4KDLB

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
69
Chain Sequence
SMKLKVTGAGINQVVTLKQDATLNDLIEHINVDVKTMRFGYPPQRINLSLGQTQLDELGINSGEKITIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 15
structure length 69
sequence length 74
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kdlB00
4W9JA 3ZNID 2IY0B 1XQQA 4PS8A 2V4LA 2NPTB 4GN1A 4MGYE 4P7IA 1VCBA 2KX3A 3ENEA 4MGKE 3U8ZA 1CMXB 3QARA 4GOCA 2GBMA 2JZZA 2HTHA 2NBUA 3Q3FA 3VH4B 2KTRB 4NQLB 2KNBA 5D2MB 2RR9A 2G45B 2HE7A 2Z0EB 2BKRB 4BBNC 2I1JA 4ICUA 2IO2B 2UYZB 4EOYA 2L0FA 2C60A 2JWZA 2IZVB 3Q3JA 1J8CA 3HIZA 3LDZE 3EHVA 4KDLB 3QCAA 3V61A 4TQ0A 2ZCCA 3GOEA 2NPTA 2MSED 4BFRA 2WX0A 5KHQA 2PEAA 4E71A 4NY0A 2YLMA 1OGWA 1WM3A 3ALBA 3EECA 3B0AA 3PTFC 2D3GA 3SD5A 3PRZA 4IWOA 2ASQA 2M4NA 3DBHI 3IFWB 1OQYA 4WJNA 4ZYNA 4BKGA 2DZJA 4KIKA 2FAZA 2V1YA 3EC8A 2LVPA 3QAQA 4B95A 1KOTA 2IO0B 1V5TA 1WGRA 2AL3A 2L0TA 1NI2A 3NS8A 2BWFA 2I1KA 3SHQA 1LQBA 4GIVA 1AARA 4GGQA 3WAMA 2L8JA 2MBHA 3AU4A 4ANUA 4ZRIA 3KUDB 1WR1A 3A9KB 1WX7A 4HLEA 2AYOB 1FXTB 3A4RA 2MCNB 2LVQA 3RCZA 1F9JA 1D3ZA 1WZ0A 1WXAA 1WJ6A 2KHWB 2PJHA 3PPAA 1WMHB 2FIFA 2D2QA 3DBRI 4WJPA 1WIAA 1Q0WB 1XD3B 3WIMA 3ZRFA 2QHOA 2KO3A 2KFKA 2KMAA 4IM2A 4ANWA 5LXIB 3M62B 2XK5B 2KQ7A 1SE9A 4BOSC 2K6DB 1WY8A 2REXA 4ZRKA 4MSMB 4PYZA 4IG7B 4AP4C 5IA7A 5JHBA 2BPSA 2IYDB 4W9FA 1GUAB 2MP2B 5CX3A 3V62A 3TJPA 4HXDA 1V2YA 3A1QB 3UGBB 3PRPB 3DVNV 4RM9A 2ZJDA 2WYQA 2DYBA 3HHMA 1UD7A 2WDTB 2N9EB 1ZKHA 2C7MB 2O6VB 3H9DA 4URKA 2OOBB 4G0NB 1UBQA 2Z0DB 4WJOA 3WALA 2FUHB 2FNJB 4OVUA 1WYWB 1E5WA 2C7NB 3C0RB 3JW0X 4TKNA 3A9JB 2LGDA 3A4SC 2KJ6A 2XK5A 2N1WA 4HPMB 1T0YA 1E7VA 3S2AA 4GDLB 3NZUA 5JHAA 3U30A 1WI0A 5DPWA 4CHKA 1P98A 2M0XA 1HE8A 3M63B 2BKFA 3NZSA 4TUUA 3L0WB 1EF1A 3TIXA 1IYFA 2DENB 4AWJA 3VTUA 4M0WB 3TL5A 4J6IA 4BOZB 3ZVVA 3ZRCA 1WM2A 3VUYA 2KC1A 1V6EA 4ICVA 2CHZA 2HJ8A 4MDKE 3VDZA 1WR6E 2EMSA 4PS3A 2LRWA 2O2VB 4HWIB 2CHXA 3ECIA 2KFJA 2CS4A 3BINA 5E6OA 3TBLD 2N7EA 4EFOA 1KLVA 1R4NI 4FHJA 2JRHA 3JVZX 5TR5A 3SU8X 3DVGX 4IWPA 4AJYB 4ASWC 4IW0A 3HM6X 1U4AA 4XC2A 3GZNI 1TZ1A 3APDA 2JVCA 2K8HA 2CR5A 2BGFA 1L7YA 2JZ3B 3DVGY 2RSUA 3PS6A 3VUWA 5CHFA 3OJ3A 2KANA 1K8RB 1NBFC 3ZIMA 2KJRA 4JQWC 3JYUA 4FULA 2BYEA 1WGDA 3PLVA 2GBNA 2LXCA 5L95C 2O2VA 5HKHA 2B3AA 2N1VA 5DPRA 5DPSA 1E7UA 3L08A 1GC6A 1UBIA 2J0JA 4FLHA 3KUZA 2KDBA 3QC8B 5KHOA 5LXHA 3VAWA 3TCAA 5E6PA 1UZXB 4IM0A 2JT4B 4KIKB 4KVGB 1LFDA 3RUIB 5JZEB 3M95A 3T8MA 3ZDTA 3ZDMC 4HPLB 2DYMA 1OTRB 3QX1A 2M8SA 4FJZA 2J0KA 4XX5A 3D32A 1WF9A 1C3TA 4MM3A 4NJ7A 3UIOB 1WJ4A 3ZTDA 1Y8RC 4XZ4A 4W9DA 1WFYA 2GBKA 3NOBA 3VXWA 2N7DA 2LD9A 2N4FA 4DXAB 2JPHA 1YJ1A 1P9DU 2AWTA 2DX5B 2YVCA 4GMVA 4IWQA 2KJHB 3N30A 3O65B 3P2BA 3NHEB 2K8CA 1WXVA 5J18A 2K39A 4EZJA 4HK2A 4YL8A 2LJ5A 3T9LA 1RRBA 4FA6A 1OEYA 1P3QU 3KH0A 4KSKC 4LDTB 4WAAA 3CF6E 3CSTA 2KFKB 2IBIB 1R4MI 5G2NA 2HD5B 2KN5A 1I42A 2L05A 5EDSA 4PS7A 3KYDD 3L17A 4W9EA 4NJ6A 1GNUA 3HK0A 5LLIA 3IVFA 2KWCA 4GDKA 3ZKJC 3K9OB 3ZO5B 4M8NA 4CYEA 1EF5A 1PQSA 4W9HA 3ZNGC 3MHSD 2ZPNA 4W9KA 3DQVA 4K81A 2LZ6A 5C1ZA 2D11A 2XEWA 2ZVNA 4W9LA 4HDQA 4G11A 2KD0A 4ANVA 4FHKA 1Z2MA 2FCSA 1UH6A 3L54A 2NS5A 2D10A 4FJYA 2K6QA 2KMCA 4DHJB 4G3XB 3I3TB 4K7WA 1H4RA 2CKHB 2BYFA 4A3OA 3QJZA 2CHWA 3RULA 4B6WA 3VTVA 3PV1A 4DWFA 3N32A 3IHPC 4IC7B 1UGMA 2ZPYA 1IPGA 3PHWB 3W1SA 3ONSA 1P1AA 2KDEB 3L16A 4M8MA 2KWVB 2Y5BB 4FN2A 2KWUB 1J19A 2DZMA 1WJUA 3R3MA 4A20A 2ZNVC 4MGIE 3DDCB 4W9GA 5G55A 4E3CA 4KDIC 2L7RA 3V6CB 2G4DB 1YD8U 2ZZPB 2ZNVB 4E74A 1GC7A 3DBSA 2FIDA 1V5OA 4ZRJA 1WGYA 3N3KB 3UINB 4GB9A 3X0WA 4X57B 1V9JA 1Q1OA 1RFAA 4F7ZA 1EUVB 4RMAA 3IBEA 3EFUA 2NCNA 2AL6A 3R7QA 5J17A 4BBNF 2DAJA 3H6NA 4DHZB 2IO1B 3PHXB 4N9F4 3R66C 2DAFA 2A5UA 2KDIA 4G50A 4IM3A 1X1MA 1WX8A 4I6LB 4HJKA 2FCNA 3WAPA 1WXMA 2GMIC 3ZNHB 2MBBB 4BVUC 2R2OA 3M3JA 2GBJA 3PLUA 3PVLA 4EZKA 3APCA 2PE6B 4K1RB 2JUOA 1LM8B 3ML8A 2C7HA 4DHJD 4ZDVA 2FCMA 2DZKA 4HCNB 2CU1A 3QIJA 1GG3A 1WGGA 1XT9B 2PE9A 2KXJA 1I35A 3IG3A 1SGHA 3VQIA 4BKSD 5C23A 3L10B 3AI5A 3NY5A 3PRMB 1L2NA 3PSEB 3BY4B 2MX2A 3VHTC 2KQSA 2N9XA 1VD2A 3OJ4B 4II3B 2O6VD 3ZLZA 1E8WA 1YX6B 4LJPB 4A3PA 3PT2B 4EUTA 3ZTCA 3CMMB 3ZUNA 3JSVB 2LRUA 4K7UA 3H7PA 2NBWB 2KC2A 3OAWA 3X23A 2BWES 4AOFA 3PZDA 4KV2A 3AU5A 3DVNU 1KJTA 2UWQA 4I6PA 1ISNA 1TBEA 2RPQA 2XBBC 3KW5B 5CHVC 3RD2A 4AJWA 2WX1A 1BT0A 4GDKB 4DBGA 1YQBA 3MJWA 2J7QB 4MJSA 3W1YA 2PPHA 4EKUA 1EO6A 3QWZB 5CHWA 2MLBA 2MQJA 2JY6A 1WX9A 3JSVA 4RM8A 5AZFA 1WGHA 3ZNZB 2DYOA 2GBRA 4NQKE 5AEKB 4MGZE 2MBQA 1TGZB 3KUCB 3SDLC 2IY1B 3QQ8B 5GMVA 3UQAA 1V81A 2BF8B 1P0RA 3QHTA 4MEMA 3LJ3A 4B9KA 2JF5A 2LASA 2WWZA 2DHZA 3AXCA 3U7DA 4HVBA 2KX0A 3VFKA 5D94A 3W1SC 2W9NA 2KZRA 2LWPA 5DCNA 5L83A 5AZHA 2K8BA 1A5RA 4KSLC 2LXAA 5DPTA 2ZCBA 3UIPB 1V80A 4WWOA 4FJVB 2KTRA 3APFA 1J0GA 5CTRC 1ZGUB 1SIFA 1Z5SB 2LI5A 4TV3A 1H8CA 3ML9A 3QA8A 3WANA 5FR6A 2C9WB 5D6JB 1Q5WB 3V6EB 4CO7A 1OEYJ 4KZCA 1G6JA 2LGYA 5E6NA 4JIOU 3B08A 2K1FA 4JL9A 4MH0E 2KOXA 2K25A 1RLFA 2A4ZA 3WAOA 1S1QB 2MW5A 1V49A 2Z59B 1LXDA 1E8XA 1UELA 2MA9B 2L3ZA 3RZWC 3RYTA 4K7SA 4LDTD 2FCQA 2G3QB 1NDDA 1WE6A 3WA0A 4WJQA 4KZ0A 4AUQC 3UQBA 3UF8A 4DK5A 1ZW7A 1V86A 2BYVE 2EMTA 2MBEA 2NVUI 2MRPA 1RAXA 3VTWA 2J0MA 2KVRA 3ZW3A 4GU2A 4WQOB 4NNJB 1YX5B 2KKCA 1WE7A 2N9PC 4MELA 3A9KA 4WWNA 1WJNA 3VVWB 4EZLA 2NR2A 1E90A 1YIWA 2R2QA 4BKTA 2ZVOA 2OJRA 2M1MA 2RD0A 2G4SA 3MTNB 3B1LX 2KK8A 4HDOA 4W9CA 1WMHA 4NAWB 4II2B 1WXSA 4JLCA 1IP9A 4JGHB 4TQ1A 3K9PB 3L13A 4FADA 3DCGA 3DOWA 4LCDE 1WH3A 1E8YA 3DPDA 2MWSB 2RGFA 3H7PB 2VRRB 5IAAC 3PREA 1S3SG 2KLCA 4HCPB 2JXXA 3A33B 1TTNA 4NPNA 4PYUA 3HM3A 2MP2A 2NBVB 3CSFA 4EEWA 3KVFB 3RT3B 4FBJB 2LVOA 3A1QA 4IUMB 5J2RA 2M17A 2ZEQA 4BKSA 3TMPB 2MBOA 5AZGA 1MG8A 5JH5C 5D7GA 2AEHA 4MSQB 5BO4B 2LUEA 1JRUA 4OVVA 2O6VA 4WWPA 4ANXA 4GXBA 2EKEC 4DHZE 2KDFB 3KYCD 4MJSB 2C5LC 4NAWA 3DBLI 2GOWA 2KLGA 2IO3B 1QZEA 2V3SA 2LGXA 3A9JA 4LJOB 1WRDB 3VUXA 1WZ3A 1C1YB 2DZIA 4GDLA 3OLMD 2JRIB 4W9IA 3RZFA 1M94A 3QK0A 3H1UA 4DDGD 1KM7A 3AULA 3H7SA 2KTFA 4DDID 1GJZA 2L00B 1E8ZA 3V60A 4F8CB 2D07B 2L76A 4I6NB 3R7RA 4F1SA 3VH3B 4GSWA 3PGEA
chains in the Genus database with same CATH superfamily
4C80A 1AN8A 3ZNID 1VZ6A 2IY0B 4MGYE 4Q2JA 2IPKD 3U8ZA 1TKGA 2JZZA 2HTHA 1AWDA 3Q3FA 1DOIA 5JXVA 2KTRB 4NQLB 2BKRB 4XYCA 2C60A 1IBXB 3Q3JA 1J8CA 3HIZA 4KDLB 1MHXA 2NPTA 2WX0A 4ZHOA 5KHQA 4E71A 2YLMA 3EECA 3B0AA 3PTFC 3PRZA 3DBHI 3GE8C 3TEYA 2FAZA 2M0AA 3V3XA 3NS8A 1TS4A 3BZDB 4GIVA 2W55A 1TKEA 1WR1A 2AYOB 2LVQA 1F9JA 1WXAA 2D3AA 1WMHB 3NZ3A 3DBRI 1WIAA 1XD3B 4IM2A 2WHIA 2XK5B 1YJJA 2KQ7A 1SE9A 2REXA 4ZRKA 4IG7B 2BPSA 2IYDB 5BMIA 4K3BA 2MP2B 3AEFB 3A1QB 3UGBB 3PRPB 2KT7A 2PMVA 2DYBA 3HHMA 2N9EB 1ZKHA 2OOBB 1UBQA 2Z0DB 4OVZA 4WJOA 1OFFA 3WALA 4OVUA 1WYWB 2C7NB 2QC8A 4TKNA 2LGDA 3ZJTA 4HPMB 3I9V1 3S2AA 3N9YC 5JHAA 4NAMA 1WI0A 1V1PA 4TUUA 1IYFA 2DENB 2VZKD 4M0WB 4J6IA 2B76B 4MDKE 2HJ8A 2XN9C 1NYRA 2CHXA 3ECIA 1TIFA 1R4NI 2JRHA 4IWPA 2MJDA 1K50A 4LTUA 3P4RB 1L7YA 2JZ3B 3DVGY 3PS6A 5FK9C 3T3OA 2LHDA 1L5PA 3BWUD 3OJ3A 1NBFC 3ZIMA 4FULA 1WGDA 3PLVA 3MC9A 2O2VA 3KLSX 3C8YA 5DPSA 3L08A 4LLGM 2J0JA 3KUZA 3RPFC 2KDBA 3TCAA 2GRIA 3RNBC 1E6EB 4IM0A 2JT4B 4KIKB 4KVGB 1MFWA 2NTTA 2W82A 1OTRB 1WF9A 3AH7A 1NYQA 3ZTDA 1TYGB 4M00A 2GBKA 3VRBB 3NOBA 3VXWA 2N7DA 4PT5A 2JPHA 2KYWA 4GMVA 2YVCA 1F2RC 3O65B 2WDQB 1WXVA 4FA6A 1P3QU 4KSKC 3KH0A 4ACFA 4WAAA 1E10A 2I38A 3CF6E 3WCQA 2KFKB 2IBIB 2DNFA 2KN5A 1L0XB 4B0EA 1I42A 3KYDD 4W9EA 1GNUA 2KWDA 3IVFA 4LNFA 4L1BA 3ZO5B 2ACZB 1EF5A 4W9HA 4W9KA 4O1NA 1AYFA 2MHJA 2LZ6A 5C1ZA 2D11A 2XEWA 2ZVNA 3GZNB 1FCCC 4WURA 4N6EB 1RWSA 2HTME 3P42A 4FHKA 1ZXHA 2FCSA 2NS5A 3HVZA 2KMCA 2R61A 2CKHB 2BYFA 4A55A 3QJZA 4YSYB 3VTVA 2PKOA 1L0VB 1UGMA 2JYTA 2WP9B 2KDEB 3L16A 3MFGA 3RMKC 2KWVB 2KWUB 1J19A 4MGIE 4W9GA 5IKCM 4KDIC 1YD8U 3NS1A 3MP9A 3DBSA 4MH8A 4GB9A 3X0WA 1V9JA 1EUVB 4RMAA 4RFBA 2NCNA 1PYWD 1PDXA 2TSSA 4CQNA 3IT6B 2IO1B 2DAFA 4G50A 1BUIC 4BVUC 3B2FA 3M3JA 4EZKA 2PE6B 4K1RB 2C7HA 4YSZB 1ZDVA 1E0ZA 3NG0A 1N61A 1WGGA 1TS5A 1XLNA 3AE6B 3L10B 3PRMB 4MM3B 3PSEB 2J53A 3VHTC 3AE2B 5IO9A 2O6VD 4EUTA 3PT2B 3CMMB 3T3NA 3ZUNA 3JSVB 4DXFA 4K7UA 1RYJA 1J7AA 2BWES 3AE1B 1N6ZA 2KVZA 2KQ4X 2FUG1 3IAS1 1TBEA 3KW5B 5CHVC 4RGOS 4P6VF 1M4VA 4DBGA 4GDKB 4LNIA 2J7QB 4MJSA 4EKUA 2JZPA 5E6JA 1VRAB 2MLBA 1V8CA 3AE7B 4RM8A 4XWTA 3ZNZB 1TGZB 2IY1B 3I63C 5GMVA 2BF8B 1P0RA 1C4CA 2QJLA 1WRIA 3LJ3A 3P4SB 1I4XA 2WWZA 3AXCA 3U7DA 4HVBA 3VFKA 3W1SC 2KZRA 2LWPA 1R4NB 1BMLC 2QMTA 5HFYA 3UIPB 2KTRA 2LHEA 1T0RC 1ZGUB 3TEXA 1KF6B 4ARIA 2AX5A 3W5VB 4TV3A 1H8CA 4RH6A 3EFCA 5D6JB 3V6EB 2Y5PA 4A90A 2VZKB 1I4QA 3B08A 2Q5WD 2UU7A 3FILB 3WAOA 2MW5A 3Q14C 4TSSA 1UELA 2AQ1B 2G3QB 2K22A 2LGSA 3WA0A 4DK5A 2EMTA 2WXGA 1JALA 2KVRA 1L4ZB 1ENFA 4BAXA 4MELA 4WWNA 1WJNA 1ZDXA 2NR2A 4BKTA 2ZVOA 3B1LX 2KK8A 4HKZE 1WMHA 4II2B 1IP9A 4FADA 3L13A 3DCGA 3DPDA 1K52A 1J7CA 2JXXA 3A33B 1TTNA 2MP2A 4EEWA 4P16A 2LVOA 3A1QA 2M17A 2ONQA 1FNVA 1VDVA 3Q8FA 4JWUC 4OVVA 2RDBC 4ANXA 1SE3A 1QZEA 2LGXA 1C1YB 1XLQA 1C77A 3ETRA 5BYQA 3RZFA 1M94A 3H1UA 1PGBA 3ZJVA 2L00B 1T5XD 3V60A 1JWUD 1F52A 2L76A 4F1SA 4M0WA 4W9JA 1DGJA 4C7ZA 3GB1A 4P7IA 1VCBA 3ENEA 3QARA 4GOCA 1KTKA 4YSXB 3MHZA 2KNBA 4C56C 1JMLA 4BBNC 2I1JA 1XLPA 4ICUA 2UYZB 2JWZA 1WYGA 3LDZE 3QCAA 4TQ0A 3IXSA 3W2DA 2G9HD 3CIRB 4NY0A 3MJ5A 2MJ3A 1YOVB 2XNAC 4A8XC 1OQYA 4BKGA 2DZJA 2LJIA 4KIKA 4B0MA 4B95A 1WGRA 2L0TA 1NI2A 3Q2AC 3SHQA 1LQBA 3L4PA 3BVZA 4GGQA 4P1CC 2MBHA 3AU4A 3DBLB 4KKIA 3RFZB 2JU6X 4XGAB 4R3DA 3A9KB 3C19A 1WX7A 3A4RA 3RCZA 1WJ6A 2PJHA 3SR6A 2QHOA 2KFKA 5LXIB 3DHGC 3M62B 1QILA 3KWLA 4MSMB 4PYZA 3AEGB 4AP4C 5JHBA 4W9FA 5CX3A 3V62A 1V2YA 3DVNV 2ZJDA 4UDUC 2WDTB 2W3RA 2EKIA 3P63A 2O6VB 4G0NB 2M56B 3NVYA 3W9CB 2FNJB 1ROEA 3C0RB 3A9JB 4GDLB 4IKGA 3NRZA 3U30A 1I4RA 1FM0D 4CHKA 1P98A 3NZSA 2GB1A 1WSPA 1N60A 3ZVVA 3VUYA 1V6EA 2CHZA 3VDZA 2LRWA 5E6OA 4EFOA 1CZPA 3AM9A 4XC2A 3GZNI 3ZXRA 1EU4A 1TZ1A 4OW0A 2BGFA 3N1ZC 2QILA 2KANA 1PGXA 1K8RB 2KJRA 3DHHC 3JYUA 3GE3C 2BYEA 2Y3AA 2BYTA 1UBIA 1SEBD 2J4XA 5E6PA 3ZGZA 2INDC 3ZDTA 1PFDA 3ZDMC 2RDHA 3QX1A 2BS2B 2WXPA 4XX5A 1C3TA 4MM3A 3NUHB 4NJ7A 1WJ4A 1TJEA 3AMZA 1Y8RC 2V3PA 4W9DA 1RM6C 2N4FA 2AWTA 2KJHB 3N30A 4DQOC 3P2BA 4HK2A 4YL8A 3T9LA 1RRBA 2CJOA 3Q8EA 2IJ0A 3CSTA 1LGRA 4PS7A 4M01A 5LLIA 4GDKA 3ZKJC 3K9OB 1TS3A 3MHSD 3AN1A 1V1OA 1KRHA 1TY0A 1FNUA 4KGSA 2OJWA 2KAJA 4C4VA 2D10A 4FJYA 2INNE 2K6QA 3AE4B 4DHJB 3I3TB 4K7WA 1H4RA 4A3OA 4B6WA 1NEKB 3PV1A 3N32A 4IC7B 1IPGA 3ZYYX 1ZOYB 3U2SC 3OWEB 3W1SA 1D5XC 3PO0A 3AV8A 4M8MA 5LNK1 4FN2A 2DZMA 3R3MA 4A20A 2ZNVC 3VR9B 1A70A 4USAA 4E3CA 2G4DB 2ZNVB 1GC7A 2X38A 2FIDA 1V5OA 3N3KB 1I4GA 1RFAA 4ITKA 1JQ4A 5EE3A 3RNGC 3IBEA 1L6VA 3FILA 2KDMA 2DAJA 3LYYA 4N9F4 4EE2A 3R66C 2A5UA 2N7JA 4IM3A 1WXMA 2GMIC 4YXDB 1FRRA 1VJKA 1D5MC 2GBJA 2JUOA 1LM8B 4ZDVA 2FCMA 3RNFC 1STEA 3U4EG 1ET9A 4YWGG 3QIJA 4KGTA 2PE9A 2KXJA 1I35A 3VQIA 4BKSD 5C23A 3NY5A 3AI5A 1L2NA 3NJTA 4HEA1 2JWUA 4II3B 1E8WA 1YX6B 1NVID 3ZTCA 3NVWA 2V0GA 2NBWB 2KC2A 3KWVA 2L32A 2UWQA 4YTPB 3RD2A 4AJWA 2BVCA 1IGCA 2PPHA 2DWQA 3QWZB 5CHWA 2WXFA 1TT5B 4JX1C 5AZFA 1WGHA 4K3CA 1XO3A 3Q3OC 4XWWA 1QOAA 2WXMA 5D3IB 3QQ8B 3Q69A 1VR9A 1V81A 5HHDG 4MEMA 4BZAA 4B9KA 1JW9D 1FEHA 5D94A 2JYEA 5DCNA 1UWXA 1QLBB 5AZHA 3RNEC 5DPTA 3IT4B 1J7BA 1C9FA 1V80A 1YQ3B 1J0GA 1SXTA 1ESFA 2SAKA 1Z5SB 3BK1A 2LI5A 3ML9A 4CO7A 1TZOA 2WXHA 1BXTA 3U52E 3BIID 1MJDA 2K25A 1RLFA 2WXLA 5TSSA 5H92C 1HZ5A 1V49A 2Z59B 1E8XA 3AE8B 2MA9B 4QAYA 2L3ZA 3RZWC 3RYTA 2KN4A 2L83A 2FCQA 4LDTD 1NDDA 2KMMA 5EE0A 2JXTA 2NVUI 2MRPA 1RAXA 3VTWA 4WQOB 2WGSA 3A9KA 3VVWB 4EZLA 4WH4A 1YIWA 2R2QA 3N1YC 2QEJC 1FFUA 3VR8B 5BMHA 2CJNA 4TQ1A 2AQ2B 4LCDE 1WH3A 4RCOA 1E8YA 4NPNA 2YEPF 3KVFB 3RT3B 1YQ4B 5J2RA 5JH5C 2ZEQA 1JWMD 3Q3MC 3BVMA 4MSQB 2HJ1A 5BO4B 4DHZE 2O6VA 4GXBA 2QIEB 3SEBA 4NAWA 3DBLI 2KLGA 2V3SA 3A9JA 2WS3B 3TSSA 5C2TB 3H8HA 4GDLA 4W9IA 4IOIE 4DDGD 1KM7A 3H7SA 5IN7A 2KTFA 2RMMA 1C76A 4I6NB 4ZRJA 3OG5A 2PLPA 2LEKA 2NPTB 4GN1A 2L1AA 2KX3A 2X8XX 4MGKE 1CMXB 2J42A 2GBMA 1YN4A 2W54A 2NBUA 2WQYB 1JWAD 4RGMA 3Q3NC 2LMCA 4EOYA 2IO2B 3MC8A 2ZW1A 3EHVA 3GOEA 2JX5A 2K0PA 2PEAA 1T6BX 1WM3A 3ALBA 2D3GA 3SD5A 3SFEB 4WJNA 4ZYNA 3EC8A 2LVPA 1KOTA 2IO0B 2FBWB 1IBXA 2I1KA 1AARA 5G5HA 2L8JA 4N59A 2WXQA 1IGDA 4HLEA 1FXTB 2MCNB 1D3ZA 1WZ0A 5IOIA 1SJHD 1XCTL 2D2QA 3WIMA 3ZRFA 5D3DA 1D4BA 4ANWA 2KMAA 2H89B 1T3QA 4BOSC 1WY8A 3ABVB 1GUAB 3J9CA 5IP4D 4L2YA 2CU3A 4AQ7A 2BB6A 3H9DA 4URKA 3AE5B 1FNWA 2FUHB 3JW0X 3AE9B 1E7PB 1I4HA 2XK5A 1T0YA 2NTSA 3RN9C 3NZUA 5DPWA 2M0XA 3M63B 3Q8BA 3W5UB 4BOZB 1XCQL 1WM2A 2KC1A 4ICVA 1R7SA 2V9HA 4PS3A 2O2VB 4HWIB 2CS4A 3BINA 5TR5A 4AJYB 3DVGX 2AQ3B 1QT9A 4ASWC 4IW0A 1U4AA 1QOBA 2JVCA 2K8HA 3EA6A 3HUIA 2W3SA 5CHFA 1I4PA 1SE2A 2FE8A 4JQWC 3AE3B 4MT5A 2LXCA 1HA5A 4XDCA 4ARCA 2B3AA 5DPRA 1E7UA 2RPVA 2J52A 1GC6A 1NENB 4FLHA 3QC8B 5LXHA 1KH0A 3VAWA 1Q10A 1AW7A 3RUIB 4A9AA 3M95A 4XE0A 4HPLB 2QCZA 4D2KA 1VZ7A 1SJED 3D32A 1EM7A 1WFYA 4DXAB 1YJ1A 1P9DU 2DX5B 5G5GA 2K8CA 5J18A 1SE4A 1TS2A 2K39A 2LJ5A 1FXAA 1OEYA 4LDTB 1OQRA 1R4MI 5G2NA 3L17A 2BT6A 4NJ6A 3Q8CA 3HK0A 1D5ZC 4XDDA 1YMHE 4M8NA 1PQSA 3DQVA 1PUTA 4K81A 4W9LA 4YT0B 4HDQA 2WLBA 2ZW0A 2KD0A 4G11A 1ZE3D 3EGRA 1Z2MA 2QDFA 4G3XB 4C7YA 4DWFA 2PIAA 2VH1A 4HJGE 1TKYA 1V97A 3B2GA 3TUOA 4ZHPA 1GAQB 3DDCB 3AEAB 2BS3B 3P4PB 5FR3A 1ACCA 2L7RA 1F0ZA 1Q1OA 3Q8AA 4OZCA 4F7ZA 2AL6A 3DWGC 3R7QA 3PZ8A 1B9RA 2IGDA 4BBNF 1C4PA 5J17A 3H6NA 3PHXB 4RGNA 2KDIA 1EWCA 1X1MA 2FCNA 3WAPA 2MBBB 5AUIA 3PLUA 3APCA 3ML8A 2L52A 1HXYD 2DZKA 4HCNB 2CU1A 2RDGA 1GG3A 1HTOA 1MPEA 3AEBB 1XT9B 4ZRPA 1SGHA 3BY4B 2MX2A 3EUB2 2KQSA 2N9XA 1VD2A 1P7FA 3OJ4B 3RI7C 2LRUA 4KX6B 1QKZA 3OAWA 4KV2A 1XXGA 3AU5A 5T8IA 1VLBA 1WGKA 1ISNA 3Q6BA 5GXGB 4KKJA 2WX1A 1YQBA 3W1YA 1FCLA 1EO6A 1FFVA 2MQJA 3JSVA 1WX9A 4REZA 4US8A 2GBRA 4JWSC 1TY2A 4NQKE 2E6XA 2MBQA 3KUCB 4M02A 3UQAA 3ZQ4A 4LK0M 1MI0A 2JF5A 2DHZA 3LB8C 5EE9A 2Z8LA 2KX0A 3FC4A 3NVVA 2D3BA 2K8BA 2LXAA 4N58A 2ZCBA 1E9MA 2WXJA 4WWOA 4FJVB 1DYQA 3APFA 1JROA 1UWMA 4OZAA 1SIFA 2JSVX 2WU5B 3N20C 4C00A 5FR6A 2C9WB 1HZ6A 1Q5WB 2V3NA 5FKAC 4FXCA 1JWBD 2LGYA 2K1FA 4JL9A 1KFYB 1SF0A 4YTMB 1LXDA 1SBBB 4LNKA 1UNSA 1WE6A 4WJQA 4KZ0A 1ZW7A 2BYVE 3ZW3A 4GU2A 1YX5B 2PW9A 1EWYC 1E90A 1T0SC 2M1MA 3MTNB 4W9CA 1Y56A 2D5GA 4WIPA 1WXSA 3K9PB 3DOWA 3BYTB 1R4MB 5HI1A 2MWSB 3H7PB 2VRRB 3O13A 5IAAC 1S3SG 1IUEA 1XLOA 3U7ZA 2NBVB 1FD6A 4BKSA 2MBOA 5C3JB 3KQ4A 2E3TA 2LUEA 4WWPA 1JRPA 3LXFA 2KDFB 3DHIC 2C5LC 2GOWA 2IO3B 1WZ3A 3AECB 2DZIA 1SIJA 3BK2A 2JRIB 3OLMD 3QK0A 3AULA 4DDID 1GJZA 1E8ZA 4F8CB 3P1MA 3R7RA 3VH3B 3PGEA 3P4QB 1XQQA 2GLSA 4J3OD 4PS8A 2V4LA 2K5PA 5BMGA 3VH4B 1GB1A 5D2MB 3V05A 2RR9A 2G45B 2HE7A 2Z0EB 4GLSC 2L0FA 2V4IB 2G1EA 2IZVB 2DLBA 3V61A 2ZCCA 2MSED 2BQQA 4BFRA 1UGJA 5AUKA 2LGIA 4S17A 1K51A 2GI9A 1OGWA 2YEPB 2IGHA 4IWOA 2ASQA 2M4NA 1RFKA 3IFWB 2V1YA 3QAQA 3IAM1 1V5TA 2AL3A 4JE3B 2BWFA 4US9A 3R2IA 1GB4A 2N9KA 2SEBD 3WAMA 1T0QC 4HRSA 4ANUA 4ZRIA 3KUDB 1WWTA 2KHWB 2I2YA 3PPAA 2FIFA 1UUPA 1WXQA 2IGGA 4WJPA 1Q0WB 1JWSD 2KO3A 2K6DB 5IA7A 1MHHE 3TJPA 4HXDA 1GOZA 4RM9A 2N9LA 4MACA 2WXIA 2WYQA 1UD7A 4P1BC 2C7MB 2MH7A 1E5WA 2PVGC 3A4SC 1F77A 2KJ6A 2M19A 2N1WA 1E7VA 2BTEA 3MC0B 4L23A 1JCKB 2WNMA 3GS2A 3TEZA 1PGAA 2INPE 1HE8A 2BBCA 2Y5CA 2BKFA 3L0WB 1EF1A 2WDVB 3TIXA 4AWJA 3VTUA 4OHJA 3TL5A 4S0RA 1HTQA 3ZRCA 1HEZE 2WXOA 3DBHB 1WR6E 1ZPSA 1UF0A 2EMSA 4LNOA 1ET6A 2HDEA 2D3CA 2KFJA 4YTNB 3TBLD 2N7EA 1KLVA 4FHJA 1B1ZA 1YJIA 3JVZX 3SU8X 3HM6X 3R2TA 3APDA 2CR5A 2RSUA 1N5XA 1YNTE 3VUWA 4HKQA 4RGTA 3AEEB 2GBNA 3DBRB 5L95C 5HKHA 2N1VA 4NJCA 3ZXVA 1FPYA 1ZXIA 3B9JA 2BB5A 5KHOA 2WXRA 4IDIA 1UZXB 2LFIA 1GPXA 1CJEA 4WWMA 1LFDA 5JZEB 3NVZA 3T8MA 5I4DA 2DYMA 4FJZA 2M8SA 1YN3A 2J0KA 5HG2A 3UIOB 4XZ4A 1MVKA 2LD9A 3HVDA 4IWQA 3RNAC 3NHEB 3RNCC 2LUMA 4EZJA 3E56A 4C4VB 4RF1A 1QOFA 2HD5B 2L05A 5EDSA 1FMAD 2KWCA 1QQRA 4CYEA 3ZNGC 5EE1A 2ZPNA 2N0SB 4ZYSA 5BYSA 2PTLA 1QOGA 1ZP0B 4ANVA 4WQMA 1FRDA 1KLGD 1OQQA 1UH6A 3L54A 2ON8A 2CHWA 3RULA 4ZRQA 3IHPC 1V1PB 2ZPYA 3PHWB 3ONSA 1P1AA 2Y5BB 1LO5D 1WJUA 5G55A 3AB5A 3FAHA 3V6CB 4E74A 2ZZPB 4AS1A 4PK1A 1WGYA 3UINB 4X57B 2EELA 4TMAB 1ZUD2 1FXIA 3EFUA 1N63A 4DHZB 1NI3A 3BVGA 1WX8A 4I6LB 2WDRB 4HJKA 3ZNHB 1CQVA 1CK1A 2R2OA 1VZ8A 3ZJUA 3PVLA 2NMQA 2QSDA 4DHJD 1D6EC 3IG3A 1XF5L 4H2AA 2DBYA 2INCC 3ZLZA 2WXKA 4LJPB 4A3PA 5BYRA 5H8YE 3I57A 3H7PA 3PZ7A 3X23A 4AOFA 3PZDA 3DVNU 1KJTA 4I6PA 1FIQA 3I5JC 2RPQA 2XBBC 1BT0A 1N62A 3MJWA 3VRAB 3TEWA 2JY6A 2JQRB 2DYOA 5AEKB 4MGZE 4A6QA 4DXGA 3DWMA 3SDLC 3FKYA 2BW2A 1C79A 3E9SA 1KLUD 3BYYB 3QHTA 3HRDD 1C4AA 1EU3A 2LASA 2W9NA 5L83A 2WXNA 1A5RA 4KSLC 3CWIA 2ICIA 4NZLB 1P7EA 1N5WA 2IDYA 4JPSA 5CTRC 2WU2B 5MPOA 1XEEA 3QA8A 3WANA 1MG4A 3AEDB 1OEYJ 4KZCA 1G6JA 5E6NA 4JIOU 4OZBA 4MH0E 4RF0A 4HPPA 2KOXA 2A4ZA 1S1QB 2H88B 1K53A 4RNAA 2PVOD 1SSNA 2MEKA 4K7SA 1YN5A 1SB3C 4AUQC 3UQBA 1I7HA 3UF8A 3UI3A 1V86A 2BS4B 2MBEA 2J0MA 1L4DB 4NNJB 2KKCA 1WE7A 2MJEA 2N9PC 4ZOHC 3N1XC 1C78A 4WAFA 1FO4A 1DOXA 1QF6A 4KGRA 2OJRA 2RD0A 2G4SA 4HDOA 4NAWB 4JLCA 4JGHB 2RGFA 3PREA 4PYUA 2KLCA 4HCPB 3HM3A 1F2RI 3CSFA 4LNNA 4FBJB 4IUMB 2K9XA 3TMPB 5AZGA 1MG8A 5D7GA 1L6UA 2AEHA 3GP7A 1JRUA 1DOYA 2EKEC 3URYA 3KYCD 4MJSB 4HROA 3R8BA 4LJOB 2K3UA 1WRDB 3VUXA 1L0YB 2OHFA 2VH2A 2OEDA 1F1HA 2D07B 2KACA 1HQRD 3SFDB 4GSWA
chains in the Genus database with same CATH topology
4W9JA 3ZNID 2IY0B 1XQQA 4PS8A 2V4LA 2NPTB 4GN1A 4MGYE 4P7IA 1VCBA 2KX3A 3ENEA 4MGKE 3U8ZA 1CMXB 3QARA 4GOCA 2GBMA 2JZZA 2HTHA 2NBUA 3Q3FA 3VH4B 2KTRB 4NQLB 2KNBA 5D2MB 2RR9A 2G45B 2HE7A 2Z0EB 2BKRB 4BBNC 2I1JA 4ICUA 2IO2B 2UYZB 4EOYA 2L0FA 2C60A 2JWZA 2IZVB 3Q3JA 1J8CA 3HIZA 3LDZE 3EHVA 4KDLB 3QCAA 3V61A 4TQ0A 2ZCCA 3GOEA 2NPTA 2MSED 4BFRA 2WX0A 5KHQA 2PEAA 4E71A 4NY0A 2YLMA 1OGWA 1WM3A 3ALBA 3EECA 3B0AA 3PTFC 2D3GA 3SD5A 3PRZA 4IWOA 2ASQA 2M4NA 3DBHI 3IFWB 1OQYA 4WJNA 4ZYNA 4BKGA 2DZJA 4KIKA 2FAZA 2V1YA 3EC8A 2LVPA 3QAQA 4B95A 1KOTA 2IO0B 1V5TA 1WGRA 2AL3A 2L0TA 1NI2A 3NS8A 2BWFA 2I1KA 3SHQA 1LQBA 4GIVA 1AARA 4GGQA 3WAMA 2L8JA 2MBHA 3AU4A 4ANUA 4ZRIA 3KUDB 1WR1A 3A9KB 1WX7A 4HLEA 2AYOB 1FXTB 3A4RA 2MCNB 2LVQA 3RCZA 1F9JA 1D3ZA 1WZ0A 1WXAA 1WJ6A 2KHWB 2PJHA 3PPAA 1WMHB 2FIFA 2D2QA 3DBRI 4WJPA 1WIAA 1Q0WB 1XD3B 3WIMA 3ZRFA 2QHOA 2KO3A 2KFKA 2KMAA 4IM2A 4ANWA 5LXIB 3M62B 2XK5B 2KQ7A 1SE9A 4BOSC 2K6DB 1WY8A 2REXA 4ZRKA 4MSMB 4PYZA 4IG7B 4AP4C 5IA7A 5JHBA 2BPSA 2IYDB 4W9FA 1GUAB 2MP2B 5CX3A 3V62A 3TJPA 4HXDA 1V2YA 3A1QB 3UGBB 3PRPB 3DVNV 4RM9A 2ZJDA 2WYQA 2DYBA 3HHMA 1UD7A 2WDTB 2N9EB 1ZKHA 2C7MB 2O6VB 3H9DA 4URKA 2OOBB 4G0NB 1UBQA 2Z0DB 4WJOA 3WALA 2FUHB 2FNJB 4OVUA 1WYWB 1E5WA 2C7NB 3C0RB 3JW0X 4TKNA 3A9JB 2LGDA 3A4SC 2KJ6A 2XK5A 2N1WA 4HPMB 1T0YA 1E7VA 3S2AA 4GDLB 3NZUA 5JHAA 3U30A 1WI0A 5DPWA 4CHKA 1P98A 2M0XA 1HE8A 3M63B 2BKFA 3NZSA 4TUUA 3L0WB 1EF1A 3TIXA 1IYFA 2DENB 4AWJA 3VTUA 4M0WB 3TL5A 4J6IA 4BOZB 3ZVVA 3ZRCA 1WM2A 3VUYA 2KC1A 1V6EA 4ICVA 2CHZA 2HJ8A 4MDKE 3VDZA 1WR6E 2EMSA 4PS3A 2LRWA 2O2VB 4HWIB 2CHXA 3ECIA 2KFJA 2CS4A 3BINA 5E6OA 3TBLD 2N7EA 4EFOA 1KLVA 1R4NI 4FHJA 2JRHA 3JVZX 5TR5A 3SU8X 3DVGX 4IWPA 4AJYB 4ASWC 4IW0A 3HM6X 1U4AA 4XC2A 3GZNI 1TZ1A 3APDA 2JVCA 2K8HA 2CR5A 2BGFA 1L7YA 2JZ3B 3DVGY 2RSUA 3PS6A 3VUWA 5CHFA 3OJ3A 2KANA 1K8RB 1NBFC 3ZIMA 2KJRA 4JQWC 3JYUA 4FULA 2BYEA 1WGDA 3PLVA 2GBNA 2LXCA 5L95C 2O2VA 5HKHA 2B3AA 2N1VA 5DPRA 5DPSA 1E7UA 3L08A 1GC6A 1UBIA 2J0JA 4FLHA 3KUZA 2KDBA 3QC8B 5KHOA 5LXHA 3VAWA 3TCAA 5E6PA 1UZXB 4IM0A 2JT4B 4KIKB 4KVGB 1LFDA 3RUIB 5JZEB 3M95A 3T8MA 3ZDTA 3ZDMC 4HPLB 2DYMA 1OTRB 3QX1A 2M8SA 4FJZA 2J0KA 4XX5A 3D32A 1WF9A 1C3TA 4MM3A 4NJ7A 3UIOB 1WJ4A 3ZTDA 1Y8RC 4XZ4A 4W9DA 1WFYA 2GBKA 3NOBA 3VXWA 2N7DA 2LD9A 2N4FA 4DXAB 2JPHA 1YJ1A 1P9DU 2AWTA 2DX5B 2YVCA 4GMVA 4IWQA 2KJHB 3N30A 3O65B 3P2BA 3NHEB 2K8CA 1WXVA 5J18A 2K39A 4EZJA 4HK2A 4YL8A 2LJ5A 3T9LA 1RRBA 4FA6A 1OEYA 1P3QU 3KH0A 4KSKC 4LDTB 4WAAA 3CF6E 3CSTA 2KFKB 2IBIB 1R4MI 5G2NA 2HD5B 2KN5A 1I42A 2L05A 5EDSA 4PS7A 3KYDD 3L17A 4W9EA 4NJ6A 1GNUA 3HK0A 5LLIA 3IVFA 2KWCA 4GDKA 3ZKJC 3K9OB 3ZO5B 4M8NA 4CYEA 1EF5A 1PQSA 4W9HA 3ZNGC 3MHSD 2ZPNA 4W9KA 3DQVA 4K81A 2LZ6A 5C1ZA 2D11A 2XEWA 2ZVNA 4W9LA 4HDQA 4G11A 2KD0A 4ANVA 4FHKA 1Z2MA 2FCSA 1UH6A 3L54A 2NS5A 2D10A 4FJYA 2K6QA 2KMCA 4DHJB 4G3XB 3I3TB 4K7WA 1H4RA 2CKHB 2BYFA 4A3OA 3QJZA 2CHWA 3RULA 4B6WA 3VTVA 3PV1A 4DWFA 3N32A 3IHPC 4IC7B 1UGMA 2ZPYA 1IPGA 3PHWB 3W1SA 3ONSA 1P1AA 2KDEB 3L16A 4M8MA 2KWVB 2Y5BB 4FN2A 2KWUB 1J19A 2DZMA 1WJUA 3R3MA 4A20A 2ZNVC 4MGIE 3DDCB 4W9GA 5G55A 4E3CA 4KDIC 2L7RA 3V6CB 2G4DB 1YD8U 2ZZPB 2ZNVB 4E74A 1GC7A 3DBSA 2FIDA 1V5OA 4ZRJA 1WGYA 3N3KB 3UINB 4GB9A 3X0WA 4X57B 1V9JA 1Q1OA 1RFAA 4F7ZA 1EUVB 4RMAA 3IBEA 3EFUA 2NCNA 2AL6A 3R7QA 5J17A 4BBNF 2DAJA 3H6NA 4DHZB 2IO1B 3PHXB 4N9F4 3R66C 2DAFA 2A5UA 2KDIA 4G50A 4IM3A 1X1MA 1WX8A 4I6LB 4HJKA 2FCNA 3WAPA 1WXMA 2GMIC 3ZNHB 2MBBB 4BVUC 2R2OA 3M3JA 2GBJA 3PLUA 3PVLA 4EZKA 3APCA 2PE6B 4K1RB 2JUOA 1LM8B 3ML8A 2C7HA 4DHJD 4ZDVA 2FCMA 2DZKA 4HCNB 2CU1A 3QIJA 1GG3A 1WGGA 1XT9B 2PE9A 2KXJA 1I35A 3IG3A 1SGHA 3VQIA 4BKSD 5C23A 3L10B 3AI5A 3NY5A 3PRMB 1L2NA 3PSEB 3BY4B 2MX2A 3VHTC 2KQSA 2N9XA 1VD2A 3OJ4B 4II3B 2O6VD 3ZLZA 1E8WA 1YX6B 4LJPB 4A3PA 3PT2B 4EUTA 3ZTCA 3CMMB 3ZUNA 3JSVB 2LRUA 4K7UA 3H7PA 2NBWB 2KC2A 3OAWA 3X23A 2BWES 4AOFA 3PZDA 4KV2A 3AU5A 3DVNU 1KJTA 2UWQA 4I6PA 1ISNA 1TBEA 2RPQA 2XBBC 3KW5B 5CHVC 3RD2A 4AJWA 2WX1A 1BT0A 4GDKB 4DBGA 1YQBA 3MJWA 2J7QB 4MJSA 3W1YA 2PPHA 4EKUA 1EO6A 3QWZB 5CHWA 2MLBA 2MQJA 2JY6A 1WX9A 3JSVA 4RM8A 5AZFA 1WGHA 3ZNZB 2DYOA 2GBRA 4NQKE 5AEKB 4MGZE 2MBQA 1TGZB 3KUCB 3SDLC 2IY1B 3QQ8B 5GMVA 3UQAA 1V81A 2BF8B 1P0RA 3QHTA 4MEMA 3LJ3A 4B9KA 2JF5A 2LASA 2WWZA 2DHZA 3AXCA 3U7DA 4HVBA 2KX0A 3VFKA 5D94A 3W1SC 2W9NA 2KZRA 2LWPA 5DCNA 5L83A 5AZHA 2K8BA 1A5RA 4KSLC 2LXAA 5DPTA 2ZCBA 3UIPB 1V80A 4WWOA 4FJVB 2KTRA 3APFA 1J0GA 5CTRC 1ZGUB 1SIFA 1Z5SB 2LI5A 4TV3A 1H8CA 3ML9A 3QA8A 3WANA 5FR6A 2C9WB 5D6JB 1Q5WB 3V6EB 4CO7A 1OEYJ 4KZCA 1G6JA 2LGYA 5E6NA 4JIOU 3B08A 2K1FA 4JL9A 4MH0E 2KOXA 2K25A 1RLFA 2A4ZA 3WAOA 1S1QB 2MW5A 1V49A 2Z59B 1LXDA 1E8XA 1UELA 2MA9B 2L3ZA 3RZWC 3RYTA 4K7SA 4LDTD 2FCQA 2G3QB 1NDDA 1WE6A 3WA0A 4WJQA 4KZ0A 4AUQC 3UQBA 3UF8A 4DK5A 1ZW7A 1V86A 2BYVE 2EMTA 2MBEA 2NVUI 2MRPA 1RAXA 3VTWA 2J0MA 2KVRA 3ZW3A 4GU2A 4WQOB 4NNJB 1YX5B 2KKCA 1WE7A 2N9PC 4MELA 3A9KA 4WWNA 1WJNA 3VVWB 4EZLA 2NR2A 1E90A 1YIWA 2R2QA 4BKTA 2ZVOA 2OJRA 2M1MA 2RD0A 2G4SA 3MTNB 3B1LX 2KK8A 4HDOA 4W9CA 1WMHA 4NAWB 4II2B 1WXSA 4JLCA 1IP9A 4JGHB 4TQ1A 3K9PB 3L13A 4FADA 3DCGA 3DOWA 4LCDE 1WH3A 1E8YA 3DPDA 2MWSB 2RGFA 3H7PB 2VRRB 5IAAC 3PREA 1S3SG 2KLCA 4HCPB 2JXXA 3A33B 1TTNA 4NPNA 4PYUA 3HM3A 2MP2A 2NBVB 3CSFA 4EEWA 3KVFB 3RT3B 4FBJB 2LVOA 3A1QA 4IUMB 5J2RA 2M17A 2ZEQA 4BKSA 3TMPB 2MBOA 5AZGA 1MG8A 5JH5C 5D7GA 2AEHA 4MSQB 5BO4B 2LUEA 1JRUA 4OVVA 2O6VA 4WWPA 4ANXA 4GXBA 2EKEC 4DHZE 2KDFB 3KYCD 4MJSB 2C5LC 4NAWA 3DBLI 2GOWA 2KLGA 2IO3B 1QZEA 2V3SA 2LGXA 3A9JA 4LJOB 1WRDB 3VUXA 1WZ3A 1C1YB 2DZIA 4GDLA 3OLMD 2JRIB 4W9IA 3RZFA 1M94A 3QK0A 3H1UA 4DDGD 1KM7A 3AULA 3H7SA 2KTFA 4DDID 1GJZA 2L00B 1E8ZA 3V60A 4F8CB 2D07B 2L76A 4I6NB 3R7RA 4F1SA 3VH3B 4GSWA 3PGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9J A;  3ZNI D;  2IY0 B;  1XQQ A;  4PS8 A;  2V4L A;  2NPT B;  4GN1 A;  4MGY E;  4P7I A;  1VCB A;  2KX3 A;  3ENE A;  4MGK E;  3U8Z A;  1CMX B;  3QAR A;  4GOC A;  2GBM A;  2JZZ A;  2HTH A;  2NBU A;  3Q3F A;  3VH4 B;  2KTR B;  4NQL B;  2KNB A;  5D2M B;  2RR9 A;  2G45 B;  2HE7 A;  2Z0E B;  2BKR B;  4BBN C;  2I1J A;  4ICU A;  2IO2 B;  2UYZ B;  4EOY A;  2L0F A;  2C60 A;  2JWZ A;  2IZV B;  3Q3J A;  1J8C A;  3HIZ A;  3LDZ E;  3EHV A;  4KDL B;  3QCA A;  3V61 A;  4TQ0 A;  2ZCC A;  3GOE A;  2NPT A;  2MSE D;  4BFR A;  2WX0 A;  5KHQ A;  2PEA A;  4E71 A;  4NY0 A;  2YLM A;  1OGW A;  1WM3 A;  3ALB A;  3EEC A;  3B0A A;  3PTF C;  2D3G A;  3SD5 A;  3PRZ A;  4IWO A;  2ASQ A;  2M4N A;  3DBH I;  3IFW B;  1OQY A;  4WJN A;  4ZYN A;  4BKG A;  2DZJ A;  4KIK A;  2FAZ A;  2V1Y A;  3EC8 A;  2LVP A;  3QAQ A;  4B95 A;  1KOT A;  2IO0 B;  1V5T A;  1WGR A;  2AL3 A;  2L0T A;  1NI2 A;  3NS8 A;  2BWF A;  2I1K A;  3SHQ A;  1LQB A;  4GIV A;  1AAR A;  4GGQ A;  3WAM A;  2L8J A;  2MBH A;  3AU4 A;  4ANU A;  4ZRI A;  3KUD B;  1WR1 A;  3A9K B;  1WX7 A;  4HLE A;  2AYO B;  1FXT B;  3A4R A;  2MCN B;  2LVQ A;  3RCZ A;  1F9J A;  1D3Z A;  1WZ0 A;  1WXA A;  1WJ6 A;  2KHW B;  2PJH A;  3PPA A;  1WMH B;  2FIF A;  2D2Q A;  3DBR I;  4WJP A;  1WIA A;  1Q0W B;  1XD3 B;  3WIM A;  3ZRF A;  2QHO A;  2KO3 A;  2KFK A;  2KMA A;  4IM2 A;  4ANW A;  5LXI B;  3M62 B;  2XK5 B;  2KQ7 A;  1SE9 A;  4BOS C;  2K6D B;  1WY8 A;  2REX A;  4ZRK A;  4MSM B;  4PYZ A;  4IG7 B;  4AP4 C;  5IA7 A;  5JHB A;  2BPS A;  2IYD B;  4W9F A;  1GUA B;  2MP2 B;  5CX3 A;  3V62 A;  3TJP A;  4HXD A;  1V2Y A;  3A1Q B;  3UGB B;  3PRP B;  3DVN V;  4RM9 A;  2ZJD A;  2WYQ A;  2DYB A;  3HHM A;  1UD7 A;  2WDT B;  2N9E B;  1ZKH A;  2C7M B;  2O6V B;  3H9D A;  4URK A;  2OOB B;  4G0N B;  1UBQ A;  2Z0D B;  4WJO A;  3WAL A;  2FUH B;  2FNJ B;  4OVU A;  1WYW B;  1E5W A;  2C7N B;  3C0R B;  3JW0 X;  4TKN A;  3A9J B;  2LGD A;  3A4S C;  2KJ6 A;  2XK5 A;  2N1W A;  4HPM B;  1T0Y A;  1E7V A;  3S2A A;  4GDL B;  3NZU A;  5JHA A;  3U30 A;  1WI0 A;  5DPW A;  4CHK A;  1P98 A;  2M0X A;  1HE8 A;  3M63 B;  2BKF A;  3NZS A;  4TUU A;  3L0W B;  1EF1 A;  3TIX A;  1IYF A;  2DEN B;  4AWJ A;  3VTU A;  4M0W B;  3TL5 A;  4J6I A;  4BOZ B;  3ZVV A;  3ZRC A;  1WM2 A;  3VUY A;  2KC1 A;  1V6E A;  4ICV A;  2CHZ A;  2HJ8 A;  4MDK E;  3VDZ A;  1WR6 E;  2EMS A;  4PS3 A;  2LRW A;  2O2V B;  4HWI B;  2CHX A;  3ECI A;  2KFJ A;  2CS4 A;  3BIN A;  5E6O A;  3TBL D;  2N7E A;  4EFO A;  1KLV A;  1R4N I;  4FHJ A;  2JRH A;  3JVZ X;  5TR5 A;  3SU8 X;  3DVG X;  4IWP A;  4AJY B;  4ASW C;  4IW0 A;  3HM6 X;  1U4A A;  4XC2 A;  3GZN I;  1TZ1 A;  3APD A;  2JVC A;  2K8H A;  2CR5 A;  2BGF A;  1L7Y A;  2JZ3 B;  3DVG Y;  2RSU A;  3PS6 A;  3VUW A;  5CHF A;  3OJ3 A;  2KAN A;  1K8R B;  1NBF C;  3ZIM A;  2KJR A;  4JQW C;  3JYU A;  4FUL A;  2BYE A;  1WGD A;  3PLV A;  2GBN A;  2LXC A;  5L95 C;  2O2V A;  5HKH A;  2B3A A;  2N1V A;  5DPR A;  5DPS A;  1E7U A;  3L08 A;  1GC6 A;  1UBI A;  2J0J A;  4FLH A;  3KUZ A;  2KDB A;  3QC8 B;  5KHO A;  5LXH A;  3VAW A;  3TCA A;  5E6P A;  1UZX B;  4IM0 A;  2JT4 B;  4KIK B;  4KVG B;  1LFD A;  3RUI B;  5JZE B;  3M95 A;  3T8M A;  3ZDT A;  3ZDM C;  4HPL B;  2DYM A;  1OTR B;  3QX1 A;  2M8S A;  4FJZ A;  2J0K A;  4XX5 A;  3D32 A;  1WF9 A;  1C3T A;  4MM3 A;  4NJ7 A;  3UIO B;  1WJ4 A;  3ZTD A;  1Y8R C;  4XZ4 A;  4W9D A;  1WFY A;  2GBK A;  3NOB A;  3VXW A;  2N7D A;  2LD9 A;  2N4F A;  4DXA B;  2JPH A;  1YJ1 A;  1P9D U;  2AWT A;  2DX5 B;  2YVC A;  4GMV A;  4IWQ A;  2KJH B;  3N30 A;  3O65 B;  3P2B A;  3NHE B;  2K8C A;  1WXV A;  5J18 A;  2K39 A;  4EZJ A;  4HK2 A;  4YL8 A;  2LJ5 A;  3T9L A;  1RRB A;  4FA6 A;  1OEY A;  1P3Q U;  3KH0 A;  4KSK C;  4LDT B;  4WAA A;  3CF6 E;  3CST A;  2KFK B;  2IBI B;  1R4M I;  5G2N A;  2HD5 B;  2KN5 A;  1I42 A;  2L05 A;  5EDS A;  4PS7 A;  3KYD D;  3L17 A;  4W9E A;  4NJ6 A;  1GNU A;  3HK0 A;  5LLI A;  3IVF A;  2KWC A;  4GDK A;  3ZKJ C;  3K9O B;  3ZO5 B;  4M8N A;  4CYE A;  1EF5 A;  1PQS A;  4W9H A;  3ZNG C;  3MHS D;  2ZPN A;  4W9K A;  3DQV A;  4K81 A;  2LZ6 A;  5C1Z A;  2D11 A;  2XEW A;  2ZVN A;  4W9L A;  4HDQ A;  4G11 A;  2KD0 A;  4ANV A;  4FHK A;  1Z2M A;  2FCS A;  1UH6 A;  3L54 A;  2NS5 A;  2D10 A;  4FJY A;  2K6Q A;  2KMC A;  4DHJ B;  4G3X B;  3I3T B;  4K7W A;  1H4R A;  2CKH B;  2BYF A;  4A3O A;  3QJZ A;  2CHW A;  3RUL A;  4B6W A;  3VTV A;  3PV1 A;  4DWF A;  3N32 A;  3IHP C;  4IC7 B;  1UGM A;  2ZPY A;  1IPG A;  3PHW B;  3W1S A;  3ONS A;  1P1A A;  2KDE B;  3L16 A;  4M8M A;  2KWV B;  2Y5B B;  4FN2 A;  2KWU B;  1J19 A;  2DZM A;  1WJU A;  3R3M A;  4A20 A;  2ZNV C;  4MGI E;  3DDC B;  4W9G A;  5G55 A;  4E3C A;  4KDI C;  2L7R A;  3V6C B;  2G4D B;  1YD8 U;  2ZZP B;  2ZNV B;  4E74 A;  1GC7 A;  3DBS A;  2FID A;  1V5O A;  4ZRJ A;  1WGY A;  3N3K B;  3UIN B;  4GB9 A;  3X0W A;  4X57 B;  1V9J A;  1Q1O A;  1RFA A;  4F7Z A;  1EUV B;  4RMA A;  3IBE A;  3EFU A;  2NCN A;  2AL6 A;  3R7Q A;  5J17 A;  4BBN F;  2DAJ A;  3H6N A;  4DHZ B;  2IO1 B;  3PHX B;  4N9F 4;  3R66 C;  2DAF A;  2A5U A;  2KDI A;  4G50 A;  4IM3 A;  1X1M A;  1WX8 A;  4I6L B;  4HJK A;  2FCN A;  3WAP A;  1WXM A;  2GMI C;  3ZNH B;  2MBB B;  4BVU C;  2R2O A;  3M3J A;  2GBJ A;  3PLU A;  3PVL A;  4EZK A;  3APC A;  2PE6 B;  4K1R B;  2JUO A;  1LM8 B;  3ML8 A;  2C7H A;  4DHJ D;  4ZDV A;  2FCM A;  2DZK A;  4HCN B;  2CU1 A;  3QIJ A;  1GG3 A;  1WGG A;  1XT9 B;  2PE9 A;  2KXJ A;  1I35 A;  3IG3 A;  1SGH A;  3VQI A;  4BKS D;  5C23 A;  3L10 B;  3AI5 A;  3NY5 A;  3PRM B;  1L2N A;  3PSE B;  3BY4 B;  2MX2 A;  3VHT C;  2KQS A;  2N9X A;  1VD2 A;  3OJ4 B;  4II3 B;  2O6V D;  3ZLZ A;  1E8W A;  1YX6 B;  4LJP B;  4A3P A;  3PT2 B;  4EUT A;  3ZTC A;  3CMM B;  3ZUN A;  3JSV B;  2LRU A;  4K7U A;  3H7P A;  2NBW B;  2KC2 A;  3OAW A;  3X23 A;  2BWE S;  4AOF A;  3PZD A;  4KV2 A;  3AU5 A;  3DVN U;  1KJT A;  2UWQ A;  4I6P A;  1ISN A;  1TBE A;  2RPQ A;  2XBB C;  3KW5 B;  5CHV C;  3RD2 A;  4AJW A;  2WX1 A;  1BT0 A;  4GDK B;  4DBG A;  1YQB A;  3MJW A;  2J7Q B;  4MJS A;  3W1Y A;  2PPH A;  4EKU A;  1EO6 A;  3QWZ B;  5CHW A;  2MLB A;  2MQJ A;  2JY6 A;  1WX9 A;  3JSV A;  4RM8 A;  5AZF A;  1WGH A;  3ZNZ B;  2DYO A;  2GBR A;  4NQK E;  5AEK B;  4MGZ E;  2MBQ A;  1TGZ B;  3KUC B;  3SDL C;  2IY1 B;  3QQ8 B;  5GMV A;  3UQA A;  1V81 A;  2BF8 B;  1P0R A;  3QHT A;  4MEM A;  3LJ3 A;  4B9K A;  2JF5 A;  2LAS A;  2WWZ A;  2DHZ A;  3AXC A;  3U7D A;  4HVB A;  2KX0 A;  3VFK A;  5D94 A;  3W1S C;  2W9N A;  2KZR A;  2LWP A;  5DCN A;  5L83 A;  5AZH A;  2K8B A;  1A5R A;  4KSL C;  2LXA A;  5DPT A;  2ZCB A;  3UIP B;  1V80 A;  4WWO A;  4FJV B;  2KTR A;  3APF A;  1J0G A;  5CTR C;  1ZGU B;  1SIF A;  1Z5S B;  2LI5 A;  4TV3 A;  1H8C A;  3ML9 A;  3QA8 A;  3WAN A;  5FR6 A;  2C9W B;  5D6J B;  1Q5W B;  3V6E B;  4CO7 A;  1OEY J;  4KZC A;  1G6J A;  2LGY A;  5E6N A;  4JIO U;  3B08 A;  2K1F A;  4JL9 A;  4MH0 E;  2KOX A;  2K25 A;  1RLF A;  2A4Z A;  3WAO A;  1S1Q B;  2MW5 A;  1V49 A;  2Z59 B;  1LXD A;  1E8X A;  1UEL A;  2MA9 B;  2L3Z A;  3RZW C;  3RYT A;  4K7S A;  4LDT D;  2FCQ A;  2G3Q B;  1NDD A;  1WE6 A;  3WA0 A;  4WJQ A;  4KZ0 A;  4AUQ C;  3UQB A;  3UF8 A;  4DK5 A;  1ZW7 A;  1V86 A;  2BYV E;  2EMT A;  2MBE A;  2NVU I;  2MRP A;  1RAX A;  3VTW A;  2J0M A;  2KVR A;  3ZW3 A;  4GU2 A;  4WQO B;  4NNJ B;  1YX5 B;  2KKC A;  1WE7 A;  2N9P C;  4MEL A;  3A9K A;  4WWN A;  1WJN A;  3VVW B;  4EZL A;  2NR2 A;  1E90 A;  1YIW A;  2R2Q A;  4BKT A;  2ZVO A;  2OJR A;  2M1M A;  2RD0 A;  2G4S A;  3MTN B;  3B1L X;  2KK8 A;  4HDO A;  4W9C A;  1WMH A;  4NAW B;  4II2 B;  1WXS A;  4JLC A;  1IP9 A;  4JGH B;  4TQ1 A;  3K9P B;  3L13 A;  4FAD A;  3DCG A;  3DOW A;  4LCD E;  1WH3 A;  1E8Y A;  3DPD A;  2MWS B;  2RGF A;  3H7P B;  2VRR B;  5IAA C;  3PRE A;  1S3S G;  2KLC A;  4HCP B;  2JXX A;  3A33 B;  1TTN A;  4NPN A;  4PYU A;  3HM3 A;  2MP2 A;  2NBV B;  3CSF A;  4EEW A;  3KVF B;  3RT3 B;  4FBJ B;  2LVO A;  3A1Q A;  4IUM B;  5J2R A;  2M17 A;  2ZEQ A;  4BKS A;  3TMP B;  2MBO A;  5AZG A;  1MG8 A;  5JH5 C;  5D7G A;  2AEH A;  4MSQ B;  5BO4 B;  2LUE A;  1JRU A;  4OVV A;  2O6V A;  4WWP A;  4ANX A;  4GXB A;  2EKE C;  4DHZ E;  2KDF B;  3KYC D;  4MJS B;  2C5L C;  4NAW A;  3DBL I;  2GOW A;  2KLG A;  2IO3 B;  1QZE A;  2V3S A;  2LGX A;  3A9J A;  4LJO B;  1WRD B;  3VUX A;  1WZ3 A;  1C1Y B;  2DZI A;  4GDL A;  3OLM D;  2JRI B;  4W9I A;  3RZF A;  1M94 A;  3QK0 A;  3H1U A;  4DDG D;  1KM7 A;  3AUL A;  3H7S A;  2KTF A;  4DDI D;  1GJZ A;  2L00 B;  1E8Z A;  3V60 A;  4F8C B;  2D07 B;  2L76 A;  4I6N B;  3R7R A;  4F1S A;  3VH3 B;  4GSW A;  3PGE A; 
#chains in the Genus database with same CATH topology
 4C80 A;  1AN8 A;  3ZNI D;  1VZ6 A;  2IY0 B;  4MGY E;  4Q2J A;  2IPK D;  3U8Z A;  1TKG A;  2JZZ A;  2HTH A;  1AWD A;  3Q3F A;  1DOI A;  5JXV A;  2KTR B;  4NQL B;  2BKR B;  4XYC A;  2C60 A;  1IBX B;  3Q3J A;  1J8C A;  3HIZ A;  4KDL B;  1MHX A;  2NPT A;  2WX0 A;  4ZHO A;  5KHQ A;  4E71 A;  2YLM A;  3EEC A;  3B0A A;  3PTF C;  3PRZ A;  3DBH I;  3GE8 C;  3TEY A;  2FAZ A;  2M0A A;  3V3X A;  3NS8 A;  1TS4 A;  3BZD B;  4GIV A;  2W55 A;  1TKE A;  1WR1 A;  2AYO B;  2LVQ A;  1F9J A;  1WXA A;  2D3A A;  1WMH B;  3NZ3 A;  3DBR I;  1WIA A;  1XD3 B;  4IM2 A;  2WHI A;  2XK5 B;  1YJJ A;  2KQ7 A;  1SE9 A;  2REX A;  4ZRK A;  4IG7 B;  2BPS A;  2IYD B;  5BMI A;  4K3B A;  2MP2 B;  3AEF B;  3A1Q B;  3UGB B;  3PRP B;  2KT7 A;  2PMV A;  2DYB A;  3HHM A;  2N9E B;  1ZKH A;  2OOB B;  1UBQ A;  2Z0D B;  4OVZ A;  4WJO A;  1OFF A;  3WAL A;  4OVU A;  1WYW B;  2C7N B;  2QC8 A;  4TKN A;  2LGD A;  3ZJT A;  4HPM B;  3I9V 1;  3S2A A;  3N9Y C;  5JHA A;  4NAM A;  1WI0 A;  1V1P A;  4TUU A;  1IYF A;  2DEN B;  2VZK D;  4M0W B;  4J6I A;  2B76 B;  4MDK E;  2HJ8 A;  2XN9 C;  1NYR A;  2CHX A;  3ECI A;  1TIF A;  1R4N I;  2JRH A;  4IWP A;  2MJD A;  1K50 A;  4LTU A;  3P4R B;  1L7Y A;  2JZ3 B;  3DVG Y;  3PS6 A;  5FK9 C;  3T3O A;  2LHD A;  1L5P A;  3BWU D;  3OJ3 A;  1NBF C;  3ZIM A;  4FUL A;  1WGD A;  3PLV A;  3MC9 A;  2O2V A;  3KLS X;  3C8Y A;  5DPS A;  3L08 A;  4LLG M;  2J0J A;  3KUZ A;  3RPF C;  2KDB A;  3TCA A;  2GRI A;  3RNB C;  1E6E B;  4IM0 A;  2JT4 B;  4KIK B;  4KVG B;  1MFW A;  2NTT A;  2W82 A;  1OTR B;  1WF9 A;  3AH7 A;  1NYQ A;  3ZTD A;  1TYG B;  4M00 A;  2GBK A;  3VRB B;  3NOB A;  3VXW A;  2N7D A;  4PT5 A;  2JPH A;  2KYW A;  4GMV A;  2YVC A;  1F2R C;  3O65 B;  2WDQ B;  1WXV A;  4FA6 A;  1P3Q U;  4KSK C;  3KH0 A;  4ACF A;  4WAA A;  1E10 A;  2I38 A;  3CF6 E;  3WCQ A;  2KFK B;  2IBI B;  2DNF A;  2KN5 A;  1L0X B;  4B0E A;  1I42 A;  3KYD D;  4W9E A;  1GNU A;  2KWD A;  3IVF A;  4LNF A;  4L1B A;  3ZO5 B;  2ACZ B;  1EF5 A;  4W9H A;  4W9K A;  4O1N A;  1AYF A;  2MHJ A;  2LZ6 A;  5C1Z A;  2D11 A;  2XEW A;  2ZVN A;  3GZN B;  1FCC C;  4WUR A;  4N6E B;  1RWS A;  2HTM E;  3P42 A;  4FHK A;  1ZXH A;  2FCS A;  2NS5 A;  3HVZ A;  2KMC A;  2R61 A;  2CKH B;  2BYF A;  4A55 A;  3QJZ A;  4YSY B;  3VTV A;  2PKO A;  1L0V B;  1UGM A;  2JYT A;  2WP9 B;  2KDE B;  3L16 A;  3MFG A;  3RMK C;  2KWV B;  2KWU B;  1J19 A;  4MGI E;  4W9G A;  5IKC M;  4KDI C;  1YD8 U;  3NS1 A;  3MP9 A;  3DBS A;  4MH8 A;  4GB9 A;  3X0W A;  1V9J A;  1EUV B;  4RMA A;  4RFB A;  2NCN A;  1PYW D;  1PDX A;  2TSS A;  4CQN A;  3IT6 B;  2IO1 B;  2DAF A;  4G50 A;  1BUI C;  4BVU C;  3B2F A;  3M3J A;  4EZK A;  2PE6 B;  4K1R B;  2C7H A;  4YSZ B;  1ZDV A;  1E0Z A;  3NG0 A;  1N61 A;  1WGG A;  1TS5 A;  1XLN A;  3AE6 B;  3L10 B;  3PRM B;  4MM3 B;  3PSE B;  2J53 A;  3VHT C;  3AE2 B;  5IO9 A;  2O6V D;  4EUT A;  3PT2 B;  3CMM B;  3T3N A;  3ZUN A;  3JSV B;  4DXF A;  4K7U A;  1RYJ A;  1J7A A;  2BWE S;  3AE1 B;  1N6Z A;  2KVZ A;  2KQ4 X;  2FUG 1;  3IAS 1;  1TBE A;  3KW5 B;  5CHV C;  4RGO S;  4P6V F;  1M4V A;  4DBG A;  4GDK B;  4LNI A;  2J7Q B;  4MJS A;  4EKU A;  2JZP A;  5E6J A;  1VRA B;  2MLB A;  1V8C A;  3AE7 B;  4RM8 A;  4XWT A;  3ZNZ B;  1TGZ B;  2IY1 B;  3I63 C;  5GMV A;  2BF8 B;  1P0R A;  1C4C A;  2QJL A;  1WRI A;  3LJ3 A;  3P4S B;  1I4X A;  2WWZ A;  3AXC A;  3U7D A;  4HVB A;  3VFK A;  3W1S C;  2KZR A;  2LWP A;  1R4N B;  1BML C;  2QMT A;  5HFY A;  3UIP B;  2KTR A;  2LHE A;  1T0R C;  1ZGU B;  3TEX A;  1KF6 B;  4ARI A;  2AX5 A;  3W5V B;  4TV3 A;  1H8C A;  4RH6 A;  3EFC A;  5D6J B;  3V6E B;  2Y5P A;  4A90 A;  2VZK B;  1I4Q A;  3B08 A;  2Q5W D;  2UU7 A;  3FIL B;  3WAO A;  2MW5 A;  3Q14 C;  4TSS A;  1UEL A;  2AQ1 B;  2G3Q B;  2K22 A;  2LGS A;  3WA0 A;  4DK5 A;  2EMT A;  2WXG A;  1JAL A;  2KVR A;  1L4Z B;  1ENF A;  4BAX A;  4MEL A;  4WWN A;  1WJN A;  1ZDX A;  2NR2 A;  4BKT A;  2ZVO A;  3B1L X;  2KK8 A;  4HKZ E;  1WMH A;  4II2 B;  1IP9 A;  4FAD A;  3L13 A;  3DCG A;  3DPD A;  1K52 A;  1J7C A;  2JXX A;  3A33 B;  1TTN A;  2MP2 A;  4EEW A;  4P16 A;  2LVO A;  3A1Q A;  2M17 A;  2ONQ A;  1FNV A;  1VDV A;  3Q8F A;  4JWU C;  4OVV A;  2RDB C;  4ANX A;  1SE3 A;  1QZE A;  2LGX A;  1C1Y B;  1XLQ A;  1C77 A;  3ETR A;  5BYQ A;  3RZF A;  1M94 A;  3H1U A;  1PGB A;  3ZJV A;  2L00 B;  1T5X D;  3V60 A;  1JWU D;  1F52 A;  2L76 A;  4F1S A;  4M0W A;  4W9J A;  1DGJ A;  4C7Z A;  3GB1 A;  4P7I A;  1VCB A;  3ENE A;  3QAR A;  4GOC A;  1KTK A;  4YSX B;  3MHZ A;  2KNB A;  4C56 C;  1JML A;  4BBN C;  2I1J A;  1XLP A;  4ICU A;  2UYZ B;  2JWZ A;  1WYG A;  3LDZ E;  3QCA A;  4TQ0 A;  3IXS A;  3W2D A;  2G9H D;  3CIR B;  4NY0 A;  3MJ5 A;  2MJ3 A;  1YOV B;  2XNA C;  4A8X C;  1OQY A;  4BKG A;  2DZJ A;  2LJI A;  4KIK A;  4B0M A;  4B95 A;  1WGR A;  2L0T A;  1NI2 A;  3Q2A C;  3SHQ A;  1LQB A;  3L4P A;  3BVZ A;  4GGQ A;  4P1C C;  2MBH A;  3AU4 A;  3DBL B;  4KKI A;  3RFZ B;  2JU6 X;  4XGA B;  4R3D A;  3A9K B;  3C19 A;  1WX7 A;  3A4R A;  3RCZ A;  1WJ6 A;  2PJH A;  3SR6 A;  2QHO A;  2KFK A;  5LXI B;  3DHG C;  3M62 B;  1QIL A;  3KWL A;  4MSM B;  4PYZ A;  3AEG B;  4AP4 C;  5JHB A;  4W9F A;  5CX3 A;  3V62 A;  1V2Y A;  3DVN V;  2ZJD A;  4UDU C;  2WDT B;  2W3R A;  2EKI A;  3P63 A;  2O6V B;  4G0N B;  2M56 B;  3NVY A;  3W9C B;  2FNJ B;  1ROE A;  3C0R B;  3A9J B;  4GDL B;  4IKG A;  3NRZ A;  3U30 A;  1I4R A;  1FM0 D;  4CHK A;  1P98 A;  3NZS A;  2GB1 A;  1WSP A;  1N60 A;  3ZVV A;  3VUY A;  1V6E A;  2CHZ A;  3VDZ A;  2LRW A;  5E6O A;  4EFO A;  1CZP A;  3AM9 A;  4XC2 A;  3GZN I;  3ZXR A;  1EU4 A;  1TZ1 A;  4OW0 A;  2BGF A;  3N1Z C;  2QIL A;  2KAN A;  1PGX A;  1K8R B;  2KJR A;  3DHH C;  3JYU A;  3GE3 C;  2BYE A;  2Y3A A;  2BYT A;  1UBI A;  1SEB D;  2J4X A;  5E6P A;  3ZGZ A;  2IND C;  3ZDT A;  1PFD A;  3ZDM C;  2RDH A;  3QX1 A;  2BS2 B;  2WXP A;  4XX5 A;  1C3T A;  4MM3 A;  3NUH B;  4NJ7 A;  1WJ4 A;  1TJE A;  3AMZ A;  1Y8R C;  2V3P A;  4W9D A;  1RM6 C;  2N4F A;  2AWT A;  2KJH B;  3N30 A;  4DQO C;  3P2B A;  4HK2 A;  4YL8 A;  3T9L A;  1RRB A;  2CJO A;  3Q8E A;  2IJ0 A;  3CST A;  1LGR A;  4PS7 A;  4M01 A;  5LLI A;  4GDK A;  3ZKJ C;  3K9O B;  1TS3 A;  3MHS D;  3AN1 A;  1V1O A;  1KRH A;  1TY0 A;  1FNU A;  4KGS A;  2OJW A;  2KAJ A;  4C4V A;  2D10 A;  4FJY A;  2INN E;  2K6Q A;  3AE4 B;  4DHJ B;  3I3T B;  4K7W A;  1H4R A;  4A3O A;  4B6W A;  1NEK B;  3PV1 A;  3N32 A;  4IC7 B;  1IPG A;  3ZYY X;  1ZOY B;  3U2S C;  3OWE B;  3W1S A;  1D5X C;  3PO0 A;  3AV8 A;  4M8M A;  5LNK 1;  4FN2 A;  2DZM A;  3R3M A;  4A20 A;  2ZNV C;  3VR9 B;  1A70 A;  4USA A;  4E3C A;  2G4D B;  2ZNV B;  1GC7 A;  2X38 A;  2FID A;  1V5O A;  3N3K B;  1I4G A;  1RFA A;  4ITK A;  1JQ4 A;  5EE3 A;  3RNG C;  3IBE A;  1L6V A;  3FIL A;  2KDM A;  2DAJ A;  3LYY A;  4N9F 4;  4EE2 A;  3R66 C;  2A5U A;  2N7J A;  4IM3 A;  1WXM A;  2GMI C;  4YXD B;  1FRR A;  1VJK A;  1D5M C;  2GBJ A;  2JUO A;  1LM8 B;  4ZDV A;  2FCM A;  3RNF C;  1STE A;  3U4E G;  1ET9 A;  4YWG G;  3QIJ A;  4KGT A;  2PE9 A;  2KXJ A;  1I35 A;  3VQI A;  4BKS D;  5C23 A;  3NY5 A;  3AI5 A;  1L2N A;  3NJT A;  4HEA 1;  2JWU A;  4II3 B;  1E8W A;  1YX6 B;  1NVI D;  3ZTC A;  3NVW A;  2V0G A;  2NBW B;  2KC2 A;  3KWV A;  2L32 A;  2UWQ A;  4YTP B;  3RD2 A;  4AJW A;  2BVC A;  1IGC A;  2PPH A;  2DWQ A;  3QWZ B;  5CHW A;  2WXF A;  1TT5 B;  4JX1 C;  5AZF A;  1WGH A;  4K3C A;  1XO3 A;  3Q3O C;  4XWW A;  1QOA A;  2WXM A;  5D3I B;  3QQ8 B;  3Q69 A;  1VR9 A;  1V81 A;  5HHD G;  4MEM A;  4BZA A;  4B9K A;  1JW9 D;  1FEH A;  5D94 A;  2JYE A;  5DCN A;  1UWX A;  1QLB B;  5AZH A;  3RNE C;  5DPT A;  3IT4 B;  1J7B A;  1C9F A;  1V80 A;  1YQ3 B;  1J0G A;  1SXT A;  1ESF A;  2SAK A;  1Z5S B;  3BK1 A;  2LI5 A;  3ML9 A;  4CO7 A;  1TZO A;  2WXH A;  1BXT A;  3U52 E;  3BII D;  1MJD A;  2K25 A;  1RLF A;  2WXL A;  5TSS A;  5H92 C;  1HZ5 A;  1V49 A;  2Z59 B;  1E8X A;  3AE8 B;  2MA9 B;  4QAY A;  2L3Z A;  3RZW C;  3RYT A;  2KN4 A;  2L83 A;  2FCQ A;  4LDT D;  1NDD A;  2KMM A;  5EE0 A;  2JXT A;  2NVU I;  2MRP A;  1RAX A;  3VTW A;  4WQO B;  2WGS A;  3A9K A;  3VVW B;  4EZL A;  4WH4 A;  1YIW A;  2R2Q A;  3N1Y C;  2QEJ C;  1FFU A;  3VR8 B;  5BMH A;  2CJN A;  4TQ1 A;  2AQ2 B;  4LCD E;  1WH3 A;  4RCO A;  1E8Y A;  4NPN A;  2YEP F;  3KVF B;  3RT3 B;  1YQ4 B;  5J2R A;  5JH5 C;  2ZEQ A;  1JWM D;  3Q3M C;  3BVM A;  4MSQ B;  2HJ1 A;  5BO4 B;  4DHZ E;  2O6V A;  4GXB A;  2QIE B;  3SEB A;  4NAW A;  3DBL I;  2KLG A;  2V3S A;  3A9J A;  2WS3 B;  3TSS A;  5C2T B;  3H8H A;  4GDL A;  4W9I A;  4IOI E;  4DDG D;  1KM7 A;  3H7S A;  5IN7 A;  2KTF A;  2RMM A;  1C76 A;  4I6N B;  4ZRJ A;  3OG5 A;  2PLP A;  2LEK A;  2NPT B;  4GN1 A;  2L1A A;  2KX3 A;  2X8X X;  4MGK E;  1CMX B;  2J42 A;  2GBM A;  1YN4 A;  2W54 A;  2NBU A;  2WQY B;  1JWA D;  4RGM A;  3Q3N C;  2LMC A;  4EOY A;  2IO2 B;  3MC8 A;  2ZW1 A;  3EHV A;  3GOE A;  2JX5 A;  2K0P A;  2PEA A;  1T6B X;  1WM3 A;  3ALB A;  2D3G A;  3SD5 A;  3SFE B;  4WJN A;  4ZYN A;  3EC8 A;  2LVP A;  1KOT A;  2IO0 B;  2FBW B;  1IBX A;  2I1K A;  1AAR A;  5G5H A;  2L8J A;  4N59 A;  2WXQ A;  1IGD A;  4HLE A;  1FXT B;  2MCN B;  1D3Z A;  1WZ0 A;  5IOI A;  1SJH D;  1XCT L;  2D2Q A;  3WIM A;  3ZRF A;  5D3D A;  1D4B A;  4ANW A;  2KMA A;  2H89 B;  1T3Q A;  4BOS C;  1WY8 A;  3ABV B;  1GUA B;  3J9C A;  5IP4 D;  4L2Y A;  2CU3 A;  4AQ7 A;  2BB6 A;  3H9D A;  4URK A;  3AE5 B;  1FNW A;  2FUH B;  3JW0 X;  3AE9 B;  1E7P B;  1I4H A;  2XK5 A;  1T0Y A;  2NTS A;  3RN9 C;  3NZU A;  5DPW A;  2M0X A;  3M63 B;  3Q8B A;  3W5U B;  4BOZ B;  1XCQ L;  1WM2 A;  2KC1 A;  4ICV A;  1R7S A;  2V9H A;  4PS3 A;  2O2V B;  4HWI B;  2CS4 A;  3BIN A;  5TR5 A;  4AJY B;  3DVG X;  2AQ3 B;  1QT9 A;  4ASW C;  4IW0 A;  1U4A A;  1QOB A;  2JVC A;  2K8H A;  3EA6 A;  3HUI A;  2W3S A;  5CHF A;  1I4P A;  1SE2 A;  2FE8 A;  4JQW C;  3AE3 B;  4MT5 A;  2LXC A;  1HA5 A;  4XDC A;  4ARC A;  2B3A A;  5DPR A;  1E7U A;  2RPV A;  2J52 A;  1GC6 A;  1NEN B;  4FLH A;  3QC8 B;  5LXH A;  1KH0 A;  3VAW A;  1Q10 A;  1AW7 A;  3RUI B;  4A9A A;  3M95 A;  4XE0 A;  4HPL B;  2QCZ A;  4D2K A;  1VZ7 A;  1SJE D;  3D32 A;  1EM7 A;  1WFY A;  4DXA B;  1YJ1 A;  1P9D U;  2DX5 B;  5G5G A;  2K8C A;  5J18 A;  1SE4 A;  1TS2 A;  2K39 A;  2LJ5 A;  1FXA A;  1OEY A;  4LDT B;  1OQR A;  1R4M I;  5G2N A;  3L17 A;  2BT6 A;  4NJ6 A;  3Q8C A;  3HK0 A;  1D5Z C;  4XDD A;  1YMH E;  4M8N A;  1PQS A;  3DQV A;  1PUT A;  4K81 A;  4W9L A;  4YT0 B;  4HDQ A;  2WLB A;  2ZW0 A;  2KD0 A;  4G11 A;  1ZE3 D;  3EGR A;  1Z2M A;  2QDF A;  4G3X B;  4C7Y A;  4DWF A;  2PIA A;  2VH1 A;  4HJG E;  1TKY A;  1V97 A;  3B2G A;  3TUO A;  4ZHP A;  1GAQ B;  3DDC B;  3AEA B;  2BS3 B;  3P4P B;  5FR3 A;  1ACC A;  2L7R A;  1F0Z A;  1Q1O A;  3Q8A A;  4OZC A;  4F7Z A;  2AL6 A;  3DWG C;  3R7Q A;  3PZ8 A;  1B9R A;  2IGD A;  4BBN F;  1C4P A;  5J17 A;  3H6N A;  3PHX B;  4RGN A;  2KDI A;  1EWC A;  1X1M A;  2FCN A;  3WAP A;  2MBB B;  5AUI A;  3PLU A;  3APC A;  3ML8 A;  2L52 A;  1HXY D;  2DZK A;  4HCN B;  2CU1 A;  2RDG A;  1GG3 A;  1HTO A;  1MPE A;  3AEB B;  1XT9 B;  4ZRP A;  1SGH A;  3BY4 B;  2MX2 A;  3EUB 2;  2KQS A;  2N9X A;  1VD2 A;  1P7F A;  3OJ4 B;  3RI7 C;  2LRU A;  4KX6 B;  1QKZ A;  3OAW A;  4KV2 A;  1XXG A;  3AU5 A;  5T8I A;  1VLB A;  1WGK A;  1ISN A;  3Q6B A;  5GXG B;  4KKJ A;  2WX1 A;  1YQB A;  3W1Y A;  1FCL A;  1EO6 A;  1FFV A;  2MQJ A;  3JSV A;  1WX9 A;  4REZ A;  4US8 A;  2GBR A;  4JWS C;  1TY2 A;  4NQK E;  2E6X A;  2MBQ A;  3KUC B;  4M02 A;  3UQA A;  3ZQ4 A;  4LK0 M;  1MI0 A;  2JF5 A;  2DHZ A;  3LB8 C;  5EE9 A;  2Z8L A;  2KX0 A;  3FC4 A;  3NVV A;  2D3B A;  2K8B A;  2LXA A;  4N58 A;  2ZCB A;  1E9M A;  2WXJ A;  4WWO A;  4FJV B;  1DYQ A;  3APF A;  1JRO A;  1UWM A;  4OZA A;  1SIF A;  2JSV X;  2WU5 B;  3N20 C;  4C00 A;  5FR6 A;  2C9W B;  1HZ6 A;  1Q5W B;  2V3N A;  5FKA C;  4FXC A;  1JWB D;  2LGY A;  2K1F A;  4JL9 A;  1KFY B;  1SF0 A;  4YTM B;  1LXD A;  1SBB B;  4LNK A;  1UNS A;  1WE6 A;  4WJQ A;  4KZ0 A;  1ZW7 A;  2BYV E;  3ZW3 A;  4GU2 A;  1YX5 B;  2PW9 A;  1EWY C;  1E90 A;  1T0S C;  2M1M A;  3MTN B;  4W9C A;  1Y56 A;  2D5G A;  4WIP A;  1WXS A;  3K9P B;  3DOW A;  3BYT B;  1R4M B;  5HI1 A;  2MWS B;  3H7P B;  2VRR B;  3O13 A;  5IAA C;  1S3S G;  1IUE A;  1XLO A;  3U7Z A;  2NBV B;  1FD6 A;  4BKS A;  2MBO A;  5C3J B;  3KQ4 A;  2E3T A;  2LUE A;  4WWP A;  1JRP A;  3LXF A;  2KDF B;  3DHI C;  2C5L C;  2GOW A;  2IO3 B;  1WZ3 A;  3AEC B;  2DZI A;  1SIJ A;  3BK2 A;  2JRI B;  3OLM D;  3QK0 A;  3AUL A;  4DDI D;  1GJZ A;  1E8Z A;  4F8C B;  3P1M A;  3R7R A;  3VH3 B;  3PGE A;  3P4Q B;  1XQQ A;  2GLS A;  4J3O D;  4PS8 A;  2V4L A;  2K5P A;  5BMG A;  3VH4 B;  1GB1 A;  5D2M B;  3V05 A;  2RR9 A;  2G45 B;  2HE7 A;  2Z0E B;  4GLS C;  2L0F A;  2V4I B;  2G1E A;  2IZV B;  2DLB A;  3V61 A;  2ZCC A;  2MSE D;  2BQQ A;  4BFR A;  1UGJ A;  5AUK A;  2LGI A;  4S17 A;  1K51 A;  2GI9 A;  1OGW A;  2YEP B;  2IGH A;  4IWO A;  2ASQ A;  2M4N A;  1RFK A;  3IFW B;  2V1Y A;  3QAQ A;  3IAM 1;  1V5T A;  2AL3 A;  4JE3 B;  2BWF A;  4US9 A;  3R2I A;  1GB4 A;  2N9K A;  2SEB D;  3WAM A;  1T0Q C;  4HRS A;  4ANU A;  4ZRI A;  3KUD B;  1WWT A;  2KHW B;  2I2Y A;  3PPA A;  2FIF A;  1UUP A;  1WXQ A;  2IGG A;  4WJP A;  1Q0W B;  1JWS D;  2KO3 A;  2K6D B;  5IA7 A;  1MHH E;  3TJP A;  4HXD A;  1GOZ A;  4RM9 A;  2N9L A;  4MAC A;  2WXI A;  2WYQ A;  1UD7 A;  4P1B C;  2C7M B;  2MH7 A;  1E5W A;  2PVG C;  3A4S C;  1F77 A;  2KJ6 A;  2M19 A;  2N1W A;  1E7V A;  2BTE A;  3MC0 B;  4L23 A;  1JCK B;  2WNM A;  3GS2 A;  3TEZ A;  1PGA A;  2INP E;  1HE8 A;  2BBC A;  2Y5C A;  2BKF A;  3L0W B;  1EF1 A;  2WDV B;  3TIX A;  4AWJ A;  3VTU A;  4OHJ A;  3TL5 A;  4S0R A;  1HTQ A;  3ZRC A;  1HEZ E;  2WXO A;  3DBH B;  1WR6 E;  1ZPS A;  1UF0 A;  2EMS A;  4LNO A;  1ET6 A;  2HDE A;  2D3C A;  2KFJ A;  4YTN B;  3TBL D;  2N7E A;  1KLV A;  4FHJ A;  1B1Z A;  1YJI A;  3JVZ X;  3SU8 X;  3HM6 X;  3R2T A;  3APD A;  2CR5 A;  2RSU A;  1N5X A;  1YNT E;  3VUW A;  4HKQ A;  4RGT A;  3AEE B;  2GBN A;  3DBR B;  5L95 C;  5HKH A;  2N1V A;  4NJC A;  3ZXV A;  1FPY A;  1ZXI A;  3B9J A;  2BB5 A;  5KHO A;  2WXR A;  4IDI A;  1UZX B;  2LFI A;  1GPX A;  1CJE A;  4WWM A;  1LFD A;  5JZE B;  3NVZ A;  3T8M A;  5I4D A;  2DYM A;  4FJZ A;  2M8S A;  1YN3 A;  2J0K A;  5HG2 A;  3UIO B;  4XZ4 A;  1MVK A;  2LD9 A;  3HVD A;  4IWQ A;  3RNA C;  3NHE B;  3RNC C;  2LUM A;  4EZJ A;  3E56 A;  4C4V B;  4RF1 A;  1QOF A;  2HD5 B;  2L05 A;  5EDS A;  1FMA D;  2KWC A;  1QQR A;  4CYE A;  3ZNG C;  5EE1 A;  2ZPN A;  2N0S B;  4ZYS A;  5BYS A;  2PTL A;  1QOG A;  1ZP0 B;  4ANV A;  4WQM A;  1FRD A;  1KLG D;  1OQQ A;  1UH6 A;  3L54 A;  2ON8 A;  2CHW A;  3RUL A;  4ZRQ A;  3IHP C;  1V1P B;  2ZPY A;  3PHW B;  3ONS A;  1P1A A;  2Y5B B;  1LO5 D;  1WJU A;  5G55 A;  3AB5 A;  3FAH A;  3V6C B;  4E74 A;  2ZZP B;  4AS1 A;  4PK1 A;  1WGY A;  3UIN B;  4X57 B;  2EEL A;  4TMA B;  1ZUD 2;  1FXI A;  3EFU A;  1N63 A;  4DHZ B;  1NI3 A;  3BVG A;  1WX8 A;  4I6L B;  2WDR B;  4HJK A;  3ZNH B;  1CQV A;  1CK1 A;  2R2O A;  1VZ8 A;  3ZJU A;  3PVL A;  2NMQ A;  2QSD A;  4DHJ D;  1D6E C;  3IG3 A;  1XF5 L;  4H2A A;  2DBY A;  2INC C;  3ZLZ A;  2WXK A;  4LJP B;  4A3P A;  5BYR A;  5H8Y E;  3I57 A;  3H7P A;  3PZ7 A;  3X23 A;  4AOF A;  3PZD A;  3DVN U;  1KJT A;  4I6P A;  1FIQ A;  3I5J C;  2RPQ A;  2XBB C;  1BT0 A;  1N62 A;  3MJW A;  3VRA B;  3TEW A;  2JY6 A;  2JQR B;  2DYO A;  5AEK B;  4MGZ E;  4A6Q A;  4DXG A;  3DWM A;  3SDL C;  3FKY A;  2BW2 A;  1C79 A;  3E9S A;  1KLU D;  3BYY B;  3QHT A;  3HRD D;  1C4A A;  1EU3 A;  2LAS A;  2W9N A;  5L83 A;  2WXN A;  1A5R A;  4KSL C;  3CWI A;  2ICI A;  4NZL B;  1P7E A;  1N5W A;  2IDY A;  4JPS A;  5CTR C;  2WU2 B;  5MPO A;  1XEE A;  3QA8 A;  3WAN A;  1MG4 A;  3AED B;  1OEY J;  4KZC A;  1G6J A;  5E6N A;  4JIO U;  4OZB A;  4MH0 E;  4RF0 A;  4HPP A;  2KOX A;  2A4Z A;  1S1Q B;  2H88 B;  1K53 A;  4RNA A;  2PVO D;  1SSN A;  2MEK A;  4K7S A;  1YN5 A;  1SB3 C;  4AUQ C;  3UQB A;  1I7H A;  3UF8 A;  3UI3 A;  1V86 A;  2BS4 B;  2MBE A;  2J0M A;  1L4D B;  4NNJ B;  2KKC A;  1WE7 A;  2MJE A;  2N9P C;  4ZOH C;  3N1X C;  1C78 A;  4WAF A;  1FO4 A;  1DOX A;  1QF6 A;  4KGR A;  2OJR A;  2RD0 A;  2G4S A;  4HDO A;  4NAW B;  4JLC A;  4JGH B;  2RGF A;  3PRE A;  4PYU A;  2KLC A;  4HCP B;  3HM3 A;  1F2R I;  3CSF A;  4LNN A;  4FBJ B;  4IUM B;  2K9X A;  3TMP B;  5AZG A;  1MG8 A;  5D7G A;  1L6U A;  2AEH A;  3GP7 A;  1JRU A;  1DOY A;  2EKE C;  3URY A;  3KYC D;  4MJS B;  4HRO A;  3R8B A;  4LJO B;  2K3U A;  1WRD B;  3VUX A;  1L0Y B;  2OHF A;  2VH2 A;  2OED A;  1F1H A;  2D07 B;  2KAC A;  1HQR D;  3SFD B;  4GSW A; 
#chains in the Genus database with same CATH homology
 4W9J A;  3ZNI D;  2IY0 B;  1XQQ A;  4PS8 A;  2V4L A;  2NPT B;  4GN1 A;  4MGY E;  4P7I A;  1VCB A;  2KX3 A;  3ENE A;  4MGK E;  3U8Z A;  1CMX B;  3QAR A;  4GOC A;  2GBM A;  2JZZ A;  2HTH A;  2NBU A;  3Q3F A;  3VH4 B;  2KTR B;  4NQL B;  2KNB A;  5D2M B;  2RR9 A;  2G45 B;  2HE7 A;  2Z0E B;  2BKR B;  4BBN C;  2I1J A;  4ICU A;  2IO2 B;  2UYZ B;  4EOY A;  2L0F A;  2C60 A;  2JWZ A;  2IZV B;  3Q3J A;  1J8C A;  3HIZ A;  3LDZ E;  3EHV A;  4KDL B;  3QCA A;  3V61 A;  4TQ0 A;  2ZCC A;  3GOE A;  2NPT A;  2MSE D;  4BFR A;  2WX0 A;  5KHQ A;  2PEA A;  4E71 A;  4NY0 A;  2YLM A;  1OGW A;  1WM3 A;  3ALB A;  3EEC A;  3B0A A;  3PTF C;  2D3G A;  3SD5 A;  3PRZ A;  4IWO A;  2ASQ A;  2M4N A;  3DBH I;  3IFW B;  1OQY A;  4WJN A;  4ZYN A;  4BKG A;  2DZJ A;  4KIK A;  2FAZ A;  2V1Y A;  3EC8 A;  2LVP A;  3QAQ A;  4B95 A;  1KOT A;  2IO0 B;  1V5T A;  1WGR A;  2AL3 A;  2L0T A;  1NI2 A;  3NS8 A;  2BWF A;  2I1K A;  3SHQ A;  1LQB A;  4GIV A;  1AAR A;  4GGQ A;  3WAM A;  2L8J A;  2MBH A;  3AU4 A;  4ANU A;  4ZRI A;  3KUD B;  1WR1 A;  3A9K B;  1WX7 A;  4HLE A;  2AYO B;  1FXT B;  3A4R A;  2MCN B;  2LVQ A;  3RCZ A;  1F9J A;  1D3Z A;  1WZ0 A;  1WXA A;  1WJ6 A;  2KHW B;  2PJH A;  3PPA A;  1WMH B;  2FIF A;  2D2Q A;  3DBR I;  4WJP A;  1WIA A;  1Q0W B;  1XD3 B;  3WIM A;  3ZRF A;  2QHO A;  2KO3 A;  2KFK A;  2KMA A;  4IM2 A;  4ANW A;  5LXI B;  3M62 B;  2XK5 B;  2KQ7 A;  1SE9 A;  4BOS C;  2K6D B;  1WY8 A;  2REX A;  4ZRK A;  4MSM B;  4PYZ A;  4IG7 B;  4AP4 C;  5IA7 A;  5JHB A;  2BPS A;  2IYD B;  4W9F A;  1GUA B;  2MP2 B;  5CX3 A;  3V62 A;  3TJP A;  4HXD A;  1V2Y A;  3A1Q B;  3UGB B;  3PRP B;  3DVN V;  4RM9 A;  2ZJD A;  2WYQ A;  2DYB A;  3HHM A;  1UD7 A;  2WDT B;  2N9E B;  1ZKH A;  2C7M B;  2O6V B;  3H9D A;  4URK A;  2OOB B;  4G0N B;  1UBQ A;  2Z0D B;  4WJO A;  3WAL A;  2FUH B;  2FNJ B;  4OVU A;  1WYW B;  1E5W A;  2C7N B;  3C0R B;  3JW0 X;  4TKN A;  3A9J B;  2LGD A;  3A4S C;  2KJ6 A;  2XK5 A;  2N1W A;  4HPM B;  1T0Y A;  1E7V A;  3S2A A;  4GDL B;  3NZU A;  5JHA A;  3U30 A;  1WI0 A;  5DPW A;  4CHK A;  1P98 A;  2M0X A;  1HE8 A;  3M63 B;  2BKF A;  3NZS A;  4TUU A;  3L0W B;  1EF1 A;  3TIX A;  1IYF A;  2DEN B;  4AWJ A;  3VTU A;  4M0W B;  3TL5 A;  4J6I A;  4BOZ B;  3ZVV A;  3ZRC A;  1WM2 A;  3VUY A;  2KC1 A;  1V6E A;  4ICV A;  2CHZ A;  2HJ8 A;  4MDK E;  3VDZ A;  1WR6 E;  2EMS A;  4PS3 A;  2LRW A;  2O2V B;  4HWI B;  2CHX A;  3ECI A;  2KFJ A;  2CS4 A;  3BIN A;  5E6O A;  3TBL D;  2N7E A;  4EFO A;  1KLV A;  1R4N I;  4FHJ A;  2JRH A;  3JVZ X;  5TR5 A;  3SU8 X;  3DVG X;  4IWP A;  4AJY B;  4ASW C;  4IW0 A;  3HM6 X;  1U4A A;  4XC2 A;  3GZN I;  1TZ1 A;  3APD A;  2JVC A;  2K8H A;  2CR5 A;  2BGF A;  1L7Y A;  2JZ3 B;  3DVG Y;  2RSU A;  3PS6 A;  3VUW A;  5CHF A;  3OJ3 A;  2KAN A;  1K8R B;  1NBF C;  3ZIM A;  2KJR A;  4JQW C;  3JYU A;  4FUL A;  2BYE A;  1WGD A;  3PLV A;  2GBN A;  2LXC A;  5L95 C;  2O2V A;  5HKH A;  2B3A A;  2N1V A;  5DPR A;  5DPS A;  1E7U A;  3L08 A;  1GC6 A;  1UBI A;  2J0J A;  4FLH A;  3KUZ A;  2KDB A;  3QC8 B;  5KHO A;  5LXH A;  3VAW A;  3TCA A;  5E6P A;  1UZX B;  4IM0 A;  2JT4 B;  4KIK B;  4KVG B;  1LFD A;  3RUI B;  5JZE B;  3M95 A;  3T8M A;  3ZDT A;  3ZDM C;  4HPL B;  2DYM A;  1OTR B;  3QX1 A;  2M8S A;  4FJZ A;  2J0K A;  4XX5 A;  3D32 A;  1WF9 A;  1C3T A;  4MM3 A;  4NJ7 A;  3UIO B;  1WJ4 A;  3ZTD A;  1Y8R C;  4XZ4 A;  4W9D A;  1WFY A;  2GBK A;  3NOB A;  3VXW A;  2N7D A;  2LD9 A;  2N4F A;  4DXA B;  2JPH A;  1YJ1 A;  1P9D U;  2AWT A;  2DX5 B;  2YVC A;  4GMV A;  4IWQ A;  2KJH B;  3N30 A;  3O65 B;  3P2B A;  3NHE B;  2K8C A;  1WXV A;  5J18 A;  2K39 A;  4EZJ A;  4HK2 A;  4YL8 A;  2LJ5 A;  3T9L A;  1RRB A;  4FA6 A;  1OEY A;  1P3Q U;  3KH0 A;  4KSK C;  4LDT B;  4WAA A;  3CF6 E;  3CST A;  2KFK B;  2IBI B;  1R4M I;  5G2N A;  2HD5 B;  2KN5 A;  1I42 A;  2L05 A;  5EDS A;  4PS7 A;  3KYD D;  3L17 A;  4W9E A;  4NJ6 A;  1GNU A;  3HK0 A;  5LLI A;  3IVF A;  2KWC A;  4GDK A;  3ZKJ C;  3K9O B;  3ZO5 B;  4M8N A;  4CYE A;  1EF5 A;  1PQS A;  4W9H A;  3ZNG C;  3MHS D;  2ZPN A;  4W9K A;  3DQV A;  4K81 A;  2LZ6 A;  5C1Z A;  2D11 A;  2XEW A;  2ZVN A;  4W9L A;  4HDQ A;  4G11 A;  2KD0 A;  4ANV A;  4FHK A;  1Z2M A;  2FCS A;  1UH6 A;  3L54 A;  2NS5 A;  2D10 A;  4FJY A;  2K6Q A;  2KMC A;  4DHJ B;  4G3X B;  3I3T B;  4K7W A;  1H4R A;  2CKH B;  2BYF A;  4A3O A;  3QJZ A;  2CHW A;  3RUL A;  4B6W A;  3VTV A;  3PV1 A;  4DWF A;  3N32 A;  3IHP C;  4IC7 B;  1UGM A;  2ZPY A;  1IPG A;  3PHW B;  3W1S A;  3ONS A;  1P1A A;  2KDE B;  3L16 A;  4M8M A;  2KWV B;  2Y5B B;  4FN2 A;  2KWU B;  1J19 A;  2DZM A;  1WJU A;  3R3M A;  4A20 A;  2ZNV C;  4MGI E;  3DDC B;  4W9G A;  5G55 A;  4E3C A;  4KDI C;  2L7R A;  3V6C B;  2G4D B;  1YD8 U;  2ZZP B;  2ZNV B;  4E74 A;  1GC7 A;  3DBS A;  2FID A;  1V5O A;  4ZRJ A;  1WGY A;  3N3K B;  3UIN B;  4GB9 A;  3X0W A;  4X57 B;  1V9J A;  1Q1O A;  1RFA A;  4F7Z A;  1EUV B;  4RMA A;  3IBE A;  3EFU A;  2NCN A;  2AL6 A;  3R7Q A;  5J17 A;  4BBN F;  2DAJ A;  3H6N A;  4DHZ B;  2IO1 B;  3PHX B;  4N9F 4;  3R66 C;  2DAF A;  2A5U A;  2KDI A;  4G50 A;  4IM3 A;  1X1M A;  1WX8 A;  4I6L B;  4HJK A;  2FCN A;  3WAP A;  1WXM A;  2GMI C;  3ZNH B;  2MBB B;  4BVU C;  2R2O A;  3M3J A;  2GBJ A;  3PLU A;  3PVL A;  4EZK A;  3APC A;  2PE6 B;  4K1R B;  2JUO A;  1LM8 B;  3ML8 A;  2C7H A;  4DHJ D;  4ZDV A;  2FCM A;  2DZK A;  4HCN B;  2CU1 A;  3QIJ A;  1GG3 A;  1WGG A;  1XT9 B;  2PE9 A;  2KXJ A;  1I35 A;  3IG3 A;  1SGH A;  3VQI A;  4BKS D;  5C23 A;  3L10 B;  3AI5 A;  3NY5 A;  3PRM B;  1L2N A;  3PSE B;  3BY4 B;  2MX2 A;  3VHT C;  2KQS A;  2N9X A;  1VD2 A;  3OJ4 B;  4II3 B;  2O6V D;  3ZLZ A;  1E8W A;  1YX6 B;  4LJP B;  4A3P A;  3PT2 B;  4EUT A;  3ZTC A;  3CMM B;  3ZUN A;  3JSV B;  2LRU A;  4K7U A;  3H7P A;  2NBW B;  2KC2 A;  3OAW A;  3X23 A;  2BWE S;  4AOF A;  3PZD A;  4KV2 A;  3AU5 A;  3DVN U;  1KJT A;  2UWQ A;  4I6P A;  1ISN A;  1TBE A;  2RPQ A;  2XBB C;  3KW5 B;  5CHV C;  3RD2 A;  4AJW A;  2WX1 A;  1BT0 A;  4GDK B;  4DBG A;  1YQB A;  3MJW A;  2J7Q B;  4MJS A;  3W1Y A;  2PPH A;  4EKU A;  1EO6 A;  3QWZ B;  5CHW A;  2MLB A;  2MQJ A;  2JY6 A;  1WX9 A;  3JSV A;  4RM8 A;  5AZF A;  1WGH A;  3ZNZ B;  2DYO A;  2GBR A;  4NQK E;  5AEK B;  4MGZ E;  2MBQ A;  1TGZ B;  3KUC B;  3SDL C;  2IY1 B;  3QQ8 B;  5GMV A;  3UQA A;  1V81 A;  2BF8 B;  1P0R A;  3QHT A;  4MEM A;  3LJ3 A;  4B9K A;  2JF5 A;  2LAS A;  2WWZ A;  2DHZ A;  3AXC A;  3U7D A;  4HVB A;  2KX0 A;  3VFK A;  5D94 A;  3W1S C;  2W9N A;  2KZR A;  2LWP A;  5DCN A;  5L83 A;  5AZH A;  2K8B A;  1A5R A;  4KSL C;  2LXA A;  5DPT A;  2ZCB A;  3UIP B;  1V80 A;  4WWO A;  4FJV B;  2KTR A;  3APF A;  1J0G A;  5CTR C;  1ZGU B;  1SIF A;  1Z5S B;  2LI5 A;  4TV3 A;  1H8C A;  3ML9 A;  3QA8 A;  3WAN A;  5FR6 A;  2C9W B;  5D6J B;  1Q5W B;  3V6E B;  4CO7 A;  1OEY J;  4KZC A;  1G6J A;  2LGY A;  5E6N A;  4JIO U;  3B08 A;  2K1F A;  4JL9 A;  4MH0 E;  2KOX A;  2K25 A;  1RLF A;  2A4Z A;  3WAO A;  1S1Q B;  2MW5 A;  1V49 A;  2Z59 B;  1LXD A;  1E8X A;  1UEL A;  2MA9 B;  2L3Z A;  3RZW C;  3RYT A;  4K7S A;  4LDT D;  2FCQ A;  2G3Q B;  1NDD A;  1WE6 A;  3WA0 A;  4WJQ A;  4KZ0 A;  4AUQ C;  3UQB A;  3UF8 A;  4DK5 A;  1ZW7 A;  1V86 A;  2BYV E;  2EMT A;  2MBE A;  2NVU I;  2MRP A;  1RAX A;  3VTW A;  2J0M A;  2KVR A;  3ZW3 A;  4GU2 A;  4WQO B;  4NNJ B;  1YX5 B;  2KKC A;  1WE7 A;  2N9P C;  4MEL A;  3A9K A;  4WWN A;  1WJN A;  3VVW B;  4EZL A;  2NR2 A;  1E90 A;  1YIW A;  2R2Q A;  4BKT A;  2ZVO A;  2OJR A;  2M1M A;  2RD0 A;  2G4S A;  3MTN B;  3B1L X;  2KK8 A;  4HDO A;  4W9C A;  1WMH A;  4NAW B;  4II2 B;  1WXS A;  4JLC A;  1IP9 A;  4JGH B;  4TQ1 A;  3K9P B;  3L13 A;  4FAD A;  3DCG A;  3DOW A;  4LCD E;  1WH3 A;  1E8Y A;  3DPD A;  2MWS B;  2RGF A;  3H7P B;  2VRR B;  5IAA C;  3PRE A;  1S3S G;  2KLC A;  4HCP B;  2JXX A;  3A33 B;  1TTN A;  4NPN A;  4PYU A;  3HM3 A;  2MP2 A;  2NBV B;  3CSF A;  4EEW A;  3KVF B;  3RT3 B;  4FBJ B;  2LVO A;  3A1Q A;  4IUM B;  5J2R A;  2M17 A;  2ZEQ A;  4BKS A;  3TMP B;  2MBO A;  5AZG A;  1MG8 A;  5JH5 C;  5D7G A;  2AEH A;  4MSQ B;  5BO4 B;  2LUE A;  1JRU A;  4OVV A;  2O6V A;  4WWP A;  4ANX A;  4GXB A;  2EKE C;  4DHZ E;  2KDF B;  3KYC D;  4MJS B;  2C5L C;  4NAW A;  3DBL I;  2GOW A;  2KLG A;  2IO3 B;  1QZE A;  2V3S A;  2LGX A;  3A9J A;  4LJO B;  1WRD B;  3VUX A;  1WZ3 A;  1C1Y B;  2DZI A;  4GDL A;  3OLM D;  2JRI B;  4W9I A;  3RZF A;  1M94 A;  3QK0 A;  3H1U A;  4DDG D;  1KM7 A;  3AUL A;  3H7S A;  2KTF A;  4DDI D;  1GJZ A;  2L00 B;  1E8Z A;  3V60 A;  4F8C B;  2D07 B;  2L76 A;  4I6N B;  3R7R A;  4F1S A;  3VH3 B;  4GSW A;  3PGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...