4KDLB

Crystal structure of p97/vcp n in complex with otu1 ubxl
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
69
Chain Sequence
b'SMKLKVTGAGINQVVTLKQDATLNDLIEHINVDVKTMRFGYPPQRINLSLGQTQLDELGINSGEKITIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
molecule tags Signaling protein/hydrolase
source organism Homo sapiens
publication title Structural Basis for Ovarian Tumor Domain-containing Protein 1 (OTU1) Binding to p97/Valosin-containing Protein (VCP).
pubmed doi rcsb
total genus 15
structure length 69
sequence length 74
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kdlB00
2M0XA 2KDBA 2N1WA 1UH6A 2KMCA 1KOTA 4OVUA 2BYVE 3ZW3A 2C7HA 4A3OA 2PPHA 2BKFA 3NZSA 3PHWB 4F8CB 1KLVA 4IC7B 1H4RA 2KK8A 4KV2A 4NNJB 3NOBA 3Q3JA 2KLGA 4LJOB 3Q3FA 2DYBA 2M4NA 2MBHA 5FR6A 1WR6E 2BKRB 3VDZA 5D7GA 3W1YA 3WAOA 2V3SA 1NI2A 2N7EA 3ZTDA 2MA9B 1E8WA 1WXSA 2C60A 1AARA 1V5TA 1E8YA 4IW0A 2CS4A 1S3SG 4KZCA 4ICVA 2BPSA 2DZKA 2KWUB 3VAWA 4E71A 2ZCCA 4G50A 2KC1A 4X57B 4ZRKA 4FA6A 3PZDA 1WJ4A 3VFKA 3V62A 1OQYA 2Z59B 5CHVC 4HPMB 2KHWB 2KWCA 3HK0A 2IY1B 1CMXB 5AZHA 3WIMA 3ZKJC 2KFJA 4KIKA 1WJUA 2UWQA 1XQQA 2C5LC 3UIPB 2N9PC 4M8MA 1EO6A 1GJZA 3A1QB 1I42A 3PPAA 4G0NB 4G3XB 2KJ6A 2KQSA 1YD8U 3DVGX 3H7PA 4PS8A 2MQJA 2L76A 4GXBA 3V61A 4MH0E 4GU2A 4IWOA 3SU8X 1GNUA 3O65B 4GSWA 2J0JA 3SHQA 5E6OA 3WANA 3U7DA 4MSQB 4NPNA 5DPRA 5AEKB 2IO1B 2M17A 2IO2B 2MBOA 3M95A 2IO3B 2MRPA 4NJ7A 3WAMA 5G2NA 1ISNA 3H7PB 4BBNF 4P7IA 3AU5A 4NJ6A 2ZPYA 4URKA 2ZVNA 4WJQA 2NBVB 2ZVOA 4BVUC 5CTRC 1WR1A 1ZW7A 1P1AA 4AP4C 2C9WB 2PEAA 4BOZB 4F7ZA 3NS8A 2RSUA 4K7WA 3ZLZA 3L10B 2O2VA 3VUYA 2MW5A 3M3JA 5DPWA 2DZJA 3IVFA 4MELA 3UQBA 2LI5A 2L0TA 4HK2A 2LWPA 1WF9A 2ZJDA 4AUQC 4MGYE 4KZ0A 2KTFA 1RRBA 4HVBA 1WGYA 3BY4B 4JIOU 4JGHB 3UIOB 2HTHA 1WJ6A 2BWFA 3L17A 4I6PA 4BKGA 4FHJA 4CYEA 4W9KA 3VTWA 3LJ3A 2B3AA 4TV3A 4DDID 3WAPA 4MJSB 2DZMA 4JQWC 2REXA 5IAAC 2NR2A 4KSLC 3RD2A 1QZEA 2MLBA 3AULA 3TJPA 1V86A 2LGXA 3PS6A 3ALBA 4ZDVA 2FCQA 1IP9A 3QK0A 4N9F4 4DHJB 4GN1A 1UELA 2L3ZA 2N9XA 3VXWA 4DBGA 4W9GA 1SIFA 2KDFB 5J17A 1WE6A 2NBWB 3QQ8B 4BBNC 4ANUA 2NS5A 3WALA 4FHKA 4GDKB 2WYQA 3PGEA 2KC2A 2LGYA 5JH5C 1V2YA 4MJSA 4KDLB 4LCDE 3VH4B 2BYFA 4II2B 4HCPB 4GIVA 2UYZB 1UZXB 2O2VB 3OJ3A 3EC8A 3U30A 3DVGY 3T9LA 1P3QU 4KIKB 4HXDA 1ZGUB 2O6VD 4NAWB 4ZRIA 4PYUA 1YJ1A 2WX1A 1C3TA 5JHAA 2LRUA 4KVGB 2XK5A 3T8MA 1VD2A 4B9KA 3APFA 4E74A 5DPSA 1RLFA 4HDOA 2JPHA 2IYDB 1WX9A 4FULA 3L0WB 1H8CA 2KX3A 1E7UA 3QA8A 2YLMA 2OOBB 1RFAA 4EZLA 1WJNA 2FIFA 3ZVVA 2D2QA 3DCGA 2MWSB 4CHKA 1K8RB 3QHTA 4NAWA 4A20A 3ZDTA 1C1YB 1Y8RC 2ZEQA 2CHZA 2R2QA 3HHMA 1IYFA 2KJHB 4WJNA 1BT0A 4AOFA 4TQ0A 2KN5A 1SGHA 3L16A 2CKHB 4K7SA 4HPLB 1D3ZA 3JSVB 2BWES 1GC7A 5BO4B 2KTRA 2WX0A 2QHOA 4GDKA 4HCNB 2K8BA 3DBHI 3KYCD 3ZNID 3PLVA 2PE6B 4GDLA 1L2NA 4LDTB 4AJWA 2D3GA 3AI5A 2YVCA 4IM0A 4EFOA 1LQBA 3R3MA 1MG8A 5JZEB 1V5OA 1R4MI 1KJTA 4MGKE 3WA0A 4HLEA 3LDZE 3CSFA 2FIDA 4KSKC 2XBBC 4BOSC 3IBEA 5EDSA 3JSVA 2AL6A 2JXXA 3OJ4B 4J6IA 3PVLA 1UGMA 2MSED 4B6WA 5D94A 1GUAB 4WWOA 1J0GA 1WX7A 1E8ZA 1NDDA 2GBNA 4M0WB 4JL9A 4GDLB 2IO0B 2LD9A 4MM3A 3SD5A 2NCNA 1WMHA 4W9EA 2C7NB 3CMMB 5C23A 3ZIMA 4DWFA 3K9PB 3QC8B 2JZZA 2DYMA 4TQ1A 4WJPA 4BKSA 1IPGA 1M94A 4G11A 1VCBA 5AZFA 1L7YA 2JY6A 3RZWC 4PYZA 3A1QA 4CO7A 4BFRA 4NY0A 2DAJA 2FCNA 3VQIA 3RYTA 5JHBA 2GOWA 3H9DA 1WXMA 3VHTC 4GOCA 4B95A 4LJPB 5LXIB 2L0FA 2DAFA 4ASWC 2KXJA 1WGDA 4YL8A 1LXDA 2K8HA 3UF8A 4ANVA 3RZFA 3A4RA 2L00B 4EUTA 2LZ6A 2J0MA 2KFKB 2K6QA 3H6NA 3CSTA 2GBJA 2LVPA 4K1RB 1E8XA 1WGRA 2D11A 1EUVB 3VTUA 1WRDB 3PREA 2K6DB 3IHPC 4W9IA 3V60A 2BYEA 4MEMA 3PHXB 5C1ZA 3L13A 3MTNB 3AXCA 2V1YA 3PTFC 3TIXA 2LRWA 4ANXA 3H1UA 3QWZB 3RCZA 2HD5B 2LGDA 2LJ5A 2A4ZA 2Z0DB 2JVCA 3DBLI 2HE7A 3ZRCA 3QJZA 1PQSA 2ZZPB 4DHZB 4DHJD 2CR5A 2ZCBA 3EFUA 1V81A 4ICUA 4EKUA 4WWPA 2K39A 2KANA 3KH0A 4RM8A 2LUEA 2FCMA 4AJYB 3BINA 4XC2A 3KUCB 4K81A 5KHOA 3R7RA 1JRUA 4NQLB 4IWQA 1WFYA 3IFWB 2DZIA 5LLIA 2JZ3B 3U8ZA 2FCSA 1SE9A 3PRZA 1FXTB 3AU4A 2WDTB 3OLMD 1WZ0A 5AZGA 1P0RA 3C0RB 2KNBA 4FADA 2I1JA 3S2AA 3DQVA 2KFKA 4WQOB 3QCAA 3APCA 4BKTA 1GG3A 4FBJB 2KDEB 2GBMA 1OGWA 4XX5A 2KX0A 3PRMB 3X23A 1WXVA 2JT4B 3DVNU 2IY0B 3H7SA 3EECA 3TL5A 5E6NA 3VTVA 3ZNHB 3CF6E 2LVQA 3SDLC 4EEWA 3ZNGC 2JF5A 5DPTA 3B1LX 5L83A 2G4SA 1WMHB 3DDCB 3DOWA 1WY8A 1OEYA 1YIWA 2KWVB 1U4AA 4TUUA 4WJOA 2KZRA 1LFDA 3TBLD 4DXAB 4DHZE 3DBRI 5KHQA 3A33B 4W9CA 4OVVA 2JRIB 2XK5B 2M1MA 2G3QB 1WM3A 5J2RA 2RR9A 4IWPA 2L05A 4EZJA 2OJRA 1TTNA 1OEYJ 4FJZA 2CHXA 3A9KB 3EHVA 3QX1A 4WWNA 3ZTCA 2K8CA 2RPQA 3APDA 3PT2B 1Q5WB 4F1SA 4HJKA 4EZKA 5D2MB 3V6CB 3L08A 4GB9A 1WGHA 2MX2A 2LVOA 1Z2MA 2AYOB 2BGFA 2FNJB 1WE7A 4XZ4A 2IBIB 4HDQA 3NHEB 1UD7A 3TCAA 2KVRA 4NQKE 1UBQA 1EF1A 3KYDD 2FAZA 3OAWA 1OTRB 4IM2A 4TKNA 1YX5B 2R2OA 3JW0X 2KQ7A 1WM2A 2KMAA 2MBEA 2C7MB 1P9DU 2MP2B 2ZNVC 3ENEA 1Q1OA 2L8JA 3N30A 1V6EA 1EF5A 2M8SA 2KTRB 2N4FA 1J8CA 3GOEA 2PJHA 2V4LA 1WYWB 3JVZX 2NPTB 1YX6B 2K25A 2EMSA 3N3KB 2IZVB 3NY5A 4W9FA 2I1KA 4I6LB 3D32A 3UINB 3KUDB 3M62B 2BF8B 2CHWA 4RM9A 5GMVA 1TBEA 2KJRA 2KO3A 3ZDMC 4BKSD 3A9JB 4ZRJA 1WIAA 3IG3A 2G45B 3JYUA 2GBKA 1G6JA 1RAXA 3HM6X 2FUHB 2DX5B 2MP2A 3KW5B 2RD0A 2RGFA 3MJWA 4DK5A 1UBIA 1R4NI 3PV1A 3W1SC 3A9KA 1X1MA 3DBSA 2L7RA 1WGGA 2XEWA 2GMIC 2DENB 2NPTA 4AWJA 3UGBB 2CU1A 2NBUA 5CHWA 4A3PA 4I6NB 2KKCA 3HIZA 4PS3A 5HKHA 2G4DB 1TZ1A 1NBFC 1Q0WB 3UQAA 1V49A 2KDIA 2HJ8A 3QIJA 2EMTA 5E6PA 1J19A 1GC6A 3GZNI 3W1SA 2JWZA 3K9OB 4K7UA 2N1VA 4WAAA 2KOXA 4ANWA 3QARA 3R7QA 2O6VA 4FN2A 4II3B 2Y5BB 3VUWA 2ASQA 3PRPB 1S1QB 3KVFB 4MGZE 2J7QB 3ZUNA 4W9JA 2KD0A 3A4SC 4FJVB 4MGIE 4JLCA 4IUMB 3ML9A 2GBRA 4LDTD 3RUIB 2DHZA 5IA7A 4FLHA 3A9JA 4MSMB 3NZUA 4MDKE 2LXCA 1E90A 4W9DA 5DCNA 3DVNV 4E3CA 1LM8B 5J18A 5TR5A 2J0KA 2O6VB 3I3TB 3VVWB 3P2BA 1A5RA 4M8NA 3VUXA 3X0WA 2AEHA 3B08A 3KUZA 4RMAA 4EOYA 5CHFA 3ZO5B 3PSEB 2D07B 2MBQA 2VRRB 3PLUA 2N9EB 4W9HA 1XD3B 4GGQA 3ZRFA 2D10A 3R66C 2K1FA 1T0YA 1Z5SB 2ZNVB 4W9LA 3DPDA 4IM3A 2AWTA 2LXAA 1YQBA 3HM3A 2LASA 4DDGD 3L54A 1E7VA 2WWZA 1WZ3A 1P98A 4FJYA 3RULA 2N7DA 2MBBB 1V9JA 3ML8A 2DYOA 1WXAA 3ZNZB 3V6EB 1V80A 1WI0A 1ZKHA 3VH3B 5G55A 4GMVA 4KDIC 1I35A 3MHSD 3B0AA 1TGZB 5CX3A 1WH3A 2PE9A 3TMPB 1KM7A 2Z0EB 3N32A 1F9JA 2EKEC 5L95C 1HE8A 2A5UA 5D6JB 5LXHA 2JRHA 2NVUI 2ZPNA 4HWIB 4PS7A 2KLCA 3ONSA 4IG7B 2MCNB 3ECIA 2AL3A 3RT3B 1WX8A 1XT9B 3QAQA 4ZYNA 3M63B 2W9NA 1E5WA 2JUOA
chains in the Genus database with same CATH superfamily
1KOTA 3E9SA 3NOBA 3Q3FA 1XCQL 3TSSA 1E7PB 3ZTDA 4WAFA 4IW0A 2DZKA 3DWMA 2I2YA 4ZRKA 3HUIA 1ZDVA 1CMXB 2WDVB 1WJUA 1J7AA 4RGOS 2WXIA 4M8MA 1QLBB 3A1QB 3DHIC 1I42A 1FM0D 2BB5A 4BAXA 2GLSA 2L83A 2MQJA 2L76A 4GXBA 1ZUD2 2LMCA 3E56A 4GU2A 4GLSC 4XWWA 4GSWA 2J0JA 2IGHA 3WANA 4MSQB 5DPRA 4A8XC 1L0XB 2IO2B 3WAMA 5G2NA 3H7PB 1JWSD 2ZVNA 5CTRC 2N9LA 2C9WB 3ZJTA 2RSUA 1TS3A 3L10B 2O2VA 3PZ7A 4LNOA 2BB6A 2MW5A 3M3JA 4K3CA 5DPWA 2DZJA 3IVFA 1TJEA 2LI5A 1FNVA 2QC8A 2ZJDA 3MC8A 4AUQC 2JYEA 2QJLA 4HVBA 1I35A 4JGHB 2HTHA 2BWFA 4DXFA 3VTWA 3LJ3A 2B3AA 2JX5A 3AN1A 2REXA 2NR2A 4KSLC 1YQ3B 4ZDVA 3QK0A 4DHJB 4M02A 1UELA 2JYTA 1ET9A 3VXWA 4UDUC 2KDFB 2R61A 3AE5B 3WALA 1MHXA 2IDYA 3MHZA 2WYQA 3BK1A 1SE2A 1ACCA 3AECB 4HCPB 2O2VB 1HZ5A 3OJ3A 4ITKA 3DVGY 3T9LA 4KIKB 4HXDA 2ONQA 3B2GA 4NAWB 4ZRIA 1N61A 1CK1A 2LRUA 3B2FA 5DPSA 3I9V1 5BYQA 3L0WB 1H8CA 1LO5D 1E7UA 3QA8A 2YLMA 1RFAA 3DCGA 1MVKA 2MWSB 1K8RB 4A20A 3HHMA 4NAMA 1SGHA 4K7SA 1D6EC 1GC7A 1L4ZB 5BO4B 3ZJVA 1JALA 2INDC 2QHOA 2W3SA 1R7SA 2K8BA 3DBHI 3FC4A 1AWDA 4AJWA 2CJNA 2YVCA 5JZEB 2H88B 4LNKA 3WA0A 3P42A 5H8YE 2V3NA 5EDSA 3JSVA 1N6ZA 2JXXA 3OJ4B 4J6IA 1T0RC 5D94A 5AUKA 1R4NB 4JL9A 2LD9A 1XLOA 1WMHA 2C7NB 3CMMB 2JZZA 4WJPA 4BKSA 1IPGA 2JY6A 4CO7A 1JRPA 4GOCA 5LXIB 2GI9A 2KXJA 1FNUA 4MACA 4MM3B 1LXDA 3UF8A 5HFYA 1FXAA 3A4RA 2L00B 2LZ6A 3LYYA 1R4MB 3NUHB 2GBJA 3AEEB 3AE4B 1MPEA 4W9IA 3AE3B 4MEMA 3QWZB 2QSDA 3U2SC 3ZRCA 3QJZA 1PQSA 4DHZB 2CR5A 2K9XA 2RDGA 2JZPA 3W9CB 2WXGA 3EFUA 3RNEC 4EKUA 1JCKB 3MJ5A 2LUEA 2EKIA 3KUCB 5KHOA 4C56C 4IWQA 1WFYA 2JZ3B 2FCSA 2BS2B 3PRZA 5AZGA 1V97A 4FADA 2LUMA 3S2AA 3DQVA 4BKTA 5I4DA 1IBXA 2KDEB 2GBMA 3DHGC 1Q10A 3PRMB 3X23A 1UNSA 3H7SA 3VTVA 3EECA 3SDLC 1JWBD 5L83A 2AQ3B 4RGMA 1JMLA 2WXJA 4JPSA 2G3QB 1WM3A 4IWPA 4EZJA 2OJRA 3BK2A 3BWUD 1WRIA 2L32A 3P4PB 1Q5WB 3OWEB 2Y3AA 2W54A 5EE1A 4XZ4A 4NQKE 2Q5WD 1BMLC 1WWTA 2MBEA 2KWDA 1Q1OA 1V6EA 2M8SA 2K22A 2V9HA 1J8CA 2PJHA 2V4LA 1KLUD 1WYWB 1EU3A 3NY5A 1E0ZA 3TEWA 4I6LB 3D32A 2SEBD 2CU3A 2J52A 2CHWA 4RM9A 3GS2A 2AX5A 2G45B 1G6JA 2GBKA 3HM6X 2MP2A 2RD0A 3AM9A 4YSZB 3DBSA 3UI3A 1HXYD 2WP9B 2DENB 2NPTA 2D3BA 3Q69A 4WIPA 4A3PA 1GB4A 1TZ1A 1NBFC 1GAQB 5EE3A 1PGAA 2HJ8A 3QIJA 1SXTA 1TYGB 3GZNI 3W1SA 1ZPSA 3R7QA 2KQ4X 3ABVB 1S1QB 5HI1A 3BYYB 3ZUNA 2KD0A 1T0SC 4RNAA 4IUMB 2M0AA 1JQ4A 2GBRA 4LDTD 5IA7A 4FLHA 2MEKA 3SFEB 4MDKE 2LXCA 2KDMA 3ZQ4A 2N7JA 3EFCA 2O6VB 3VVWB 3P2BA 1FRDA 2LEKA 4RMAA 3ZO5B 2V4IB 2JXTA 2MBQA 1NENB 1ZE3D 1RFKA 2WXHA 1XD3B 2D10A 5EE0A 4IM3A 4XDDA 1YNTE 1WYGA 3HM3A 2HJ1A 4JE3B 3Q2AC 2LGSA 3AE1B 1NEKB 4FJYA 2MBBB 1WXAA 3ZNZB 3P4RB 3V6EB 1HA5A 4XWTA 3KQ4A 1WH3A 1KM7A 2WS3B 2LFIA 1HE8A 5LXHA 4L1BA 4IG7B 3RN9C 1YOVB 3N1ZC 1I4RA 2AL3A 1WX8A 2KYWA 3GB1A 3R2TA 2N1WA 1HQRD 5BMGA 2BYVE 1VZ7A 3ZW3A 2WXLA 1UF0A 2BKFA 3NZSA 1I4QA 4IC7B 4NNJB 3Q3JA 2KLGA 2M4NA 2BKRB 2WHIA 5FR3A 5H92C 3RPFC 3WAOA 3BZDB 2BQQA 1NI2A 1E8WA 2C60A 2CS4A 1S3SG 1V8CA 1GB1A 3VAWA 2ZCCA 3BVMA 4OZCA 4EE2A 4FA6A 2WQYB 1EM7A 3PZDA 1WJ4A 1WXQA 4TMAB 2Z59B 2NTSA 2KHWB 2KWCA 2BTEA 5AZHA 4DXGA 2UWQA 3UIPB 1CQVA 1EO6A 1GJZA 1TS2A 3PPAA 4JX1C 3DVGX 3P63A 1TIFA 4C7ZA 3V61A 2VH1A 3MC9A 1GNUA 2K3UA 2WXKA 3SHQA 2QMTA 3SEBA 2M17A 1ISNA 1RYJA 1XO3A 2WXPA 4URKA 2NBVB 4BVUC 1ZW7A 4OVZA 2PEAA 4F7ZA 3NS8A 4YWGG 4IDIA 3W2DA 4MELA 1FXIA 3UQBA 3R8BA 1XEEA 2L0TA 1V1OA 2J4XA 1WGYA 4I6PA 2WXFA 4TV3A 4DDID 3WAPA 4MJSB 1QZEA 3AULA 3TJPA 2LGXA 2FCQA 2OHFA 4N9F4 1F0ZA 1SF0A 1IBXB 4YXDB 2JSVX 5J17A 4FHKA 2J53A 4GDKB 3Q8CA 4DQOC 2KC2A 5BYSA 1EU4A 5JH5C 1V2YA 4XGAB 4LCDE 1GOZA 3P4QB 4II2B 1UUPA 2UYZB 3EC8A 1K53A 2RDHA 4PYUA 2WX1A 4KVGB 4L2YA 3T8MA 3APFA 4CQNA 3KLSX 2QILA 2IYDB 1AYFA 4FULA 2KX3A 1YMHE 4EZLA 2D2QA 1ESFA 4NAWA 1MI0A 1C79A 1Y8RC 2ZEQA 2CHZA 4TQ0A 1I4HA 4HPLB 1TY2A 3CIRB 4GDKA 3U7ZA 2FE8A 4GDLA 4ZYSA 4LDTB 2WNMA 1LQBA 2ICIA 1KJTA 4MGKE 4HLEA 3N20C 2EELA 3RI7C 4KSKC 2XBBC 3ZJUA 3IAM1 5IO9A 2KVZA 2G9HD 4B6WA 1J0GA 1NDDA 1PDXA 2IO0B 1T3QA 4AQ7A 2WXQA 4DWFA 5C23A 4TQ1A 2K0PA 1M94A 2WXNA 1VCBA 1F77A 5AZFA 2QCZA 2DAJA 2GOWA 4P1BC 1I7HA 1MFWA 4B95A 4ASWC 3B9JA 2ZW1A 2KFKB 2LVPA 1YN5A 1E8XA 4LK0M 3VTUA 1TZOA 3IHPC 4ACFA 2DLBA 3V60A 3PHXB 3NZ3A 1J7CA 2HD5B 1FIQA 3NJTA 2Z0DB 3DBLI 2HE7A 4WH4A 4XYCA 2FUG1 1V81A 4ICUA 4WURA 2K39A 2KANA 3KH0A 1OQQA 3IT6B 3R7RA 1TT5B 2WDTB 3HVZA 3C19A 4LNFA 2I1JA 2WU2B 1JWMD 2KFKA 1L0VB 4P1CC 4FBJB 3AB5A 1F1HA 2H89B 2CJOA 2D3AA 4XX5A 5G5GA 1BXTA 3ZNHB 2LVQA 1JW9D 4ZHOA 3ZNGC 5DPTA 2M56B 2INNE 3B1LX 3FILB 2G4SA 3T3NA 1YIWA 3TEYA 3ZXVA 4OVVA 3T3OA 2XK5B 3NG0A 1UGJA 2CHXA 3A9KB 3QX1A 2RPQA 2WXOA 4EZKA 2KT7A 4GB9A 2LVOA 1Z2MA 3NHEB 2G1EA 3TCAA 1UBQA 4TKNA 2FAZA 1YX5B 1P9DU 2Y5CA 3ZGZA 3JVZX 2IZVB 2I1KA 3KUDB 1TKGA 3M62B 5GMVA 4BKSD 2KO3A 1N5WA 1EWYC 1UWMA 4ZRJA 1WIAA 3RNFC 1F2RC 1RAXA 2DX5B 3KW5B 2RGFA 2NMQA 3GE8C 1MG4A 1ZP0B 1F52A 3W1SC 4P6VF 3A9KA 1X1MA 1FCLA 2XEWA 1KH0A 4ZRPA 2L52A 1P7FA 2NBUA 5IOIA 3HIZA 5HKHA 1V49A 2HDEA 1D5MC 5C2TB 1J19A 1GC6A 1OFFA 4XE0A 2JWZA 3K9OB 1JWUD 2KOXA 2Y5BB 3PRPB 1L4DB 3KVFB 2WDQB 2KN4A 4FJVB 3N9YC 3ZXRA 4ZHPA 3ML9A 3RUIB 3TEZA 3FKYA 4W9DA 3DVNV 4E3CA 5TR5A 3BVGA 1FCCC 4L23A 2AEHA 2E6XA 3B08A 3OG5A 4P16A 1WSPA 5CHFA 3PSEB 2D07B 2N9KA 2VRRB 3PLUA 2N9EB 3I63C 1KF6B 2LGIA 4IOIE 4DDGD 1N63A 1QKZA 1E7VA 1HTQA 2QEJC 3RULA 1V9JA 3KWVA 2DYOA 4QAYA 5G55A 3C8YA 3B0AA 1TGZB 2PE9A 1PGBA 4B0EA 1C4CA 5D6JB 2NVUI 1NI3A 3NRZA 2W9NA 3M63B 1E5WA 2JUOA 3Q8AA 2M0XA 1I4PA 2KDBA 1UH6A 2KMCA 4ZRQA 3GZNB 4OVUA 2C7HA 3PHWB 4F8CB 1KLVA 1H4RA 2KK8A 3AE7B 4KV2A 1ZOYB 1VLBA 2MBHA 1WR6E 1T6BX 1NYQA 1N5XA 1DOYA 3W1YA 4ARIA 1WXSA 1V5TA 1E8YA 4KZCA 4ICVA 4E71A 5IKCM 4FXCA 1XF5L 2BVCA 2VH2A 4US9A 1OQYA 3AEGB 1QILA 2KMMA 4HPMB 3WIMA 1DOIA 3ZKJC 2KFJA 4KIKA 1PGXA 1RM6C 4YTPB 2KJ6A 1YD8U 1C76A 4PS8A 3PO0A 4KGRA 3NS1A 4MH0E 4IWOA 3VR9B 3LB8C 3O65B 5HHDG 5E6OA 1IGDA 3U7DA 3W5UB 4B0MA 2IO1B 1XXGA 4YT0B 1DOXA 2DBYA 2IO3B 2MRPA 4BBNF 1CZPA 3AU5A 2ZPYA 1WR1A 4AP4C 1P1AA 3P4SB 4BOZB 4K7WA 1FO4A 4HK2A 2LWPA 2X38A 4RF1A 4MGYE 1K50A 3BY4B 4JIOU 1WJ6A 3L17A 5BMIA 4CYEA 1QT9A 1C4PA 3BVZA 4JQWC 2B76B 3RD2A 1V86A 3AEDB 4A6QA 4GN1A 2L3ZA 2N9XA 1C78A 4W9GA 1WE6A 2NBWB 1AW7A 4BBNC 3Q3NC 4ANUA 4HJGE 2INCC 2KAJA 4MJSA 4KDLB 2WGSA 4N58A 4C00A 3VH4B 4KX6B 4A55A 4GIVA 1SBBB 3U30A 1P3QU 4C80A 1C3TA 2XK5A 1ENFA 4B9KA 1VD2A 2MH7A 4E74A 1TKEA 2Z8LA 4HDOA 5FKAC 1WX9A 1FD6A 1N62A 3TEXA 3N1XC 3ZVVA 4CHKA 2MJ3A 3QHTA 2LHEA 3VR8B 3O13A 3ZDTA 1YJIA 1IYFA 2R2QA 4WJNA 2KN5A 3DWGC 3L16A 2UU7A 1SE3A 1YN3A 3GP7A 2WX0A 4HCNB 3KYCD 2DNFA 4M0WA 4RCOA 1MG8A 1V5OA 4HKQA 2FIDA 3IBEA 1FPYA 4HEA1 4WQMA 1WGKA 4C4VB 2NTTA 2FBWB 1YQ4B 2MSED 1WX7A 2GBNA 3HRDD 3RNCC 4GDLB 2INPE 4W9EA 3AEBB 5AUIA 3ZIMA 2ACZB 4PYZA 4BFRA 3SR6A 2FCNA 3VQIA 3RYTA 1WXMA 3VHTC 4NZLB 2K8HA 4EUTA 2BS3B 1FMAD 1WGRA 2D11A 1EUVB 1WRDB 3PREA 4KGSA 5C1ZA 3PTFC 2LRWA 1D5XC 3ETRA 4US8A 2LGDA 2OEDA 2W55A 3WCQA 3W5VB 2ZZPB 1ZXHA 3MC0B 2ZCBA 2LHDA 1VZ6A 2BS4B 2FCMA 4KGTA 4AJYB 3BINA 4S0RA 2YEPB 4XC2A 4K81A 1JRUA 4NQLB 5LLIA 3IFWB 3U52E 1PFDA 1SE9A 3OLMD 4S17A 1P0RA 1TY0A 3C0RB 2KNBA 3GE3C 1L5PA 4WQOB 1FRRA 1TS5A 2IGDA 1GG3A 1OGWA 1ROEA 2KX0A 3Q6BA 1WXVA 2JT4B 3DVNU 5JXVA 3CF6E 3I57A 4TSSA 3DDCB 1WMHB 3DOWA 1WY8A 1OEYA 4WJOA 1LFDA 1QOGA 3DBRI 5KHQA 3A33B 4W9CA 1C4AA 2JRIB 3P1MA 5J2RA 2L05A 1TTNA 4FJZA 3AH7A 3EHVA 3ZTCA 5D2MB 3I5JC 1WGHA 3FILA 4KKIA 2MX2A 4N6EB 1KTKA 2BGFA 1WE7A 2IBIB 4HDQA 1UD7A 1Y56A 2D5GA 3OAWA 1OTRB 4LLGM 1WM2A 2KQ7A 4PT5A 4XDCA 2C7MB 3ENEA 3N30A 2L8JA 3CWIA 1EF5A 1M4VA 2KTRB 3GOEA 3DBLB 2K25A 2EMSA 3N3KB 3UINB 3EUB2 1XLQA 2BF8B 2KACA 1FFVA 1TBEA 2KJRA 3A9JB 1CJEA 1K51A 2OJWA 2MHJA 3IG3A 3JYUA 3MP9A 2FUHB 3MJWA 1UBIA 1R4NI 2QIEB 4RGTA 1IGCA 2V0GA 3UGBB 2CU1A 2J42A 5CHWA 4I6NB 2G4DB 1Q0WB 3UQAA 2KDIA 4C7YA 1JROA 1OQRA 5E6PA 1T5XD 1VZ8A 3V3XA 4K7UA 2VZKB 2N1VA 4WAAA 1L6VA 1RWSA 1VR9A 4FN2A 1HTOA 3VUWA 2ASQA 3AV8A 2J7QB 3A4SC 4MGIE 4JLCA 2X8XX 2DHZA 3A9JA 3L4PA 1DYQA 5DCNA 1E90A 2PLPA 2J0KA 2BYTA 3VUXA 3X0WA 3KUZA 2N0SB 5IP4D 3VRBB 2QDFA 4W9HA 2AQ1B 4GGQA 3ZRFA 1Z5SB 2ZNVB 3DPDA 2LXAA 1YQBA 2PTLA 5T8IA 1AN8A 3VRAB 2ZW0A 3L54A 2DWQA 2RDBC 1V1PA 1P98A 3ML8A 1WI0A 3VH3B 3HVDA 4KKJA 5BYRA 4HROA 3MHSD 5CX3A 1F9JA 1QOFA 4A90A 2A5UA 1N60A 4HWIB 1ET6A 4PS7A 1XT9B 1QOBA 4LNIA 4IKGA 3RNGC 3DBRB 2JQRB 4A3OA 2PPHA 1F2RI 1E9MA 1PUTA 4M01A 4WWMA 3N1YC 3NVVA 2BBCA 4JWSC 4LJOB 4HRSA 2DYBA 2PVOD 5FR6A 3VDZA 5D7GA 1E10A 2V3SA 1T0QC 2N7EA 2MA9B 3RNBC 1AARA 1L0YB 2BPSA 2KWUB 4C4VA 2W82A 4G50A 2KC1A 4X57B 1STEA 3VFKA 3V62A 1B1ZA 5CHVC 3URYA 3HK0A 4HPPA 2IY1B 1E6EB 1XLNA 1XQQA 2C5LC 5LNK1 4LTUA 2N9PC 4G0NB 3EA6A 4G3XB 2KQSA 3H7PA 3PZ8A 3BYTB 3SU8X 3BIID 1HEZE 1P7EA 4NPNA 5FK9C 5AEKB 4A9AA 2BT6A 2MBOA 3M95A 4NJ7A 5EE9A 2D3CA 4P7IA 4NJ6A 4WJQA 2ZVOA 2GB1A 3ZLZA 1VRAB 3VUYA 2LJIA 4MT5A 4OZAA 1WF9A 4KZ0A 2KTFA 1RRBA 2WU5B 4RH6A 3UIOB 4BKGA 2Y5PA 4FHJA 4W9KA 2DZMA 5IAAC 3AE9B 4PK1A 2MLBA 3PS6A 2XNAC 3ALBA 1I4GA 4BZAA 1IP9A 4DBGA 1SIFA 1SIJA 3QQ8B 2NS5A 2GRIA 3PGEA 1FFUA 2LGYA 1ZXIA 3Q3OC 2BYFA 2E3TA 2YEPF 1D5ZC 1UZXB 1SE4A 4USAA 1ZGUB 2O6VD 1ZDXA 1KFYB 1YJ1A 4MH8A 5JHAA 2RPVA 5BMHA 4YTNB 4Q2JA 1RLFA 2JPHA 1TKYA 4RF0A 2OOBB 1WJNA 2FIFA 1K52A 1KRHA 1SB3C 3AE8B 5D3IB 3IXSA 1C1YB 2XN9C 2KJHB 2VZKD 1BT0A 4AOFA 2CKHB 2BW2A 1D3ZA 2WDRB 3JSVB 2BWES 3ZYYX 2KTRA 5HG2A 3U4EG 3ZNID 3PLVA 2PE6B 1L2NA 2D3GA 2IGGA 3AI5A 4IM0A 4EFOA 3AE6B 3R3MA 4YTMB 1NYRA 1R4MI 3MFGA 3LDZE 3CSFA 4BOSC 1XCTL 2AL6A 2MJDA 2W3RA 3AE2B 1VJKA 3PVLA 1UGMA 2RMMA 2M19A 1GUAB 4WWOA 1E8ZA 4M0WB 4MM3A 3SD5A 2NCNA 1MJDA 3K9PB 3QC8B 4D2KA 2DYMA 2WLBA 1A70A 4G11A 1QQRA 4RGNA 3RZWC 1L7YA 3NVZA 2JWUA 3A1QA 4NY0A 5JHBA 3H9DA 4LJPB 3RMKC 2L0FA 2DAFA 1WGDA 3AEAB 4YL8A 4ANVA 3RZFA 2J0MA 2K6QA 3H6NA 3CSTA 4K1RB 5MPOA 1QOAA 2WXMA 2K6DB 4ARCA 2BYEA 2MJEA 3LXFA 3L13A 3MTNB 3AXCA 2V1YA 2PVGC 3TIXA 1FNWA 4ANXA 3H1UA 3TUOA 3RCZA 2LJ5A 2A4ZA 2JVCA 3Q8BA 4DHJD 4WWPA 4RM8A 1NVID 2DZIA 3U8ZA 4N59A 1FXTB 3EGRA 3AU4A 3RNAC 3Q14C 1WZ0A 1C77A 3AMZA 3H8HA 2IJ0A 3QCAA 3APCA 1B9RA 1UWXA 4HKZE 4OZBA 1IUEA 3NVWA 3Q8EA 2PKOA 3TL5A 1L6UA 2IPKD 2IY0B 2SAKA 5E6NA 1C9FA 2V3PA 4EEWA 2JF5A 4YSXB 4OHJA 1VDVA 3FAHA 4JWUC 2KWVB 1U4AA 4TUUA 1TS4A 2KZRA 3TBLD 4DXAB 4DHZE 3Q3MC 4LNNA 2M1MA 3DBHB 2RR9A 5C3JB 1GPXA 1SJED 1OEYJ 3RFZB 4NJCA 4WWNA 2K8CA 3APDA 2PIAA 3KWLA 3PT2B 4F1SA 4HJKA 1SEBD 3V6CB 3L08A 4RFBA 2AYOB 2TSSA 2FNJB 2KVRA 1EF1A 3KYDD 4IM2A 1HZ6A 2R2OA 3JW0X 2KMAA 2ON8A 2ZNVC 2MP2B 1SSNA 2L1AA 3R2IA 2N4FA 2PW9A 5E6JA 2K5PA 2NPTB 1YX6B 4W9FA 4ZOHC 4H2AA 3ZDMC 5IN7A 4DK5A 2WXRA 3PV1A 1KLGD 1SJHD 2L7RA 1WGGA 4AS1A 1LGRA 2GMIC 3Q8FA 4AWJA 3DHHC 1D4BA 3IT4B 2KKCA 4PS3A 2AQ2B 1DGJA 2EMTA 4REZA 1PYWD 2HTME 3SFDB 1J7BA 4ANWA 3QARA 1QF6A 2O6VA 4II3B 4OW0A 4MGZE 3NVYA 4W9JA 3AEFB 4MSMB 3NZUA 1LM8B 5J18A 2I38A 1FEHA 1BUIC 3I3TB 1A5RA 4M8NA 4EOYA 4YSYB 4J3OD 4K3BA 5GXGB 1JWAD 3V05A 4R3DA 3R66C 2K1FA 1T0YA 4W9LA 2AWTA 5G5HA 2LASA 5D3DA 1MHHE 2WWZA 4O1NA 1WZ3A 2N7DA 3IAS1 1V80A 1ZKHA 1YN4A 2JU6X 1I4XA 4GMVA 4KDIC 3J9CA 3TMPB 1EWCA 1XLPA 2Z0EB 3N32A 2EKEC 5L95C 4M00A 2JRHA 2PMVA 2ZPNA 2KLCA 3ONSA 1V1PB 2MCNB 3ECIA 3RT3B 3QAQA 4ZYNA 5TSSA 1YJJA
chains in the Genus database with same CATH topology
2M0XA 2KDBA 2N1WA 1UH6A 2KMCA 1KOTA 4OVUA 2BYVE 3ZW3A 2C7HA 4A3OA 2PPHA 2BKFA 3NZSA 3PHWB 4F8CB 1KLVA 4IC7B 1H4RA 2KK8A 4KV2A 4NNJB 3NOBA 3Q3JA 2KLGA 4LJOB 3Q3FA 2DYBA 2M4NA 2MBHA 5FR6A 1WR6E 2BKRB 3VDZA 5D7GA 3W1YA 3WAOA 2V3SA 1NI2A 2N7EA 3ZTDA 2MA9B 1E8WA 1WXSA 2C60A 1AARA 1V5TA 1E8YA 4IW0A 2CS4A 1S3SG 4KZCA 4ICVA 2BPSA 2DZKA 2KWUB 3VAWA 4E71A 2ZCCA 4G50A 2KC1A 4X57B 4ZRKA 4FA6A 3PZDA 1WJ4A 3VFKA 3V62A 1OQYA 2Z59B 5CHVC 4HPMB 2KHWB 2KWCA 3HK0A 2IY1B 1CMXB 5AZHA 3WIMA 3ZKJC 2KFJA 4KIKA 1WJUA 2UWQA 1XQQA 2C5LC 3UIPB 2N9PC 4M8MA 1EO6A 1GJZA 3A1QB 1I42A 3PPAA 4G0NB 4G3XB 2KJ6A 2KQSA 1YD8U 3DVGX 3H7PA 4PS8A 2MQJA 2L76A 4GXBA 3V61A 4MH0E 4GU2A 4IWOA 3SU8X 1GNUA 3O65B 4GSWA 2J0JA 3SHQA 5E6OA 3WANA 3U7DA 4MSQB 4NPNA 5DPRA 5AEKB 2IO1B 2M17A 2IO2B 2MBOA 3M95A 2IO3B 2MRPA 4NJ7A 3WAMA 5G2NA 1ISNA 3H7PB 4BBNF 4P7IA 3AU5A 4NJ6A 2ZPYA 4URKA 2ZVNA 4WJQA 2NBVB 2ZVOA 4BVUC 5CTRC 1WR1A 1ZW7A 1P1AA 4AP4C 2C9WB 2PEAA 4BOZB 4F7ZA 3NS8A 2RSUA 4K7WA 3ZLZA 3L10B 2O2VA 3VUYA 2MW5A 3M3JA 5DPWA 2DZJA 3IVFA 4MELA 3UQBA 2LI5A 2L0TA 4HK2A 2LWPA 1WF9A 2ZJDA 4AUQC 4MGYE 4KZ0A 2KTFA 1RRBA 4HVBA 1WGYA 3BY4B 4JIOU 4JGHB 3UIOB 2HTHA 1WJ6A 2BWFA 3L17A 4I6PA 4BKGA 4FHJA 4CYEA 4W9KA 3VTWA 3LJ3A 2B3AA 4TV3A 4DDID 3WAPA 4MJSB 2DZMA 4JQWC 2REXA 5IAAC 2NR2A 4KSLC 3RD2A 1QZEA 2MLBA 3AULA 3TJPA 1V86A 2LGXA 3PS6A 3ALBA 4ZDVA 2FCQA 1IP9A 3QK0A 4N9F4 4DHJB 4GN1A 1UELA 2L3ZA 2N9XA 3VXWA 4DBGA 4W9GA 1SIFA 2KDFB 5J17A 1WE6A 2NBWB 3QQ8B 4BBNC 4ANUA 2NS5A 3WALA 4FHKA 4GDKB 2WYQA 3PGEA 2KC2A 2LGYA 5JH5C 1V2YA 4MJSA 4KDLB 4LCDE 3VH4B 2BYFA 4II2B 4HCPB 4GIVA 2UYZB 1UZXB 2O2VB 3OJ3A 3EC8A 3U30A 3DVGY 3T9LA 1P3QU 4KIKB 4HXDA 1ZGUB 2O6VD 4NAWB 4ZRIA 4PYUA 1YJ1A 2WX1A 1C3TA 5JHAA 2LRUA 4KVGB 2XK5A 3T8MA 1VD2A 4B9KA 3APFA 4E74A 5DPSA 1RLFA 4HDOA 2JPHA 2IYDB 1WX9A 4FULA 3L0WB 1H8CA 2KX3A 1E7UA 3QA8A 2YLMA 2OOBB 1RFAA 4EZLA 1WJNA 2FIFA 3ZVVA 2D2QA 3DCGA 2MWSB 4CHKA 1K8RB 3QHTA 4NAWA 4A20A 3ZDTA 1C1YB 1Y8RC 2ZEQA 2CHZA 2R2QA 3HHMA 1IYFA 2KJHB 4WJNA 1BT0A 4AOFA 4TQ0A 2KN5A 1SGHA 3L16A 2CKHB 4K7SA 4HPLB 1D3ZA 3JSVB 2BWES 1GC7A 5BO4B 2KTRA 2WX0A 2QHOA 4GDKA 4HCNB 2K8BA 3DBHI 3KYCD 3ZNID 3PLVA 2PE6B 4GDLA 1L2NA 4LDTB 4AJWA 2D3GA 3AI5A 2YVCA 4IM0A 4EFOA 1LQBA 3R3MA 1MG8A 5JZEB 1V5OA 1R4MI 1KJTA 4MGKE 3WA0A 4HLEA 3LDZE 3CSFA 2FIDA 4KSKC 2XBBC 4BOSC 3IBEA 5EDSA 3JSVA 2AL6A 2JXXA 3OJ4B 4J6IA 3PVLA 1UGMA 2MSED 4B6WA 5D94A 1GUAB 4WWOA 1J0GA 1WX7A 1E8ZA 1NDDA 2GBNA 4M0WB 4JL9A 4GDLB 2IO0B 2LD9A 4MM3A 3SD5A 2NCNA 1WMHA 4W9EA 2C7NB 3CMMB 5C23A 3ZIMA 4DWFA 3K9PB 3QC8B 2JZZA 2DYMA 4TQ1A 4WJPA 4BKSA 1IPGA 1M94A 4G11A 1VCBA 5AZFA 1L7YA 2JY6A 3RZWC 4PYZA 3A1QA 4CO7A 4BFRA 4NY0A 2DAJA 2FCNA 3VQIA 3RYTA 5JHBA 2GOWA 3H9DA 1WXMA 3VHTC 4GOCA 4B95A 4LJPB 5LXIB 2L0FA 2DAFA 4ASWC 2KXJA 1WGDA 4YL8A 1LXDA 2K8HA 3UF8A 4ANVA 3RZFA 3A4RA 2L00B 4EUTA 2LZ6A 2J0MA 2KFKB 2K6QA 3H6NA 3CSTA 2GBJA 2LVPA 4K1RB 1E8XA 1WGRA 2D11A 1EUVB 3VTUA 1WRDB 3PREA 2K6DB 3IHPC 4W9IA 3V60A 2BYEA 4MEMA 3PHXB 5C1ZA 3L13A 3MTNB 3AXCA 2V1YA 3PTFC 3TIXA 2LRWA 4ANXA 3H1UA 3QWZB 3RCZA 2HD5B 2LGDA 2LJ5A 2A4ZA 2Z0DB 2JVCA 3DBLI 2HE7A 3ZRCA 3QJZA 1PQSA 2ZZPB 4DHZB 4DHJD 2CR5A 2ZCBA 3EFUA 1V81A 4ICUA 4EKUA 4WWPA 2K39A 2KANA 3KH0A 4RM8A 2LUEA 2FCMA 4AJYB 3BINA 4XC2A 3KUCB 4K81A 5KHOA 3R7RA 1JRUA 4NQLB 4IWQA 1WFYA 3IFWB 2DZIA 5LLIA 2JZ3B 3U8ZA 2FCSA 1SE9A 3PRZA 1FXTB 3AU4A 2WDTB 3OLMD 1WZ0A 5AZGA 1P0RA 3C0RB 2KNBA 4FADA 2I1JA 3S2AA 3DQVA 2KFKA 4WQOB 3QCAA 3APCA 4BKTA 1GG3A 4FBJB 2KDEB 2GBMA 1OGWA 4XX5A 2KX0A 3PRMB 3X23A 1WXVA 2JT4B 3DVNU 2IY0B 3H7SA 3EECA 3TL5A 5E6NA 3VTVA 3ZNHB 3CF6E 2LVQA 3SDLC 4EEWA 3ZNGC 2JF5A 5DPTA 3B1LX 5L83A 2G4SA 1WMHB 3DDCB 3DOWA 1WY8A 1OEYA 1YIWA 2KWVB 1U4AA 4TUUA 4WJOA 2KZRA 1LFDA 3TBLD 4DXAB 4DHZE 3DBRI 5KHQA 3A33B 4W9CA 4OVVA 2JRIB 2XK5B 2M1MA 2G3QB 1WM3A 5J2RA 2RR9A 4IWPA 2L05A 4EZJA 2OJRA 1TTNA 1OEYJ 4FJZA 2CHXA 3A9KB 3EHVA 3QX1A 4WWNA 3ZTCA 2K8CA 2RPQA 3APDA 3PT2B 1Q5WB 4F1SA 4HJKA 4EZKA 5D2MB 3V6CB 3L08A 4GB9A 1WGHA 2MX2A 2LVOA 1Z2MA 2AYOB 2BGFA 2FNJB 1WE7A 4XZ4A 2IBIB 4HDQA 3NHEB 1UD7A 3TCAA 2KVRA 4NQKE 1UBQA 1EF1A 3KYDD 2FAZA 3OAWA 1OTRB 4IM2A 4TKNA 1YX5B 2R2OA 3JW0X 2KQ7A 1WM2A 2KMAA 2MBEA 2C7MB 1P9DU 2MP2B 2ZNVC 3ENEA 1Q1OA 2L8JA 3N30A 1V6EA 1EF5A 2M8SA 2KTRB 2N4FA 1J8CA 3GOEA 2PJHA 2V4LA 1WYWB 3JVZX 2NPTB 1YX6B 2K25A 2EMSA 3N3KB 2IZVB 3NY5A 4W9FA 2I1KA 4I6LB 3D32A 3UINB 3KUDB 3M62B 2BF8B 2CHWA 4RM9A 5GMVA 1TBEA 2KJRA 2KO3A 3ZDMC 4BKSD 3A9JB 4ZRJA 1WIAA 3IG3A 2G45B 3JYUA 2GBKA 1G6JA 1RAXA 3HM6X 2FUHB 2DX5B 2MP2A 3KW5B 2RD0A 2RGFA 3MJWA 4DK5A 1UBIA 1R4NI 3PV1A 3W1SC 3A9KA 1X1MA 3DBSA 2L7RA 1WGGA 2XEWA 2GMIC 2DENB 2NPTA 4AWJA 3UGBB 2CU1A 2NBUA 5CHWA 4A3PA 4I6NB 2KKCA 3HIZA 4PS3A 5HKHA 2G4DB 1TZ1A 1NBFC 1Q0WB 3UQAA 1V49A 2KDIA 2HJ8A 3QIJA 2EMTA 5E6PA 1J19A 1GC6A 3GZNI 3W1SA 2JWZA 3K9OB 4K7UA 2N1VA 4WAAA 2KOXA 4ANWA 3QARA 3R7QA 2O6VA 4FN2A 4II3B 2Y5BB 3VUWA 2ASQA 3PRPB 1S1QB 3KVFB 4MGZE 2J7QB 3ZUNA 4W9JA 2KD0A 3A4SC 4FJVB 4MGIE 4JLCA 4IUMB 3ML9A 2GBRA 4LDTD 3RUIB 2DHZA 5IA7A 4FLHA 3A9JA 4MSMB 3NZUA 4MDKE 2LXCA 1E90A 4W9DA 5DCNA 3DVNV 4E3CA 1LM8B 5J18A 5TR5A 2J0KA 2O6VB 3I3TB 3VVWB 3P2BA 1A5RA 4M8NA 3VUXA 3X0WA 2AEHA 3B08A 3KUZA 4RMAA 4EOYA 5CHFA 3ZO5B 3PSEB 2D07B 2MBQA 2VRRB 3PLUA 2N9EB 4W9HA 1XD3B 4GGQA 3ZRFA 2D10A 3R66C 2K1FA 1T0YA 1Z5SB 2ZNVB 4W9LA 3DPDA 4IM3A 2AWTA 2LXAA 1YQBA 3HM3A 2LASA 4DDGD 3L54A 1E7VA 2WWZA 1WZ3A 1P98A 4FJYA 3RULA 2N7DA 2MBBB 1V9JA 3ML8A 2DYOA 1WXAA 3ZNZB 3V6EB 1V80A 1WI0A 1ZKHA 3VH3B 5G55A 4GMVA 4KDIC 1I35A 3MHSD 3B0AA 1TGZB 5CX3A 1WH3A 2PE9A 3TMPB 1KM7A 2Z0EB 3N32A 1F9JA 2EKEC 5L95C 1HE8A 2A5UA 5D6JB 5LXHA 2JRHA 2NVUI 2ZPNA 4HWIB 4PS7A 2KLCA 3ONSA 4IG7B 2MCNB 3ECIA 2AL3A 3RT3B 1WX8A 1XT9B 3QAQA 4ZYNA 3M63B 2W9NA 1E5WA 2JUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0X A;  2KDB A;  2N1W A;  1UH6 A;  2KMC A;  1KOT A;  4OVU A;  2BYV E;  3ZW3 A;  2C7H A;  4A3O A;  2PPH A;  2BKF A;  3NZS A;  3PHW B;  4F8C B;  1KLV A;  4IC7 B;  1H4R A;  2KK8 A;  4KV2 A;  4NNJ B;  3NOB A;  3Q3J A;  2KLG A;  4LJO B;  3Q3F A;  2DYB A;  2M4N A;  2MBH A;  5FR6 A;  1WR6 E;  2BKR B;  3VDZ A;  5D7G A;  3W1Y A;  3WAO A;  2V3S A;  1NI2 A;  2N7E A;  3ZTD A;  2MA9 B;  1E8W A;  1WXS A;  2C60 A;  1AAR A;  1V5T A;  1E8Y A;  4IW0 A;  2CS4 A;  1S3S G;  4KZC A;  4ICV A;  2BPS A;  2DZK A;  2KWU B;  3VAW A;  4E71 A;  2ZCC A;  4G50 A;  2KC1 A;  4X57 B;  4ZRK A;  4FA6 A;  3PZD A;  1WJ4 A;  3VFK A;  3V62 A;  1OQY A;  2Z59 B;  5CHV C;  4HPM B;  2KHW B;  2KWC A;  3HK0 A;  2IY1 B;  1CMX B;  5AZH A;  3WIM A;  3ZKJ C;  2KFJ A;  4KIK A;  1WJU A;  2UWQ A;  1XQQ A;  2C5L C;  3UIP B;  2N9P C;  4M8M A;  1EO6 A;  1GJZ A;  3A1Q B;  1I42 A;  3PPA A;  4G0N B;  4G3X B;  2KJ6 A;  2KQS A;  1YD8 U;  3DVG X;  3H7P A;  4PS8 A;  2MQJ A;  2L76 A;  4GXB A;  3V61 A;  4MH0 E;  4GU2 A;  4IWO A;  3SU8 X;  1GNU A;  3O65 B;  4GSW A;  2J0J A;  3SHQ A;  5E6O A;  3WAN A;  3U7D A;  4MSQ B;  4NPN A;  5DPR A;  5AEK B;  2IO1 B;  2M17 A;  2IO2 B;  2MBO A;  3M95 A;  2IO3 B;  2MRP A;  4NJ7 A;  3WAM A;  5G2N A;  1ISN A;  3H7P B;  4BBN F;  4P7I A;  3AU5 A;  4NJ6 A;  2ZPY A;  4URK A;  2ZVN A;  4WJQ A;  2NBV B;  2ZVO A;  4BVU C;  5CTR C;  1WR1 A;  1ZW7 A;  1P1A A;  4AP4 C;  2C9W B;  2PEA A;  4BOZ B;  4F7Z A;  3NS8 A;  2RSU A;  4K7W A;  3ZLZ A;  3L10 B;  2O2V A;  3VUY A;  2MW5 A;  3M3J A;  5DPW A;  2DZJ A;  3IVF A;  4MEL A;  3UQB A;  2LI5 A;  2L0T A;  4HK2 A;  2LWP A;  1WF9 A;  2ZJD A;  4AUQ C;  4MGY E;  4KZ0 A;  2KTF A;  1RRB A;  4HVB A;  1WGY A;  3BY4 B;  4JIO U;  4JGH B;  3UIO B;  2HTH A;  1WJ6 A;  2BWF A;  3L17 A;  4I6P A;  4BKG A;  4FHJ A;  4CYE A;  4W9K A;  3VTW A;  3LJ3 A;  2B3A A;  4TV3 A;  4DDI D;  3WAP A;  4MJS B;  2DZM A;  4JQW C;  2REX A;  5IAA C;  2NR2 A;  4KSL C;  3RD2 A;  1QZE A;  2MLB A;  3AUL A;  3TJP A;  1V86 A;  2LGX A;  3PS6 A;  3ALB A;  4ZDV A;  2FCQ A;  1IP9 A;  3QK0 A;  4N9F 4;  4DHJ B;  4GN1 A;  1UEL A;  2L3Z A;  2N9X A;  3VXW A;  4DBG A;  4W9G A;  1SIF A;  2KDF B;  5J17 A;  1WE6 A;  2NBW B;  3QQ8 B;  4BBN C;  4ANU A;  2NS5 A;  3WAL A;  4FHK A;  4GDK B;  2WYQ A;  3PGE A;  2KC2 A;  2LGY A;  5JH5 C;  1V2Y A;  4MJS A;  4KDL B;  4LCD E;  3VH4 B;  2BYF A;  4II2 B;  4HCP B;  4GIV A;  2UYZ B;  1UZX B;  2O2V B;  3OJ3 A;  3EC8 A;  3U30 A;  3DVG Y;  3T9L A;  1P3Q U;  4KIK B;  4HXD A;  1ZGU B;  2O6V D;  4NAW B;  4ZRI A;  4PYU A;  1YJ1 A;  2WX1 A;  1C3T A;  5JHA A;  2LRU A;  4KVG B;  2XK5 A;  3T8M A;  1VD2 A;  4B9K A;  3APF A;  4E74 A;  5DPS A;  1RLF A;  4HDO A;  2JPH A;  2IYD B;  1WX9 A;  4FUL A;  3L0W B;  1H8C A;  2KX3 A;  1E7U A;  3QA8 A;  2YLM A;  2OOB B;  1RFA A;  4EZL A;  1WJN A;  2FIF A;  3ZVV A;  2D2Q A;  3DCG A;  2MWS B;  4CHK A;  1K8R B;  3QHT A;  4NAW A;  4A20 A;  3ZDT A;  1C1Y B;  1Y8R C;  2ZEQ A;  2CHZ A;  2R2Q A;  3HHM A;  1IYF A;  2KJH B;  4WJN A;  1BT0 A;  4AOF A;  4TQ0 A;  2KN5 A;  1SGH A;  3L16 A;  2CKH B;  4K7S A;  4HPL B;  1D3Z A;  3JSV B;  2BWE S;  1GC7 A;  5BO4 B;  2KTR A;  2WX0 A;  2QHO A;  4GDK A;  4HCN B;  2K8B A;  3DBH I;  3KYC D;  3ZNI D;  3PLV A;  2PE6 B;  4GDL A;  1L2N A;  4LDT B;  4AJW A;  2D3G A;  3AI5 A;  2YVC A;  4IM0 A;  4EFO A;  1LQB A;  3R3M A;  1MG8 A;  5JZE B;  1V5O A;  1R4M I;  1KJT A;  4MGK E;  3WA0 A;  4HLE A;  3LDZ E;  3CSF A;  2FID A;  4KSK C;  2XBB C;  4BOS C;  3IBE A;  5EDS A;  3JSV A;  2AL6 A;  2JXX A;  3OJ4 B;  4J6I A;  3PVL A;  1UGM A;  2MSE D;  4B6W A;  5D94 A;  1GUA B;  4WWO A;  1J0G A;  1WX7 A;  1E8Z A;  1NDD A;  2GBN A;  4M0W B;  4JL9 A;  4GDL B;  2IO0 B;  2LD9 A;  4MM3 A;  3SD5 A;  2NCN A;  1WMH A;  4W9E A;  2C7N B;  3CMM B;  5C23 A;  3ZIM A;  4DWF A;  3K9P B;  3QC8 B;  2JZZ A;  2DYM A;  4TQ1 A;  4WJP A;  4BKS A;  1IPG A;  1M94 A;  4G11 A;  1VCB A;  5AZF A;  1L7Y A;  2JY6 A;  3RZW C;  4PYZ A;  3A1Q A;  4CO7 A;  4BFR A;  4NY0 A;  2DAJ A;  2FCN A;  3VQI A;  3RYT A;  5JHB A;  2GOW A;  3H9D A;  1WXM A;  3VHT C;  4GOC A;  4B95 A;  4LJP B;  5LXI B;  2L0F A;  2DAF A;  4ASW C;  2KXJ A;  1WGD A;  4YL8 A;  1LXD A;  2K8H A;  3UF8 A;  4ANV A;  3RZF A;  3A4R A;  2L00 B;  4EUT A;  2LZ6 A;  2J0M A;  2KFK B;  2K6Q A;  3H6N A;  3CST A;  2GBJ A;  2LVP A;  4K1R B;  1E8X A;  1WGR A;  2D11 A;  1EUV B;  3VTU A;  1WRD B;  3PRE A;  2K6D B;  3IHP C;  4W9I A;  3V60 A;  2BYE A;  4MEM A;  3PHX B;  5C1Z A;  3L13 A;  3MTN B;  3AXC A;  2V1Y A;  3PTF C;  3TIX A;  2LRW A;  4ANX A;  3H1U A;  3QWZ B;  3RCZ A;  2HD5 B;  2LGD A;  2LJ5 A;  2A4Z A;  2Z0D B;  2JVC A;  3DBL I;  2HE7 A;  3ZRC A;  3QJZ A;  1PQS A;  2ZZP B;  4DHZ B;  4DHJ D;  2CR5 A;  2ZCB A;  3EFU A;  1V81 A;  4ICU A;  4EKU A;  4WWP A;  2K39 A;  2KAN A;  3KH0 A;  4RM8 A;  2LUE A;  2FCM A;  4AJY B;  3BIN A;  4XC2 A;  3KUC B;  4K81 A;  5KHO A;  3R7R A;  1JRU A;  4NQL B;  4IWQ A;  1WFY A;  3IFW B;  2DZI A;  5LLI A;  2JZ3 B;  3U8Z A;  2FCS A;  1SE9 A;  3PRZ A;  1FXT B;  3AU4 A;  2WDT B;  3OLM D;  1WZ0 A;  5AZG A;  1P0R A;  3C0R B;  2KNB A;  4FAD A;  2I1J A;  3S2A A;  3DQV A;  2KFK A;  4WQO B;  3QCA A;  3APC A;  4BKT A;  1GG3 A;  4FBJ B;  2KDE B;  2GBM A;  1OGW A;  4XX5 A;  2KX0 A;  3PRM B;  3X23 A;  1WXV A;  2JT4 B;  3DVN U;  2IY0 B;  3H7S A;  3EEC A;  3TL5 A;  5E6N A;  3VTV A;  3ZNH B;  3CF6 E;  2LVQ A;  3SDL C;  4EEW A;  3ZNG C;  2JF5 A;  5DPT A;  3B1L X;  5L83 A;  2G4S A;  1WMH B;  3DDC B;  3DOW A;  1WY8 A;  1OEY A;  1YIW A;  2KWV B;  1U4A A;  4TUU A;  4WJO A;  2KZR A;  1LFD A;  3TBL D;  4DXA B;  4DHZ E;  3DBR I;  5KHQ A;  3A33 B;  4W9C A;  4OVV A;  2JRI B;  2XK5 B;  2M1M A;  2G3Q B;  1WM3 A;  5J2R A;  2RR9 A;  4IWP A;  2L05 A;  4EZJ A;  2OJR A;  1TTN A;  1OEY J;  4FJZ A;  2CHX A;  3A9K B;  3EHV A;  3QX1 A;  4WWN A;  3ZTC A;  2K8C A;  2RPQ A;  3APD A;  3PT2 B;  1Q5W B;  4F1S A;  4HJK A;  4EZK A;  5D2M B;  3V6C B;  3L08 A;  4GB9 A;  1WGH A;  2MX2 A;  2LVO A;  1Z2M A;  2AYO B;  2BGF A;  2FNJ B;  1WE7 A;  4XZ4 A;  2IBI B;  4HDQ A;  3NHE B;  1UD7 A;  3TCA A;  2KVR A;  4NQK E;  1UBQ A;  1EF1 A;  3KYD D;  2FAZ A;  3OAW A;  1OTR B;  4IM2 A;  4TKN A;  1YX5 B;  2R2O A;  3JW0 X;  2KQ7 A;  1WM2 A;  2KMA A;  2MBE A;  2C7M B;  1P9D U;  2MP2 B;  2ZNV C;  3ENE A;  1Q1O A;  2L8J A;  3N30 A;  1V6E A;  1EF5 A;  2M8S A;  2KTR B;  2N4F A;  1J8C A;  3GOE A;  2PJH A;  2V4L A;  1WYW B;  3JVZ X;  2NPT B;  1YX6 B;  2K25 A;  2EMS A;  3N3K B;  2IZV B;  3NY5 A;  4W9F A;  2I1K A;  4I6L B;  3D32 A;  3UIN B;  3KUD B;  3M62 B;  2BF8 B;  2CHW A;  4RM9 A;  5GMV A;  1TBE A;  2KJR A;  2KO3 A;  3ZDM C;  4BKS D;  3A9J B;  4ZRJ A;  1WIA A;  3IG3 A;  2G45 B;  3JYU A;  2GBK A;  1G6J A;  1RAX A;  3HM6 X;  2FUH B;  2DX5 B;  2MP2 A;  3KW5 B;  2RD0 A;  2RGF A;  3MJW A;  4DK5 A;  1UBI A;  1R4N I;  3PV1 A;  3W1S C;  3A9K A;  1X1M A;  3DBS A;  2L7R A;  1WGG A;  2XEW A;  2GMI C;  2DEN B;  2NPT A;  4AWJ A;  3UGB B;  2CU1 A;  2NBU A;  5CHW A;  4A3P A;  4I6N B;  2KKC A;  3HIZ A;  4PS3 A;  5HKH A;  2G4D B;  1TZ1 A;  1NBF C;  1Q0W B;  3UQA A;  1V49 A;  2KDI A;  2HJ8 A;  3QIJ A;  2EMT A;  5E6P A;  1J19 A;  1GC6 A;  3GZN I;  3W1S A;  2JWZ A;  3K9O B;  4K7U A;  2N1V A;  4WAA A;  2KOX A;  4ANW A;  3QAR A;  3R7Q A;  2O6V A;  4FN2 A;  4II3 B;  2Y5B B;  3VUW A;  2ASQ A;  3PRP B;  1S1Q B;  3KVF B;  4MGZ E;  2J7Q B;  3ZUN A;  4W9J A;  2KD0 A;  3A4S C;  4FJV B;  4MGI E;  4JLC A;  4IUM B;  3ML9 A;  2GBR A;  4LDT D;  3RUI B;  2DHZ A;  5IA7 A;  4FLH A;  3A9J A;  4MSM B;  3NZU A;  4MDK E;  2LXC A;  1E90 A;  4W9D A;  5DCN A;  3DVN V;  4E3C A;  1LM8 B;  5J18 A;  5TR5 A;  2J0K A;  2O6V B;  3I3T B;  3VVW B;  3P2B A;  1A5R A;  4M8N A;  3VUX A;  3X0W A;  2AEH A;  3B08 A;  3KUZ A;  4RMA A;  4EOY A;  5CHF A;  3ZO5 B;  3PSE B;  2D07 B;  2MBQ A;  2VRR B;  3PLU A;  2N9E B;  4W9H A;  1XD3 B;  4GGQ A;  3ZRF A;  2D10 A;  3R66 C;  2K1F A;  1T0Y A;  1Z5S B;  2ZNV B;  4W9L A;  3DPD A;  4IM3 A;  2AWT A;  2LXA A;  1YQB A;  3HM3 A;  2LAS A;  4DDG D;  3L54 A;  1E7V A;  2WWZ A;  1WZ3 A;  1P98 A;  4FJY A;  3RUL A;  2N7D A;  2MBB B;  1V9J A;  3ML8 A;  2DYO A;  1WXA A;  3ZNZ B;  3V6E B;  1V80 A;  1WI0 A;  1ZKH A;  3VH3 B;  5G55 A;  4GMV A;  4KDI C;  1I35 A;  3MHS D;  3B0A A;  1TGZ B;  5CX3 A;  1WH3 A;  2PE9 A;  3TMP B;  1KM7 A;  2Z0E B;  3N32 A;  1F9J A;  2EKE C;  5L95 C;  1HE8 A;  2A5U A;  5D6J B;  5LXH A;  2JRH A;  2NVU I;  2ZPN A;  4HWI B;  4PS7 A;  2KLC A;  3ONS A;  4IG7 B;  2MCN B;  3ECI A;  2AL3 A;  3RT3 B;  1WX8 A;  1XT9 B;  3QAQ A;  4ZYN A;  3M63 B;  2W9N A;  1E5W A;  2JUO A; 
#chains in the Genus database with same CATH topology
 1KOT A;  3E9S A;  3NOB A;  3Q3F A;  1XCQ L;  3TSS A;  1E7P B;  3ZTD A;  4WAF A;  4IW0 A;  2DZK A;  3DWM A;  2I2Y A;  4ZRK A;  3HUI A;  1ZDV A;  1CMX B;  2WDV B;  1WJU A;  1J7A A;  4RGO S;  2WXI A;  4M8M A;  1QLB B;  3A1Q B;  3DHI C;  1I42 A;  1FM0 D;  2BB5 A;  4BAX A;  2GLS A;  2L83 A;  2MQJ A;  2L76 A;  4GXB A;  1ZUD 2;  2LMC A;  3E56 A;  4GU2 A;  4GLS C;  4XWW A;  4GSW A;  2J0J A;  2IGH A;  3WAN A;  4MSQ B;  5DPR A;  4A8X C;  1L0X B;  2IO2 B;  3WAM A;  5G2N A;  3H7P B;  1JWS D;  2ZVN A;  5CTR C;  2N9L A;  2C9W B;  3ZJT A;  2RSU A;  1TS3 A;  3L10 B;  2O2V A;  3PZ7 A;  4LNO A;  2BB6 A;  2MW5 A;  3M3J A;  4K3C A;  5DPW A;  2DZJ A;  3IVF A;  1TJE A;  2LI5 A;  1FNV A;  2QC8 A;  2ZJD A;  3MC8 A;  4AUQ C;  2JYE A;  2QJL A;  4HVB A;  1I35 A;  4JGH B;  2HTH A;  2BWF A;  4DXF A;  3VTW A;  3LJ3 A;  2B3A A;  2JX5 A;  3AN1 A;  2REX A;  2NR2 A;  4KSL C;  1YQ3 B;  4ZDV A;  3QK0 A;  4DHJ B;  4M02 A;  1UEL A;  2JYT A;  1ET9 A;  3VXW A;  4UDU C;  2KDF B;  2R61 A;  3AE5 B;  3WAL A;  1MHX A;  2IDY A;  3MHZ A;  2WYQ A;  3BK1 A;  1SE2 A;  1ACC A;  3AEC B;  4HCP B;  2O2V B;  1HZ5 A;  3OJ3 A;  4ITK A;  3DVG Y;  3T9L A;  4KIK B;  4HXD A;  2ONQ A;  3B2G A;  4NAW B;  4ZRI A;  1N61 A;  1CK1 A;  2LRU A;  3B2F A;  5DPS A;  3I9V 1;  5BYQ A;  3L0W B;  1H8C A;  1LO5 D;  1E7U A;  3QA8 A;  2YLM A;  1RFA A;  3DCG A;  1MVK A;  2MWS B;  1K8R B;  4A20 A;  3HHM A;  4NAM A;  1SGH A;  4K7S A;  1D6E C;  1GC7 A;  1L4Z B;  5BO4 B;  3ZJV A;  1JAL A;  2IND C;  2QHO A;  2W3S A;  1R7S A;  2K8B A;  3DBH I;  3FC4 A;  1AWD A;  4AJW A;  2CJN A;  2YVC A;  5JZE B;  2H88 B;  4LNK A;  3WA0 A;  3P42 A;  5H8Y E;  2V3N A;  5EDS A;  3JSV A;  1N6Z A;  2JXX A;  3OJ4 B;  4J6I A;  1T0R C;  5D94 A;  5AUK A;  1R4N B;  4JL9 A;  2LD9 A;  1XLO A;  1WMH A;  2C7N B;  3CMM B;  2JZZ A;  4WJP A;  4BKS A;  1IPG A;  2JY6 A;  4CO7 A;  1JRP A;  4GOC A;  5LXI B;  2GI9 A;  2KXJ A;  1FNU A;  4MAC A;  4MM3 B;  1LXD A;  3UF8 A;  5HFY A;  1FXA A;  3A4R A;  2L00 B;  2LZ6 A;  3LYY A;  1R4M B;  3NUH B;  2GBJ A;  3AEE B;  3AE4 B;  1MPE A;  4W9I A;  3AE3 B;  4MEM A;  3QWZ B;  2QSD A;  3U2S C;  3ZRC A;  3QJZ A;  1PQS A;  4DHZ B;  2CR5 A;  2K9X A;  2RDG A;  2JZP A;  3W9C B;  2WXG A;  3EFU A;  3RNE C;  4EKU A;  1JCK B;  3MJ5 A;  2LUE A;  2EKI A;  3KUC B;  5KHO A;  4C56 C;  4IWQ A;  1WFY A;  2JZ3 B;  2FCS A;  2BS2 B;  3PRZ A;  5AZG A;  1V97 A;  4FAD A;  2LUM A;  3S2A A;  3DQV A;  4BKT A;  5I4D A;  1IBX A;  2KDE B;  2GBM A;  3DHG C;  1Q10 A;  3PRM B;  3X23 A;  1UNS A;  3H7S A;  3VTV A;  3EEC A;  3SDL C;  1JWB D;  5L83 A;  2AQ3 B;  4RGM A;  1JML A;  2WXJ A;  4JPS A;  2G3Q B;  1WM3 A;  4IWP A;  4EZJ A;  2OJR A;  3BK2 A;  3BWU D;  1WRI A;  2L32 A;  3P4P B;  1Q5W B;  3OWE B;  2Y3A A;  2W54 A;  5EE1 A;  4XZ4 A;  4NQK E;  2Q5W D;  1BML C;  1WWT A;  2MBE A;  2KWD A;  1Q1O A;  1V6E A;  2M8S A;  2K22 A;  2V9H A;  1J8C A;  2PJH A;  2V4L A;  1KLU D;  1WYW B;  1EU3 A;  3NY5 A;  1E0Z A;  3TEW A;  4I6L B;  3D32 A;  2SEB D;  2CU3 A;  2J52 A;  2CHW A;  4RM9 A;  3GS2 A;  2AX5 A;  2G45 B;  1G6J A;  2GBK A;  3HM6 X;  2MP2 A;  2RD0 A;  3AM9 A;  4YSZ B;  3DBS A;  3UI3 A;  1HXY D;  2WP9 B;  2DEN B;  2NPT A;  2D3B A;  3Q69 A;  4WIP A;  4A3P A;  1GB4 A;  1TZ1 A;  1NBF C;  1GAQ B;  5EE3 A;  1PGA A;  2HJ8 A;  3QIJ A;  1SXT A;  1TYG B;  3GZN I;  3W1S A;  1ZPS A;  3R7Q A;  2KQ4 X;  3ABV B;  1S1Q B;  5HI1 A;  3BYY B;  3ZUN A;  2KD0 A;  1T0S C;  4RNA A;  4IUM B;  2M0A A;  1JQ4 A;  2GBR A;  4LDT D;  5IA7 A;  4FLH A;  2MEK A;  3SFE B;  4MDK E;  2LXC A;  2KDM A;  3ZQ4 A;  2N7J A;  3EFC A;  2O6V B;  3VVW B;  3P2B A;  1FRD A;  2LEK A;  4RMA A;  3ZO5 B;  2V4I B;  2JXT A;  2MBQ A;  1NEN B;  1ZE3 D;  1RFK A;  2WXH A;  1XD3 B;  2D10 A;  5EE0 A;  4IM3 A;  4XDD A;  1YNT E;  1WYG A;  3HM3 A;  2HJ1 A;  4JE3 B;  3Q2A C;  2LGS A;  3AE1 B;  1NEK B;  4FJY A;  2MBB B;  1WXA A;  3ZNZ B;  3P4R B;  3V6E B;  1HA5 A;  4XWT A;  3KQ4 A;  1WH3 A;  1KM7 A;  2WS3 B;  2LFI A;  1HE8 A;  5LXH A;  4L1B A;  4IG7 B;  3RN9 C;  1YOV B;  3N1Z C;  1I4R A;  2AL3 A;  1WX8 A;  2KYW A;  3GB1 A;  3R2T A;  2N1W A;  1HQR D;  5BMG A;  2BYV E;  1VZ7 A;  3ZW3 A;  2WXL A;  1UF0 A;  2BKF A;  3NZS A;  1I4Q A;  4IC7 B;  4NNJ B;  3Q3J A;  2KLG A;  2M4N A;  2BKR B;  2WHI A;  5FR3 A;  5H92 C;  3RPF C;  3WAO A;  3BZD B;  2BQQ A;  1NI2 A;  1E8W A;  2C60 A;  2CS4 A;  1S3S G;  1V8C A;  1GB1 A;  3VAW A;  2ZCC A;  3BVM A;  4OZC A;  4EE2 A;  4FA6 A;  2WQY B;  1EM7 A;  3PZD A;  1WJ4 A;  1WXQ A;  4TMA B;  2Z59 B;  2NTS A;  2KHW B;  2KWC A;  2BTE A;  5AZH A;  4DXG A;  2UWQ A;  3UIP B;  1CQV A;  1EO6 A;  1GJZ A;  1TS2 A;  3PPA A;  4JX1 C;  3DVG X;  3P63 A;  1TIF A;  4C7Z A;  3V61 A;  2VH1 A;  3MC9 A;  1GNU A;  2K3U A;  2WXK A;  3SHQ A;  2QMT A;  3SEB A;  2M17 A;  1ISN A;  1RYJ A;  1XO3 A;  2WXP A;  4URK A;  2NBV B;  4BVU C;  1ZW7 A;  4OVZ A;  2PEA A;  4F7Z A;  3NS8 A;  4YWG G;  4IDI A;  3W2D A;  4MEL A;  1FXI A;  3UQB A;  3R8B A;  1XEE A;  2L0T A;  1V1O A;  2J4X A;  1WGY A;  4I6P A;  2WXF A;  4TV3 A;  4DDI D;  3WAP A;  4MJS B;  1QZE A;  3AUL A;  3TJP A;  2LGX A;  2FCQ A;  2OHF A;  4N9F 4;  1F0Z A;  1SF0 A;  1IBX B;  4YXD B;  2JSV X;  5J17 A;  4FHK A;  2J53 A;  4GDK B;  3Q8C A;  4DQO C;  2KC2 A;  5BYS A;  1EU4 A;  5JH5 C;  1V2Y A;  4XGA B;  4LCD E;  1GOZ A;  3P4Q B;  4II2 B;  1UUP A;  2UYZ B;  3EC8 A;  1K53 A;  2RDH A;  4PYU A;  2WX1 A;  4KVG B;  4L2Y A;  3T8M A;  3APF A;  4CQN A;  3KLS X;  2QIL A;  2IYD B;  1AYF A;  4FUL A;  2KX3 A;  1YMH E;  4EZL A;  2D2Q A;  1ESF A;  4NAW A;  1MI0 A;  1C79 A;  1Y8R C;  2ZEQ A;  2CHZ A;  4TQ0 A;  1I4H A;  4HPL B;  1TY2 A;  3CIR B;  4GDK A;  3U7Z A;  2FE8 A;  4GDL A;  4ZYS A;  4LDT B;  2WNM A;  1LQB A;  2ICI A;  1KJT A;  4MGK E;  4HLE A;  3N20 C;  2EEL A;  3RI7 C;  4KSK C;  2XBB C;  3ZJU A;  3IAM 1;  5IO9 A;  2KVZ A;  2G9H D;  4B6W A;  1J0G A;  1NDD A;  1PDX A;  2IO0 B;  1T3Q A;  4AQ7 A;  2WXQ A;  4DWF A;  5C23 A;  4TQ1 A;  2K0P A;  1M94 A;  2WXN A;  1VCB A;  1F77 A;  5AZF A;  2QCZ A;  2DAJ A;  2GOW A;  4P1B C;  1I7H A;  1MFW A;  4B95 A;  4ASW C;  3B9J A;  2ZW1 A;  2KFK B;  2LVP A;  1YN5 A;  1E8X A;  4LK0 M;  3VTU A;  1TZO A;  3IHP C;  4ACF A;  2DLB A;  3V60 A;  3PHX B;  3NZ3 A;  1J7C A;  2HD5 B;  1FIQ A;  3NJT A;  2Z0D B;  3DBL I;  2HE7 A;  4WH4 A;  4XYC A;  2FUG 1;  1V81 A;  4ICU A;  4WUR A;  2K39 A;  2KAN A;  3KH0 A;  1OQQ A;  3IT6 B;  3R7R A;  1TT5 B;  2WDT B;  3HVZ A;  3C19 A;  4LNF A;  2I1J A;  2WU2 B;  1JWM D;  2KFK A;  1L0V B;  4P1C C;  4FBJ B;  3AB5 A;  1F1H A;  2H89 B;  2CJO A;  2D3A A;  4XX5 A;  5G5G A;  1BXT A;  3ZNH B;  2LVQ A;  1JW9 D;  4ZHO A;  3ZNG C;  5DPT A;  2M56 B;  2INN E;  3B1L X;  3FIL B;  2G4S A;  3T3N A;  1YIW A;  3TEY A;  3ZXV A;  4OVV A;  3T3O A;  2XK5 B;  3NG0 A;  1UGJ A;  2CHX A;  3A9K B;  3QX1 A;  2RPQ A;  2WXO A;  4EZK A;  2KT7 A;  4GB9 A;  2LVO A;  1Z2M A;  3NHE B;  2G1E A;  3TCA A;  1UBQ A;  4TKN A;  2FAZ A;  1YX5 B;  1P9D U;  2Y5C A;  3ZGZ A;  3JVZ X;  2IZV B;  2I1K A;  3KUD B;  1TKG A;  3M62 B;  5GMV A;  4BKS D;  2KO3 A;  1N5W A;  1EWY C;  1UWM A;  4ZRJ A;  1WIA A;  3RNF C;  1F2R C;  1RAX A;  2DX5 B;  3KW5 B;  2RGF A;  2NMQ A;  3GE8 C;  1MG4 A;  1ZP0 B;  1F52 A;  3W1S C;  4P6V F;  3A9K A;  1X1M A;  1FCL A;  2XEW A;  1KH0 A;  4ZRP A;  2L52 A;  1P7F A;  2NBU A;  5IOI A;  3HIZ A;  5HKH A;  1V49 A;  2HDE A;  1D5M C;  5C2T B;  1J19 A;  1GC6 A;  1OFF A;  4XE0 A;  2JWZ A;  3K9O B;  1JWU D;  2KOX A;  2Y5B B;  3PRP B;  1L4D B;  3KVF B;  2WDQ B;  2KN4 A;  4FJV B;  3N9Y C;  3ZXR A;  4ZHP A;  3ML9 A;  3RUI B;  3TEZ A;  3FKY A;  4W9D A;  3DVN V;  4E3C A;  5TR5 A;  3BVG A;  1FCC C;  4L23 A;  2AEH A;  2E6X A;  3B08 A;  3OG5 A;  4P16 A;  1WSP A;  5CHF A;  3PSE B;  2D07 B;  2N9K A;  2VRR B;  3PLU A;  2N9E B;  3I63 C;  1KF6 B;  2LGI A;  4IOI E;  4DDG D;  1N63 A;  1QKZ A;  1E7V A;  1HTQ A;  2QEJ C;  3RUL A;  1V9J A;  3KWV A;  2DYO A;  4QAY A;  5G55 A;  3C8Y A;  3B0A A;  1TGZ B;  2PE9 A;  1PGB A;  4B0E A;  1C4C A;  5D6J B;  2NVU I;  1NI3 A;  3NRZ A;  2W9N A;  3M63 B;  1E5W A;  2JUO A;  3Q8A A;  2M0X A;  1I4P A;  2KDB A;  1UH6 A;  2KMC A;  4ZRQ A;  3GZN B;  4OVU A;  2C7H A;  3PHW B;  4F8C B;  1KLV A;  1H4R A;  2KK8 A;  3AE7 B;  4KV2 A;  1ZOY B;  1VLB A;  2MBH A;  1WR6 E;  1T6B X;  1NYQ A;  1N5X A;  1DOY A;  3W1Y A;  4ARI A;  1WXS A;  1V5T A;  1E8Y A;  4KZC A;  4ICV A;  4E71 A;  5IKC M;  4FXC A;  1XF5 L;  2BVC A;  2VH2 A;  4US9 A;  1OQY A;  3AEG B;  1QIL A;  2KMM A;  4HPM B;  3WIM A;  1DOI A;  3ZKJ C;  2KFJ A;  4KIK A;  1PGX A;  1RM6 C;  4YTP B;  2KJ6 A;  1YD8 U;  1C76 A;  4PS8 A;  3PO0 A;  4KGR A;  3NS1 A;  4MH0 E;  4IWO A;  3VR9 B;  3LB8 C;  3O65 B;  5HHD G;  5E6O A;  1IGD A;  3U7D A;  3W5U B;  4B0M A;  2IO1 B;  1XXG A;  4YT0 B;  1DOX A;  2DBY A;  2IO3 B;  2MRP A;  4BBN F;  1CZP A;  3AU5 A;  2ZPY A;  1WR1 A;  4AP4 C;  1P1A A;  3P4S B;  4BOZ B;  4K7W A;  1FO4 A;  4HK2 A;  2LWP A;  2X38 A;  4RF1 A;  4MGY E;  1K50 A;  3BY4 B;  4JIO U;  1WJ6 A;  3L17 A;  5BMI A;  4CYE A;  1QT9 A;  1C4P A;  3BVZ A;  4JQW C;  2B76 B;  3RD2 A;  1V86 A;  3AED B;  4A6Q A;  4GN1 A;  2L3Z A;  2N9X A;  1C78 A;  4W9G A;  1WE6 A;  2NBW B;  1AW7 A;  4BBN C;  3Q3N C;  4ANU A;  4HJG E;  2INC C;  2KAJ A;  4MJS A;  4KDL B;  2WGS A;  4N58 A;  4C00 A;  3VH4 B;  4KX6 B;  4A55 A;  4GIV A;  1SBB B;  3U30 A;  1P3Q U;  4C80 A;  1C3T A;  2XK5 A;  1ENF A;  4B9K A;  1VD2 A;  2MH7 A;  4E74 A;  1TKE A;  2Z8L A;  4HDO A;  5FKA C;  1WX9 A;  1FD6 A;  1N62 A;  3TEX A;  3N1X C;  3ZVV A;  4CHK A;  2MJ3 A;  3QHT A;  2LHE A;  3VR8 B;  3O13 A;  3ZDT A;  1YJI A;  1IYF A;  2R2Q A;  4WJN A;  2KN5 A;  3DWG C;  3L16 A;  2UU7 A;  1SE3 A;  1YN3 A;  3GP7 A;  2WX0 A;  4HCN B;  3KYC D;  2DNF A;  4M0W A;  4RCO A;  1MG8 A;  1V5O A;  4HKQ A;  2FID A;  3IBE A;  1FPY A;  4HEA 1;  4WQM A;  1WGK A;  4C4V B;  2NTT A;  2FBW B;  1YQ4 B;  2MSE D;  1WX7 A;  2GBN A;  3HRD D;  3RNC C;  4GDL B;  2INP E;  4W9E A;  3AEB B;  5AUI A;  3ZIM A;  2ACZ B;  4PYZ A;  4BFR A;  3SR6 A;  2FCN A;  3VQI A;  3RYT A;  1WXM A;  3VHT C;  4NZL B;  2K8H A;  4EUT A;  2BS3 B;  1FMA D;  1WGR A;  2D11 A;  1EUV B;  1WRD B;  3PRE A;  4KGS A;  5C1Z A;  3PTF C;  2LRW A;  1D5X C;  3ETR A;  4US8 A;  2LGD A;  2OED A;  2W55 A;  3WCQ A;  3W5V B;  2ZZP B;  1ZXH A;  3MC0 B;  2ZCB A;  2LHD A;  1VZ6 A;  2BS4 B;  2FCM A;  4KGT A;  4AJY B;  3BIN A;  4S0R A;  2YEP B;  4XC2 A;  4K81 A;  1JRU A;  4NQL B;  5LLI A;  3IFW B;  3U52 E;  1PFD A;  1SE9 A;  3OLM D;  4S17 A;  1P0R A;  1TY0 A;  3C0R B;  2KNB A;  3GE3 C;  1L5P A;  4WQO B;  1FRR A;  1TS5 A;  2IGD A;  1GG3 A;  1OGW A;  1ROE A;  2KX0 A;  3Q6B A;  1WXV A;  2JT4 B;  3DVN U;  5JXV A;  3CF6 E;  3I57 A;  4TSS A;  3DDC B;  1WMH B;  3DOW A;  1WY8 A;  1OEY A;  4WJO A;  1LFD A;  1QOG A;  3DBR I;  5KHQ A;  3A33 B;  4W9C A;  1C4A A;  2JRI B;  3P1M A;  5J2R A;  2L05 A;  1TTN A;  4FJZ A;  3AH7 A;  3EHV A;  3ZTC A;  5D2M B;  3I5J C;  1WGH A;  3FIL A;  4KKI A;  2MX2 A;  4N6E B;  1KTK A;  2BGF A;  1WE7 A;  2IBI B;  4HDQ A;  1UD7 A;  1Y56 A;  2D5G A;  3OAW A;  1OTR B;  4LLG M;  1WM2 A;  2KQ7 A;  4PT5 A;  4XDC A;  2C7M B;  3ENE A;  3N30 A;  2L8J A;  3CWI A;  1EF5 A;  1M4V A;  2KTR B;  3GOE A;  3DBL B;  2K25 A;  2EMS A;  3N3K B;  3UIN B;  3EUB 2;  1XLQ A;  2BF8 B;  2KAC A;  1FFV A;  1TBE A;  2KJR A;  3A9J B;  1CJE A;  1K51 A;  2OJW A;  2MHJ A;  3IG3 A;  3JYU A;  3MP9 A;  2FUH B;  3MJW A;  1UBI A;  1R4N I;  2QIE B;  4RGT A;  1IGC A;  2V0G A;  3UGB B;  2CU1 A;  2J42 A;  5CHW A;  4I6N B;  2G4D B;  1Q0W B;  3UQA A;  2KDI A;  4C7Y A;  1JRO A;  1OQR A;  5E6P A;  1T5X D;  1VZ8 A;  3V3X A;  4K7U A;  2VZK B;  2N1V A;  4WAA A;  1L6V A;  1RWS A;  1VR9 A;  4FN2 A;  1HTO A;  3VUW A;  2ASQ A;  3AV8 A;  2J7Q B;  3A4S C;  4MGI E;  4JLC A;  2X8X X;  2DHZ A;  3A9J A;  3L4P A;  1DYQ A;  5DCN A;  1E90 A;  2PLP A;  2J0K A;  2BYT A;  3VUX A;  3X0W A;  3KUZ A;  2N0S B;  5IP4 D;  3VRB B;  2QDF A;  4W9H A;  2AQ1 B;  4GGQ A;  3ZRF A;  1Z5S B;  2ZNV B;  3DPD A;  2LXA A;  1YQB A;  2PTL A;  5T8I A;  1AN8 A;  3VRA B;  2ZW0 A;  3L54 A;  2DWQ A;  2RDB C;  1V1P A;  1P98 A;  3ML8 A;  1WI0 A;  3VH3 B;  3HVD A;  4KKJ A;  5BYR A;  4HRO A;  3MHS D;  5CX3 A;  1F9J A;  1QOF A;  4A90 A;  2A5U A;  1N60 A;  4HWI B;  1ET6 A;  4PS7 A;  1XT9 B;  1QOB A;  4LNI A;  4IKG A;  3RNG C;  3DBR B;  2JQR B;  4A3O A;  2PPH A;  1F2R I;  1E9M A;  1PUT A;  4M01 A;  4WWM A;  3N1Y C;  3NVV A;  2BBC A;  4JWS C;  4LJO B;  4HRS A;  2DYB A;  2PVO D;  5FR6 A;  3VDZ A;  5D7G A;  1E10 A;  2V3S A;  1T0Q C;  2N7E A;  2MA9 B;  3RNB C;  1AAR A;  1L0Y B;  2BPS A;  2KWU B;  4C4V A;  2W82 A;  4G50 A;  2KC1 A;  4X57 B;  1STE A;  3VFK A;  3V62 A;  1B1Z A;  5CHV C;  3URY A;  3HK0 A;  4HPP A;  2IY1 B;  1E6E B;  1XLN A;  1XQQ A;  2C5L C;  5LNK 1;  4LTU A;  2N9P C;  4G0N B;  3EA6 A;  4G3X B;  2KQS A;  3H7P A;  3PZ8 A;  3BYT B;  3SU8 X;  3BII D;  1HEZ E;  1P7E A;  4NPN A;  5FK9 C;  5AEK B;  4A9A A;  2BT6 A;  2MBO A;  3M95 A;  4NJ7 A;  5EE9 A;  2D3C A;  4P7I A;  4NJ6 A;  4WJQ A;  2ZVO A;  2GB1 A;  3ZLZ A;  1VRA B;  3VUY A;  2LJI A;  4MT5 A;  4OZA A;  1WF9 A;  4KZ0 A;  2KTF A;  1RRB A;  2WU5 B;  4RH6 A;  3UIO B;  4BKG A;  2Y5P A;  4FHJ A;  4W9K A;  2DZM A;  5IAA C;  3AE9 B;  4PK1 A;  2MLB A;  3PS6 A;  2XNA C;  3ALB A;  1I4G A;  4BZA A;  1IP9 A;  4DBG A;  1SIF A;  1SIJ A;  3QQ8 B;  2NS5 A;  2GRI A;  3PGE A;  1FFU A;  2LGY A;  1ZXI A;  3Q3O C;  2BYF A;  2E3T A;  2YEP F;  1D5Z C;  1UZX B;  1SE4 A;  4USA A;  1ZGU B;  2O6V D;  1ZDX A;  1KFY B;  1YJ1 A;  4MH8 A;  5JHA A;  2RPV A;  5BMH A;  4YTN B;  4Q2J A;  1RLF A;  2JPH A;  1TKY A;  4RF0 A;  2OOB B;  1WJN A;  2FIF A;  1K52 A;  1KRH A;  1SB3 C;  3AE8 B;  5D3I B;  3IXS A;  1C1Y B;  2XN9 C;  2KJH B;  2VZK D;  1BT0 A;  4AOF A;  2CKH B;  2BW2 A;  1D3Z A;  2WDR B;  3JSV B;  2BWE S;  3ZYY X;  2KTR A;  5HG2 A;  3U4E G;  3ZNI D;  3PLV A;  2PE6 B;  1L2N A;  2D3G A;  2IGG A;  3AI5 A;  4IM0 A;  4EFO A;  3AE6 B;  3R3M A;  4YTM B;  1NYR A;  1R4M I;  3MFG A;  3LDZ E;  3CSF A;  4BOS C;  1XCT L;  2AL6 A;  2MJD A;  2W3R A;  3AE2 B;  1VJK A;  3PVL A;  1UGM A;  2RMM A;  2M19 A;  1GUA B;  4WWO A;  1E8Z A;  4M0W B;  4MM3 A;  3SD5 A;  2NCN A;  1MJD A;  3K9P B;  3QC8 B;  4D2K A;  2DYM A;  2WLB A;  1A70 A;  4G11 A;  1QQR A;  4RGN A;  3RZW C;  1L7Y A;  3NVZ A;  2JWU A;  3A1Q A;  4NY0 A;  5JHB A;  3H9D A;  4LJP B;  3RMK C;  2L0F A;  2DAF A;  1WGD A;  3AEA B;  4YL8 A;  4ANV A;  3RZF A;  2J0M A;  2K6Q A;  3H6N A;  3CST A;  4K1R B;  5MPO A;  1QOA A;  2WXM A;  2K6D B;  4ARC A;  2BYE A;  2MJE A;  3LXF A;  3L13 A;  3MTN B;  3AXC A;  2V1Y A;  2PVG C;  3TIX A;  1FNW A;  4ANX A;  3H1U A;  3TUO A;  3RCZ A;  2LJ5 A;  2A4Z A;  2JVC A;  3Q8B A;  4DHJ D;  4WWP A;  4RM8 A;  1NVI D;  2DZI A;  3U8Z A;  4N59 A;  1FXT B;  3EGR A;  3AU4 A;  3RNA C;  3Q14 C;  1WZ0 A;  1C77 A;  3AMZ A;  3H8H A;  2IJ0 A;  3QCA A;  3APC A;  1B9R A;  1UWX A;  4HKZ E;  4OZB A;  1IUE A;  3NVW A;  3Q8E A;  2PKO A;  3TL5 A;  1L6U A;  2IPK D;  2IY0 B;  2SAK A;  5E6N A;  1C9F A;  2V3P A;  4EEW A;  2JF5 A;  4YSX B;  4OHJ A;  1VDV A;  3FAH A;  4JWU C;  2KWV B;  1U4A A;  4TUU A;  1TS4 A;  2KZR A;  3TBL D;  4DXA B;  4DHZ E;  3Q3M C;  4LNN A;  2M1M A;  3DBH B;  2RR9 A;  5C3J B;  1GPX A;  1SJE D;  1OEY J;  3RFZ B;  4NJC A;  4WWN A;  2K8C A;  3APD A;  2PIA A;  3KWL A;  3PT2 B;  4F1S A;  4HJK A;  1SEB D;  3V6C B;  3L08 A;  4RFB A;  2AYO B;  2TSS A;  2FNJ B;  2KVR A;  1EF1 A;  3KYD D;  4IM2 A;  1HZ6 A;  2R2O A;  3JW0 X;  2KMA A;  2ON8 A;  2ZNV C;  2MP2 B;  1SSN A;  2L1A A;  3R2I A;  2N4F A;  2PW9 A;  5E6J A;  2K5P A;  2NPT B;  1YX6 B;  4W9F A;  4ZOH C;  4H2A A;  3ZDM C;  5IN7 A;  4DK5 A;  2WXR A;  3PV1 A;  1KLG D;  1SJH D;  2L7R A;  1WGG A;  4AS1 A;  1LGR A;  2GMI C;  3Q8F A;  4AWJ A;  3DHH C;  1D4B A;  3IT4 B;  2KKC A;  4PS3 A;  2AQ2 B;  1DGJ A;  2EMT A;  4REZ A;  1PYW D;  2HTM E;  3SFD B;  1J7B A;  4ANW A;  3QAR A;  1QF6 A;  2O6V A;  4II3 B;  4OW0 A;  4MGZ E;  3NVY A;  4W9J A;  3AEF B;  4MSM B;  3NZU A;  1LM8 B;  5J18 A;  2I38 A;  1FEH A;  1BUI C;  3I3T B;  1A5R A;  4M8N A;  4EOY A;  4YSY B;  4J3O D;  4K3B A;  5GXG B;  1JWA D;  3V05 A;  4R3D A;  3R66 C;  2K1F A;  1T0Y A;  4W9L A;  2AWT A;  5G5H A;  2LAS A;  5D3D A;  1MHH E;  2WWZ A;  4O1N A;  1WZ3 A;  2N7D A;  3IAS 1;  1V80 A;  1ZKH A;  1YN4 A;  2JU6 X;  1I4X A;  4GMV A;  4KDI C;  3J9C A;  3TMP B;  1EWC A;  1XLP A;  2Z0E B;  3N32 A;  2EKE C;  5L95 C;  4M00 A;  2JRH A;  2PMV A;  2ZPN A;  2KLC A;  3ONS A;  1V1P B;  2MCN B;  3ECI A;  3RT3 B;  3QAQ A;  4ZYN A;  5TSS A;  1YJJ A; 
#chains in the Genus database with same CATH homology
 2M0X A;  2KDB A;  2N1W A;  1UH6 A;  2KMC A;  1KOT A;  4OVU A;  2BYV E;  3ZW3 A;  2C7H A;  4A3O A;  2PPH A;  2BKF A;  3NZS A;  3PHW B;  4F8C B;  1KLV A;  4IC7 B;  1H4R A;  2KK8 A;  4KV2 A;  4NNJ B;  3NOB A;  3Q3J A;  2KLG A;  4LJO B;  3Q3F A;  2DYB A;  2M4N A;  2MBH A;  5FR6 A;  1WR6 E;  2BKR B;  3VDZ A;  5D7G A;  3W1Y A;  3WAO A;  2V3S A;  1NI2 A;  2N7E A;  3ZTD A;  2MA9 B;  1E8W A;  1WXS A;  2C60 A;  1AAR A;  1V5T A;  1E8Y A;  4IW0 A;  2CS4 A;  1S3S G;  4KZC A;  4ICV A;  2BPS A;  2DZK A;  2KWU B;  3VAW A;  4E71 A;  2ZCC A;  4G50 A;  2KC1 A;  4X57 B;  4ZRK A;  4FA6 A;  3PZD A;  1WJ4 A;  3VFK A;  3V62 A;  1OQY A;  2Z59 B;  5CHV C;  4HPM B;  2KHW B;  2KWC A;  3HK0 A;  2IY1 B;  1CMX B;  5AZH A;  3WIM A;  3ZKJ C;  2KFJ A;  4KIK A;  1WJU A;  2UWQ A;  1XQQ A;  2C5L C;  3UIP B;  2N9P C;  4M8M A;  1EO6 A;  1GJZ A;  3A1Q B;  1I42 A;  3PPA A;  4G0N B;  4G3X B;  2KJ6 A;  2KQS A;  1YD8 U;  3DVG X;  3H7P A;  4PS8 A;  2MQJ A;  2L76 A;  4GXB A;  3V61 A;  4MH0 E;  4GU2 A;  4IWO A;  3SU8 X;  1GNU A;  3O65 B;  4GSW A;  2J0J A;  3SHQ A;  5E6O A;  3WAN A;  3U7D A;  4MSQ B;  4NPN A;  5DPR A;  5AEK B;  2IO1 B;  2M17 A;  2IO2 B;  2MBO A;  3M95 A;  2IO3 B;  2MRP A;  4NJ7 A;  3WAM A;  5G2N A;  1ISN A;  3H7P B;  4BBN F;  4P7I A;  3AU5 A;  4NJ6 A;  2ZPY A;  4URK A;  2ZVN A;  4WJQ A;  2NBV B;  2ZVO A;  4BVU C;  5CTR C;  1WR1 A;  1ZW7 A;  1P1A A;  4AP4 C;  2C9W B;  2PEA A;  4BOZ B;  4F7Z A;  3NS8 A;  2RSU A;  4K7W A;  3ZLZ A;  3L10 B;  2O2V A;  3VUY A;  2MW5 A;  3M3J A;  5DPW A;  2DZJ A;  3IVF A;  4MEL A;  3UQB A;  2LI5 A;  2L0T A;  4HK2 A;  2LWP A;  1WF9 A;  2ZJD A;  4AUQ C;  4MGY E;  4KZ0 A;  2KTF A;  1RRB A;  4HVB A;  1WGY A;  3BY4 B;  4JIO U;  4JGH B;  3UIO B;  2HTH A;  1WJ6 A;  2BWF A;  3L17 A;  4I6P A;  4BKG A;  4FHJ A;  4CYE A;  4W9K A;  3VTW A;  3LJ3 A;  2B3A A;  4TV3 A;  4DDI D;  3WAP A;  4MJS B;  2DZM A;  4JQW C;  2REX A;  5IAA C;  2NR2 A;  4KSL C;  3RD2 A;  1QZE A;  2MLB A;  3AUL A;  3TJP A;  1V86 A;  2LGX A;  3PS6 A;  3ALB A;  4ZDV A;  2FCQ A;  1IP9 A;  3QK0 A;  4N9F 4;  4DHJ B;  4GN1 A;  1UEL A;  2L3Z A;  2N9X A;  3VXW A;  4DBG A;  4W9G A;  1SIF A;  2KDF B;  5J17 A;  1WE6 A;  2NBW B;  3QQ8 B;  4BBN C;  4ANU A;  2NS5 A;  3WAL A;  4FHK A;  4GDK B;  2WYQ A;  3PGE A;  2KC2 A;  2LGY A;  5JH5 C;  1V2Y A;  4MJS A;  4KDL B;  4LCD E;  3VH4 B;  2BYF A;  4II2 B;  4HCP B;  4GIV A;  2UYZ B;  1UZX B;  2O2V B;  3OJ3 A;  3EC8 A;  3U30 A;  3DVG Y;  3T9L A;  1P3Q U;  4KIK B;  4HXD A;  1ZGU B;  2O6V D;  4NAW B;  4ZRI A;  4PYU A;  1YJ1 A;  2WX1 A;  1C3T A;  5JHA A;  2LRU A;  4KVG B;  2XK5 A;  3T8M A;  1VD2 A;  4B9K A;  3APF A;  4E74 A;  5DPS A;  1RLF A;  4HDO A;  2JPH A;  2IYD B;  1WX9 A;  4FUL A;  3L0W B;  1H8C A;  2KX3 A;  1E7U A;  3QA8 A;  2YLM A;  2OOB B;  1RFA A;  4EZL A;  1WJN A;  2FIF A;  3ZVV A;  2D2Q A;  3DCG A;  2MWS B;  4CHK A;  1K8R B;  3QHT A;  4NAW A;  4A20 A;  3ZDT A;  1C1Y B;  1Y8R C;  2ZEQ A;  2CHZ A;  2R2Q A;  3HHM A;  1IYF A;  2KJH B;  4WJN A;  1BT0 A;  4AOF A;  4TQ0 A;  2KN5 A;  1SGH A;  3L16 A;  2CKH B;  4K7S A;  4HPL B;  1D3Z A;  3JSV B;  2BWE S;  1GC7 A;  5BO4 B;  2KTR A;  2WX0 A;  2QHO A;  4GDK A;  4HCN B;  2K8B A;  3DBH I;  3KYC D;  3ZNI D;  3PLV A;  2PE6 B;  4GDL A;  1L2N A;  4LDT B;  4AJW A;  2D3G A;  3AI5 A;  2YVC A;  4IM0 A;  4EFO A;  1LQB A;  3R3M A;  1MG8 A;  5JZE B;  1V5O A;  1R4M I;  1KJT A;  4MGK E;  3WA0 A;  4HLE A;  3LDZ E;  3CSF A;  2FID A;  4KSK C;  2XBB C;  4BOS C;  3IBE A;  5EDS A;  3JSV A;  2AL6 A;  2JXX A;  3OJ4 B;  4J6I A;  3PVL A;  1UGM A;  2MSE D;  4B6W A;  5D94 A;  1GUA B;  4WWO A;  1J0G A;  1WX7 A;  1E8Z A;  1NDD A;  2GBN A;  4M0W B;  4JL9 A;  4GDL B;  2IO0 B;  2LD9 A;  4MM3 A;  3SD5 A;  2NCN A;  1WMH A;  4W9E A;  2C7N B;  3CMM B;  5C23 A;  3ZIM A;  4DWF A;  3K9P B;  3QC8 B;  2JZZ A;  2DYM A;  4TQ1 A;  4WJP A;  4BKS A;  1IPG A;  1M94 A;  4G11 A;  1VCB A;  5AZF A;  1L7Y A;  2JY6 A;  3RZW C;  4PYZ A;  3A1Q A;  4CO7 A;  4BFR A;  4NY0 A;  2DAJ A;  2FCN A;  3VQI A;  3RYT A;  5JHB A;  2GOW A;  3H9D A;  1WXM A;  3VHT C;  4GOC A;  4B95 A;  4LJP B;  5LXI B;  2L0F A;  2DAF A;  4ASW C;  2KXJ A;  1WGD A;  4YL8 A;  1LXD A;  2K8H A;  3UF8 A;  4ANV A;  3RZF A;  3A4R A;  2L00 B;  4EUT A;  2LZ6 A;  2J0M A;  2KFK B;  2K6Q A;  3H6N A;  3CST A;  2GBJ A;  2LVP A;  4K1R B;  1E8X A;  1WGR A;  2D11 A;  1EUV B;  3VTU A;  1WRD B;  3PRE A;  2K6D B;  3IHP C;  4W9I A;  3V60 A;  2BYE A;  4MEM A;  3PHX B;  5C1Z A;  3L13 A;  3MTN B;  3AXC A;  2V1Y A;  3PTF C;  3TIX A;  2LRW A;  4ANX A;  3H1U A;  3QWZ B;  3RCZ A;  2HD5 B;  2LGD A;  2LJ5 A;  2A4Z A;  2Z0D B;  2JVC A;  3DBL I;  2HE7 A;  3ZRC A;  3QJZ A;  1PQS A;  2ZZP B;  4DHZ B;  4DHJ D;  2CR5 A;  2ZCB A;  3EFU A;  1V81 A;  4ICU A;  4EKU A;  4WWP A;  2K39 A;  2KAN A;  3KH0 A;  4RM8 A;  2LUE A;  2FCM A;  4AJY B;  3BIN A;  4XC2 A;  3KUC B;  4K81 A;  5KHO A;  3R7R A;  1JRU A;  4NQL B;  4IWQ A;  1WFY A;  3IFW B;  2DZI A;  5LLI A;  2JZ3 B;  3U8Z A;  2FCS A;  1SE9 A;  3PRZ A;  1FXT B;  3AU4 A;  2WDT B;  3OLM D;  1WZ0 A;  5AZG A;  1P0R A;  3C0R B;  2KNB A;  4FAD A;  2I1J A;  3S2A A;  3DQV A;  2KFK A;  4WQO B;  3QCA A;  3APC A;  4BKT A;  1GG3 A;  4FBJ B;  2KDE B;  2GBM A;  1OGW A;  4XX5 A;  2KX0 A;  3PRM B;  3X23 A;  1WXV A;  2JT4 B;  3DVN U;  2IY0 B;  3H7S A;  3EEC A;  3TL5 A;  5E6N A;  3VTV A;  3ZNH B;  3CF6 E;  2LVQ A;  3SDL C;  4EEW A;  3ZNG C;  2JF5 A;  5DPT A;  3B1L X;  5L83 A;  2G4S A;  1WMH B;  3DDC B;  3DOW A;  1WY8 A;  1OEY A;  1YIW A;  2KWV B;  1U4A A;  4TUU A;  4WJO A;  2KZR A;  1LFD A;  3TBL D;  4DXA B;  4DHZ E;  3DBR I;  5KHQ A;  3A33 B;  4W9C A;  4OVV A;  2JRI B;  2XK5 B;  2M1M A;  2G3Q B;  1WM3 A;  5J2R A;  2RR9 A;  4IWP A;  2L05 A;  4EZJ A;  2OJR A;  1TTN A;  1OEY J;  4FJZ A;  2CHX A;  3A9K B;  3EHV A;  3QX1 A;  4WWN A;  3ZTC A;  2K8C A;  2RPQ A;  3APD A;  3PT2 B;  1Q5W B;  4F1S A;  4HJK A;  4EZK A;  5D2M B;  3V6C B;  3L08 A;  4GB9 A;  1WGH A;  2MX2 A;  2LVO A;  1Z2M A;  2AYO B;  2BGF A;  2FNJ B;  1WE7 A;  4XZ4 A;  2IBI B;  4HDQ A;  3NHE B;  1UD7 A;  3TCA A;  2KVR A;  4NQK E;  1UBQ A;  1EF1 A;  3KYD D;  2FAZ A;  3OAW A;  1OTR B;  4IM2 A;  4TKN A;  1YX5 B;  2R2O A;  3JW0 X;  2KQ7 A;  1WM2 A;  2KMA A;  2MBE A;  2C7M B;  1P9D U;  2MP2 B;  2ZNV C;  3ENE A;  1Q1O A;  2L8J A;  3N30 A;  1V6E A;  1EF5 A;  2M8S A;  2KTR B;  2N4F A;  1J8C A;  3GOE A;  2PJH A;  2V4L A;  1WYW B;  3JVZ X;  2NPT B;  1YX6 B;  2K25 A;  2EMS A;  3N3K B;  2IZV B;  3NY5 A;  4W9F A;  2I1K A;  4I6L B;  3D32 A;  3UIN B;  3KUD B;  3M62 B;  2BF8 B;  2CHW A;  4RM9 A;  5GMV A;  1TBE A;  2KJR A;  2KO3 A;  3ZDM C;  4BKS D;  3A9J B;  4ZRJ A;  1WIA A;  3IG3 A;  2G45 B;  3JYU A;  2GBK A;  1G6J A;  1RAX A;  3HM6 X;  2FUH B;  2DX5 B;  2MP2 A;  3KW5 B;  2RD0 A;  2RGF A;  3MJW A;  4DK5 A;  1UBI A;  1R4N I;  3PV1 A;  3W1S C;  3A9K A;  1X1M A;  3DBS A;  2L7R A;  1WGG A;  2XEW A;  2GMI C;  2DEN B;  2NPT A;  4AWJ A;  3UGB B;  2CU1 A;  2NBU A;  5CHW A;  4A3P A;  4I6N B;  2KKC A;  3HIZ A;  4PS3 A;  5HKH A;  2G4D B;  1TZ1 A;  1NBF C;  1Q0W B;  3UQA A;  1V49 A;  2KDI A;  2HJ8 A;  3QIJ A;  2EMT A;  5E6P A;  1J19 A;  1GC6 A;  3GZN I;  3W1S A;  2JWZ A;  3K9O B;  4K7U A;  2N1V A;  4WAA A;  2KOX A;  4ANW A;  3QAR A;  3R7Q A;  2O6V A;  4FN2 A;  4II3 B;  2Y5B B;  3VUW A;  2ASQ A;  3PRP B;  1S1Q B;  3KVF B;  4MGZ E;  2J7Q B;  3ZUN A;  4W9J A;  2KD0 A;  3A4S C;  4FJV B;  4MGI E;  4JLC A;  4IUM B;  3ML9 A;  2GBR A;  4LDT D;  3RUI B;  2DHZ A;  5IA7 A;  4FLH A;  3A9J A;  4MSM B;  3NZU A;  4MDK E;  2LXC A;  1E90 A;  4W9D A;  5DCN A;  3DVN V;  4E3C A;  1LM8 B;  5J18 A;  5TR5 A;  2J0K A;  2O6V B;  3I3T B;  3VVW B;  3P2B A;  1A5R A;  4M8N A;  3VUX A;  3X0W A;  2AEH A;  3B08 A;  3KUZ A;  4RMA A;  4EOY A;  5CHF A;  3ZO5 B;  3PSE B;  2D07 B;  2MBQ A;  2VRR B;  3PLU A;  2N9E B;  4W9H A;  1XD3 B;  4GGQ A;  3ZRF A;  2D10 A;  3R66 C;  2K1F A;  1T0Y A;  1Z5S B;  2ZNV B;  4W9L A;  3DPD A;  4IM3 A;  2AWT A;  2LXA A;  1YQB A;  3HM3 A;  2LAS A;  4DDG D;  3L54 A;  1E7V A;  2WWZ A;  1WZ3 A;  1P98 A;  4FJY A;  3RUL A;  2N7D A;  2MBB B;  1V9J A;  3ML8 A;  2DYO A;  1WXA A;  3ZNZ B;  3V6E B;  1V80 A;  1WI0 A;  1ZKH A;  3VH3 B;  5G55 A;  4GMV A;  4KDI C;  1I35 A;  3MHS D;  3B0A A;  1TGZ B;  5CX3 A;  1WH3 A;  2PE9 A;  3TMP B;  1KM7 A;  2Z0E B;  3N32 A;  1F9J A;  2EKE C;  5L95 C;  1HE8 A;  2A5U A;  5D6J B;  5LXH A;  2JRH A;  2NVU I;  2ZPN A;  4HWI B;  4PS7 A;  2KLC A;  3ONS A;  4IG7 B;  2MCN B;  3ECI A;  2AL3 A;  3RT3 B;  1WX8 A;  1XT9 B;  3QAQ A;  4ZYN A;  3M63 B;  2W9N A;  1E5W A;  2JUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...