01 A;  4MM3 A;  2EEL A;  3AE6 B;  3P4S B;  2J4X A;  2PVO D;  2JRI B;  3KVF B;  2XNA C;  1QZE A;  4DQO C;  3AUL A;  4BKT A;  2BB5 A;  2LRU A;  3UGB B;  4WJQ A;  1IP9 A;  3GE3 C;  2KO3 A;  2DLB A;  3QC8 B;  3ALB A;  3ONS A;  1EWY C;  1FXA A;  2D11 A;  4HJK A;  4GXB A;  5IOI A;  2INC C;  2KMA A;  1BXT A;  1UWX A;  2LEK A;  4BAX A;  3Q8F A;  3L54 A;  3AM9 A;  4IG7 B;  3NUH B;  3DVG Y;  2J42 A;  2I2Y A;  2HJ8 A;  1WXQ A;  3L13 A;  1WR6 E;  3T8M A;  3QCA A;  2KQ7 A;  2IGG A;  4ZYN A;  4ANX A;  4KIK B;  2J0M A;  3DBS A;  4WWM A;  3X23 A;  3NY5 A;  2WXP A;  2WXI A;  3N32 A;  2L3Z A;  5DPW A;  2QIL A;  1E8Z A;  3PLU A;  3TEY A;  2M1M A;  3SU8 X;  1YOV B;  2ZNV B;  1B1Z A;  2ZW0 A;  2FCQ A;  1OEY J;  1UGM A;  2CU1 A;  3WAN A;  4K3C A;  5CHF A;  4IM2 A;  5AEK B;  2KFK B;  2CHW A;  5IO9 A;  2DZI A;  1C77 A;  4W9K A;  2BTE A;  3A9J A;  2WU2 B;  1ZOY B;  2KDF B;  2QSD A;  1JML A;  2WXO A;  4C80 A;  3VDZ A;  1FIQ A;  2LD9 A;  2ZJD A;  4ITK A;  2D3C A;  3MC0 B;  3VTV A;  3MC9 A;  1ZDV A;  2DYO A;  4K7S A;  1ZXH A;  2G9H D;  4IOI E;  5D3I B;  2WXJ A;  4XDD A;  4M8M A;  5T8I A;  4LNI A;  2C5L C;  1WGR A;  1N61 A;  4NY0 A;  1SJH D;  4KZC A;  2IPK D;  3VRA B;  1YX5 B;  2AQ2 B;  3MP9 A;  3RNF C;  3SFD B;  1EWC A;  2JUO A;  1J7A A;  2ONQ A;  4Q2J A;  2FUG 1;  4RF1 A;  1NEK B;  2N9E B;  1ZP0 B;  4PYZ A;  3RT3 B;  2PEA A;  5GMV A;  3JW0 X;  5BYR A;  3NG0 A;  4DBG A;  1L2N A;  1AN8 A;  4UDU C;  5FKA C;  1EU3 A;  1EF1 A;  2RDG A;  2L76 A;  4MAC A;  2NTT A;  2WXF A;  3RNA C;  1TT5 B;  1UBQ A;  1M4V A;  1PQS A;  3AU4 A;  2M0A A;  4HRO A;  4ICV A;  1LQB A;  3WAO A;  5IKC M;  1FCC C;  1PGA A;  4HK2 A;  1T0R C;  3Q3M C;  2RMM A;  4II2 B;  2HD5 B;  5TSS A;  2RSU A;  4NNJ B;  5CX3 A;  3U52 E;  1WZ3 A;  1Z2M A;  1V1O A;  4EE2 A;  2CHZ A;  4XYC A;  1ZXI A;  4A55 A;  1KJT A;  2K0P A;  2K39 A;  3A33 B;  1E10 A;  2BKF A;  3IBE A;  1F52 A;  5BMG A;  4YSX B;  1T6B X;  1RFK A;  2EMS A;  2ICI A;  1C3T A;  1TTN A;  3JSV B;  3ENE A;  2N9P C;  4E71 A;  3RUL A;  1SGH A;  1V86 A;  1TKE A;  1E8W A;  1CZP A;  3PTF C;  4TUU A;  1V1P A;  3AU5 A;  4OZC A;  2W55 A;  3U7D A;  4BKS D;  4TMA B;  4LNK A;  2DX5 B;  2LUE A;  2LVO A;  2LGD A;  3MC8 A;  2LI5 A;  3P63 A;  3HM6 X;  3RN9 C;  3LDZ E;  2KZR A;  2BYF A;  1T0Q C;  3A4S C;  1FEH A;  4URK A;  2LAS A;  1KH0 A;  4KSL C;  2K5P A;  4B6W A;  1XQQ A;  5JZE B;  4TQ0 A;  3L08 A;  3PZ7 A;  4NQL B;  3QHT A;  2W82 A;  3ZXV A;  3PRZ A;  5KHQ A;  2V3S A;  1T5X D;  3B08 A;  1JAL A;  2J53 A;  3AV8 A;  4NQK E;  1FRR A;  4C7Z A;  2N9X A;  3CMM B;  5D7G A;  1K50 A;  1AWD A;  1SBB B;  2BPS A;  5G5H A;  1QKZ A;  4FBJ B;  3ZTD A;  2WP9 B;  4LDT B;  2PLP A;  4A9A A;  1WY8 A;  3ZW3 A;  2G4D B;  1BT0 A;  3R7Q A;  4MSM B;  4HPM B;  1NEN B;  2L1A A;  1TYG B;  3NS1 A;  5GXG B;  3MTN B;  1WXM A;  2MBO A;  1WI0 A;  4K81 A;  5HFY A;  5G5G A;  3TJP A;  2VZK B;  1HEZ E;  4HWI B;  1IGC A;  2MP2 B;  3I3T B;  1UF0 A;  2KKC A;  5CTR C;  1FNV A;  3NS8 A;  2AL3 A;  1DOX A;  1WF9 A;  3IT4 B;  1Q1O A;  1D6E C;  1J19 A;  4AWJ A;  3IFW B;  2XK5 A;  1HA5 A;  2TSS A;  3WCQ A;  5EE3 A;  2IO0 B;  3EHV A;  2UWQ A;  2I1J A;  1V81 A;  2ZVN A;  4FHK A;  1VJK A;  4HPP A;  2J52 A;  2IDY A;  5CHW A;  2JYE A;  2R2Q A;  2A5U A;  3M62 B;  2AQ1 B;  4N58 A;  1VR9 A;  3DBR B;  1FPY A;  3QAQ A;  3P4P B;  2RGF A;  3BIN A;  3RFZ B;  2ZVO A;  2J0K A;  3IAM 1;  1WIA A;  2L00 B;  3BVZ A;  2D3A A;  3Q2A C;  3QWZ B;  2O2V A;  4FJV B;  1L6V A;  4IWO A;  2DAJ A;  2IJ0 A;  2FCM A;  1WE7 A;  2K25 A;  2IO2 B;  5LXH A;  1WMH A;  2AL6 A;  1YJI A;  2KMM A;  5LLI A;  1UBI A;  4GMV A;  4NZL B;  3UI3 A;  2PIA A;  3N1Y C;  3FIL B;  2KC1 A;  2MJE A;  3PHX B;  2K8C A;  3H1U A;  2JQR B;  3QA8 A;  2HE7 A;  1IPG A;  2ACZ B;  2K9X A;  2FCN A;  1Y56 A;  2QHO A;  3HHM A;  1C79 A;  1QOA A;  2LRW A;  4YSZ B;  1TS5 A;  2KLC A;  4DXG A;  1NDD A;  4A8X C;  4XZ4 A;  2W3R A;  5EDS A;  4US8 A;  2DZM A;  4OZB A;  1FNU A;  2JWU A;  4FN2 A;  1ESF A;  1MHX A;  2PPH A;  2BS4 B;  4QAY A;  2BQQ A;  3NVZ A;  1I4R A;  3JVZ X;  4M0W B;  3VRB B;  2NBU A;  2PKO A;  1IGD A;  1FD6 A;  3DBH B;  2MH7 A;  3W1Y A;  1I4X A;  4GGQ A;  3Q8B A;  4MM3 B;  3TUO A;  1VCB A;  1XO3 A;  3I63 C;  1NYR A;  3NZU A;  3W2D A;  1V97 A;  3PZD A;  5H8Y E;  4E3C A;  2C7M B;  3ZKJ C;  2M0X A;  4C00 A;  4WJO A;  3R2I A;  4GIV A;  4G50 A;  3RZF A;  1Z5S B;  3OJ4 B;  2M8S A;  3PT2 B;  3P1M A;  4GLS C;  2DBY A;  3SDL C;  2MA9 B;  4W9L A;  3AE7 B;  3S2A A;  4BVU C;  4LDT D;  4DWF A;  4MEM A;  3BY4 B;  2UYZ B;  3VTU A;  1ENF A;  3ML8 A;  2BYV E;  2DHZ A;  1E9M A;  4DDG D;  5J17 A;  2KX3 A;  4HXD A;  2M56 B;  2AQ3 B;  4HEA 1;  2JZ3 B;  3CSF A;  3IG3 A;  1JRO A;  4LTU A;  3U8Z A;  1HXY D;  3IVF A;  3V6E B;  4RNA A;  2L7R A;  2VZK D;  4B0M A;  1XLP A;  3KYD D;  2N0S B;  2L8J A;  4TSS A;  3TSS A;  4WWO A;  3H6N A;  4MGK E;  4WJP A;  1STE A;  2LGS A;  2FID A;  4HKZ E;  3ZTC A;  1I35 A;  2VH2 A;  1N63 A;  1XCQ L;  5I4D A;  2D3G A;  3DVN U;  1PDX A;  2UU7 A;  3SR6 A;  5HG2 A;  1SSN A;  3PRP B;  4EUT A;  3A9J B;  2WXL A; 
#chains in the Genus database with same CATH homology
 2C5L C;  5G2N A;  1WGR A;  3ZDT A;  1P1A A;  5J2R A;  4NY0 A;  4KZC A;  1V9J A;  2BWF A;  3APC A;  4LCD E;  3RUI B;  2K6Q A;  3VH4 B;  2IO3 B;  1TBE A;  2NBV B;  3PS6 A;  3VUX A;  1YX5 B;  2N7E A;  5TR5 A;  4PS7 A;  4DDI D;  3ZIM A;  3ML9 A;  3QQ8 B;  2XEW A;  1WMH B;  5KHO A;  4GSW A;  2JUO A;  3VVW B;  4GDK A;  4IW0 A;  1AAR A;  3L16 A;  2FIF A;  3ZNG C;  2D10 A;  2K6D B;  1L7Y A;  1UD7 A;  2N9E B;  4PYZ A;  4NJ7 A;  4EZK A;  4ANV A;  3SD5 A;  4WWP A;  4ZRK A;  3RT3 B;  3ZNZ B;  2PEA A;  5GMV A;  3JW0 X;  4F8C B;  5JHB A;  4CYE A;  3B1L X;  2J7Q B;  3V6C B;  3U30 A;  4DBG A;  1L2N A;  2ZZP B;  2KQS A;  3TBL D;  1EF1 A;  2L76 A;  2IYD B;  1WR1 A;  3H7S A;  4AJY B;  1ZGU B;  4JIO U;  1UBQ A;  4ZRJ A;  4GDK B;  2NR2 A;  2ZPN A;  1PQS A;  4JLC A;  3AU4 A;  2KAN A;  2C9W B;  4XC2 A;  2FAZ A;  3TCA A;  1OEY A;  2Z0D B;  4W9F A;  2A4Z A;  2IY0 B;  2YLM A;  1OQY A;  2MP2 A;  4ICV A;  4ANW A;  1LQB A;  4E74 A;  3WAO A;  2KOX A;  3D32 A;  2GBJ A;  1J8C A;  2J0J A;  2N1V A;  4HK2 A;  4MGY E;  4LJO B;  3KYC D;  4II2 B;  2HD5 B;  2DYM A;  4I6P A;  2G4S A;  1LM8 B;  2BYE A;  3ZNH B;  4BKG A;  3H7P A;  1V5T A;  2RSU A;  4NNJ B;  2RD0 A;  5CX3 A;  3PGE A;  3HIZ A;  3VUY A;  2WX0 A;  3DVN V;  3MJW A;  2ASQ A;  4W9E A;  3EFU A;  1YD8 U;  1WZ3 A;  2KHW B;  1Z2M A;  5IA7 A;  2BF8 B;  4A3O A;  3CST A;  1K8R B;  4ZDV A;  2CHZ A;  4TKN A;  3PSE B;  4EZL A;  4HDO A;  4DHZ E;  3DBL I;  3GZN I;  4EKU A;  1E8Y A;  1KJT A;  3WAP A;  2K39 A;  4MDK E;  2DAF A;  3P2B A;  2JT4 B;  4W9H A;  4GDL B;  3A33 B;  3N30 A;  3RCZ A;  2BKF A;  3IBE A;  3KUC B;  1R4N I;  3H7P B;  4BBN F;  4MSQ B;  2ZCB A;  1WGG A;  3WAM A;  1XT9 B;  3MHS D;  4OVU A;  3Q3F A;  3GOE A;  1WE6 A;  4G3X B;  2EMS A;  1H8C A;  3IHP C;  2GBM A;  1C3T A;  3M95 A;  3R66 C;  1TTN A;  3V62 A;  3VHT C;  3JSV B;  3ENE A;  2N9P C;  4E71 A;  1V2Y A;  3RUL A;  2NPT A;  1SGH A;  2KN5 A;  1V86 A;  1E8W A;  3Q3J A;  3DDC B;  2DZK A;  2G45 B;  3C0R B;  3OJ3 A;  1A5R A;  3PTF C;  1WXV A;  3PPA A;  4J6I A;  4TUU A;  3L17 A;  2KNB A;  3AU5 A;  2FUH B;  1V5O A;  2NBW B;  3VFK A;  4CO7 A;  3U7D A;  4F1S A;  4BKS D;  2I1K A;  5E6N A;  2LGX A;  2DX5 B;  1WXS A;  2KC2 A;  4KDI C;  2LUE A;  1VD2 A;  2R2O A;  3CF6 E;  4MJS B;  2LVO A;  2MX2 A;  3PRM B;  2LGD A;  4ANU A;  1EO6 A;  4NAW A;  2LI5 A;  4HCN B;  1V80 A;  2RR9 A;  4NPN A;  2N1W A;  2K8B A;  3HM6 X;  2LZ6 A;  3LDZ E;  4FJY A;  2KZR A;  2BYF A;  3A4S C;  5DPT A;  4URK A;  5D6J B;  2LAS A;  3M3J A;  3VXW A;  1ISN A;  4KSL C;  3M63 B;  2BGF A;  5JHA A;  4B6W A;  4IM0 A;  1XQQ A;  5JZE B;  1ZW7 A;  2AEH A;  1S1Q B;  2KFJ A;  4WWN A;  1P3Q U;  3L08 A;  4DHJ D;  3DBR I;  4TQ0 A;  4W9C A;  3V60 A;  2ZPY A;  3DCG A;  4NQL B;  1WX7 A;  2GOW A;  3KW5 B;  1GG3 A;  2V1Y A;  3L0W B;  4NAW B;  2KTR A;  3QHT A;  1RFA A;  1WRD B;  2LWP A;  1E90 A;  1OGW A;  1YIW A;  3DVG X;  3PRZ A;  3TL5 A;  3ZLZ A;  2KDE B;  4JQW C;  5KHQ A;  2V3S A;  2KJR A;  2DEN B;  3B08 A;  3EEC A;  4EOY A;  1D3Z A;  5J18 A;  1CMX B;  2PE6 B;  2O6V D;  3WA0 A;  1V49 A;  1MG8 A;  4NQK E;  4IC7 B;  2N9X A;  3CMM B;  1UEL A;  2MBE A;  5D7G A;  3ZRF A;  5LXH A;  5DPR A;  2KD0 A;  3HM3 A;  2M4N A;  4BBN C;  2BPS A;  5HKH A;  3PVL A;  2MQJ A;  2JVC A;  3QX1 A;  1I42 A;  2DYB A;  2KTR B;  5E6O A;  3EC8 A;  3RYT A;  2IZV B;  5IAA C;  3NZS A;  2XBB C;  4B9K A;  3ZTD A;  4FBJ B;  3UIO B;  4ICU A;  1RLF A;  1WYW B;  3UQB A;  4LDT B;  1SIF A;  2KDI A;  1WY8 A;  3ZW3 A;  2G4D B;  3ZRC A;  2JZZ A;  4EEW A;  4FAD A;  1BT0 A;  2FNJ B;  3QIJ A;  4GU2 A;  1GJZ A;  3ZVV A;  3R7Q A;  4MSM B;  4HPM B;  4AP4 C;  3UQA A;  3N3K B;  2MRP A;  2JF5 A;  2MW5 A;  4HPL B;  3OLM D;  4K1R B;  3W1S A;  3L10 B;  1KOT A;  1TGZ B;  2KX0 A;  2WX1 A;  1HE8 A;  2OOB B;  3MTN B;  4P7I A;  1WXM A;  2AYO B;  4HCP B;  2ZCC A;  2L05 A;  2NS5 A;  2MBO A;  1WI0 A;  5L83 A;  2G3Q B;  4K81 A;  1GC7 A;  4KZ0 A;  4MGZ E;  3ZDM C;  2GBK A;  3TJP A;  3DPD A;  1E7U A;  2W9N A;  3UF8 A;  4HWI B;  5BO4 B;  4DXA B;  3APD A;  2MP2 B;  3I3T B;  2CS4 A;  1ZKH A;  2KKC A;  3DBH I;  4HDQ A;  4KIK A;  2KWU B;  2KJ6 A;  5CTR C;  2KK8 A;  3VTW A;  3NS8 A;  3VAW A;  4G0N B;  1TZ1 A;  2AL3 A;  3ZUN A;  3VQI A;  1WF9 A;  2MCN B;  2MSE D;  1Q1O A;  4FLH A;  3KUZ A;  4PS8 A;  1J19 A;  2GBN A;  4PS3 A;  4AWJ A;  3IFW B;  2KWV B;  2XK5 A;  2O6V A;  2RPQ A;  1GUA B;  3A9K A;  4IWQ A;  3WIM A;  1F9J A;  3QAR A;  4RM8 A;  2IO0 B;  3EHV A;  4KSK C;  4F7Z A;  2KXJ A;  2KFK A;  2JPH A;  2NCN A;  2CHX A;  1WXA A;  5AZG A;  5AZH A;  2UWQ A;  1WJN A;  4IM3 A;  2I1J A;  4FHJ A;  1WJ4 A;  3R3M A;  1YJ1 A;  1V81 A;  2ZVN A;  4FHK A;  4TQ1 A;  1WM3 A;  1E5W A;  2GBR A;  4WJN A;  4CHK A;  2EMT A;  2MWS B;  1LFD A;  3TIX A;  5CHW A;  4RM9 A;  2R2Q A;  2A5U A;  3M62 B;  1NBF C;  4II3 B;  3ZO5 B;  4EZJ A;  1XD3 B;  3A4R A;  1EF5 A;  1WGD A;  3ECI A;  3O65 B;  3QAQ A;  5D94 A;  4X57 B;  5C1Z A;  2NPT B;  2KMC A;  4AJW A;  4FA6 A;  2RGF A;  4FUL A;  4A3P A;  2KVR A;  3BIN A;  2IBI B;  2ZVO A;  2J0K A;  2BKR B;  1NI2 A;  4I6L B;  1T0Y A;  1Q0W B;  1WIA A;  3KUD B;  2L00 B;  2KJH B;  1UH6 A;  3QWZ B;  2O2V A;  3ZNI D;  3APF A;  4FJV B;  4IWO A;  3K9P B;  2DAJ A;  4AOF A;  1WGY A;  2FCM A;  1V6E A;  3V61 A;  1WE7 A;  2L0T A;  1YQB A;  2K1F A;  2K8H A;  1LXD A;  2K25 A;  2B3A A;  2PJH A;  2REX A;  2IO2 B;  1S3S G;  2LXA A;  4W9J A;  1WMH A;  1WM2 A;  2AL6 A;  3PRE A;  5LLI A;  1UBI A;  3UIN B;  4GMV A;  4DK5 A;  5LXI B;  4ZRI A;  2AWT A;  1U4A A;  2KC1 A;  3WAL A;  1SE9 A;  1FXT B;  3PHX B;  2K8C A;  3H1U A;  1G6J A;  3QA8 A;  3A1Q A;  3PLV A;  2HE7 A;  1IPG A;  1Q5W B;  2LXC A;  4HLE A;  4IUM B;  5D2M B;  2L0F A;  3QK0 A;  2CKH B;  3OAW A;  3X0W A;  1Y8R C;  3KH0 A;  1UZX B;  2C7H A;  2FCN A;  2QHO A;  1P98 A;  3HHM A;  1WH3 A;  2YVC A;  5L95 C;  2LRW A;  4YL8 A;  4MGI E;  1E8X A;  4WQO B;  2KLC A;  1E7V A;  1WJ6 A;  2MBQ A;  2VRR B;  4TV3 A;  4BOZ B;  1NDD A;  2MBH A;  2EKE C;  4N9F 4;  1M94 A;  4XZ4 A;  1RAX A;  1JRU A;  1P9D U;  4W9D A;  1WX8 A;  5EDS A;  4ASW C;  2FCS A;  4MEL A;  1J0G A;  3W1S C;  4BKS A;  1WGH A;  1GNU A;  4MM3 A;  4RMA A;  3B0A A;  2DZM A;  4DHZ B;  2JWZ A;  4FN2 A;  1RRB A;  3A1Q B;  2KTF A;  4M8N A;  4BOS C;  2PPH A;  2ZEQ A;  3PHW B;  4KDL B;  2JRI B;  3JVZ X;  4M0W B;  3KVF B;  5G55 A;  2NBU A;  1QZE A;  2BWE S;  3AUL A;  4BKT A;  2N7D A;  1OTR B;  3AI5 A;  2LRU A;  2WDT B;  2D2Q A;  3W1Y A;  3UGB B;  2DZJ A;  1WZ0 A;  4WJQ A;  3QJZ A;  1IP9 A;  4GGQ A;  2KO3 A;  4HVB A;  3QC8 B;  2C7N B;  5FR6 A;  3ALB A;  3ONS A;  3T9L A;  4BFR A;  3NHE B;  1VCB A;  4HJK A;  1H4R A;  2D11 A;  3NZU A;  4MH0 E;  3K9O B;  3PV1 A;  2ZNV C;  4GXB A;  4W9G A;  4GDL A;  2OJR A;  2WWZ A;  4W9I A;  3PZD A;  4E3C A;  2C7M B;  3ZKJ C;  2LGY A;  2M0X A;  1EUV B;  2LVQ A;  4WJO A;  2KMA A;  4GIV A;  4G50 A;  2JXX A;  3RZF A;  2GMI C;  1Z5S B;  3L54 A;  3OJ4 B;  2M8S A;  5CHV C;  2KWC A;  1KM7 A;  3PT2 B;  3DVG Y;  4IG7 B;  2D07 B;  4WAA A;  2HTH A;  4EFO A;  2HJ8 A;  1WX9 A;  3JSV A;  3L13 A;  1WR6 E;  4GB9 A;  3QCA A;  3T8M A;  3SDL C;  2MA9 B;  4DHJ B;  2KQ7 A;  5DCN A;  4W9L A;  1P0R A;  4ZYN A;  3UIP B;  3NOB A;  3S2A A;  4ANX A;  4JGH B;  4KIK B;  2Z59 B;  2J0M A;  3DBS A;  3X23 A;  3NY5 A;  4LDT D;  4BVU C;  4GN1 A;  4DWF A;  3N32 A;  2L3Z A;  4MEM A;  5DPW A;  2LJ5 A;  3BY4 B;  5C23 A;  2C60 A;  2Z0E B;  1E8Z A;  2UYZ B;  2JY6 A;  3LJ3 A;  3VTU A;  3PLU A;  2Y5B B;  4AUQ C;  1KLV A;  2M1M A;  3AXC A;  4MJS A;  3ML8 A;  1WFY A;  2BYV E;  3VUW A;  2DHZ A;  3SU8 X;  2ZNV B;  4KVG B;  4DDG D;  5J17 A;  3VH3 B;  2PE9 A;  3JYU A;  5E6P A;  2MBB B;  2XK5 B;  5AZF A;  1X1M A;  2KX3 A;  2O6V B;  3A9K B;  2FCQ A;  2JRH A;  1GC6 A;  3DQV A;  1OEY J;  1UGM A;  1YX6 B;  4I6N B;  2V4L A;  4HXD A;  4G11 A;  2CU1 A;  5DPS A;  3R7R A;  3WAN A;  2WYQ A;  4LJP B;  1WJU A;  2KLG A;  4IWP A;  2JZ3 B;  2NVU I;  5CHF A;  3DOW A;  3CSF A;  3IG3 A;  2IY1 B;  1IYF A;  4IM2 A;  3RZW C;  5AEK B;  2KFK B;  1R4M I;  4XX5 A;  3U8Z A;  4K7U A;  3IVF A;  2CHW A;  3V6E B;  4PYU A;  2L7R A;  2DZI A;  4W9K A;  2M17 A;  4B95 A;  3A9J A;  3KYD D;  4NJ6 A;  3TMP B;  4A20 A;  2KDB A;  3HK0 A;  2KDF B;  2L8J A;  3VDZ A;  2LD9 A;  3H6N A;  2ZJD A;  2IO1 B;  4MGK E;  4WJP A;  4WWO A;  2LVP A;  2FID A;  3SHQ A;  2MLB A;  3ZTC A;  1I35 A;  3VTV A;  5JH5 C;  2DYO A;  4JL9 A;  4OVV A;  4K7S A;  4KV2 A;  2D3G A;  2CR5 A;  3DVN U;  1C1Y B;  4K7W A;  3RD2 A;  4FJZ A;  3H9D A;  3PRP B;  4EUT A;  4M8M A;  3A9J B;  2O2V B;  2N4F A;  4GOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...