4KDLB

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
69
Chain Sequence
b'SMKLKVTGAGINQVVTLKQDATLNDLIEHINVDVKTMRFGYPPQRINLSLGQTQLDELGINSGEKITIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 15
structure length 69
sequence length 74
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kdlB00
4BOZB 3ZUNA 3HK0A 3ECIA 1WM3A 3U8ZA 1S3SG 2W9NA 2G3QB 4FJZA 4GU2A 2K6QA 3PLUA 1WE7A 1F9JA 4FLHA 2ZPNA 3L10B 5L95C 2J0KA 2L76A 4ICVA 2L0FA 3DPDA 4HXDA 3WIMA 1IP9A 4GDKB 4FJVB 2L8JA 1VD2A 3K9OB 2MQJA 5AZHA 4EFOA 2JZ3B 2GBKA 3WALA 3VAWA 2XBBC 5LLIA 3APFA 2JXXA 2ZVOA 2MW5A 2LGYA 2R2QA 2WDTB 2O6VB 3VQIA 2JPHA 2ZJDA 4TUUA 3QX1A 2KO3A 4IUMB 5J18A 1V49A 3UGBB 4BKTA 4DDGD 3TJPA 1E8YA 2C9WB 1WXSA 3NZUA 4FHJA 2WX1A 4IG7B 1TGZB 3HM6X 4G3XB 3IVFA 1V81A 4URKA 4K81A 2NS5A 3VXWA 3JSVA 4NQKE 4KVGB 3KUZA 2IO3B 4RM9A 2KJRA 1TZ1A 1GJZA 2NBVB 3SDLC 4ANUA 3L54A 2M1MA 4A3PA 1UELA 1SIFA 1WI0A 2KFJA 4I6PA 3U30A 2K6DB 2N1VA 4W9HA 2EMSA 1TBEA 4KZCA 2XK5B 4G11A 4W9IA 4IWOA 4GDLA 3QWZB 4KDLB 1WX7A 3DVNV 4DK5A 3ZNID 4CYEA 5C23A 1WR1A 4JLCA 3KVFB 4KIKB 2OJRA 3ZO5B 1J0GA 2O2VB 1E5WA 2KJ6A 2LI5A 5AEKB 2YLMA 2KC2A 2AL3A 1V5OA 4I6NB 3QIJA 2AWTA 1J19A 2KANA 4M8NA 2A4ZA 2BKFA 3DOWA 3PRMB 3A1QB 4M8MA 5LXHA 3B08A 1KJTA 2LD9A 1LFDA 2N9XA 2L05A 4I6LB 3ZRFA 3C0RB 3A33B 4JGHB 5IAAC 3D32A 2ASQA 4B6WA 2NPTA 3WA0A 4BKSD 4FADA 2BGFA 3PT2B 4RM8A 3DBSA 3RT3B 4MELA 2KJHB 1AARA 2IY0B 4GXBA 2KC1A 3IG3A 3BINA 3L08A 1HE8A 4IM2A 3ZIMA 2BYFA 3HHMA 3PRPB 4EOYA 3UF8A 5CHFA 5E6NA 1R4NI 4W9GA 4II2B 1G6JA 2CHXA 3ZRCA 2LVPA 2KX0A 3CSFA 4PS8A 1TTNA 2HD5B 3ML8A 3PTFC 1P98A 4WWOA 4AUQC 2PPHA 3LDZE 3TIXA 3KH0A 4DHJD 4OVVA 2DYBA 3APDA 4WAAA 3A9JA 3V62A 1FXTB 3H7PB 5D7GA 2NR2A 1LM8B 1Q5WB 1WE6A 2WYQA 4P7IA 2FCMA 1NBFC 4ASWC 2KQ7A 2LZ6A 2NVUI 2KLCA 1YQBA 2O6VA 3DCGA 4XX5A 3U7DA 3BY4B 3WANA 2L7RA 4EEWA 2KFKA 2K1FA 3UIOB 2KMAA 1S1QB 2LGXA 3M62B 2LJ5A 3L16A 4JIOU 4FJYA 3H9DA 2C5LC 2KDIA 4FBJB 4MGZE 3RZFA 3IFWB 5L83A 3SHQA 2JZZA 3ONSA 3KUDB 2RD0A 1EF5A 3Q3FA 5CTRC 4WWNA 2Z59B 2FCSA 4LDTD 2LXCA 4DHZE 1I42A 4WQOB 4XZ4A 3M95A 2PE6B 1WGHA 4PYUA 3TBLD 1EO6A 2KX3A 2MSED 4ICUA 3MHSD 3V6EB 3M63B 2MBBB 3MTNB 1T0YA 2DX5B 1ZKHA 2M8SA 2KWCA 4GIVA 1V80A 4ZRKA 1PQSA 2I1JA 5GMVA 2ZVNA 2CS4A 2KTRA 3V61A 2LWPA 4G50A 1E8XA 4MDKE 1R4MI 2PE9A 4EKUA 3I3TB 1KM7A 4ZRJA 3L0WB 2LASA 2KWUB 3DDCB 2CU1A 3N32A 3PLVA 4KIKA 3TCAA 2J7QB 3W1SC 2HTHA 2LUEA 2O2VA 3DVGY 3OLMD 4AJYB 1KOTA 3KUCB 2AYOB 4FHKA 3EFUA 4AJWA 3AU5A 2BPSA 2L3ZA 3DQVA 4IM0A 4MGIE 4FA6A 1WZ3A 3ZW3A 3A1QA 1I35A 4PS7A 5CHVC 3ENEA 5EDSA 4TQ0A 4X57B 1OEYA 2AEHA 1UH6A 4IM3A 1YJ1A 3B1LX 4PYZA 1ZGUB 2A5UA 2DAFA 1XQQA 4K7SA 5JHBA 4ANXA 3AU4A 4ZYNA 1MG8A 4DXAB 1V9JA 3CMMB 2IBIB 2JT4B 2KD0A 3IHPC 4W9LA 1GC7A 2FAZA 2NCNA 3AULA 1Z2MA 4LJOB 1WJ4A 3UIPB 4NAWB 1BT0A 4GB9A 5TR5A 1WMHB 3CSTA 1UBQA 2KHWB 3T9LA 3TMPB 1E8WA 5BO4B 3MJWA 4E71A 4TQ1A 3WAPA 1IPGA 5D2MB 3JVZX 1WGGA 1RRBA 2ZNVB 1WF9A 4RMAA 4F1SA 1WXVA 1WH3A 3VTVA 1KLVA 2JWZA 1NI2A 2DHZA 2RSUA 4FULA 2BWES 3EC8A 3PHXB 1YX5B 4J6IA 3X0WA 2D2QA 2GBJA 2IO0B 2J0JA 3H7PA 2YVCA 1WY8A 1LQBA 2C7MB 2MLBA 2MBHA 1U4AA 2V3SA 3DBLI 3OJ4B 1L7YA 5DPSA 2UYZB 3VTUA 3PS6A 4LCDE 3PV1A 2B3AA 2LRWA 3T8MA 3A9KB 3JYUA 1E8ZA 2DENB 2EMTA 2MCNB 3PSEB 3NOBA 2KDEB 4JL9A 4GN1A 1V6EA 2KZRA 2REXA 4MJSA 5AZGA 3WAMA 1JRUA 3X23A 2Z0EB 3ZDTA 2UWQA 2KNBA 2C7HA 5CHWA 3UQBA 1WGYA 2JUOA 5DPRA 1WRDB 2N9PC 4HWIB 2GMIC 3WAOA 2FNJB 2ZCCA 4K1RB 1XT9B 5DPWA 4HDOA 1UZXB 4WJNA 2KVRA 2DAJA 2KDBA 4DHJB 4W9DA 3A4RA 3R3MA 3RCZA 1E90A 3W1SA 1H4RA 1V2YA 3JSVB 3R7RA 4BBNF 3CF6E 4ANWA 3RYTA 1YX6B 4GDKA 2KDFB 3QHTA 2N1WA 1QZEA 2KLGA 2WWZA 2KMCA 3A4SC 3DBRI 3GOEA 4NJ6A 4CO7A 4ZDVA 3ZVVA 2NBWB 4AOFA 4ZRIA 3VFKA 1WFYA 2AL6A 2J0MA 2ZZPB 2BYVE 5DPTA 2MP2B 2DYMA 4GGQA 1CMXB 3EHVA 4W9FA 5DCNA 2V1YA 2GBNA 1C3TA 3ZNZB 2K8HA 1H8CA 2JRHA 3PRZA 4LDTB 3OJ3A 3PHWB 2M17A 1WX9A 2KKCA 3VTWA 2WX0A 3OAWA 1P0RA 2BWFA 4HDQA 2IY1B 3TL5A 2CKHB 3RZWC 4F8CB 2HE7A 4NAWA 5E6OA 3M3JA 2MA9B 3RULA 4B9KA 1LXDA 1WZ0A 4TV3A 2G4SA 2ZCBA 1C1YB 2MX2A 2N7DA 4HPMB 3VUWA 4HVBA 5KHQA 1IYFA 2M4NA 2NPTB 2XK5A 2N4FA 1K8RB 2N9EB 4ANVA 2HJ8A 1ZW7A 3DBHI 3V6CB 2KN5A 3DVNU 5G55A 3ZKJC 2FCNA 3H7SA 3QK0A 4A20A 5LXIB 3N3KB 3ZTCA 4HJKA 2LVQA 3ALBA 3QCAA 1V5TA 2MWSB 4GSWA 1SGHA 1V86A 4MM3A 4W9KA 2K8CA 5JZEB 5JHAA 5AZFA 3VHTC 1A5RA 2L0TA 3W1YA 1YIWA 2JVCA 3KYDD 4MH0E 1P1AA 2FIDA 2MBOA 4DWFA 2EKEC 4NY0A 4BKSA 3A9KA 4WJOA 4B95A 3ZNGC 4EZKA 3EECA 3S2AA 2DZKA 2OOBB 4EZJA 4IW0A 2I1KA 3A9JB 2VRRB 4MEMA 2JY6A 2MBQA 4IC7B 4DDID 2LVOA 4NJ7A 1WX8A 2M0XA 2ZPYA 1UBIA 2FUHB 4WJQA 3KYCD 3VUXA 2KFKB 2BF8B 2V4LA 5C1ZA 4N9F4 4W9JA 1GC6A 3H1UA 1UD7A 3AI5A 2Z0DB 2O6VD 4IWQA 2K39A 4A3OA 1E7VA 2Y5BB 1X1MA 2IYDB 4AP4C 3SU8X 4BVUC 1NDDA 1WJ6A 2FIFA 3VH4B 5KHOA 3NHEB 2JRIB 1P9DU 3QAQA 2K8BA 3VH3B 4KDIC 3ZLZA 3P2BA 4EZLA 3ZTDA 2K25A 4E3CA 4K7UA 1UGMA 3PVLA 2DYOA 2ZNVC 1Q1OA 1P3QU 4GOCA 1WGDA 2PEAA 2RR9A 3IBEA 2KK8A 3ZNHB 4AWJA 4F7ZA 3HM3A 3PREA 4OVUA 4BOSC 3ML9A 4K7WA 2KTRB 3APCA 2KTFA 4NPNA 2MP2A 3HIZA 3NY5A 1RFAA 3H6NA 4G0NB 2RPQA 2D11A 1WXAA 4W9CA 2GBRA 2KWVB 4WJPA 1OGWA 5HKHA 2D10A 1GNUA 2MRPA 1RAXA 1ISNA 2CHWA 1GG3A 2XEWA 1Y8RC 1SE9A 3SD5A 5G2NA 1EUVB 4IWPA 3VVWB 5D6JB 2FCQA 3QQ8B 4BKGA 2KXJA 3NS8A 2C7NB 4KV2A 2NBUA 4II3B 3R66C 4TKNA 5D94A 4BBNC 2G45B 3AXCA 1GUAB 2BYEA 3UQAA 2LRUA 3O65B 3L17A 3ZDMC 3RUIB 2DZJA 3DVGX 3QARA 4CHKA 4MGYE 4GMVA 3PPAA 1WYWB 1VCBA 3QA8A 4JQWC 4NQLB 3V60A 1OEYJ 2IO2B 4MSMB 4HLEA 2ZEQA 4HK2A 2IZVB 2PJHA 3PGEA 4KSLC 5E6PA 2GBMA 2JF5A 4WWPA 3VUYA 4GDLB 3LJ3A 4LJPB 4NNJB 1WR6E 4YL8A 5J17A 2BKRB 2DZMA 2KOXA 4XC2A 4HPLB 3PZDA 3QC8B 2D3GA 1M94A 1WJUA 4M0WB 2C60A 2IO1B 4PS3A 1WXMA 4FN2A 5J2RA 1OQYA 3B0AA 3JW0X 2QHOA 1XD3B 4MGKE 1RLFA 1D3ZA 2CR5A 3Q3JA 5JH5C 4DBGA 4MSQB 3RD2A 3VDZA 5IA7A 1WMHA 4EUTA 1OTRB 2D07B 3N30A 4DHZB 1WGRA 1YD8U 2DZIA 3GZNI 2CHZA 3NZSA 2RGFA 4MJSB 4BFRA 3R7QA 2KQSA 3L13A 2LGDA 3QJZA 3K9PB 1Z5SB 4E74A 4KSKC 1J8CA 3KW5B 4KZ0A 1Q0WB 1WM2A 2N7EA 3UINB 2GOWA 1EF1A 1WJNA 1E7UA 4HCPB 2L00B 5CX3A 5FR6A 2G4DB 2MBEA 4W9EA 1L2NA 2R2OA 1WIAA 4HCNB 2LXAA
chains in the Genus database with same CATH superfamily
5EE1A 4FJZA 4RFBA 2K6QA 3PLUA 3N1XC 4FLHA 2ZPNA 5L95C 3AE7B 2L76A 2IJ0A 4HXDA 2L8JA 2W3RA 2JZ3B 3U2SC 3WALA 2BS4B 3APFA 4Q2JA 2QSDA 4TUUA 5I4DA 2KO3A 2SEBD 2LUMA 1SEBD 4WAFA 4AQ7A 1V81A 2NS5A 3KUZA 1QOFA 2NBVB 4OVZA 1UELA 2KFJA 4I6PA 1L0YB 3U30A 2EMSA 3OWEB 2IGDA 4GDLA 4DK5A 4KDLB 3MC9A 4JLCA 3RNCC 1NENB 4KIKB 2OJRA 3RNAC 2KJ6A 1V5OA 1T6BX 3QIJA 2WQYB 2AWTA 1J19A 2KANA 2N0SB 4YSXB 3Q8FA 4I6LB 3C0RB 4JGHB 5IAAC 1XXGA 3D32A 3FILA 1LO5D 4BKSD 5IN7A 2EKIA 3PT2B 4RM8A 4MELA 3IT4B 2IY0B 3IG3A 4IM2A 3ZIMA 4EOYA 5CHFA 1RM6C 4W9GA 3ZRCA 4PK1A 4NJCA 2KX0A 3AV8A 2G9HD 3ML8A 1P98A 4LTUA 3E9SA 1FCCC 4WQMA 2BVCA 2K3UA 4JWSC 3A9JA 4DXGA 1LM8B 4AS1A 1FO4A 2BS2B 2O6VA 2KLCA 1YQBA 3U7DA 1E0ZA 4MT5A 1S1QB 3H9DA 2RPVA 3NJTA 3RZFA 2JZZA 3KUDB 2RD0A 5HFYA 4LDTD 4TMAB 4WQOB 1HTQA 3W9CB 1WGHA 4PYUA 1ACCA 1N5WA 2M8SA 2KWCA 5GMVA 2ZVNA 3V61A 4UDUC 1CJEA 2KWUB 3N32A 3DBLB 3H8HA 2K0PA 4FHKA 3EFUA 1BUIC 4MGIE 4FA6A 3A1QA 1MHXA 1N60A 4PS7A 1OEYA 1UH6A 2PW9A 3VRBB 4XGAB 2CJNA 4K7SA 5JHBA 4ANXA 2WXIA 1V9JA 2N9LA 3BVGA 3CMMB 2JT4B 2KD0A 3IHPC 5JXVA 3AULA 1R4NB 1Z2MA 4GB9A 3CSTA 4A8XC 2WGSA 3T9LA 5BO4B 4E71A 1RYJA 5D2MB 3JVZX 4RCOA 4RMAA 1HEZE 1WH3A 3VTVA 2JWZA 2D3BA 2KMMA 4M0WA 2LFIA 2DBYA 2V3SA 1WY8A 2L32A 1ZDXA 5BMHA 1MJDA 2B3AA 3T8MA 1IBXA 1CK1A 4YSYB 2MCNB 3PSEB 3NOBA 4JL9A 1ZDVA 4GN1A 2XNAC 3X23A 1JRUA 2JYEA 2UWQA 1WGYA 2JUOA 1WRDB 2GMIC 2FNJB 1KRHA 1V1PB 1FNVA 4IDIA 2KDBA 5HI1A 2L83A 1H4RA 1V2YA 4BBNF 2CU3A 4GDKA 2N1WA 2KLGA 3GOEA 4NJ6A 2KMCA 1HA5A 3ZVVA 3ETRA 1WFYA 2ZZPB 4KGSA 2HDEA 2BYVE 3ZYYX 1WXQA 2DYMA 1CMXB 2WNMA 2TSSA 3SFEB 2V1YA 2V0GA 2K8HA 1PDXA 3PHWB 1WX9A 2KKCA 2WX0A 2Y5PA 2K5PA 3ZXRA 4XYCA 3AEEB 1VZ8A 2HE7A 4NAWA 3RULA 1LXDA 3EA6A 1J7CA 3DWMA 2MX2A 3B9JA 2NPTB 2HJ8A 4YSZB 1QILA 1XO3A 2K9XA 3QCAA 1V5TA 4BAXA 3NZ3A 5GXGB 2K8CA 5JZEB 5JHAA 2L0TA 3BYYB 1FXIA 3U7ZA 2YEPF 3S2AA 2OOBB 4EZJA 3R8BA 1MPEA 3SFDB 2VRRB 3ZQ4A 1L0VB 2M0XA 1SJED 4KX6B 3KYCD 2AQ1B 4W9JA 1GC6A 3H1UA 2Z0DB 1E7VA 2IYDB 4BVUC 3T3OA 1JWUD 3P63A 1T0SC 3BZDB 3NHEB 1TS5A 1F52A 4EZLA 4JPSA 3ZTDA 2K25A 4E3CA 2D3CA 2N7JA 5D3DA 4ZRQA 5EE3A 4AWJA 4F7ZA 3HM3A 3APCA 3HIZA 3H6NA 4B0EA 4W9CA 1WXAA 3GB1A 3WCQA 5HKHA 2D10A 2MRPA 2WDVB 1ISNA 4OZCA 2XEWA 2HTME 1EUVB 4WWMA 1GB4A 2FCQA 3QQ8B 2KXJA 3AXCA 2WLBA 1ZE3D 3O65B 2DZJA 1B1ZA 3PPAA 4K3BA 3V60A 1FXAA 2WXKA 2IO2B 1STEA 4HLEA 3Q8EA 2FBWB 3RMKC 4WWPA 1L4DB 4LJPB 4HROA 4HPLB 3QC8B 4US9A 1WJUA 3GE3C 1XF5L 3Q8AA 2V3PA 1WXMA 3EUB2 3IXSA 1OQYA 4M01A 3CIRB 3KWLA 4ZHOA 4ZYSA 1NI3A 4EUTA 2N9KA 2D07B 3N30A 3T3NA 3AE9B 3Q2AC 4DHZB 1YD8U 3NZSA 2WXJA 4MJSB 3QJZA 1Z5SB 3NS1A 1SE2A 4S0RA 3LYYA 3UINB 1WJNA 5FR6A 1OQQA 2QILA 4M02A 2MBEA 1L2NA 2R2OA 2INCC 1WIAA 4HCNB 4BOZB 2QDFA 4OZBA 2IGHA 3U4EG 4A55A 1SBBB 3U8ZA 1S3SG 2G3QB 2LJIA 1UWXA 1YN3A 1WE7A 1F9JA 3K9OB 4EFOA 1ET9A 2GBKA 2DWQA 2XBBC 5BYRA 2R2QA 2WDTB 3VQIA 2ZJDA 1WYGA 3TEYA 3BVZA 4IUMB 5J18A 1K50A 3UGBB 1L5PA 2ZW1A 5AUKA 3HRDD 1WXSA 4FHJA 4IG7B 4URKA 3VXWA 4NQKE 4RM9A 1UF0A 4ANUA 2M1MA 1SIFA 1WI0A 4WH4A 2N1VA 4W9HA 3HUIA 3AECB 2KQ4X 3N1YC 2LGIA 1WX7A 1XLNA 2B76B 2RDHA 1WR1A 1HXYD 3KVFB 1E5WA 2LI5A 2YLMA 4ZRPA 1D4BA 5IP4D 4RF1A 1KJTA 4P16A 2N9XA 3ZRFA 3NUHB 1BMLC 1PGBA 2ASQA 2BGFA 1ZP0B 3DBSA 4IOIE 3RT3B 2KJHB 4GXBA 4DQOC 3HHMA 3MFGA 2OHFA 1R4NI 4II2B 1P7FA 2LVPA 1R4MB 1DYQA 2HD5B 3BK1A 3TIXA 4DHJD 4OVVA 3APDA 2PVGC 2NR2A 2WYQA 2G1EA 2FCMA 4LNKA 2NVUI 4XX5A 3PZ7A 1C78A 3UIOB 3AE5B 4GLSC 4FJYA 5FKAC 1EWYC 2KDIA 3SHQA 2GRIA 3AE6B 2QMTA 4WWNA 2Z59B 2FCSA 2LXCA 4A6QA 2NTTA 2WDRB 1EO6A 3M63B 1K52A 1ZKHA 4BZAA 2KTRA 4ITKA 4MDKE 2PE9A 1AYFA 1KM7A 1TKYA 2LASA 1FNWA 3TCAA 4KIKA 2J7QB 4AJYB 3DVGY 2PIAA 2AYOB 5D3IB 2L3ZA 3DQVA 5BMIA 4C7ZA 1V1OA 1WZ3A 3ZW3A 5EDSA 2AEHA 1FFUA 2A5UA 3LXFA 1I4HA 1YOVB 3MJ5A 3AEFB 3MHZA 1MG8A 4ZYNA 3DHIC 2GI9A 2IBIB 1GC7A 2FAZA 2NCNA 2MHJA 2JSVX 1KLUD 1WMHB 3SR6A 3TMPB 1E8WA 3MJWA 5BYQA 3W5VB 1FMAD 2ZNVB 1WF9A 1F0ZA 4F1SA 1WXVA 5BMGA 4L2YA 2DHZA 2RSUA 3PZ8A 3EC8A 3PHXB 1YX5B 4IKGA 2D2QA 2GBJA 2IO0B 2J0JA 2YVCA 2BTEA 1VR9A 5DPSA 2MBHA 2AX5A 1UNSA 1ENFA 4LCDE 1SB3C 3PV1A 1EU3A 3A9KB 4RNAA 2KDEB 3WAMA 4HRSA 1PYWD 2BQQA 2SAKA 1QF6A 3UQBA 1VLBA 2JZPA 1NVID 5DPWA 3Q3MC 1UZXB 3W1SA 5FK9C 3R7RA 3CF6E 1YX6B 3A4SC 3DBRI 1GPXA 4CO7A 2NBWB 4AOFA 4ZRIA 1FRDA 3VFKA 3VR8B 4RGOS 1I7HA 5DPTA 1QOAA 3EHVA 5DCNA 1QOGA 3PRZA 4LDTB 1K51A 2WXNA 3GS2A 5HG2A 2Y5CA 2BWFA 2I38A 2JU6X 2CKHB 3RNFC 5E6OA 1KTKA 2G4SA 4HPMB 4HVBA 3VUWA 2XK5A 2N4FA 4ANVA 3C8YA 1ZW7A 3DBHI 2KN5A 3DVNU 5G55A 2FCNA 3QK0A 5LXIB 3N3KB 1IGDA 4C4VB 1SGHA 1V86A 2LHEA 3KLSX 3W1YA 1A5RA 1YIWA 3KYDD 3IT6B 4MH0E 2MBOA 4NY0A 3EECA 4RGMA 2DZKA 3A9JB 1T3QA 4KKJA 1XEEA 2JY6A 2HJ1A 2R61A 2LVOA 5IKCM 2JQRB 2L52A 4NJ7A 3B2FA 3BK2A 2ZPYA 1UBIA 2FUHB 4WJQA 3VUXA 2BF8B 2V4LA 5C1ZA 2ONQA 1E6EB 1UD7A 2O6VD 4L23A 2K39A 1X1MA 4AP4C 3SU8X 2KWDA 1WRIA 3QAQA 1DOYA 1GAQB 3VH3B 2W54A 1F2RC 4XE0A 1UGMA 3PVLA 2DYOA 2ZNVC 1Q1OA 1P3QU 4JWUC 2KK8A 3Q14C 3PREA 1OFFA 4K7WA 4NAMA 2KTFA 4NPNA 1RFAA 2OEDA 3ZGZA 2D11A 2WU2B 1GNUA 1VJKA 3PO0A 2CHWA 1GG3A 1NEKB 1Y8RC 3GZNB 3VVWB 4BKGA 2C7NB 2W55A 1EWCA 3TUOA 4TKNA 3R66C 5D94A 2K22A 1GUAB 2BYEA 4REZA 1QKZA 3QARA 4MGYE 1VCBA 3HVDA 3W5UB 1UUPA 2LGSA 5LNK1 3TSSA 4HK2A 3EGRA 3V3XA 3TEXA 3PGEA 2JF5A 3LJ3A 2L1AA 1WR6E 1I4PA 2BKRB 4XC2A 1JWSD 3DWGC 4M00A 4RGTA 2D3GA 1VDVA 2IGGA 2J53A 4A90A 4D2KA 1HZ6A 4M0WB 5J2RA 3B0AA 3Q6BA 3FC4A 1MFWA 4MGKE 2CR5A 3RD2A 1E9MA 1IBXB 3ZJVA 4BFRA 2KQSA 3L13A 1N62A 2LGDA 3K9PB 4E74A 3KW5B 4KZ0A 2N7EA 1FCLA 2V3NA 2V9HA 4HCPB 1E7UA 5CX3A 1AW7A 2GB1A 2WXRA 1WM3A 1ET6A 4GU2A 3J9CA 1J7AA 2J0KA 3ABVB 3DPDA 1N5XA 3Q8CA 4GDKB 2QJLA 4FJVB 5AZHA 2MQJA 3VAWA 5LLIA 2ZVOA 2MW5A 2LGYA 3AMZA 4XDDA 1V49A 4BKTA 1C4AA 1FNUA 3NVVA 3TJPA 3SEBA 1Q10A 1EU4A 3NZUA 1TGZB 2BYTA 4G3XB 3IVFA 4K81A 3JSVA 3RN9C 2KJRA 1GJZA 3L54A 4K3CA 1TBEA 2M19A 1JWMD 4G11A 4W9IA 2INNE 4IWOA 3QWZB 1NYQA 3ZNID 4CYEA 1T0QC 5C23A 2E6XA 1I4RA 3ZO5B 1J0GA 2O2VB 2ZW0A 2H88B 1YQ4B 2AL3A 2INDC 4ZHPA 1JROA 4M8NA 2BKFA 2X38A 3V05A 4N59A 4M8MA 5LXHA 3MC8A 2XN9C 4OW0A 1B9RA 4FADA 4B6WA 2MH7A 4MH8A 2KC1A 3BINA 3L08A 3PRPB 3UF8A 5E6NA 1C76A 3CSFA 3UI3A 3BIID 4PS8A 1TTNA 3VR9B 4WWOA 4AUQC 1AWDA 1SIJA 3LB8C 1FXTB 3H7PB 1WE6A 1Q5WB 1NBFC 4ASWC 2KQ7A 3DCGA 1L6UA 3BY4B 3KWVA 3L4PA 3R2TA 3P1MA 4EEWA 2KFKA 3NRZA 1KH0A 1F77A 3M62B 3L16A 4JIOU 1XCTL 2C5LC 3I63C 4FBJB 4MGZE 1JCKB 1TY0A 5L83A 1DGJA 3ONSA 3Q3FA 2D3AA 2WXLA 4DHZE 4XZ4A 1WWTA 4JX1C 2PE6B 3I5JC 3TBLD 2WHIA 2PLPA 1PUTA 3MHSD 3V6EB 3MTNB 4KKIA 4ZRKA 1PQSA 1ESFA 2I1JA 2CS4A 4EKUA 4G50A 4US8A 1JALA 1I4XA 3L0WB 4WIPA 3DDCB 2BB5A 2CU1A 3PLVA 4B0MA 1KOTA 3AB5A 3Q69A 4AJWA 2BPSA 1MG4A 4IM0A 1FIQA 3GP7A 3TEZA 2WP9B 1I35A 5CHVC 4TQ0A 4IM3A 3P4QB 1YMHE 1YJ1A 3B1LX 4PYZA 2DAFA 1XQQA 5BYSA 4C7YA 1FM0D 2WXPA 1C9FA 4DXAB 4W9LA 2LHDA 4KGRA 3NG0A 1WJ4A 3FKYA 1UBQA 3Q3NC 3AEGB 3N9YC 2WXOA 1YQ3B 4TQ1A 1IPGA 2BS3B 1RRBA 4YT0B 4C80A 2BBCA 2WXMA 2J4XA 1KLVA 2BWES 2Q5WD 3VRAB 2MEKA 3KQ4A 4MM3B 2C7MB 3DBLI 1U4AA 3OJ4B 3JYUA 1E8ZA 1UWMA 4YTPB 2EMTA 2NMQA 3AH7A 3AN1A 4NZLB 5AZGA 1V6EA 1C4PA 1TS2A 2KN4A 2Z0EB 5CHWA 3AM9A 2N9PC 2ICIA 2FE8A 2ZCCA 4K1RB 3RNBC 4RF0A 4HDOA 4WJNA 2M0AA 2KVRA 4DHJB 3W2DA 4ARIA 4W9DA 3A4RA 3R3MA 3HVZA 2H89B 4ANWA 2AQ2B 4N58A 1T0RC 1QZEA 2WWZA 4ZDVA 5G5HA 1HTOA 1XLQA 2AL6A 5H92C 1N63A 2MP2B 3ZXVA 3RNEC 5FR3A 2V4IB 3ZNZB 2JRHA 1FFVA 1JQ4A 2M17A 3VTWA 2PVOD 5EE9A 3TL5A 2VZKB 1DOIA 3M3JA 4B9KA 1V97A 4HKZE 1WZ0A 1XCQL 1VRAB 1C1YB 1ZXHA 2N7DA 1JMLA 2VZKD 1IYFA 4OZAA 1K8RB 2N9EB 5E6JA 1TS3A 1N61A 3ZKJC 2QEJC 4A20A 2WU5B 4YTNB 1KFYB 3ZTCA 1CZPA 3ALBA 1RFKA 2MWSB 4GSWA 2FIDA 4J3OD 1M4VA 4BKSA 3A9KA 4B95A 4EZKA 3AEBB 4MEMA 1GOZA 2KACA 2MBQA 2VH1A 1EM7A 4DDID 2BB6A 2ACZB 4LNOA 1I4GA 3RNGC 4N9F4 3AI5A 4IWQA 4A3OA 2Y5BB 1NDDA 3AE4B 2KAJA 2JRIB 1KLGD 3Q8BA 3GE8C 3ZLZA 2LMCA 4K7UA 1WGDA 2PEAA 3B2GA 3Q3OC 4OVUA 2KTRB 2KYWA 3NY5A 4G0NB 3BWUD 1SE3A 1Y56A 1F1HA 1JWAD 4N6EB 2KWVB 4LNIA 2E3TA 3U52E 2J52A 4KGTA 1RAXA 3FAHA 1QT9A 2KVZA 1SE9A 1SE4A 4WURA 2DLBA 4IWPA 5G2NA 1RWSA 3NVWA 3RPFC 5EE0A 2QC8A 2G45B 3DVGX 3I57A 4CHKA 1WYWB 3QA8A 1WSPA 1OEYJ 1P7EA 4MSMB 2OJWA 1VZ6A 2IZVB 4C4VA 5E6PA 3VUYA 4GDLB 3NVYA 1YN4A 2DZMA 2KOXA 4DXFA 2AQ3B 1I4QA 3BYTB 1M94A 4S17A 4PS3A 4C56C 4FN2A 4QAYA 1E7PB 1ZXIA 3ZJUA 2WDQB 1MI0A 3JW0X 3BVMA 1D3ZA 5JH5C 1D6EC 3VDZA 3AE1B 5IA7A 1WGRA 2DZIA 3FILB 2RGFA 1QLBB 4KSKC 5IO9A 1WM2A 1EF1A 1D5ZC 2G4DB 5IOIA 4W9EA 1ZPSA 3ZUNA 3HK0A 3ECIA 2W9NA 2I2YA 1J7BA 2GLSA 3L10B 2FUG1 4ICVA 2L0FA 3P42A 2W82A 3WIMA 1IP9A 1YJIA 1JRPA 1VD2A 3MP9A 2JXXA 2O6VB 2JPHA 3QX1A 2WXGA 3E56A 2INPE 1L6VA 2UU7A 4DDGD 1N6ZA 1E8YA 2C9WB 1V1PA 2WX1A 3HM6X 3NVZA 3AE2B 2QIEB 4KVGB 4ARCA 1FPYA 4HPPA 2IO3B 1TZ1A 2LEKA 2CJOA 3SDLC 4A3PA 4P1BC 4EE2A 2K6DB 3EFCA 4H2AA 4KZCA 1YN5A 2X8XX 3RFZB 2XK5B 3DVNV 5AUIA 3AE8B 1YNTE 2QCZA 1MVKA 3P4PB 4JE3B 5AEKB 2KC2A 4I6NB 4C00A 1C79A 2A4ZA 1SXTA 3DOWA 3PRMB 3A1QB 3B08A 1T5XD 2LD9A 3P4SB 1LFDA 4L1BA 2L05A 1HQRD 3A33B 1QOBA 1SJHD 1PGAA 2NPTA 3WA0A 4LNNA 4LK0M 4OHJA 1AARA 1HE8A 2BYFA 1BXTA 4CQNA 4FXCA 1G6JA 3AEDB 2CHXA 5C2TB 2MJ3A 3PTFC 2PTLA 2PPHA 3LDZE 3KH0A 2DYBA 1XLPA 4WAAA 5T8IA 3V62A 5D7GA 5HHDG 4XDCA 1TZOA 4P7IA 1C77A 2LZ6A 3N20C 3WANA 2L7RA 3TEWA 1TS4A 2K1FA 2JYTA 3N1ZC 2KMAA 2LGXA 1QQRA 2LJ5A 1D5XC 1ZUD2 2RMMA 4PT5A 3IFWB 5H8YE 5CTRC 1EF5A 3I9V1 1I42A 3M95A 4HJGE 2KX3A 1KF6B 2MSED 2EELA 4ICUA 4XWTA 4XWWA 2MBBB 1T0YA 2DX5B 2Y3AA 4GIVA 1V80A 2LWPA 1E8XA 1R4MI 3I3TB 4ZRJA 3DHHC 1SSNA 3MC0B 3W1SC 2WXQA 2HTHA 2LUEA 2O2VA 1K53A 2WXFA 1L4ZB 3KUCB 2MJDA 1ROEA 3AU5A 4HEA1 3ENEA 4X57B 1ZGUB 1YJJA 3IAS1 3AU4A 2KDMA 1R7SA 3P4RB 4LJOB 3UIPB 4NAWB 1BT0A 5TR5A 2KHWB 2WXHA 3AE3B 3OG5A 4LLGM 3WAPA 1WGGA 3DBRB 3R2IA 1TYGB 1NI2A 4FULA 4J6IA 3X0WA 3CWIA 3H7PA 3OLMD 1LQBA 2MLBA 1L7YA 2UYZB 3VTUA 2PKOA 3PS6A 2LRWA 1JWBD 2RDGA 5MPOA 2DENB 3AEAB 5C3JB 1DOXA 2KZRA 2REXA 4MJSA 3ZDTA 1IUEA 2KNBA 2C7HA 1NYRA 5DPRA 1OQRA 4HWIB 3WAOA 1XT9B 1JW9D 4HKQA 3DBHB 2DAJA 1TJEA 3RCZA 2BW2A 1E90A 1F2RI 3JSVB 3RYTA 1TKGA 2KDFB 3QHTA 4MACA 2MJEA 2J0MA 4YTMB 2WS3B 4GGQA 4ACFA 4YXDB 4W9FA 4P1CC 2GBNA 1C3TA 2IPKD 3O13A 1H8CA 3OJ3A 1IGCA 4RGNA 2Z8LA 2JXTA 1L0XB 1CQVA 3OAWA 1P0RA 2IDYA 2W3SA 4HDQA 2IY1B 3RZWC 2DNFA 4F8CB 1FD6A 2MA9B 4R3DA 4TV3A 2ZCBA 5KHQA 2M4NA 1XLOA 3URYA 3IAM1 4TSSA 3V6CB 3H7SA 2YEPB 4HJKA 2LVQA 1LGRA 3DHGC 4MM3A 2M56B 4W9KA 5AZFA 3VHTC 2ON8A 2JVCA 1P1AA 4DWFA 2VH2A 2EKEC 1FEHA 4WJOA 3ZNGC 1PFDA 1TY2A 4IW0A 2I1KA 4IC7B 1FRRA 1V8CA 1WX8A 3ZJTA 2KFKB 2NTSA 5G5GA 1WJ6A 2FIFA 3VH4B 5KHOA 1P9DU 2RDBC 2K8BA 4KDIC 3P2BA 4GOCA 3ZNHB 2RR9A 3IBEA 4USAA 1TKEA 4BOSC 3ML9A 1E10A 2MP2A 4YWGG 4A9AA 2RPQA 2GBRA 4WJPA 1OGWA 1PGXA 1UGJA 1A70A 1GB1A 3SD5A 3C19A 5D6JB 3NS8A 4KV2A 2NBUA 4II3B 4BBNC 3UQAA 2LRUA 3L17A 3ZDMC 3RUIB 4GMVA 1SF0A 2D5GA 4LNFA 4JQWC 4NQLB 2JWUA 1C4CA 2ZEQA 1AN8A 2JX5A 1WGKA 2PJHA 4KSLC 2GBMA 3RI7C 4NNJB 4YL8A 5J17A 1TIFA 4ZOHC 3PZDA 1HZ5A 1MHHE 1VZ7A 2C60A 2IO1B 2BT6A 4RH6A 2QHOA 1XD3B 1RLFA 1D5MC 3Q3JA 4DBGA 4MSQB 5TSSA 1WMHA 2PMVA 1OTRB 2J42A 1TT5B 3GZNI 2CHZA 3R7QA 1J8CA 1Q0WB 4P6VF 2GOWA 2L00B 4O1NA 2KT7A 1ZOYB 2LXAA
chains in the Genus database with same CATH topology
4BOZB 3ZUNA 3HK0A 3ECIA 1WM3A 3U8ZA 1S3SG 2W9NA 2G3QB 4FJZA 4GU2A 2K6QA 3PLUA 1WE7A 1F9JA 4FLHA 2ZPNA 3L10B 5L95C 2J0KA 2L76A 4ICVA 2L0FA 3DPDA 4HXDA 3WIMA 1IP9A 4GDKB 4FJVB 2L8JA 1VD2A 3K9OB 2MQJA 5AZHA 4EFOA 2JZ3B 2GBKA 3WALA 3VAWA 2XBBC 5LLIA 3APFA 2JXXA 2ZVOA 2MW5A 2LGYA 2R2QA 2WDTB 2O6VB 3VQIA 2JPHA 2ZJDA 4TUUA 3QX1A 2KO3A 4IUMB 5J18A 1V49A 3UGBB 4BKTA 4DDGD 3TJPA 1E8YA 2C9WB 1WXSA 3NZUA 4FHJA 2WX1A 4IG7B 1TGZB 3HM6X 4G3XB 3IVFA 1V81A 4URKA 4K81A 2NS5A 3VXWA 3JSVA 4NQKE 4KVGB 3KUZA 2IO3B 4RM9A 2KJRA 1TZ1A 1GJZA 2NBVB 3SDLC 4ANUA 3L54A 2M1MA 4A3PA 1UELA 1SIFA 1WI0A 2KFJA 4I6PA 3U30A 2K6DB 2N1VA 4W9HA 2EMSA 1TBEA 4KZCA 2XK5B 4G11A 4W9IA 4IWOA 4GDLA 3QWZB 4KDLB 1WX7A 3DVNV 4DK5A 3ZNID 4CYEA 5C23A 1WR1A 4JLCA 3KVFB 4KIKB 2OJRA 3ZO5B 1J0GA 2O2VB 1E5WA 2KJ6A 2LI5A 5AEKB 2YLMA 2KC2A 2AL3A 1V5OA 4I6NB 3QIJA 2AWTA 1J19A 2KANA 4M8NA 2A4ZA 2BKFA 3DOWA 3PRMB 3A1QB 4M8MA 5LXHA 3B08A 1KJTA 2LD9A 1LFDA 2N9XA 2L05A 4I6LB 3ZRFA 3C0RB 3A33B 4JGHB 5IAAC 3D32A 2ASQA 4B6WA 2NPTA 3WA0A 4BKSD 4FADA 2BGFA 3PT2B 4RM8A 3DBSA 3RT3B 4MELA 2KJHB 1AARA 2IY0B 4GXBA 2KC1A 3IG3A 3BINA 3L08A 1HE8A 4IM2A 3ZIMA 2BYFA 3HHMA 3PRPB 4EOYA 3UF8A 5CHFA 5E6NA 1R4NI 4W9GA 4II2B 1G6JA 2CHXA 3ZRCA 2LVPA 2KX0A 3CSFA 4PS8A 1TTNA 2HD5B 3ML8A 3PTFC 1P98A 4WWOA 4AUQC 2PPHA 3LDZE 3TIXA 3KH0A 4DHJD 4OVVA 2DYBA 3APDA 4WAAA 3A9JA 3V62A 1FXTB 3H7PB 5D7GA 2NR2A 1LM8B 1Q5WB 1WE6A 2WYQA 4P7IA 2FCMA 1NBFC 4ASWC 2KQ7A 2LZ6A 2NVUI 2KLCA 1YQBA 2O6VA 3DCGA 4XX5A 3U7DA 3BY4B 3WANA 2L7RA 4EEWA 2KFKA 2K1FA 3UIOB 2KMAA 1S1QB 2LGXA 3M62B 2LJ5A 3L16A 4JIOU 4FJYA 3H9DA 2C5LC 2KDIA 4FBJB 4MGZE 3RZFA 3IFWB 5L83A 3SHQA 2JZZA 3ONSA 3KUDB 2RD0A 1EF5A 3Q3FA 5CTRC 4WWNA 2Z59B 2FCSA 4LDTD 2LXCA 4DHZE 1I42A 4WQOB 4XZ4A 3M95A 2PE6B 1WGHA 4PYUA 3TBLD 1EO6A 2KX3A 2MSED 4ICUA 3MHSD 3V6EB 3M63B 2MBBB 3MTNB 1T0YA 2DX5B 1ZKHA 2M8SA 2KWCA 4GIVA 1V80A 4ZRKA 1PQSA 2I1JA 5GMVA 2ZVNA 2CS4A 2KTRA 3V61A 2LWPA 4G50A 1E8XA 4MDKE 1R4MI 2PE9A 4EKUA 3I3TB 1KM7A 4ZRJA 3L0WB 2LASA 2KWUB 3DDCB 2CU1A 3N32A 3PLVA 4KIKA 3TCAA 2J7QB 3W1SC 2HTHA 2LUEA 2O2VA 3DVGY 3OLMD 4AJYB 1KOTA 3KUCB 2AYOB 4FHKA 3EFUA 4AJWA 3AU5A 2BPSA 2L3ZA 3DQVA 4IM0A 4MGIE 4FA6A 1WZ3A 3ZW3A 3A1QA 1I35A 4PS7A 5CHVC 3ENEA 5EDSA 4TQ0A 4X57B 1OEYA 2AEHA 1UH6A 4IM3A 1YJ1A 3B1LX 4PYZA 1ZGUB 2A5UA 2DAFA 1XQQA 4K7SA 5JHBA 4ANXA 3AU4A 4ZYNA 1MG8A 4DXAB 1V9JA 3CMMB 2IBIB 2JT4B 2KD0A 3IHPC 4W9LA 1GC7A 2FAZA 2NCNA 3AULA 1Z2MA 4LJOB 1WJ4A 3UIPB 4NAWB 1BT0A 4GB9A 5TR5A 1WMHB 3CSTA 1UBQA 2KHWB 3T9LA 3TMPB 1E8WA 5BO4B 3MJWA 4E71A 4TQ1A 3WAPA 1IPGA 5D2MB 3JVZX 1WGGA 1RRBA 2ZNVB 1WF9A 4RMAA 4F1SA 1WXVA 1WH3A 3VTVA 1KLVA 2JWZA 1NI2A 2DHZA 2RSUA 4FULA 2BWES 3EC8A 3PHXB 1YX5B 4J6IA 3X0WA 2D2QA 2GBJA 2IO0B 2J0JA 3H7PA 2YVCA 1WY8A 1LQBA 2C7MB 2MLBA 2MBHA 1U4AA 2V3SA 3DBLI 3OJ4B 1L7YA 5DPSA 2UYZB 3VTUA 3PS6A 4LCDE 3PV1A 2B3AA 2LRWA 3T8MA 3A9KB 3JYUA 1E8ZA 2DENB 2EMTA 2MCNB 3PSEB 3NOBA 2KDEB 4JL9A 4GN1A 1V6EA 2KZRA 2REXA 4MJSA 5AZGA 3WAMA 1JRUA 3X23A 2Z0EB 3ZDTA 2UWQA 2KNBA 2C7HA 5CHWA 3UQBA 1WGYA 2JUOA 5DPRA 1WRDB 2N9PC 4HWIB 2GMIC 3WAOA 2FNJB 2ZCCA 4K1RB 1XT9B 5DPWA 4HDOA 1UZXB 4WJNA 2KVRA 2DAJA 2KDBA 4DHJB 4W9DA 3A4RA 3R3MA 3RCZA 1E90A 3W1SA 1H4RA 1V2YA 3JSVB 3R7RA 4BBNF 3CF6E 4ANWA 3RYTA 1YX6B 4GDKA 2KDFB 3QHTA 2N1WA 1QZEA 2KLGA 2WWZA 2KMCA 3A4SC 3DBRI 3GOEA 4NJ6A 4CO7A 4ZDVA 3ZVVA 2NBWB 4AOFA 4ZRIA 3VFKA 1WFYA 2AL6A 2J0MA 2ZZPB 2BYVE 5DPTA 2MP2B 2DYMA 4GGQA 1CMXB 3EHVA 4W9FA 5DCNA 2V1YA 2GBNA 1C3TA 3ZNZB 2K8HA 1H8CA 2JRHA 3PRZA 4LDTB 3OJ3A 3PHWB 2M17A 1WX9A 2KKCA 3VTWA 2WX0A 3OAWA 1P0RA 2BWFA 4HDQA 2IY1B 3TL5A 2CKHB 3RZWC 4F8CB 2HE7A 4NAWA 5E6OA 3M3JA 2MA9B 3RULA 4B9KA 1LXDA 1WZ0A 4TV3A 2G4SA 2ZCBA 1C1YB 2MX2A 2N7DA 4HPMB 3VUWA 4HVBA 5KHQA 1IYFA 2M4NA 2NPTB 2XK5A 2N4FA 1K8RB 2N9EB 4ANVA 2HJ8A 1ZW7A 3DBHI 3V6CB 2KN5A 3DVNU 5G55A 3ZKJC 2FCNA 3H7SA 3QK0A 4A20A 5LXIB 3N3KB 3ZTCA 4HJKA 2LVQA 3ALBA 3QCAA 1V5TA 2MWSB 4GSWA 1SGHA 1V86A 4MM3A 4W9KA 2K8CA 5JZEB 5JHAA 5AZFA 3VHTC 1A5RA 2L0TA 3W1YA 1YIWA 2JVCA 3KYDD 4MH0E 1P1AA 2FIDA 2MBOA 4DWFA 2EKEC 4NY0A 4BKSA 3A9KA 4WJOA 4B95A 3ZNGC 4EZKA 3EECA 3S2AA 2DZKA 2OOBB 4EZJA 4IW0A 2I1KA 3A9JB 2VRRB 4MEMA 2JY6A 2MBQA 4IC7B 4DDID 2LVOA 4NJ7A 1WX8A 2M0XA 2ZPYA 1UBIA 2FUHB 4WJQA 3KYCD 3VUXA 2KFKB 2BF8B 2V4LA 5C1ZA 4N9F4 4W9JA 1GC6A 3H1UA 1UD7A 3AI5A 2Z0DB 2O6VD 4IWQA 2K39A 4A3OA 1E7VA 2Y5BB 1X1MA 2IYDB 4AP4C 3SU8X 4BVUC 1NDDA 1WJ6A 2FIFA 3VH4B 5KHOA 3NHEB 2JRIB 1P9DU 3QAQA 2K8BA 3VH3B 4KDIC 3ZLZA 3P2BA 4EZLA 3ZTDA 2K25A 4E3CA 4K7UA 1UGMA 3PVLA 2DYOA 2ZNVC 1Q1OA 1P3QU 4GOCA 1WGDA 2PEAA 2RR9A 3IBEA 2KK8A 3ZNHB 4AWJA 4F7ZA 3HM3A 3PREA 4OVUA 4BOSC 3ML9A 4K7WA 2KTRB 3APCA 2KTFA 4NPNA 2MP2A 3HIZA 3NY5A 1RFAA 3H6NA 4G0NB 2RPQA 2D11A 1WXAA 4W9CA 2GBRA 2KWVB 4WJPA 1OGWA 5HKHA 2D10A 1GNUA 2MRPA 1RAXA 1ISNA 2CHWA 1GG3A 2XEWA 1Y8RC 1SE9A 3SD5A 5G2NA 1EUVB 4IWPA 3VVWB 5D6JB 2FCQA 3QQ8B 4BKGA 2KXJA 3NS8A 2C7NB 4KV2A 2NBUA 4II3B 3R66C 4TKNA 5D94A 4BBNC 2G45B 3AXCA 1GUAB 2BYEA 3UQAA 2LRUA 3O65B 3L17A 3ZDMC 3RUIB 2DZJA 3DVGX 3QARA 4CHKA 4MGYE 4GMVA 3PPAA 1WYWB 1VCBA 3QA8A 4JQWC 4NQLB 3V60A 1OEYJ 2IO2B 4MSMB 4HLEA 2ZEQA 4HK2A 2IZVB 2PJHA 3PGEA 4KSLC 5E6PA 2GBMA 2JF5A 4WWPA 3VUYA 4GDLB 3LJ3A 4LJPB 4NNJB 1WR6E 4YL8A 5J17A 2BKRB 2DZMA 2KOXA 4XC2A 4HPLB 3PZDA 3QC8B 2D3GA 1M94A 1WJUA 4M0WB 2C60A 2IO1B 4PS3A 1WXMA 4FN2A 5J2RA 1OQYA 3B0AA 3JW0X 2QHOA 1XD3B 4MGKE 1RLFA 1D3ZA 2CR5A 3Q3JA 5JH5C 4DBGA 4MSQB 3RD2A 3VDZA 5IA7A 1WMHA 4EUTA 1OTRB 2D07B 3N30A 4DHZB 1WGRA 1YD8U 2DZIA 3GZNI 2CHZA 3NZSA 2RGFA 4MJSB 4BFRA 3R7QA 2KQSA 3L13A 2LGDA 3QJZA 3K9PB 1Z5SB 4E74A 4KSKC 1J8CA 3KW5B 4KZ0A 1Q0WB 1WM2A 2N7EA 3UINB 2GOWA 1EF1A 1WJNA 1E7UA 4HCPB 2L00B 5CX3A 5FR6A 2G4DB 2MBEA 4W9EA 1L2NA 2R2OA 1WIAA 4HCNB 2LXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOZ B;  3ZUN A;  3HK0 A;  3ECI A;  1WM3 A;  3U8Z A;  1S3S G;  2W9N A;  2G3Q B;  4FJZ A;  4GU2 A;  2K6Q A;  3PLU A;  1WE7 A;  1F9J A;  4FLH A;  2ZPN A;  3L10 B;  5L95 C;  2J0K A;  2L76 A;  4ICV A;  2L0F A;  3DPD A;  4HXD A;  3WIM A;  1IP9 A;  4GDK B;  4FJV B;  2L8J A;  1VD2 A;  3K9O B;  2MQJ A;  5AZH A;  4EFO A;  2JZ3 B;  2GBK A;  3WAL A;  3VAW A;  2XBB C;  5LLI A;  3APF A;  2JXX A;  2ZVO A;  2MW5 A;  2LGY A;  2R2Q A;  2WDT B;  2O6V B;  3VQI A;  2JPH A;  2ZJD A;  4TUU A;  3QX1 A;  2KO3 A;  4IUM B;  5J18 A;  1V49 A;  3UGB B;  4BKT A;  4DDG D;  3TJP A;  1E8Y A;  2C9W B;  1WXS A;  3NZU A;  4FHJ A;  2WX1 A;  4IG7 B;  1TGZ B;  3HM6 X;  4G3X B;  3IVF A;  1V81 A;  4URK A;  4K81 A;  2NS5 A;  3VXW A;  3JSV A;  4NQK E;  4KVG B;  3KUZ A;  2IO3 B;  4RM9 A;  2KJR A;  1TZ1 A;  1GJZ A;  2NBV B;  3SDL C;  4ANU A;  3L54 A;  2M1M A;  4A3P A;  1UEL A;  1SIF A;  1WI0 A;  2KFJ A;  4I6P A;  3U30 A;  2K6D B;  2N1V A;  4W9H A;  2EMS A;  1TBE A;  4KZC A;  2XK5 B;  4G11 A;  4W9I A;  4IWO A;  4GDL A;  3QWZ B;  4KDL B;  1WX7 A;  3DVN V;  4DK5 A;  3ZNI D;  4CYE A;  5C23 A;  1WR1 A;  4JLC A;  3KVF B;  4KIK B;  2OJR A;  3ZO5 B;  1J0G A;  2O2V B;  1E5W A;  2KJ6 A;  2LI5 A;  5AEK B;  2YLM A;  2KC2 A;  2AL3 A;  1V5O A;  4I6N B;  3QIJ A;  2AWT A;  1J19 A;  2KAN A;  4M8N A;  2A4Z A;  2BKF A;  3DOW A;  3PRM B;  3A1Q B;  4M8M A;  5LXH A;  3B08 A;  1KJT A;  2LD9 A;  1LFD A;  2N9X A;  2L05 A;  4I6L B;  3ZRF A;  3C0R B;  3A33 B;  4JGH B;  5IAA C;  3D32 A;  2ASQ A;  4B6W A;  2NPT A;  3WA0 A;  4BKS D;  4FAD A;  2BGF A;  3PT2 B;  4RM8 A;  3DBS A;  3RT3 B;  4MEL A;  2KJH B;  1AAR A;  2IY0 B;  4GXB A;  2KC1 A;  3IG3 A;  3BIN A;  3L08 A;  1HE8 A;  4IM2 A;  3ZIM A;  2BYF A;  3HHM A;  3PRP B;  4EOY A;  3UF8 A;  5CHF A;  5E6N A;  1R4N I;  4W9G A;  4II2 B;  1G6J A;  2CHX A;  3ZRC A;  2LVP A;  2KX0 A;  3CSF A;  4PS8 A;  1TTN A;  2HD5 B;  3ML8 A;  3PTF C;  1P98 A;  4WWO A;  4AUQ C;  2PPH A;  3LDZ E;  3TIX A;  3KH0 A;  4DHJ D;  4OVV A;  2DYB A;  3APD A;  4WAA A;  3A9J A;  3V62 A;  1FXT B;  3H7P B;  5D7G A;  2NR2 A;  1LM8 B;  1Q5W B;  1WE6 A;  2WYQ A;  4P7I A;  2FCM A;  1NBF C;  4ASW C;  2KQ7 A;  2LZ6 A;  2NVU I;  2KLC A;  1YQB A;  2O6V A;  3DCG A;  4XX5 A;  3U7D A;  3BY4 B;  3WAN A;  2L7R A;  4EEW A;  2KFK A;  2K1F A;  3UIO B;  2KMA A;  1S1Q B;  2LGX A;  3M62 B;  2LJ5 A;  3L16 A;  4JIO U;  4FJY A;  3H9D A;  2C5L C;  2KDI A;  4FBJ B;  4MGZ E;  3RZF A;  3IFW B;  5L83 A;  3SHQ A;  2JZZ A;  3ONS A;  3KUD B;  2RD0 A;  1EF5 A;  3Q3F A;  5CTR C;  4WWN A;  2Z59 B;  2FCS A;  4LDT D;  2LXC A;  4DHZ E;  1I42 A;  4WQO B;  4XZ4 A;  3M95 A;  2PE6 B;  1WGH A;  4PYU A;  3TBL D;  1EO6 A;  2KX3 A;  2MSE D;  4ICU A;  3MHS D;  3V6E B;  3M63 B;  2MBB B;  3MTN B;  1T0Y A;  2DX5 B;  1ZKH A;  2M8S A;  2KWC A;  4GIV A;  1V80 A;  4ZRK A;  1PQS A;  2I1J A;  5GMV A;  2ZVN A;  2CS4 A;  2KTR A;  3V61 A;  2LWP A;  4G50 A;  1E8X A;  4MDK E;  1R4M I;  2PE9 A;  4EKU A;  3I3T B;  1KM7 A;  4ZRJ A;  3L0W B;  2LAS A;  2KWU B;  3DDC B;  2CU1 A;  3N32 A;  3PLV A;  4KIK A;  3TCA A;  2J7Q B;  3W1S C;  2HTH A;  2LUE A;  2O2V A;  3DVG Y;  3OLM D;  4AJY B;  1KOT A;  3KUC B;  2AYO B;  4FHK A;  3EFU A;  4AJW A;  3AU5 A;  2BPS A;  2L3Z A;  3DQV A;  4IM0 A;  4MGI E;  4FA6 A;  1WZ3 A;  3ZW3 A;  3A1Q A;  1I35 A;  4PS7 A;  5CHV C;  3ENE A;  5EDS A;  4TQ0 A;  4X57 B;  1OEY A;  2AEH A;  1UH6 A;  4IM3 A;  1YJ1 A;  3B1L X;  4PYZ A;  1ZGU B;  2A5U A;  2DAF A;  1XQQ A;  4K7S A;  5JHB A;  4ANX A;  3AU4 A;  4ZYN A;  1MG8 A;  4DXA B;  1V9J A;  3CMM B;  2IBI B;  2JT4 B;  2KD0 A;  3IHP C;  4W9L A;  1GC7 A;  2FAZ A;  2NCN A;  3AUL A;  1Z2M A;  4LJO B;  1WJ4 A;  3UIP B;  4NAW B;  1BT0 A;  4GB9 A;  5TR5 A;  1WMH B;  3CST A;  1UBQ A;  2KHW B;  3T9L A;  3TMP B;  1E8W A;  5BO4 B;  3MJW A;  4E71 A;  4TQ1 A;  3WAP A;  1IPG A;  5D2M B;  3JVZ X;  1WGG A;  1RRB A;  2ZNV B;  1WF9 A;  4RMA A;  4F1S A;  1WXV A;  1WH3 A;  3VTV A;  1KLV A;  2JWZ A;  1NI2 A;  2DHZ A;  2RSU A;  4FUL A;  2BWE S;  3EC8 A;  3PHX B;  1YX5 B;  4J6I A;  3X0W A;  2D2Q A;  2GBJ A;  2IO0 B;  2J0J A;  3H7P A;  2YVC A;  1WY8 A;  1LQB A;  2C7M B;  2MLB A;  2MBH A;  1U4A A;  2V3S A;  3DBL I;  3OJ4 B;  1L7Y A;  5DPS A;  2UYZ B;  3VTU A;  3PS6 A;  4LCD E;  3PV1 A;  2B3A A;  2LRW A;  3T8M A;  3A9K B;  3JYU A;  1E8Z A;  2DEN B;  2EMT A;  2MCN B;  3PSE B;  3NOB A;  2KDE B;  4JL9 A;  4GN1 A;  1V6E A;  2KZR A;  2REX A;  4MJS A;  5AZG A;  3WAM A;  1JRU A;  3X23 A;  2Z0E B;  3ZDT A;  2UWQ A;  2KNB A;  2C7H A;  5CHW A;  3UQB A;  1WGY A;  2JUO A;  5DPR A;  1WRD B;  2N9P C;  4HWI B;  2GMI C;  3WAO A;  2FNJ B;  2ZCC A;  4K1R B;  1XT9 B;  5DPW A;  4HDO A;  1UZX B;  4WJN A;  2KVR A;  2DAJ A;  2KDB A;  4DHJ B;  4W9D A;  3A4R A;  3R3M A;  3RCZ A;  1E90 A;  3W1S A;  1H4R A;  1V2Y A;  3JSV B;  3R7R A;  4BBN F;  3CF6 E;  4ANW A;  3RYT A;  1YX6 B;  4GDK A;  2KDF B;  3QHT A;  2N1W A;  1QZE A;  2KLG A;  2WWZ A;  2KMC A;  3A4S C;  3DBR I;  3GOE A;  4NJ6 A;  4CO7 A;  4ZDV A;  3ZVV A;  2NBW B;  4AOF A;  4ZRI A;  3VFK A;  1WFY A;  2AL6 A;  2J0M A;  2ZZP B;  2BYV E;  5DPT A;  2MP2 B;  2DYM A;  4GGQ A;  1CMX B;  3EHV A;  4W9F A;  5DCN A;  2V1Y A;  2GBN A;  1C3T A;  3ZNZ B;  2K8H A;  1H8C A;  2JRH A;  3PRZ A;  4LDT B;  3OJ3 A;  3PHW B;  2M17 A;  1WX9 A;  2KKC A;  3VTW A;  2WX0 A;  3OAW A;  1P0R A;  2BWF A;  4HDQ A;  2IY1 B;  3TL5 A;  2CKH B;  3RZW C;  4F8C B;  2HE7 A;  4NAW A;  5E6O A;  3M3J A;  2MA9 B;  3RUL A;  4B9K A;  1LXD A;  1WZ0 A;  4TV3 A;  2G4S A;  2ZCB A;  1C1Y B;  2MX2 A;  2N7D A;  4HPM B;  3VUW A;  4HVB A;  5KHQ A;  1IYF A;  2M4N A;  2NPT B;  2XK5 A;  2N4F A;  1K8R B;  2N9E B;  4ANV A;  2HJ8 A;  1ZW7 A;  3DBH I;  3V6C B;  2KN5 A;  3DVN U;  5G55 A;  3ZKJ C;  2FCN A;  3H7S A;  3QK0 A;  4A20 A;  5LXI B;  3N3K B;  3ZTC A;  4HJK A;  2LVQ A;  3ALB A;  3QCA A;  1V5T A;  2MWS B;  4GSW A;  1SGH A;  1V86 A;  4MM3 A;  4W9K A;  2K8C A;  5JZE B;  5JHA A;  5AZF A;  3VHT C;  1A5R A;  2L0T A;  3W1Y A;  1YIW A;  2JVC A;  3KYD D;  4MH0 E;  1P1A A;  2FID A;  2MBO A;  4DWF A;  2EKE C;  4NY0 A;  4BKS A;  3A9K A;  4WJO A;  4B95 A;  3ZNG C;  4EZK A;  3EEC A;  3S2A A;  2DZK A;  2OOB B;  4EZJ A;  4IW0 A;  2I1K A;  3A9J B;  2VRR B;  4MEM A;  2JY6 A;  2MBQ A;  4IC7 B;  4DDI D;  2LVO A;  4NJ7 A;  1WX8 A;  2M0X A;  2ZPY A;  1UBI A;  2FUH B;  4WJQ A;  3KYC D;  3VUX A;  2KFK B;  2BF8 B;  2V4L A;  5C1Z A;  4N9F 4;  4W9J A;  1GC6 A;  3H1U A;  1UD7 A;  3AI5 A;  2Z0D B;  2O6V D;  4IWQ A;  2K39 A;  4A3O A;  1E7V A;  2Y5B B;  1X1M A;  2IYD B;  4AP4 C;  3SU8 X;  4BVU C;  1NDD A;  1WJ6 A;  2FIF A;  3VH4 B;  5KHO A;  3NHE B;  2JRI B;  1P9D U;  3QAQ A;  2K8B A;  3VH3 B;  4KDI C;  3ZLZ A;  3P2B A;  4EZL A;  3ZTD A;  2K25 A;  4E3C A;  4K7U A;  1UGM A;  3PVL A;  2DYO A;  2ZNV C;  1Q1O A;  1P3Q U;  4GOC A;  1WGD A;  2PEA A;  2RR9 A;  3IBE A;  2KK8 A;  3ZNH B;  4AWJ A;  4F7Z A;  3HM3 A;  3PRE A;  4OVU A;  4BOS C;  3ML9 A;  4K7W A;  2KTR B;  3APC A;  2KTF A;  4NPN A;  2MP2 A;  3HIZ A;  3NY5 A;  1RFA A;  3H6N A;  4G0N B;  2RPQ A;  2D11 A;  1WXA A;  4W9C A;  2GBR A;  2KWV B;  4WJP A;  1OGW A;  5HKH A;  2D10 A;  1GNU A;  2MRP A;  1RAX A;  1ISN A;  2CHW A;  1GG3 A;  2XEW A;  1Y8R C;  1SE9 A;  3SD5 A;  5G2N A;  1EUV B;  4IWP A;  3VVW B;  5D6J B;  2FCQ A;  3QQ8 B;  4BKG A;  2KXJ A;  3NS8 A;  2C7N B;  4KV2 A;  2NBU A;  4II3 B;  3R66 C;  4TKN A;  5D94 A;  4BBN C;  2G45 B;  3AXC A;  1GUA B;  2BYE A;  3UQA A;  2LRU A;  3O65 B;  3L17 A;  3ZDM C;  3RUI B;  2DZJ A;  3DVG X;  3QAR A;  4CHK A;  4MGY E;  4GMV A;  3PPA A;  1WYW B;  1VCB A;  3QA8 A;  4JQW C;  4NQL B;  3V60 A;  1OEY J;  2IO2 B;  4MSM B;  4HLE A;  2ZEQ A;  4HK2 A;  2IZV B;  2PJH A;  3PGE A;  4KSL C;  5E6P A;  2GBM A;  2JF5 A;  4WWP A;  3VUY A;  4GDL B;  3LJ3 A;  4LJP B;  4NNJ B;  1WR6 E;  4YL8 A;  5J17 A;  2BKR B;  2DZM A;  2KOX A;  4XC2 A;  4HPL B;  3PZD A;  3QC8 B;  2D3G A;  1M94 A;  1WJU A;  4M0W B;  2C60 A;  2IO1 B;  4PS3 A;  1WXM A;  4FN2 A;  5J2R A;  1OQY A;  3B0A A;  3JW0 X;  2QHO A;  1XD3 B;  4MGK E;  1RLF A;  1D3Z A;  2CR5 A;  3Q3J A;  5JH5 C;  4DBG A;  4MSQ B;  3RD2 A;  3VDZ A;  5IA7 A;  1WMH A;  4EUT A;  1OTR B;  2D07 B;  3N30 A;  4DHZ B;  1WGR A;  1YD8 U;  2DZI A;  3GZN I;  2CHZ A;  3NZS A;  2RGF A;  4MJS B;  4BFR A;  3R7Q A;  2KQS A;  3L13 A;  2LGD A;  3QJZ A;  3K9P B;  1Z5S B;  4E74 A;  4KSK C;  1J8C A;  3KW5 B;  4KZ0 A;  1Q0W B;  1WM2 A;  2N7E A;  3UIN B;  2GOW A;  1EF1 A;  1WJN A;  1E7U A;  4HCP B;  2L00 B;  5CX3 A;  5FR6 A;  2G4D B;  2MBE A;  4W9E A;  1L2N A;  2R2O A;  1WIA A;  4HCN B;  2LXA A; 
#chains in the Genus database with same CATH topology
 5EE1 A;  4FJZ A;  4RFB A;  2K6Q A;  3PLU A;  3N1X C;  4FLH A;  2ZPN A;  5L95 C;  3AE7 B;  2L76 A;  2IJ0 A;  4HXD A;  2L8J A;  2W3R A;  2JZ3 B;  3U2S C;  3WAL A;  2BS4 B;  3APF A;  4Q2J A;  2QSD A;  4TUU A;  5I4D A;  2KO3 A;  2SEB D;  2LUM A;  1SEB D;  4WAF A;  4AQ7 A;  1V81 A;  2NS5 A;  3KUZ A;  1QOF A;  2NBV B;  4OVZ A;  1UEL A;  2KFJ A;  4I6P A;  1L0Y B;  3U30 A;  2EMS A;  3OWE B;  2IGD A;  4GDL A;  4DK5 A;  4KDL B;  3MC9 A;  4JLC A;  3RNC C;  1NEN B;  4KIK B;  2OJR A;  3RNA C;  2KJ6 A;  1V5O A;  1T6B X;  3QIJ A;  2WQY B;  2AWT A;  1J19 A;  2KAN A;  2N0S B;  4YSX B;  3Q8F A;  4I6L B;  3C0R B;  4JGH B;  5IAA C;  1XXG A;  3D32 A;  3FIL A;  1LO5 D;  4BKS D;  5IN7 A;  2EKI A;  3PT2 B;  4RM8 A;  4MEL A;  3IT4 B;  2IY0 B;  3IG3 A;  4IM2 A;  3ZIM A;  4EOY A;  5CHF A;  1RM6 C;  4W9G A;  3ZRC A;  4PK1 A;  4NJC A;  2KX0 A;  3AV8 A;  2G9H D;  3ML8 A;  1P98 A;  4LTU A;  3E9S A;  1FCC C;  4WQM A;  2BVC A;  2K3U A;  4JWS C;  3A9J A;  4DXG A;  1LM8 B;  4AS1 A;  1FO4 A;  2BS2 B;  2O6V A;  2KLC A;  1YQB A;  3U7D A;  1E0Z A;  4MT5 A;  1S1Q B;  3H9D A;  2RPV A;  3NJT A;  3RZF A;  2JZZ A;  3KUD B;  2RD0 A;  5HFY A;  4LDT D;  4TMA B;  4WQO B;  1HTQ A;  3W9C B;  1WGH A;  4PYU A;  1ACC A;  1N5W A;  2M8S A;  2KWC A;  5GMV A;  2ZVN A;  3V61 A;  4UDU C;  1CJE A;  2KWU B;  3N32 A;  3DBL B;  3H8H A;  2K0P A;  4FHK A;  3EFU A;  1BUI C;  4MGI E;  4FA6 A;  3A1Q A;  1MHX A;  1N60 A;  4PS7 A;  1OEY A;  1UH6 A;  2PW9 A;  3VRB B;  4XGA B;  2CJN A;  4K7S A;  5JHB A;  4ANX A;  2WXI A;  1V9J A;  2N9L A;  3BVG A;  3CMM B;  2JT4 B;  2KD0 A;  3IHP C;  5JXV A;  3AUL A;  1R4N B;  1Z2M A;  4GB9 A;  3CST A;  4A8X C;  2WGS A;  3T9L A;  5BO4 B;  4E71 A;  1RYJ A;  5D2M B;  3JVZ X;  4RCO A;  4RMA A;  1HEZ E;  1WH3 A;  3VTV A;  2JWZ A;  2D3B A;  2KMM A;  4M0W A;  2LFI A;  2DBY A;  2V3S A;  1WY8 A;  2L32 A;  1ZDX A;  5BMH A;  1MJD A;  2B3A A;  3T8M A;  1IBX A;  1CK1 A;  4YSY B;  2MCN B;  3PSE B;  3NOB A;  4JL9 A;  1ZDV A;  4GN1 A;  2XNA C;  3X23 A;  1JRU A;  2JYE A;  2UWQ A;  1WGY A;  2JUO A;  1WRD B;  2GMI C;  2FNJ B;  1KRH A;  1V1P B;  1FNV A;  4IDI A;  2KDB A;  5HI1 A;  2L83 A;  1H4R A;  1V2Y A;  4BBN F;  2CU3 A;  4GDK A;  2N1W A;  2KLG A;  3GOE A;  4NJ6 A;  2KMC A;  1HA5 A;  3ZVV A;  3ETR A;  1WFY A;  2ZZP B;  4KGS A;  2HDE A;  2BYV E;  3ZYY X;  1WXQ A;  2DYM A;  1CMX B;  2WNM A;  2TSS A;  3SFE B;  2V1Y A;  2V0G A;  2K8H A;  1PDX A;  3PHW B;  1WX9 A;  2KKC A;  2WX0 A;  2Y5P A;  2K5P A;  3ZXR A;  4XYC A;  3AEE B;  1VZ8 A;  2HE7 A;  4NAW A;  3RUL A;  1LXD A;  3EA6 A;  1J7C A;  3DWM A;  2MX2 A;  3B9J A;  2NPT B;  2HJ8 A;  4YSZ B;  1QIL A;  1XO3 A;  2K9X A;  3QCA A;  1V5T A;  4BAX A;  3NZ3 A;  5GXG B;  2K8C A;  5JZE B;  5JHA A;  2L0T A;  3BYY B;  1FXI A;  3U7Z A;  2YEP F;  3S2A A;  2OOB B;  4EZJ A;  3R8B A;  1MPE A;  3SFD B;  2VRR B;  3ZQ4 A;  1L0V B;  2M0X A;  1SJE D;  4KX6 B;  3KYC D;  2AQ1 B;  4W9J A;  1GC6 A;  3H1U A;  2Z0D B;  1E7V A;  2IYD B;  4BVU C;  3T3O A;  1JWU D;  3P63 A;  1T0S C;  3BZD B;  3NHE B;  1TS5 A;  1F52 A;  4EZL A;  4JPS A;  3ZTD A;  2K25 A;  4E3C A;  2D3C A;  2N7J A;  5D3D A;  4ZRQ A;  5EE3 A;  4AWJ A;  4F7Z A;  3HM3 A;  3APC A;  3HIZ A;  3H6N A;  4B0E A;  4W9C A;  1WXA A;  3GB1 A;  3WCQ A;  5HKH A;  2D10 A;  2MRP A;  2WDV B;  1ISN A;  4OZC A;  2XEW A;  2HTM E;  1EUV B;  4WWM A;  1GB4 A;  2FCQ A;  3QQ8 B;  2KXJ A;  3AXC A;  2WLB A;  1ZE3 D;  3O65 B;  2DZJ A;  1B1Z A;  3PPA A;  4K3B A;  3V60 A;  1FXA A;  2WXK A;  2IO2 B;  1STE A;  4HLE A;  3Q8E A;  2FBW B;  3RMK C;  4WWP A;  1L4D B;  4LJP B;  4HRO A;  4HPL B;  3QC8 B;  4US9 A;  1WJU A;  3GE3 C;  1XF5 L;  3Q8A A;  2V3P A;  1WXM A;  3EUB 2;  3IXS A;  1OQY A;  4M01 A;  3CIR B;  3KWL A;  4ZHO A;  4ZYS A;  1NI3 A;  4EUT A;  2N9K A;  2D07 B;  3N30 A;  3T3N A;  3AE9 B;  3Q2A C;  4DHZ B;  1YD8 U;  3NZS A;  2WXJ A;  4MJS B;  3QJZ A;  1Z5S B;  3NS1 A;  1SE2 A;  4S0R A;  3LYY A;  3UIN B;  1WJN A;  5FR6 A;  1OQQ A;  2QIL A;  4M02 A;  2MBE A;  1L2N A;  2R2O A;  2INC C;  1WIA A;  4HCN B;  4BOZ B;  2QDF A;  4OZB A;  2IGH A;  3U4E G;  4A55 A;  1SBB B;  3U8Z A;  1S3S G;  2G3Q B;  2LJI A;  1UWX A;  1YN3 A;  1WE7 A;  1F9J A;  3K9O B;  4EFO A;  1ET9 A;  2GBK A;  2DWQ A;  2XBB C;  5BYR A;  2R2Q A;  2WDT B;  3VQI A;  2ZJD A;  1WYG A;  3TEY A;  3BVZ A;  4IUM B;  5J18 A;  1K50 A;  3UGB B;  1L5P A;  2ZW1 A;  5AUK A;  3HRD D;  1WXS A;  4FHJ A;  4IG7 B;  4URK A;  3VXW A;  4NQK E;  4RM9 A;  1UF0 A;  4ANU A;  2M1M A;  1SIF A;  1WI0 A;  4WH4 A;  2N1V A;  4W9H A;  3HUI A;  3AEC B;  2KQ4 X;  3N1Y C;  2LGI A;  1WX7 A;  1XLN A;  2B76 B;  2RDH A;  1WR1 A;  1HXY D;  3KVF B;  1E5W A;  2LI5 A;  2YLM A;  4ZRP A;  1D4B A;  5IP4 D;  4RF1 A;  1KJT A;  4P16 A;  2N9X A;  3ZRF A;  3NUH B;  1BML C;  1PGB A;  2ASQ A;  2BGF A;  1ZP0 B;  3DBS A;  4IOI E;  3RT3 B;  2KJH B;  4GXB A;  4DQO C;  3HHM A;  3MFG A;  2OHF A;  1R4N I;  4II2 B;  1P7F A;  2LVP A;  1R4M B;  1DYQ A;  2HD5 B;  3BK1 A;  3TIX A;  4DHJ D;  4OVV A;  3APD A;  2PVG C;  2NR2 A;  2WYQ A;  2G1E A;  2FCM A;  4LNK A;  2NVU I;  4XX5 A;  3PZ7 A;  1C78 A;  3UIO B;  3AE5 B;  4GLS C;  4FJY A;  5FKA C;  1EWY C;  2KDI A;  3SHQ A;  2GRI A;  3AE6 B;  2QMT A;  4WWN A;  2Z59 B;  2FCS A;  2LXC A;  4A6Q A;  2NTT A;  2WDR B;  1EO6 A;  3M63 B;  1K52 A;  1ZKH A;  4BZA A;  2KTR A;  4ITK A;  4MDK E;  2PE9 A;  1AYF A;  1KM7 A;  1TKY A;  2LAS A;  1FNW A;  3TCA A;  4KIK A;  2J7Q B;  4AJY B;  3DVG Y;  2PIA A;  2AYO B;  5D3I B;  2L3Z A;  3DQV A;  5BMI A;  4C7Z A;  1V1O A;  1WZ3 A;  3ZW3 A;  5EDS A;  2AEH A;  1FFU A;  2A5U A;  3LXF A;  1I4H A;  1YOV B;  3MJ5 A;  3AEF B;  3MHZ A;  1MG8 A;  4ZYN A;  3DHI C;  2GI9 A;  2IBI B;  1GC7 A;  2FAZ A;  2NCN A;  2MHJ A;  2JSV X;  1KLU D;  1WMH B;  3SR6 A;  3TMP B;  1E8W A;  3MJW A;  5BYQ A;  3W5V B;  1FMA D;  2ZNV B;  1WF9 A;  1F0Z A;  4F1S A;  1WXV A;  5BMG A;  4L2Y A;  2DHZ A;  2RSU A;  3PZ8 A;  3EC8 A;  3PHX B;  1YX5 B;  4IKG A;  2D2Q A;  2GBJ A;  2IO0 B;  2J0J A;  2YVC A;  2BTE A;  1VR9 A;  5DPS A;  2MBH A;  2AX5 A;  1UNS A;  1ENF A;  4LCD E;  1SB3 C;  3PV1 A;  1EU3 A;  3A9K B;  4RNA A;  2KDE B;  3WAM A;  4HRS A;  1PYW D;  2BQQ A;  2SAK A;  1QF6 A;  3UQB A;  1VLB A;  2JZP A;  1NVI D;  5DPW A;  3Q3M C;  1UZX B;  3W1S A;  5FK9 C;  3R7R A;  3CF6 E;  1YX6 B;  3A4S C;  3DBR I;  1GPX A;  4CO7 A;  2NBW B;  4AOF A;  4ZRI A;  1FRD A;  3VFK A;  3VR8 B;  4RGO S;  1I7H A;  5DPT A;  1QOA A;  3EHV A;  5DCN A;  1QOG A;  3PRZ A;  4LDT B;  1K51 A;  2WXN A;  3GS2 A;  5HG2 A;  2Y5C A;  2BWF A;  2I38 A;  2JU6 X;  2CKH B;  3RNF C;  5E6O A;  1KTK A;  2G4S A;  4HPM B;  4HVB A;  3VUW A;  2XK5 A;  2N4F A;  4ANV A;  3C8Y A;  1ZW7 A;  3DBH I;  2KN5 A;  3DVN U;  5G55 A;  2FCN A;  3QK0 A;  5LXI B;  3N3K B;  1IGD A;  4C4V B;  1SGH A;  1V86 A;  2LHE A;  3KLS X;  3W1Y A;  1A5R A;  1YIW A;  3KYD D;  3IT6 B;  4MH0 E;  2MBO A;  4NY0 A;  3EEC A;  4RGM A;  2DZK A;  3A9J B;  1T3Q A;  4KKJ A;  1XEE A;  2JY6 A;  2HJ1 A;  2R61 A;  2LVO A;  5IKC M;  2JQR B;  2L52 A;  4NJ7 A;  3B2F A;  3BK2 A;  2ZPY A;  1UBI A;  2FUH B;  4WJQ A;  3VUX A;  2BF8 B;  2V4L A;  5C1Z A;  2ONQ A;  1E6E B;  1UD7 A;  2O6V D;  4L23 A;  2K39 A;  1X1M A;  4AP4 C;  3SU8 X;  2KWD A;  1WRI A;  3QAQ A;  1DOY A;  1GAQ B;  3VH3 B;  2W54 A;  1F2R C;  4XE0 A;  1UGM A;  3PVL A;  2DYO A;  2ZNV C;  1Q1O A;  1P3Q U;  4JWU C;  2KK8 A;  3Q14 C;  3PRE A;  1OFF A;  4K7W A;  4NAM A;  2KTF A;  4NPN A;  1RFA A;  2OED A;  3ZGZ A;  2D11 A;  2WU2 B;  1GNU A;  1VJK A;  3PO0 A;  2CHW A;  1GG3 A;  1NEK B;  1Y8R C;  3GZN B;  3VVW B;  4BKG A;  2C7N B;  2W55 A;  1EWC A;  3TUO A;  4TKN A;  3R66 C;  5D94 A;  2K22 A;  1GUA B;  2BYE A;  4REZ A;  1QKZ A;  3QAR A;  4MGY E;  1VCB A;  3HVD A;  3W5U B;  1UUP A;  2LGS A;  5LNK 1;  3TSS A;  4HK2 A;  3EGR A;  3V3X A;  3TEX A;  3PGE A;  2JF5 A;  3LJ3 A;  2L1A A;  1WR6 E;  1I4P A;  2BKR B;  4XC2 A;  1JWS D;  3DWG C;  4M00 A;  4RGT A;  2D3G A;  1VDV A;  2IGG A;  2J53 A;  4A90 A;  4D2K A;  1HZ6 A;  4M0W B;  5J2R A;  3B0A A;  3Q6B A;  3FC4 A;  1MFW A;  4MGK E;  2CR5 A;  3RD2 A;  1E9M A;  1IBX B;  3ZJV A;  4BFR A;  2KQS A;  3L13 A;  1N62 A;  2LGD A;  3K9P B;  4E74 A;  3KW5 B;  4KZ0 A;  2N7E A;  1FCL A;  2V3N A;  2V9H A;  4HCP B;  1E7U A;  5CX3 A;  1AW7 A;  2GB1 A;  2WXR A;  1WM3 A;  1ET6 A;  4GU2 A;  3J9C A;  1J7A A;  2J0K A;  3ABV B;  3DPD A;  1N5X A;  3Q8C A;  4GDK B;  2QJL A;  4FJV B;  5AZH A;  2MQJ A;  3VAW A;  5LLI A;  2ZVO A;  2MW5 A;  2LGY A;  3AMZ A;  4XDD A;  1V49 A;  4BKT A;  1C4A A;  1FNU A;  3NVV A;  3TJP A;  3SEB A;  1Q10 A;  1EU4 A;  3NZU A;  1TGZ B;  2BYT A;  4G3X B;  3IVF A;  4K81 A;  3JSV A;  3RN9 C;  2KJR A;  1GJZ A;  3L54 A;  4K3C A;  1TBE A;  2M19 A;  1JWM D;  4G11 A;  4W9I A;  2INN E;  4IWO A;  3QWZ B;  1NYQ A;  3ZNI D;  4CYE A;  1T0Q C;  5C23 A;  2E6X A;  1I4R A;  3ZO5 B;  1J0G A;  2O2V B;  2ZW0 A;  2H88 B;  1YQ4 B;  2AL3 A;  2IND C;  4ZHP A;  1JRO A;  4M8N A;  2BKF A;  2X38 A;  3V05 A;  4N59 A;  4M8M A;  5LXH A;  3MC8 A;  2XN9 C;  4OW0 A;  1B9R A;  4FAD A;  4B6W A;  2MH7 A;  4MH8 A;  2KC1 A;  3BIN A;  3L08 A;  3PRP B;  3UF8 A;  5E6N A;  1C76 A;  3CSF A;  3UI3 A;  3BII D;  4PS8 A;  1TTN A;  3VR9 B;  4WWO A;  4AUQ C;  1AWD A;  1SIJ A;  3LB8 C;  1FXT B;  3H7P B;  1WE6 A;  1Q5W B;  1NBF C;  4ASW C;  2KQ7 A;  3DCG A;  1L6U A;  3BY4 B;  3KWV A;  3L4P A;  3R2T A;  3P1M A;  4EEW A;  2KFK A;  3NRZ A;  1KH0 A;  1F77 A;  3M62 B;  3L16 A;  4JIO U;  1XCT L;  2C5L C;  3I63 C;  4FBJ B;  4MGZ E;  1JCK B;  1TY0 A;  5L83 A;  1DGJ A;  3ONS A;  3Q3F A;  2D3A A;  2WXL A;  4DHZ E;  4XZ4 A;  1WWT A;  4JX1 C;  2PE6 B;  3I5J C;  3TBL D;  2WHI A;  2PLP A;  1PUT A;  3MHS D;  3V6E B;  3MTN B;  4KKI A;  4ZRK A;  1PQS A;  1ESF A;  2I1J A;  2CS4 A;  4EKU A;  4G50 A;  4US8 A;  1JAL A;  1I4X A;  3L0W B;  4WIP A;  3DDC B;  2BB5 A;  2CU1 A;  3PLV A;  4B0M A;  1KOT A;  3AB5 A;  3Q69 A;  4AJW A;  2BPS A;  1MG4 A;  4IM0 A;  1FIQ A;  3GP7 A;  3TEZ A;  2WP9 B;  1I35 A;  5CHV C;  4TQ0 A;  4IM3 A;  3P4Q B;  1YMH E;  1YJ1 A;  3B1L X;  4PYZ A;  2DAF A;  1XQQ A;  5BYS A;  4C7Y A;  1FM0 D;  2WXP A;  1C9F A;  4DXA B;  4W9L A;  2LHD A;  4KGR A;  3NG0 A;  1WJ4 A;  3FKY A;  1UBQ A;  3Q3N C;  3AEG B;  3N9Y C;  2WXO A;  1YQ3 B;  4TQ1 A;  1IPG A;  2BS3 B;  1RRB A;  4YT0 B;  4C80 A;  2BBC A;  2WXM A;  2J4X A;  1KLV A;  2BWE S;  2Q5W D;  3VRA B;  2MEK A;  3KQ4 A;  4MM3 B;  2C7M B;  3DBL I;  1U4A A;  3OJ4 B;  3JYU A;  1E8Z A;  1UWM A;  4YTP B;  2EMT A;  2NMQ A;  3AH7 A;  3AN1 A;  4NZL B;  5AZG A;  1V6E A;  1C4P A;  1TS2 A;  2KN4 A;  2Z0E B;  5CHW A;  3AM9 A;  2N9P C;  2ICI A;  2FE8 A;  2ZCC A;  4K1R B;  3RNB C;  4RF0 A;  4HDO A;  4WJN A;  2M0A A;  2KVR A;  4DHJ B;  3W2D A;  4ARI A;  4W9D A;  3A4R A;  3R3M A;  3HVZ A;  2H89 B;  4ANW A;  2AQ2 B;  4N58 A;  1T0R C;  1QZE A;  2WWZ A;  4ZDV A;  5G5H A;  1HTO A;  1XLQ A;  2AL6 A;  5H92 C;  1N63 A;  2MP2 B;  3ZXV A;  3RNE C;  5FR3 A;  2V4I B;  3ZNZ B;  2JRH A;  1FFV A;  1JQ4 A;  2M17 A;  3VTW A;  2PVO D;  5EE9 A;  3TL5 A;  2VZK B;  1DOI A;  3M3J A;  4B9K A;  1V97 A;  4HKZ E;  1WZ0 A;  1XCQ L;  1VRA B;  1C1Y B;  1ZXH A;  2N7D A;  1JML A;  2VZK D;  1IYF A;  4OZA A;  1K8R B;  2N9E B;  5E6J A;  1TS3 A;  1N61 A;  3ZKJ C;  2QEJ C;  4A20 A;  2WU5 B;  4YTN B;  1KFY B;  3ZTC A;  1CZP A;  3ALB A;  1RFK A;  2MWS B;  4GSW A;  2FID A;  4J3O D;  1M4V A;  4BKS A;  3A9K A;  4B95 A;  4EZK A;  3AEB B;  4MEM A;  1GOZ A;  2KAC A;  2MBQ A;  2VH1 A;  1EM7 A;  4DDI D;  2BB6 A;  2ACZ B;  4LNO A;  1I4G A;  3RNG C;  4N9F 4;  3AI5 A;  4IWQ A;  4A3O A;  2Y5B B;  1NDD A;  3AE4 B;  2KAJ A;  2JRI B;  1KLG D;  3Q8B A;  3GE8 C;  3ZLZ A;  2LMC A;  4K7U A;  1WGD A;  2PEA A;  3B2G A;  3Q3O C;  4OVU A;  2KTR B;  2KYW A;  3NY5 A;  4G0N B;  3BWU D;  1SE3 A;  1Y56 A;  1F1H A;  1JWA D;  4N6E B;  2KWV B;  4LNI A;  2E3T A;  3U52 E;  2J52 A;  4KGT A;  1RAX A;  3FAH A;  1QT9 A;  2KVZ A;  1SE9 A;  1SE4 A;  4WUR A;  2DLB A;  4IWP A;  5G2N A;  1RWS A;  3NVW A;  3RPF C;  5EE0 A;  2QC8 A;  2G45 B;  3DVG X;  3I57 A;  4CHK A;  1WYW B;  3QA8 A;  1WSP A;  1OEY J;  1P7E A;  4MSM B;  2OJW A;  1VZ6 A;  2IZV B;  4C4V A;  5E6P A;  3VUY A;  4GDL B;  3NVY A;  1YN4 A;  2DZM A;  2KOX A;  4DXF A;  2AQ3 B;  1I4Q A;  3BYT B;  1M94 A;  4S17 A;  4PS3 A;  4C56 C;  4FN2 A;  4QAY A;  1E7P B;  1ZXI A;  3ZJU A;  2WDQ B;  1MI0 A;  3JW0 X;  3BVM A;  1D3Z A;  5JH5 C;  1D6E C;  3VDZ A;  3AE1 B;  5IA7 A;  1WGR A;  2DZI A;  3FIL B;  2RGF A;  1QLB B;  4KSK C;  5IO9 A;  1WM2 A;  1EF1 A;  1D5Z C;  2G4D B;  5IOI A;  4W9E A;  1ZPS A;  3ZUN A;  3HK0 A;  3ECI A;  2W9N A;  2I2Y A;  1J7B A;  2GLS A;  3L10 B;  2FUG 1;  4ICV A;  2L0F A;  3P42 A;  2W82 A;  3WIM A;  1IP9 A;  1YJI A;  1JRP A;  1VD2 A;  3MP9 A;  2JXX A;  2O6V B;  2JPH A;  3QX1 A;  2WXG A;  3E56 A;  2INP E;  1L6V A;  2UU7 A;  4DDG D;  1N6Z A;  1E8Y A;  2C9W B;  1V1P A;  2WX1 A;  3HM6 X;  3NVZ A;  3AE2 B;  2QIE B;  4KVG B;  4ARC A;  1FPY A;  4HPP A;  2IO3 B;  1TZ1 A;  2LEK A;  2CJO A;  3SDL C;  4A3P A;  4P1B C;  4EE2 A;  2K6D B;  3EFC A;  4H2A A;  4KZC A;  1YN5 A;  2X8X X;  3RFZ B;  2XK5 B;  3DVN V;  5AUI A;  3AE8 B;  1YNT E;  2QCZ A;  1MVK A;  3P4P B;  4JE3 B;  5AEK B;  2KC2 A;  4I6N B;  4C00 A;  1C79 A;  2A4Z A;  1SXT A;  3DOW A;  3PRM B;  3A1Q B;  3B08 A;  1T5X D;  2LD9 A;  3P4S B;  1LFD A;  4L1B A;  2L05 A;  1HQR D;  3A33 B;  1QOB A;  1SJH D;  1PGA A;  2NPT A;  3WA0 A;  4LNN A;  4LK0 M;  4OHJ A;  1AAR A;  1HE8 A;  2BYF A;  1BXT A;  4CQN A;  4FXC A;  1G6J A;  3AED B;  2CHX A;  5C2T B;  2MJ3 A;  3PTF C;  2PTL A;  2PPH A;  3LDZ E;  3KH0 A;  2DYB A;  1XLP A;  4WAA A;  5T8I A;  3V62 A;  5D7G A;  5HHD G;  4XDC A;  1TZO A;  4P7I A;  1C77 A;  2LZ6 A;  3N20 C;  3WAN A;  2L7R A;  3TEW A;  1TS4 A;  2K1F A;  2JYT A;  3N1Z C;  2KMA A;  2LGX A;  1QQR A;  2LJ5 A;  1D5X C;  1ZUD 2;  2RMM A;  4PT5 A;  3IFW B;  5H8Y E;  5CTR C;  1EF5 A;  3I9V 1;  1I42 A;  3M95 A;  4HJG E;  2KX3 A;  1KF6 B;  2MSE D;  2EEL A;  4ICU A;  4XWT A;  4XWW A;  2MBB B;  1T0Y A;  2DX5 B;  2Y3A A;  4GIV A;  1V80 A;  2LWP A;  1E8X A;  1R4M I;  3I3T B;  4ZRJ A;  3DHH C;  1SSN A;  3MC0 B;  3W1S C;  2WXQ A;  2HTH A;  2LUE A;  2O2V A;  1K53 A;  2WXF A;  1L4Z B;  3KUC B;  2MJD A;  1ROE A;  3AU5 A;  4HEA 1;  3ENE A;  4X57 B;  1ZGU B;  1YJJ A;  3IAS 1;  3AU4 A;  2KDM A;  1R7S A;  3P4R B;  4LJO B;  3UIP B;  4NAW B;  1BT0 A;  5TR5 A;  2KHW B;  2WXH A;  3AE3 B;  3OG5 A;  4LLG M;  3WAP A;  1WGG A;  3DBR B;  3R2I A;  1TYG B;  1NI2 A;  4FUL A;  4J6I A;  3X0W A;  3CWI A;  3H7P A;  3OLM D;  1LQB A;  2MLB A;  1L7Y A;  2UYZ B;  3VTU A;  2PKO A;  3PS6 A;  2LRW A;  1JWB D;  2RDG A;  5MPO A;  2DEN B;  3AEA B;  5C3J B;  1DOX A;  2KZR A;  2REX A;  4MJS A;  3ZDT A;  1IUE A;  2KNB A;  2C7H A;  1NYR A;  5DPR A;  1OQR A;  4HWI B;  3WAO A;  1XT9 B;  1JW9 D;  4HKQ A;  3DBH B;  2DAJ A;  1TJE A;  3RCZ A;  2BW2 A;  1E90 A;  1F2R I;  3JSV B;  3RYT A;  1TKG A;  2KDF B;  3QHT A;  4MAC A;  2MJE A;  2J0M A;  4YTM B;  2WS3 B;  4GGQ A;  4ACF A;  4YXD B;  4W9F A;  4P1C C;  2GBN A;  1C3T A;  2IPK D;  3O13 A;  1H8C A;  3OJ3 A;  1IGC A;  4RGN A;  2Z8L A;  2JXT A;  1L0X B;  1CQV A;  3OAW A;  1P0R A;  2IDY A;  2W3S A;  4HDQ A;  2IY1 B;  3RZW C;  2DNF A;  4F8C B;  1FD6 A;  2MA9 B;  4R3D A;  4TV3 A;  2ZCB A;  5KHQ A;  2M4N A;  1XLO A;  3URY A;  3IAM 1;  4TSS A;  3V6C B;  3H7S A;  2YEP B;  4HJK A;  2LVQ A;  1LGR A;  3DHG C;  4MM3 A;  2M56 B;  4W9K A;  5AZF A;  3VHT C;  2ON8 A;  2JVC A;  1P1A A;  4DWF A;  2VH2 A;  2EKE C;  1FEH A;  4WJO A;  3ZNG C;  1PFD A;  1TY2 A;  4IW0 A;  2I1K A;  4IC7 B;  1FRR A;  1V8C A;  1WX8 A;  3ZJT A;  2KFK B;  2NTS A;  5G5G A;  1WJ6 A;  2FIF A;  3VH4 B;  5KHO A;  1P9D U;  2RDB C;  2K8B A;  4KDI C;  3P2B A;  4GOC A;  3ZNH B;  2RR9 A;  3IBE A;  4USA A;  1TKE A;  4BOS C;  3ML9 A;  1E10 A;  2MP2 A;  4YWG G;  4A9A A;  2RPQ A;  2GBR A;  4WJP A;  1OGW A;  1PGX A;  1UGJ A;  1A70 A;  1GB1 A;  3SD5 A;  3C19 A;  5D6J B;  3NS8 A;  4KV2 A;  2NBU A;  4II3 B;  4BBN C;  3UQA A;  2LRU A;  3L17 A;  3ZDM C;  3RUI B;  4GMV A;  1SF0 A;  2D5G A;  4LNF A;  4JQW C;  4NQL B;  2JWU A;  1C4C A;  2ZEQ A;  1AN8 A;  2JX5 A;  1WGK A;  2PJH A;  4KSL C;  2GBM A;  3RI7 C;  4NNJ B;  4YL8 A;  5J17 A;  1TIF A;  4ZOH C;  3PZD A;  1HZ5 A;  1MHH E;  1VZ7 A;  2C60 A;  2IO1 B;  2BT6 A;  4RH6 A;  2QHO A;  1XD3 B;  1RLF A;  1D5M C;  3Q3J A;  4DBG A;  4MSQ B;  5TSS A;  1WMH A;  2PMV A;  1OTR B;  2J42 A;  1TT5 B;  3GZN I;  2CHZ A;  3R7Q A;  1J8C A;  1Q0W B;  4P6V F;  2GOW A;  2L00 B;  4O1N A;  2KT7 A;  1ZOY B;  2LXA A; 
#chains in the Genus database with same CATH homology
 4BOZ B;  3ZUN A;  3HK0 A;  3ECI A;  1WM3 A;  3U8Z A;  1S3S G;  2W9N A;  2G3Q B;  4FJZ A;  4GU2 A;  2K6Q A;  3PLU A;  1WE7 A;  1F9J A;  4FLH A;  2ZPN A;  3L10 B;  5L95 C;  2J0K A;  2L76 A;  4ICV A;  2L0F A;  3DPD A;  4HXD A;  3WIM A;  1IP9 A;  4GDK B;  4FJV B;  2L8J A;  1VD2 A;  3K9O B;  2MQJ A;  5AZH A;  4EFO A;  2JZ3 B;  2GBK A;  3WAL A;  3VAW A;  2XBB C;  5LLI A;  3APF A;  2JXX A;  2ZVO A;  2MW5 A;  2LGY A;  2R2Q A;  2WDT B;  2O6V B;  3VQI A;  2JPH A;  2ZJD A;  4TUU A;  3QX1 A;  2KO3 A;  4IUM B;  5J18 A;  1V49 A;  3UGB B;  4BKT A;  4DDG D;  3TJP A;  1E8Y A;  2C9W B;  1WXS A;  3NZU A;  4FHJ A;  2WX1 A;  4IG7 B;  1TGZ B;  3HM6 X;  4G3X B;  3IVF A;  1V81 A;  4URK A;  4K81 A;  2NS5 A;  3VXW A;  3JSV A;  4NQK E;  4KVG B;  3KUZ A;  2IO3 B;  4RM9 A;  2KJR A;  1TZ1 A;  1GJZ A;  2NBV B;  3SDL C;  4ANU A;  3L54 A;  2M1M A;  4A3P A;  1UEL A;  1SIF A;  1WI0 A;  2KFJ A;  4I6P A;  3U30 A;  2K6D B;  2N1V A;  4W9H A;  2EMS A;  1TBE A;  4KZC A;  2XK5 B;  4G11 A;  4W9I A;  4IWO A;  4GDL A;  3QWZ B;  4KDL B;  1WX7 A;  3DVN V;  4DK5 A;  3ZNI D;  4CYE A;  5C23 A;  1WR1 A;  4JLC A;  3KVF B;  4KIK B;  2OJR A;  3ZO5 B;  1J0G A;  2O2V B;  1E5W A;  2KJ6 A;  2LI5 A;  5AEK B;  2YLM A;  2KC2 A;  2AL3 A;  1V5O A;  4I6N B;  3QIJ A;  2AWT A;  1J19 A;  2KAN A;  4M8N A;  2A4Z A;  2BKF A;  3DOW A;  3PRM B;  3A1Q B;  4M8M A;  5LXH A;  3B08 A;  1KJT A;  2LD9 A;  1LFD A;  2N9X A;  2L05 A;  4I6L B;  3ZRF A;  3C0R B;  3A33 B;  4JGH B;  5IAA C;  3D32 A;  2ASQ A;  4B6W A;  2NPT A;  3WA0 A;  4BKS D;  4FAD A;  2BGF A;  3PT2 B;  4RM8 A;  3DBS A;  3RT3 B;  4MEL A;  2KJH B;  1AAR A;  2IY0 B;  4GXB A;  2KC1 A;  3IG3 A;  3BIN A;  3L08 A;  1HE8 A;  4IM2 A;  3ZIM A;  2BYF A;  3HHM A;  3PRP B;  4EOY A;  3UF8 A;  5CHF A;  5E6N A;  1R4N I;  4W9G A;  4II2 B;  1G6J A;  2CHX A;  3ZRC A;  2LVP A;  2KX0 A;  3CSF A;  4PS8 A;  1TTN A;  2HD5 B;  3ML8 A;  3PTF C;  1P98 A;  4WWO A;  4AUQ C;  2PPH A;  3LDZ E;  3TIX A;  3KH0 A;  4DHJ D;  4OVV A;  2DYB A;  3APD A;  4WAA A;  3A9J A;  3V62 A;  1FXT B;  3H7P B;  5D7G A;  2NR2 A;  1LM8 B;  1Q5W B;  1WE6 A;  2WYQ A;  4P7I A;  2FCM A;  1NBF C;  4ASW C;  2KQ7 A;  2LZ6 A;  2NVU I;  2KLC A;  1YQB A;  2O6V A;  3DCG A;  4XX5 A;  3U7D A;  3BY4 B;  3WAN A;  2L7R A;  4EEW A;  2KFK A;  2K1F A;  3UIO B;  2KMA A;  1S1Q B;  2LGX A;  3M62 B;  2LJ5 A;  3L16 A;  4JIO U;  4FJY A;  3H9D A;  2C5L C;  2KDI A;  4FBJ B;  4MGZ E;  3RZF A;  3IFW B;  5L83 A;  3SHQ A;  2JZZ A;  3ONS A;  3KUD B;  2RD0 A;  1EF5 A;  3Q3F A;  5CTR C;  4WWN A;  2Z59 B;  2FCS A;  4LDT D;  2LXC A;  4DHZ E;  1I42 A;  4WQO B;  4XZ4 A;  3M95 A;  2PE6 B;  1WGH A;  4PYU A;  3TBL D;  1EO6 A;  2KX3 A;  2MSE D;  4ICU A;  3MHS D;  3V6E B;  3M63 B;  2MBB B;  3MTN B;  1T0Y A;  2DX5 B;  1ZKH A;  2M8S A;  2KWC A;  4GIV A;  1V80 A;  4ZRK A;  1PQS A;  2I1J A;  5GMV A;  2ZVN A;  2CS4 A;  2KTR A;  3V61 A;  2LWP A;  4G50 A;  1E8X A;  4MDK E;  1R4M I;  2PE9 A;  4EKU A;  3I3T B;  1KM7 A;  4ZRJ A;  3L0W B;  2LAS A;  2KWU B;  3DDC B;  2CU1 A;  3N32 A;  3PLV A;  4KIK A;  3TCA A;  2J7Q B;  3W1S C;  2HTH A;  2LUE A;  2O2V A;  3DVG Y;  3OLM D;  4AJY B;  1KOT A;  3KUC B;  2AYO B;  4FHK A;  3EFU A;  4AJW A;  3AU5 A;  2BPS A;  2L3Z A;  3DQV A;  4IM0 A;  4MGI E;  4FA6 A;  1WZ3 A;  3ZW3 A;  3A1Q A;  1I35 A;  4PS7 A;  5CHV C;  3ENE A;  5EDS A;  4TQ0 A;  4X57 B;  1OEY A;  2AEH A;  1UH6 A;  4IM3 A;  1YJ1 A;  3B1L X;  4PYZ A;  1ZGU B;  2A5U A;  2DAF A;  1XQQ A;  4K7S A;  5JHB A;  4ANX A;  3AU4 A;  4ZYN A;  1MG8 A;  4DXA B;  1V9J A;  3CMM B;  2IBI B;  2JT4 B;  2KD0 A;  3IHP C;  4W9L A;  1GC7 A;  2FAZ A;  2NCN A;  3AUL A;  1Z2M A;  4LJO B;  1WJ4 A;  3UIP B;  4NAW B;  1BT0 A;  4GB9 A;  5TR5 A;  1WMH B;  3CST A;  1UBQ A;  2KHW B;  3T9L A;  3TMP B;  1E8W A;  5BO4 B;  3MJW A;  4E71 A;  4TQ1 A;  3WAP A;  1IPG A;  5D2M B;  3JVZ X;  1WGG A;  1RRB A;  2ZNV B;  1WF9 A;  4RMA A;  4F1S A;  1WXV A;  1WH3 A;  3VTV A;  1KLV A;  2JWZ A;  1NI2 A;  2DHZ A;  2RSU A;  4FUL A;  2BWE S;  3EC8 A;  3PHX B;  1YX5 B;  4J6I A;  3X0W A;  2D2Q A;  2GBJ A;  2IO0 B;  2J0J A;  3H7P A;  2YVC A;  1WY8 A;  1LQB A;  2C7M B;  2MLB A;  2MBH A;  1U4A A;  2V3S A;  3DBL I;  3OJ4 B;  1L7Y A;  5DPS A;  2UYZ B;  3VTU A;  3PS6 A;  4LCD E;  3PV1 A;  2B3A A;  2LRW A;  3T8M A;  3A9K B;  3JYU A;  1E8Z A;  2DEN B;  2EMT A;  2MCN B;  3PSE B;  3NOB A;  2KDE B;  4JL9 A;  4GN1 A;  1V6E A;  2KZR A;  2REX A;  4MJS A;  5AZG A;  3WAM A;  1JRU A;  3X23 A;  2Z0E B;  3ZDT A;  2UWQ A;  2KNB A;  2C7H A;  5CHW A;  3UQB A;  1WGY A;  2JUO A;  5DPR A;  1WRD B;  2N9P C;  4HWI B;  2GMI C;  3WAO A;  2FNJ B;  2ZCC A;  4K1R B;  1XT9 B;  5DPW A;  4HDO A;  1UZX B;  4WJN A;  2KVR A;  2DAJ A;  2KDB A;  4DHJ B;  4W9D A;  3A4R A;  3R3M A;  3RCZ A;  1E90 A;  3W1S A;  1H4R A;  1V2Y A;  3JSV B;  3R7R A;  4BBN F;  3CF6 E;  4ANW A;  3RYT A;  1YX6 B;  4GDK A;  2KDF B;  3QHT A;  2N1W A;  1QZE A;  2KLG A;  2WWZ A;  2KMC A;  3A4S C;  3DBR I;  3GOE A;  4NJ6 A;  4CO7 A;  4ZDV A;  3ZVV A;  2NBW B;  4AOF A;  4ZRI A;  3VFK A;  1WFY A;  2AL6 A;  2J0M A;  2ZZP B;  2BYV E;  5DPT A;  2MP2 B;  2DYM A;  4GGQ A;  1CMX B;  3EHV A;  4W9F A;  5DCN A;  2V1Y A;  2GBN A;  1C3T A;  3ZNZ B;  2K8H A;  1H8C A;  2JRH A;  3PRZ A;  4LDT B;  3OJ3 A;  3PHW B;  2M17 A;  1WX9 A;  2KKC A;  3VTW A;  2WX0 A;  3OAW A;  1P0R A;  2BWF A;  4HDQ A;  2IY1 B;  3TL5 A;  2CKH B;  3RZW C;  4F8C B;  2HE7 A;  4NAW A;  5E6O A;  3M3J A;  2MA9 B;  3RUL A;  4B9K A;  1LXD A;  1WZ0 A;  4TV3 A;  2G4S A;  2ZCB A;  1C1Y B;  2MX2 A;  2N7D A;  4HPM B;  3VUW A;  4HVB A;  5KHQ A;  1IYF A;  2M4N A;  2NPT B;  2XK5 A;  2N4F A;  1K8R B;  2N9E B;  4ANV A;  2HJ8 A;  1ZW7 A;  3DBH I;  3V6C B;  2KN5 A;  3DVN U;  5G55 A;  3ZKJ C;  2FCN A;  3H7S A;  3QK0 A;  4A20 A;  5LXI B;  3N3K B;  3ZTC A;  4HJK A;  2LVQ A;  3ALB A;  3QCA A;  1V5T A;  2MWS B;  4GSW A;  1SGH A;  1V86 A;  4MM3 A;  4W9K A;  2K8C A;  5JZE B;  5JHA A;  5AZF A;  3VHT C;  1A5R A;  2L0T A;  3W1Y A;  1YIW A;  2JVC A;  3KYD D;  4MH0 E;  1P1A A;  2FID A;  2MBO A;  4DWF A;  2EKE C;  4NY0 A;  4BKS A;  3A9K A;  4WJO A;  4B95 A;  3ZNG C;  4EZK A;  3EEC A;  3S2A A;  2DZK A;  2OOB B;  4EZJ A;  4IW0 A;  2I1K A;  3A9J B;  2VRR B;  4MEM A;  2JY6 A;  2MBQ A;  4IC7 B;  4DDI D;  2LVO A;  4NJ7 A;  1WX8 A;  2M0X A;  2ZPY A;  1UBI A;  2FUH B;  4WJQ A;  3KYC D;  3VUX A;  2KFK B;  2BF8 B;  2V4L A;  5C1Z A;  4N9F 4;  4W9J A;  1GC6 A;  3H1U A;  1UD7 A;  3AI5 A;  2Z0D B;  2O6V D;  4IWQ A;  2K39 A;  4A3O A;  1E7V A;  2Y5B B;  1X1M A;  2IYD B;  4AP4 C;  3SU8 X;  4BVU C;  1NDD A;  1WJ6 A;  2FIF A;  3VH4 B;  5KHO A;  3NHE B;  2JRI B;  1P9D U;  3QAQ A;  2K8B A;  3VH3 B;  4KDI C;  3ZLZ A;  3P2B A;  4EZL A;  3ZTD A;  2K25 A;  4E3C A;  4K7U A;  1UGM A;  3PVL A;  2DYO A;  2ZNV C;  1Q1O A;  1P3Q U;  4GOC A;  1WGD A;  2PEA A;  2RR9 A;  3IBE A;  2KK8 A;  3ZNH B;  4AWJ A;  4F7Z A;  3HM3 A;  3PRE A;  4OVU A;  4BOS C;  3ML9 A;  4K7W A;  2KTR B;  3APC A;  2KTF A;  4NPN A;  2MP2 A;  3HIZ A;  3NY5 A;  1RFA A;  3H6N A;  4G0N B;  2RPQ A;  2D11 A;  1WXA A;  4W9C A;  2GBR A;  2KWV B;  4WJP A;  1OGW A;  5HKH A;  2D10 A;  1GNU A;  2MRP A;  1RAX A;  1ISN A;  2CHW A;  1GG3 A;  2XEW A;  1Y8R C;  1SE9 A;  3SD5 A;  5G2N A;  1EUV B;  4IWP A;  3VVW B;  5D6J B;  2FCQ A;  3QQ8 B;  4BKG A;  2KXJ A;  3NS8 A;  2C7N B;  4KV2 A;  2NBU A;  4II3 B;  3R66 C;  4TKN A;  5D94 A;  4BBN C;  2G45 B;  3AXC A;  1GUA B;  2BYE A;  3UQA A;  2LRU A;  3O65 B;  3L17 A;  3ZDM C;  3RUI B;  2DZJ A;  3DVG X;  3QAR A;  4CHK A;  4MGY E;  4GMV A;  3PPA A;  1WYW B;  1VCB A;  3QA8 A;  4JQW C;  4NQL B;  3V60 A;  1OEY J;  2IO2 B;  4MSM B;  4HLE A;  2ZEQ A;  4HK2 A;  2IZV B;  2PJH A;  3PGE A;  4KSL C;  5E6P A;  2GBM A;  2JF5 A;  4WWP A;  3VUY A;  4GDL B;  3LJ3 A;  4LJP B;  4NNJ B;  1WR6 E;  4YL8 A;  5J17 A;  2BKR B;  2DZM A;  2KOX A;  4XC2 A;  4HPL B;  3PZD A;  3QC8 B;  2D3G A;  1M94 A;  1WJU A;  4M0W B;  2C60 A;  2IO1 B;  4PS3 A;  1WXM A;  4FN2 A;  5J2R A;  1OQY A;  3B0A A;  3JW0 X;  2QHO A;  1XD3 B;  4MGK E;  1RLF A;  1D3Z A;  2CR5 A;  3Q3J A;  5JH5 C;  4DBG A;  4MSQ B;  3RD2 A;  3VDZ A;  5IA7 A;  1WMH A;  4EUT A;  1OTR B;  2D07 B;  3N30 A;  4DHZ B;  1WGR A;  1YD8 U;  2DZI A;  3GZN I;  2CHZ A;  3NZS A;  2RGF A;  4MJS B;  4BFR A;  3R7Q A;  2KQS A;  3L13 A;  2LGD A;  3QJZ A;  3K9P B;  1Z5S B;  4E74 A;  4KSK C;  1J8C A;  3KW5 B;  4KZ0 A;  1Q0W B;  1WM2 A;  2N7E A;  3UIN B;  2GOW A;  1EF1 A;  1WJN A;  1E7U A;  4HCP B;  2L00 B;  5CX3 A;  5FR6 A;  2G4D B;  2MBE A;  4W9E A;  1L2N A;  2R2O A;  1WIA A;  4HCN B;  2LXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...