4KE7A

Crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with an 1-myristoyl glycerol analogue
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
245
Chain Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMLPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 96
structure length 245
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke7A00
4MQLA 1SCQA 4JNCA 1IUPA 1H23A 5ALFA 1EK1A 3LP5A 1CFJA 5CT9A 4H7DA 3H19A 4WFJA 4BCCA 4NVRA 3G02A 1DT3A 4CG3A 3EF3A 5K3EA 4H77A 4PQEA 1HLGA 4BDTA 1FFBA 1ZJ4A 3FYUA 1FFCA 5JYCA 5AI9A 1H2ZA 3R3XA 2I78A 4QLOA 5JZSA 2C0PA 5DNUA 5AKJA 4ZV7A 1DINA 6YASA 3MVEA 1QIMA 2D5LA 1UKBA 2OQIA 3H17A 3KOOA 5CH3A 5A2GA 3IIIA 2V97A 4X3CA 2PU5A 2J4FA 4FKBA 2OG1A 4GBGA 4LKOA 1QTRA 4FNGA 4F0JA 5ALWA 3ED1A 4UFOA 5HK8A 1QIJA 2YH2A 3WZMA 1NX9A 1UT6A 1W75A 3WI7A 4QA9A 3STYA 3C8DA 3PF9A 3SX4A 2H7XA 2ACKA 1P0MA 1SC9A 5AHXA 3R41A 2HDWA 1MAAA 4UHDA 1A8SA 1ODSA 5HQ3A 4FBLA 1AKNA 1U8EA 4RE6A 5IVIA 1DTEA 3ZPXA 1CVLA 5JARA 2VAVA 4J0GA 3IA2A 1BS9A 1KEZA 2ORYA 2WUEA 3WK7A 1XZMA 1C4XA 1IMJA 2K2QB 1XRNA 2H9YA 1BCRA 3DEAA 2XUGA 1XZGA 1N5MA 4P92A 1EDEA 4J03A 3GFFA 4GWLA 1EHYA 2XMGA 3H2KA 2HADA 5AK3A 1CUAA 4OD0A 1TKRA 4BE4A 2BKLA 1JMYA 1JJIA 3WIOA 3DS8A 2XUKA 1XLUA 5AJHA 1QFSA 5HF5A 4X92A 2WFLB 3STUA 4UHBA 2ES4A 4H7JA 1F6WA 5AI8A 2DQZA 1F8UA 1OCEA 1UOPA 1PV1A 4QDTA 1UK9A 2XMCA 2OCKA 1ZGBA 5FP0A 3WQHA 4W63A 2C58A 3FCXA 5AKYA 4Y2RA 5JANA 4I19A 4TGLA 1HKHA 1YCDA 5AI6A 2O7RA 3PUIA 1Z68A 2R11A 1Q84A 4UHEA 3CCBA 4Q3LA 1VLQA 1K4YA 4AMYA 2GBCA 5BV7A 3GBSA 3G7NA 4K6KA 1XZIA 3ICVA 4YPVA 5T4BA 1TCAA 2O2IA 2OGTA 3ESBA 1EA5A 3D5EA 2PSFA 4C6HA 1DQZA 5JD5A 1WHSA 4BAZA 3GA7A 2BAGA 2PU7A 4UHHA 3BF7A 2Z5GA 4INZA 4M0EA 4MWTA 4B83A 4OYLA 2JIDA 2I3ZA 3FYUB 4Y2VA 3FBWA 4BZZA 5CT6A 4Y2SA 1G4HA 2ZYHA 5AOBA 3D4LA 4J0JA 4BVJA 5DJ5A 2HL6A 5F4ZA 2WU4A 5AM0A 5D3ZA 1VJ5A 3W9BA 4KYVA 4F5ZA 3W05A 1AC5A 4FLEA 2PSHA 2ZJ6A 1QIIA 2CEKA 1R88A 1YAHA 2D0DA 4GDMA 4EY4A 1FFDA 3KD2A 3Q0TA 4JUIA 3V1LA 3BIWA 4OB7A 2XB6A 4PO3X 3AINA 4W1PA 5FPPA 1EINA 1WOMA 1FJ2A 2XUQA 5JAOA 3K9BA 4C87A 1PFQA 3LIIA 2RI6A 5A7HA 4AO6A 5C8XA 4X6YA 1LBSA 3BL8A 3B12A 3JYHA 4AN1A 4LYDA 4X00A 4Q3OA 5AOAA 1BRTA 3PI6A 2G63A 1W6RA 5E4JA 4GECA 1MJ5A 5HF8A 3H18A 1YB6A 1JU4A 2JF0A 4N5IX 4U2DA 1U2EA 1W1IA 1ISPA 1R50A 4PV7A 4JEIA 3I2JA 2PUHA 2ONCA 2QZPA 2OXEA 3WL8A 4G9GA 2JGIA 3SWWA 5KWJA 1RWQA 3FWHA 4X7BA 3C6BA 2Y1KA 5AKLA 1XZJA 3HEAA 4XWGA 5JATA 1CUSA 3TRDA 5EIAA 3PFBA 5IH7A 4B81A 5AKGA 2BGRA 4OU5A 4CG2A 1YS1X 1RYYA 5EI5A 1BE0A 1MTZA 1LPBB 2GYVA 1JI3A 4FWBA 4UBLA 2VT7A 3AJAA 3ESAA 4H7KA 3N2ZB 1DWOA 2HIHA 1UKAA 5SYMA 4K6HA 1N5RA 3IB3A 4C01A 3VVLA 1E66A 3HACA 3L1JA 4LXGA 5D3KA 4KRYA 1QIKA 1YB7A 2I3DA 3QZUA 4DNOA 3O9MA 2WG2A 4G9EA 5K3AA 4ZREA 3HXKA 2WUGA 5AP9A 3DOIA 1MO2A 4H0CA 5LZ7A 3ZLUA 4DSAA 3FLBA 3X3HA 1YR2A 1BCSA 1VE7A 1QONA 2XUFA 1CPYA 2YYSA 3OURA 3VJLA 2WHPA 1XZBA 5K3FB 1ZJ5A 4YK7A 1HPLA 5AI4A 4FFWA 1N8SA 3BIXA 5LKRA 1B6GA 3G0GA 2RIPA 1TCBA 2AXEA 1LPSA 2G4LA 4Y7DA 3WKDA 3WYNA 3BWXA 5H3HA 1ZI8A 2PX6A 3DL4A 1WPXA 4PSDA 4X6UA 1HQDA 1QIDA 1ZI6A 4J0CA 2WJ3A 2GBFA 5LYYA 3F96A 3QPAA 5LZ9A 3E1GA 1QLWA 1XZEA 4EA6A 1XZAA 3GZJA 3TEJA 3NOXA 1MX9A 2ZYRA 1CLEA 1LPAB 4P93A 4AZ0A 3C87A 3FSGA 3I1IA 1IZ8A 5E2IA 2QT9A 3AIOA 4KAJA 4IH9A 4IO0A 4G4IA 3VKFA 2VJCA 3IVMA 1GKKA 4D9JA 3DJYA 5HZGA 3DDUA 3WWPA 2BJHA 4DMKA 5CT4A 4Y2QA 5EHXA 4AO8A 3O4HA 4HRYA 4K2AA 4QWWA 1CUVA 4HVTA 2BGNA 1UKCA 5DNWA 1SFRA 3CXUA 2CBGA 4WFIA 4ETWA 3WWCA 2AJBA 4AQDA 1EB8A 4F60A 5C8ZA 4HZGA 3G8YA 3N0TA 4UBMA 2DHCA 3C8HA 1JJFA 1LPMA 4H7FA 4B0PA 5AM2A 4Q3KA 2EEPA 1CUEA 1QOZA 5FLKA 3OC0A 2XQGA 1E8NA 3MUNA 2ZYIA 3D0KA 3S8YA 1USWA 3RK4A 4X71A 3DCNA 5EHNA 3R3VA 4B85A 2IX9A 3OPMA 1XZLA 2Z8ZA 5AO9A 1MNAA 2VSQA 4KJXA 5LZ5A 2PUJA 2E3JA 2QTBA 3UUFA 2X76A 2ZVDA 3DKKA 3T52A 1CUIA 3BJRA 5JALA 3QMWA 3DLTA 1Y7IA 3P2MA 4Q82A 5ALDA 2ZJFA 1YA8A 3WL7A 2WJ4A 3G9UA 4LXHA 3NWOA 3LIPA 3C5WP 4Y2TA 2H1IA 1K63A 5EFZA 5C8VA 2QR5A 4J0HA 2HHAA 5ALIA 1E89A 2PSDA 4ARAA 4LHEA 4A23A 1K6EA 4KAAA 1E3QA 1Q0RA 1SCKA 1IUOA 2GZRA 4YASA 5JAPA 1CUUA 5DTJA 3W9UA 1D07A 4JH0A 5AIBA 3I6YA 1UZAA 4E15A 4Y2UA 4MQMA 2HRQA 2JEZA 2JBWA 4L72A 1DX6A 2HRRA 2DFPA 4H35A 5ALHA 5FRDA 5FXMA 3D2AA 4NMWA 4UFNA 3B5EA 2GYWA 3U0VA 2UZ0A 2ACEA 2WG1A 4C4YA 4EY7A 3H2JA 3O4JA 1XQWA 1A8UA 4XIIA 5HQ3B 5FDFA 1FSSA 4GLBA 3EQ8A 4BATA 1JU3A 3VVMA 4O08A 4NZZA 4BCBA 4G1FA 4EHBA 3F67A 1EDDA 2FJPA 3I1YA 2QM0A 5AKZA 3UUEA 3WKBA 4W1QA 4A16A 4X93A 4Y2XA 2WHRA 3KXPA 2VTVA 4J0IA 3WA7A 3JWEA 2C5FA 3WK9A 5HF6A 2QS9A 1DU4A 4X90A 2WTNA 2XT0A 2PPLA 5LZ2A 1ZICA 3NGMA 2JGMA 5ALTA 1C7JA 3CN7A 4EBBA 3TJMA 1THTA 1QE3A 2XDWA 5CBKA 2XUHA 2VATA 2C5GA 2WKWA 2Z3WA 4DGQA 1GKLA 4BVLA 3F98A 1W4LA 5HK9A 5EIHA 1WB5A 2V98A 3PUHA 3DD5A 5DLPA 3W2TA 1YAJA 3C6ZA 4G4JA 4FNMA 1L7AA 2ECFA 2WJ6A 2YASA 1VE6A 3G9XA 5CXUA 1EDBA 3IUNA 3DNMA 3T4UA 3RKSA 1I6WA 4CIAA 3AILA 4QDOA 5FKJA 5AKHA 4CCWA 3R3ZA 3E4DA 4IH1A 1ETHA 2OGZA 2HA4A 4ZI5A 5AH0A 2J4CA 1Q83A 3K6KA 5ALOA 2C7BA 2WFZA 4ROTA 3IUJA 1CUWA 4X97A 5ALLA 4X91A 1ORWA 3EQ9A 2XQFA 2FUKA 5T4HA 2QRUA 3DQZA 5AKEA 1R3DA 1DQYA 4W9RA 5ALZA 2OGSA 2J3QA 4HAIA 1SOMA 2H7YA 1AX9A 1CUHA 1E8DA 4KAFA 4ZGBA 3I6MA 4UBIA 5AKKA 4RGYA 1W52X 4N8DA 4DTCA 5ALQA 4A5SA 4WY8A 1TRHA 4QDXA 5CH8A 3WL5A 3DL7A 3WWOA 4L9AA 1U65A 3C45A 2RGUA 3BE8A 1EI9A 5LZ8A 3H2GA 1B41A 2XUAA 2DR0A 1CUBA 3DYVA 2WIFA 2QUAA 2QJRA 1CUGA 3GELA 3G0DA 1ODCA 3BXPA 4BCDA 3L1HA 1UK8A 2WU3A 5ALEA 5ALSA 4KE7A 4C4XA 1KU0A 3ANTA 1XQVA 2OCLA 4KEAA 1AUOA 2WHPB 1XRQA 3M81A 2HA5A 1UK7A 4M0FA 4UHCA 5CTAA 1GT6A 2WIKA 5DYTA 4H7IA 2XQIA 5DTIA 2QXTA 2VEOA 3C5VA 1CEXA 4OCZA 3PF8A 5J3JA 1BEEA 1A88A 3W06A 1JFRA 4MXDA 1JT2A 1WHTA 3TGLA 3WK8A 5AKXA 2LIPA 1UOOA 5HFAA 4B7ZA 2HU8A 1BU8A 4LYEA 3DOHA 1W76A 1LGYA 5HCUA 3G0IA 4EB0A 2XMBA 2VF2A 5ALPA 1QO7A 5DWDA 1UOQA 1VOTA 1QIFA 5T4EA 1TCCA 2XQJA 4CG1A 3H2HA 3IDAA 1QFMA 4TVKA 3PE6A 4HS9A 2BUCA 1XZKA 1GGVA 4U2CA 2FJ0A 5HKBA 1YA4A 1CUFA 1BN6A 2W22A 2WLSA 3NUZA 2C4HA 5SYNA 3ANSA 3DYIA 3SK0A 3I2KA 3U1TA 1LPNA 2XUDA 4AO7A 4WFKA 1N1MA 2J3DA 4HTAA 4DLNA 3ZI7A 1OXMA 4G8BA 5LZ4A 2WIJA 4J0DA 4X6XA 4BZWA 1BN7A 1K8QA 1QZ3A 2HA6A 1NU6A 5A6VA 2OAGA 3FLAA 5YASA 1AMNA 3EQ7A 2XUPA 3STWA 5I7UA 4W1RA 5ALJA 4KACA 5HFNA 5HKAA 5K5EA 2O7VA 1S8OA 1XKTA 4KE6A 4AX4A 4BAGA 3WK6A 3FLEA 3HJUA 1XKLA 4FDMA 3G0CA 2FX5A 2ZYSA 4BB0A 2QMQA 2RHTA 5CURA 2WILA 1H2WA 4QWMA 3AFIA 2X8BA 5DYYA 2WFMA 4PSCA 3BJMA 3BF8A 4OB6A 2I03A 3IUQA 2Q0XA 3O4IA 4FTWA 5ALGA 3AUKA 2PBLA 1EH5A 1DWPA 3ESDA 1X70A 3FNBA 1EK2A 5EIEA 4IH4A 3G9ZA 1XZFA 4OPMA 1BEZA 2PL5A 4DM7A 5AM4A 3A70A 1QO9A 5AM3A 3V9AA 2WIGA 4CI9A 1ZD4A 3WKEA 1Q0ZA 3HC7A 4C88A 4BC0A 4DMHA 4DMCA 2Y6UA 1Y7HA 2DSNA 3KSRA 2BCEA 2WSLA 1JKMA 1ZD2P 3S2ZA 2XUJA 3WWEA 3GUUA 5DNVA 4UBOA 4PW0A 3MUOA 4AXBA 1A7UA 4K5QA 3DKRA 3ILSA 2OCIA 2CUTA 1XLWA 3BDIA 4GXNA 5LLSA 2JGEA 1CQZA 4AZ3A 1QTIA 4BAUA 3ZWQA 3IUMA 4RE5A 3D7RA 2ZSIA 4H7HA 1CUYA 2Y2VA 1O6FA 1LPOA 1M33A 1VZ2A 2QXUA 4H7EA 4B0OA 4UFPA 4U2FA 1H2YA 4E11A 3RM3A 3FVTA 4QDZA 1DX4A 2O2HA 3QM1A 2B20A 4QE3A 1VA4A 3V1NA 5EHZA 3R3WA 5D7BA 5LP1A 4KE9A 3O95A 2HA2A 4B9AA 2WHQA 3WK5A 5JD4A 1UWCA 3QYJA 4X85A 4OYYA 4AN0A 4N5HX 3A2MA 4Y2PA 1CUCA 1XRRA 1AZWA 2CMFA 2HFJA 2BUBA 2B4KA 2HA7A 5C81A 4EY5A 1QIGA 4Q05A 4GEGA 1CR6A 3HZOA 4P08A 3D2CA 4UHFA 3H04A 2RONA 1HBJA 1CUZA 1GQSA 3Q8WA 2VAXA 4JYMA 1FFEA 3LLCA 2HU7A 4IQ4A 2WUFA 1TAHA 3RLIA 3VJKA 2AJCA 3IULA 1RP1A 1EVQA 4QNNA 1YASA 2VJBA 2XMQA 2CKMA 4AMZA 1BROA 1QIEA 3R0VA 2PM8A 1ORVA 4PF1A 3VXKA 3WA6A 5JAUA 4Y2JA 3R3YA 4HXEB 3I2FA 3CN9A 3FSGD 1CRLA 1G42A 2QUBA 1TQHA 1ACJA 4ARBA 3VJMA 1LPPA 3E3AA 5FOQA 2P8SA 5AI5A 4MJ3A 4MWSA 3FVRA 5JD6A 1KU6A 4B6GA 1AURA 4BBZA 4AB1A 2O2GA 1XROA 4KR0A 1J06A 3ZV7A 4GHWA 4Q1VA 1DWQA 4UBJA 4BTLA 2OCGA 3STXA 3O4GA 3FYUC 1QGED 1QJ4A 4H18A 2IIVA 5CH5A 3WL6A 2JGLA 4B9EA 4P9NA 2CZQA 3LS2A 5ALMA 3WIBA 3KDAA 4HRXA 3AZPA 3D59A 1G66A 1MT3A 1MPXA 2QVBA 4DYHA 1OILA 4K6GA 4HXGA 2DHDA 3I2HA 5A62A 3AIKA 1X2BA 2HA3A 3EBLA 1YSCA 2XMDA 3C6YA 2WQZA 4MEAA 3SC2A 3WZLA 4OSEA 1MN6A 2XMRA 3OM8A 3QH4A 4X94A 5A7FA 1LZKA 1XQYA 4DNQA 2VQ6A 3QMMA 3FCYA 5K3FA 4B80A 3A2LA 2V96A 4PSUA 2RHWA 3LCRA 3I28A 4B82A 3H1BA 1HL7A 4Y2YA 2ZJ7A 1U4NA 2C0QA 2VA9A 4U2EA 5CT8A 5IVDA 5ALVA 4G4GA 4UPDA 3GROA 1GZ7A 3WWDA 3WK4A 2XMZA 3FYTA 1EB9A 1XZHA 4W1SA 4BP9A 1THGA 1ZD3A 1UFOA 4J0KA 1ZGCA 4Q34A 5ALRA 4UBNA 3UMJA 4BYMA 4C89A 4B84A 5BOVA 3PDCA 1EXWA 2B61A 3B3QA 3H1AA 5A71A 1JMKC 1LLFA 5ISMA 1HDEA 2JGKA 5I8PA 1TIBA 5AIAA 1GQRA 4RPCA 1J1IA 3I2GA 3QMVA 2XQKA 2JEYA 3L1IA 2Z8XA 3O9VA 1LBTA 3ESCA 5ALKA 4FBMA 5ESRA 4BDSA 4XVCA 1T2NA 2GYUA 3STVA 1MAHA 4U2GA 3CCCA 2XLBA 3H2IA 1E8MA 1R1DA 4ZV9A 5KREA 3WLAA 1CIJA 1A8QA 1JJBA 2PKYX 4EUSA 3KWJA 3WYDA 4BP8A 3MGAA 2WUDA 5KBYA 1XZDA 4GI1A 3V48A 5ALNA 3C43A 3H0CA 4V2IA 5JADA 3E0XA 5ALXA 5FPQA 5D6OA 1MX1A 3WMRA 2QKYA 2YXPX 5E4TA 1F0PA 4KRXA 1XRMA 1L7QA 4G8CA 4LIPD 3HABA 2CB9A 5IVKA 4XX1A 5EGNA 2WG0A 1MU0A 1J2EA 3W04A 4CCYB 1Y37A 3IBTA 4HXFB 5JZBA 2WIDA 2VJDA 4MYSA 1WCYA 1ZI9A 5K3BA 1ZD5A 3FOBA 1ZIXA 2HA0A 2XLCA 4DNPA 4ZRDA 5JASA 3QBJA 4DSZA 1DT5A 1GPKA 1WM1A 3VISA 4WDQA 2H7CA 3C6XA 1G5FA 4WCVA 4MEBA 3AZOA 5JZ9A 3G0BA 4NS4A 1XRLA 1TK3A 4GW3A 2OPHA 1AGYA 1GXSA 2EDCA 1GPNA 2HM7A 3V1KA 1C7IA 4WDRA 4F21A 1P0IA 1X2EA 2JGFA 4CFSA 1VXRA 2DHEA 4DIUA 4FFVA 3QITA 4N8EA 3I6ZA 2DCMA 2VT6A 1WB6A 5K3CA 5AM5A 3OTQA 3QPDA 1T4MA 3O0DA 4FOLA 5CXXA 4RNCA 3YASA 5CMLA 4ZXFA 4E14A 4QLAA 1EVEA 3F9CA 4DNFA 5AKIA 3AZQA 1XRPA 4UUQA 2W6CX 3I2IA 1XFDA 4S0XA 2B9VA 4LXIA 4FMPA 3WKCA 3V1MA 5E4YA 4N8SA 1IVYA 2Y6VA 2Z3ZA 3ZLVA 1R9MA 1CUDA 4KE8A 1NU8A 2PVSA 4DMFA 5DYWA 5ALUA 5BWBA 3WKAA 4I4CA 4WJLA 5CT5A 5FUMA 2XMSA 2X5XA 2QJWA 2AJ8A 2V9ZA 1WB4A 2R8BA 3WJ1A 3K2IA 1ZIYA 2WFLA 5CW2A 5FV4A 5HF9A 3OG9A 2BUAA 2RAUA 3F8SA 5AK6A 1XZCA 4MYDA 1ACLA 5BWCA 4G5XA 1LNSA 5AI0A 4TPKA 1AQLA 5CRIA 2G5TA 1K5PA 4EY6A 4WY5A 5AK5A 3A6ZA 4C4ZA 2ZSHA 5LIPA 1O6GA 3WJ2A 1UXOA 1L7RA 1MNQA 2GZSA 1PJAA 1XLVA 4L3WA 4E46A 2HFKA 4Y9SA 3RARA 4BVKA 3FAKA 4CCYA 2DQYA 2BFNA 2AJLI 1LZLA 5T4FA 1E5TA 4J3JA 5C7YA 2XUOA 4BRSA 3BDVA 4X95A 5AICA 4M0MA 2NW6A 2XE4A 3HI4A 3M83A 4EZIA 2Y2UA 3A2NA 2VJAA 4QZVA 1IUNA 1H22A 4BE9A 5IVHA 4U2BA 3HLKA 4G8DA 4XJVA 1IZ7A 5JIBA 3R3UA 4FLMA 1XQXA 5KWIA 2XI4A 4OUKX 1EX9A 1VXOA 1R4ZA 4FLFA 2IITA 1UK6A 2GBIA 3QVMA 4BC1A 3D2BA 5AK4A 5AM1A 3KWFA 5A7GA 4UBKA 1YS2X 2JGJA 1P0QA 3PFCA 5K3DA 2CJPA 4JYPA 4L0CA 4EY8A 1ZOIA 1CV2A 1F0NA 1VKHA 4ZWNA 2XUIA 2EDAA 5LKAA 3G9TA 1CQWA 3OOSA 4J7AA 3QPCA 1CUXA 3HYSA 4IHAA 2PSEA 3M3DA 5I9IA 2OQVA 1VA5A 1P0PA 1H2XA 3HSSA 2WM2A 4OB8A 1J07A 3VDXA 2G5PA 2GBGA 1GPLA 4I3FA 4QEKA 3ICWA 1QIHA 5EHQA 3JW8A 4PNZA 4BTVA 2OAEA 4BRZA 1WPRA 5AOCA 2QOEA 2ROQA 1ODTC 3AIMA 4QDUA 5ALYA 2OLEA 2AJDA 4FHZA 3EIOA 1MX5A 3HRHA 4YX9A 2HU5A 3C70A 4OU4A 4CIBA 2WTMA 1R9NA 3IURA 1CUJA 3F97A 7YASA 2PSJA 3M82A 4ITVA 3R40A 4Z49A 3PICA 5IKXA 1VZ3A 1SCIA 5JAHA 1FFAA 3D3NA 3ZLTA 3STTA
chains in the Genus database with same CATH superfamily
4WKBA 3L7IA 5AVJA 4JNCA 5BSKA 3MTQA 4KDCA 2EJUA 2FW7A 1DUVG 1KI3A 1KMNA 1EK1A 221PA 3D4IA 3HLYA 3FDIA 3K35A 4MI3A 3SU8A 2JFUA 1KORA 2BMDA 1PJ3A 3D54D 1HNWB 2PKQO 5K3OA 5CT9A 3LVFO 4BNDA 4H7DA 2O8CA 4BCCA 4EG1A 5CUQA 2JANA 3FZNA 1YDHA 1CR0A 3K73O 5TIIA 3EF3A 1KNQA 5K3EA 4RK4A 3T5CA 2VP3A 3GMTA 4YDHB 1EDZA 1E2EA 1RJWA 1YC2A 4IZHA 2P9QA 4DIKA 1HLGA 4RDXA 2I6FA 1X7WA 1ZJ4A 2H9AA 1O96B 2V9CA 3A04A 1HEIA 4QPJC 4RWEA 4F3CA 5C1OA 2GF2A 3ZJVA 2CMDA 3M6AA 4FFNA 3DFMA 3HJAA 1NLZA 4NS1A 2IUFA 2L2QA 5TJ9A 4RMJA 1GOTA 1VIAA 4AJ1A 5A06A 1BJTA 3O92A 1PYDA 2B3DA 3ITEA 5GQSA 3M9WA 1QKKA 1U8TA 2C0PA 1GCGA 2OKCA 4KXUA 3WOVA 1C30A 1PUXA 3RH0A 4BKRA 1VPVA 2R7MA 2GN8A 1O2DA 1ZUWA 1PVDA 5F7XA 4OQQA 3W8DA 4R1QA 1UKBA 2XVYA 3D5QA 1JHDA 3KPJA 3V8EA 2D7DA 3QUSA 4MIYA 1X77A 2J4FA 3H9BA 1B73A 2FA9A 1JPNA 3IPCA 2ANCA 1DDGA 3O1JC 3WL4A 1R4MA 4JT4A 3U37A 3ZWOA 4FNGA 2X4IA 1XYYA 1E5VA 4MV6A 4B3MB 5ALWA 5AVSA 2C4VA 2X6RA 3ACCA 5THQA 3ZD8A 2GA8A 3VA7A 3MAGA 3R8FA 3CZ4A 3EXG2 2PX4A 3KWMA 1OTXA 1U1DA 3WZMA 1U8AA 1K06A 4DLZA 2JAWA 3OWXA 4A8JB 3SXUB 4DLLA 3C8DA 3VC7A 4TM7A 3GW8A 2H7XA 2YZNA 2ACKA 3NHKA 1NDUA 4RF4A 1XELA 3QY9A 2WWYA 5DNEA 5AHXA 4BQIA 3VKHA 2ZEJA 2HDWA 1MAAA 1G4AE 4YRPA 5DHPA 2WP8J 1QYCA 2RKOA 3UOGA 3HCAA 1PDVA 3ZWVA 1U8EA 1V26A 5I9NA 3D31A 3CX6A 3IV9A 3E7PA 4RE6A 4KPFC 3B2QA 4O4LF 4U9HS 3O4RA 1E3JA 3IUYA 5JARA 3ZOKA 3O8OA 4IHQA 5T64A 4J0GA 3EXAA 3GCGA 2CXHA 3NX4A 1WEKA 3BIJA 4GL4A 3WK7A 1C0KA 1X7ZB 9ABPA 2JAPA 2J9ZB 1ML4A 2QMOA 1GG9A 4XYBA 4W5JA 3RKUA 1U7PA 2HQ1A 4NEQA 1RP7A 3U26A 3TVYA 3MERA 1XRNA 1K3UB 3H5IA 5JI3E 5CDFA 3OQ6A 4EI9A 4LNUA 1UBUS 2E4VA 1CY0A 1JQAA 2Z9CA 3HP4A 3ISVA 2ZDHA 3WYCA 5BNTA 1Z17A 4L16A 3DEAA 4DJTA 5FD8A 4OL0A 2WWVD 3SZLA 3ABQB 5K0JA 1XRJA 5SZJA 4ANFA 1JPJA 1BGXT 4QXRA 1PGNA 3UGTA 4DCVA 5IFLA 4LOIA 1BKDR 1JJ7A 3CBGA 1UC9A 1XQ1A 3F4KA 3UT5B 4AL4A 5FBRB 3CNHA 3H16A 4DHWA 5AW9A 1JG6A 3NDRA 3TSAA 2G36A 4CT0A 2CN1A 1U3CA 4FUTA 4FIZA 4KIWA 2HADA 2QB5A 5IC4A 4MVJF 1CUAA 1XPOA 3R6GA 2NM0A 1OFUX 2Z4SA 4REMA 3QGMA 4S0ZA 2DF8A 4JI0B 2GRJA 3DS8A 1XLUA 4RD6A 2KB0A 4HCJA 1SOWA 4LZZA 2AG8A 3NV9A 3DMDA 4XCVA 5IJXA 1UBLS 2H65A 3P9QA 4AK9A 1DGQA 2OQRA 2OWDA 4ZRNA 3U31A 3A3KA 1JWLA 5CAEA 4M9SA 1KZGB 4YAFA 2DQZA 4YBRA 3DV9A 4Q7LA 3AB3A 3SS7X 3UM9A 3WQBA 1GZDA 1PV1A 3GEHA 4E5MA 1SPXA 2X14A 2VJMA 4YAKA 1PNOA 2ZRFA 1V11A 5FA8A 3LW7A 2E85A 1T2AA 1L8AA 3DAOA 3EZ2A 3KEQA 1KFEB 4M1WA 5DBFA 3KLNA 2E4YA 1I01A 3ABOB 4JBWA 1PD0A 1A9XA 4MEJA 4ZTBA 4W63A 1XU4A 4AUNA 2WPDA 1YZGA 3B3AA 1EK6A 3OLWA 1BE1A 1CE8B 3OPYB 4EJSB 1Y9EA 1RM3A 3LO5A 2I9PA 3VHXA 1SQFA 1JG1A 3NG1A 2DOKA 4TWAA 1VPTA 1VI5A 5KX5F 5LLTA 1ZG3A 3O90A 1YC5A 2O7RA 3LYHA 1MRZA 1ILWA 3EC2A 2AMJA 1B8NA 2IYQA 4FNOA 5T7BA 1UZUA 1Q84A 1SU8A 1DRVA 1JLKA 1CSEE 1RADA 4FGZA 4LYJA 3O73A 4BLSA 5KPJA 4RHTA 2AR0A 3O3CA 3FGOA 3U7RA 4HXYA 3B3JA 4KLNA 4KQMA 4YP7A 4Q3LA 1VLQA 4GKJB 3T9DA 2CF5A 2IZ0A 3FGNA 4Q24A 3ZW7A 1RIIA 1F06A 3ETCA 1TYBE 4LF8B 1UBOS 4H15A 1CY6A 1AS0A 3HGTA 3MEQA 5CG2A 5BQPA 1AHNA 3I09A 3TTWA 4TRMA 4L28A 3LYLA 2VZLA 3FFXA 1IPEA 5AVUA 4K9QA 3TE6A 4JBXA 3OZRA 1OLXA 2JDIA 2W8BB 1JKIA 1TCAA 3DFKA 2OGTA 4H60A 4BX0A 4EVIA 5A4MS 3NDBB 1S3GA 3BGVA 1NT4A 3ASVA 4PAQA 2WM9B 2PUFA 5JD5A 1KEPA 4Y30A 3B51X 4BAZA 5I7OA 1R0LA 2I62A 3NYRA 4S1VA 2XDAA 4O2AB 5IT9A 3S7TA 4XX0A 4IIFA 2X2OA 2FEMA 4TKVA 1GCOA 4J7CA 3QX3A 1B26A 3RSOA 3UK2A 3TDNA 2WUWE 3D3WB 3GLIA 4QATA 4GVLA 1Z29A 2JIDA 2DXIA 1W2GA 1VG1A 4JASB 4Q66C 5EP4A 1TJ5A 5EY5B 2WNHA 3V4FA 4RCZA 3OWOA 4ZVLA 5IDQA 3DBHB 4M87A 3H8SA 1NOIA 3FYUB 3AB7A 4Y2VA 4BZZA 3I52A 2ORWA 4S1NA 4Y2SA 2VBFA 1T5DX 3R0IA 2BOVA 1FS6A 2BISA 5TJHA 3NC1C 5AHWA 3D4LA 3V9PA 4LY0A 1W49A 3AR4A 3EG9A 3ET5A 2YZ7A 5DJ5A 1XV5A 1IIRA 2WM8A 4KIJA 4E3WA 2Q2WA 4UTZA 5JR3A 3V7NA 2RJNA 5AM0A 3P4XA 3H7IA 2X0NA 4NK4A 5E2BA 3JZFA 1W2WB 4XXHA 5D3ZA 3WL3A 1ZKMA 3PDIA 1QM5A 5EEHA 1BW9B 2V5AA 1DX9A 2C9BA 2L19A 5EE9A 3FDZB 3VGPA 1KAQA 3UW3A 1B6RA 3A1TA 4LJSA 1R16A 1ECGA 5JCZA 3I72A 1VJCA 2QRJA 2V6GA 1W5FA 4HQNA 3UA3A 4QBTA 2DJ5A 4BO0A 4JU9A 3RYHA 1I5EA 1QGOA 1YAHA 2FQQA 2PWZA 6ABPA 3U7HB 4FONA 5DM0A 1RRPA 2ZRPA 1RRMA 3TW4A 4CW7A 3HMKA 3Q0TA 1CP3A 1IY1A 3MSXA 1RAEA 2RK6A 2Z6AA 3V1LA 2CDAA 4E03A 1SD2A 1BU5A 2I34A 3E5MA 4OJTA 4M6WB 1G18A 3VC2A 4B7UA 4B34A 4BJ5A 5JDIC 1EINA 2AEMA 2R2GA 3TOSA 4BO3A 1IEWA 1KTVA 3AFHA 4L27A 3KCNA 4LXUA 3TLBA 4C3ZA 4CU5A 2QV0A 1O95C 1OYWA 3E18A 5TVGA 1PFQA 3WAGA 4G09A 4IGIA 2BJWA 2DFNA 2PAFA 5E1BA 2PMCA 1S2OA 3TPZA 2BFAA 3TZKA 2ZPAA 4EEZA 3GHHA 3ZI0A 2QRVB 2X0EA 1SKYE 3GMDA 2M6RA 1H2RS 1LJUA 3AKYA 3S2YA 3WLMA 1JIIA 2XB8A 4IDQA 4ER3A 3ONNA 4XUGB 4O2BB 1XCMA 3PCTA 3P20A 4GOLD 1YF3A 3JVEA 5FI0B 2X5KO 3NBMA 4JT9A 2PX2A 2IQ5A 2IZ7A 1BRTA 2FWBA 5D51S 4CM7A 5EEGA 2WB4A 1WQ1R 1ZBQA 3HXPA 5E4JA 5ETJA 1JAXA 3NNSA 3ORYA 4EI7A 3SXJA 1TF2A 1PO7A 5CM2Z 1MJ5A 2D00A 2J3LA 3U81A 3T7RA 5T5QA 5HF8A 3H18A 3IKJA 3G13A 2IRWA 3OT1A 4KOAA 2J5BA 2PNFA 4I9GA 3KSDO 3R7FA 1I7SB 4FGSA 2D5IA 3CR3C 3QA3E 5L7TA 1UFKA 4RLHA 1JAIA 3M2TA 2ZUVA 2JGRA 3OLXA 2JF0A 5JAMA 3UV7A 4F2WA 4MV5A 4N5IX 3W9YA 4MB6A 3NASA 1ISPA 1YIOA 1KJ8A 4NV0A 1ELOA 2H85A 2CVPA 3HYRA 5EXSA 4DJ5X 1E4EB 1XZPA 1ULBA 3FYHA 3ZZTA 4D99A 4NBSA 3IKMB 2ZIUB 5FTJA 1JNXX 3KQHA 3RRYA 2QY9A 2TMDA 1VKZA 2PUTA 2G76A 3C3AA 3H5WA 4LSZA 1J2TA 2J1LA 4EOGA 5DGTA 4YONB 3PGA1 2FPLA 2WF6A 4RAOA 3RUPA 1USIA 1AB5A 3QNWA 4DY4A 2NO7A 3RT7A 3ZV5A 3KHTA 2JGIA 4O1IA 5AW0A 2OC4A 3BWBA 4BXOA 3F4LA 3JVVA 5KWJA 2IE8A 4H9GA 3IBGA 5IEBA 4M1SA 3QYAA 4HGOA 5LOVA 3MQFA 1TFRA 4Q9IA 3ZE9A 4KGXA 1H4QA 2HK8A 4NCXA 2P4QA 2WVHA 5T8KA 2AI3A 4RABA 1TF7A 4PO9A 1PF7E 2QG4A 4NBWA 7ADHA 4XWGA 1CUSA 1XTRA 2MWMA 1DKPA 1ECCA 2R6FA 3BEDA 3D7SA 3IOEA 4WINA 4X61A 4YMHA 3FKQA 3Q7RA 4I1IA 4HLUA 3BB4A 3UV6A 3ZQKA 4OHZA 5IH7A 4JIGA 3Q7TA 1B3RA 4B81A 4IIBA 1RI2A 4CLDA 4FFMA 1YQTA 1BE8A 4TTRA 4P7KA 3AQIA 3L0ZA 1QH1A 1K6IA 3U3DA 2HZ7A 4ZAXA 5SY9A 4N41A 3TZ6A 2JKZA 1G16A 5BN4A 1IJKA 3COPA 3KC2A 3KYBA 2UKDA 4L9RA 3T3MB 1BE0A 4PRKA 4DG5A 2HEGA 3KEMA 4BO9A 2NYUA 1QHYA 2X1VA 4IVQA 1FXWF 4TSFD 1Y33E 2OG2A 2AI1A 5EZYA 3L0OA 1P4JA 3PUXA 1LPBB 4O4IA 2YZKA 3X0DA 4ND4A 1BJRE 1R64A 3ONFA 5ECGC 2YBDA 2QX7A 4FWBA 1KY2A 1VFPA 4UBLA 4YPFA 4TWBA 2PMDA 4MVXA 1LB1B 3WGOA 5CYGA 1R9JA 5LUAA 3DP9A 4EGAA 1N7GA 1XP8A 4ZOAA 5HKKD 4LCJA 3G2LA 5E1OA 2IU3A 1AO0A 1CVIA 3T7IA 4JQSA 4OIMA 3WLLA 4XSVA 1RWVA 4IIJA 6CHYA 1IH8A 2RAVA 1XU9A 4H4CA 3QVSA 3D3EA 1PJ8A 1L5MA 4H7KA 1B1CA 5LOVF 2QAIA 1UKAA 2YRXA 4QXQA 3ZI4A 2QI9F 4Z9YA 4MGEA 3BIOA 5SYMA 4K6HA 2JH8A 2Q50A 4R7ZA 3IB3A 2ZJAA 4B6FA 3VVLA 4FE7A 4C01A 3PEYA 2QYHA 5GP1A 5TRTA 2D5AA 1DTWB 3VPDA 1Z34A 1ZQ1A 2HYIC 2ZVPX 2P2NA 2OFPA 4OEHA 1OPXA 4MW1A 3P5SA 2FQYA 3C8ZA 3LNCA 1Q7TA 4MKZA 3UQYS 5CCDA 1F38A 2ZT8A 2WT4A 1OBCA 1VJGA 3E5NA 3NS7A 4JELA 5EKSA 3U4QB 2EFJA 3OEHD 2QHXA 4BN5A 1Y1RA 2OLJA 5JFOA 1W0CA 4KC0A 4X66B 2FLVA 3AHEA 5T67A 1KMCA 4G9EA 3ROMA 2Q5OA 1O94A 4Y6RA 5HE9A 2H63A 3VR2D 1T9CA 4L2IB 2WUGA 3SP1A 3AESB 3BUSA 1H85A 1LJLA 2GAAA 1IOVA 3CF2A 5BSFA 3GVIA 1MO2A 1DKLA 5LP6F 2D13A 1NHWA 4LHVA 1VKJA 3LFHA 1ZGGA 2R4UA 1B1AA 3LCVB 3Q7QA 3ZDCA 3X3HA 3CGWA 1FMJA 1IZZA 1ZVVA 1XWIA 2VUTA 3F7MA 3R6DA 1IHYA 1QONA 4KN9S 3CUKA 3RI3A 4BNKA 2G82A 3U3MA 4KWIA 2VDPB 1ZL0A 5E9WA 3L05A 1NR1A 1ZMRA 4RVOA 3S2SA 1Q17A 5ELMA 4CODB 1RWMA 2QPTA 3QJ5A 3V4ZA 1RBZA 3ZTTA 3OZAA 4OO3A 3ZGNA 4BNFA 5CB0A 3KKEA 1NRJB 2WHPA 1XZBA 4EYEA 3EDCA 4C0AC 3EWNA 1H4VB 1G291 2DULA 2I6XA 2PTHA 2VXOA 2ZRBA 1KDZA 1T2CA 3PC8A 4RIHA 1XTZA 2IGBA 5H02A 1IBCA 4EGCB 2C20A 2EIXA 4CG0A 3KJNA 4F3YA 2EIHA 2R7KA 1HE3A 1NN5A 1VFNA 4D46A 2ORED 4JLAA 1E2MA 2EZUA 2Y0PA 3IOMA 4FT4A 1IY2A 5FPSA 3ROPA 4B3BA 1LRJA 5ARBA 1H93A 5LKRA 1NZJA 1FMFA 1IHUA 1E1DA 1TK2A 2QV7A 1QHXA 2DRIA 2KWIA 2QLNA 2MOKA 2RIPA 4K6CA 3TQQA 2QW1A 4ES6A 3FZGA 3HRIA 4L8YA 4GC5A 1OXXK 1LPSA 3BMOA 3K05A 5G4LA 3UK7A 3NT5A 4JVMA 5DN9A 4IJVA 4FDLA 1WUHS 1ZI8A 5D01A 4DR7B 1OKKD 3CF0A 3DL4A 2XZTA 3KUCA 2G7MC 2HPAA 4NSNA 4X6UA 4CU2A 2YQZA 2Z98A 2KBFA 2VZEA 3CLSC 2E1PA 2QMZA 2V4MA 3FNQA 1BWPA 4J0QA 3TZBA 1FRVA 1ZI6A 1XTVA 2B2CA 3L1KA 3WIVA 1Z5VA 1RHQA 1RDFA 1U1CA 3MCZA 1SC6A 4X1YB 1RW4A 1IJEA 2UUCB 3NKLA 2YV1A 4X7RA 1JR6A 4J07A 5ERXA 5JROA 1XJQA 1I2BA 4I1OA 1U9IA 4YRKA 2HHLA 1ZCJA 3VR4D 2WQ6A 2ZBQA 2FW9A 3K0CC 1XZEA 4GOMD 5UKDA 4ME6A 5FTMA 2EQBA 4YJGA 3HSKA 5TPWA 3TLEA 1PL7A 3TZEA 3GZJA 4WNCA 2SBTA 2I7TA 3NH9A 4GX0A 1TA4A 1A82A 1QHEA 1FDRA 3DHVA 3NOXA 1FLDA 1C2YA 2XXBA 4B87A 4BVGA 4WBNB 3J80A 2O2EA 2JBAA 4LDZA 4PU0A 2V74B 4RYLA 2FCRA 2MHCA 1G6OA 3B1VA 5CPFA 4DR2B 4MVJG 3OQNA 2IUYA 3HLTA 2QT9A 5KSYA 5KSWB 3RTDA 4F45A 1D0VA 2NU6A 1J97A 3ME5A 4DG8A 4RQAA 4BEVA 4B3HA 1EAYA 3EEYA 2P4EA 1LK5A 5HZGA 3ZLBA 3SJ7A 2BJHA 3MTAA 2JLQA 1XTJA 2FKAA 3B70A 5E9QA 4XLLA 1NN0A 4PGGA 2X1LA 2ATIA 3WBJA 5EHXA 1E2GA 4LZLA 3O4HA 4HRYA 2IYFA 5TQJA 3WTBA 3VZDA 2MSWA 1M1YE 3DDOA 5JZMA 4BP3A 1TA0A 1OR8A 2XGMA 4F1JA 1JBEA 4LKRA 3LO8A 1BMFA 3KAKA 4W6QA 4YAOA 3SQNA 3ND9A 1AN9A 4MUNA 3CXUA 5EJ9A 4LC1A 3DZKA 3FNFA 3O4FA 5CNJA 4NV1A 4M9QA 1KVSA 2O3QA 3WWCA 1QQ6A 4OQ4A 2FN9A 3UHJA 2MJLA 2QI9C 2JFHA 2XYPA 5C8ZA 4C06A 1HMYA 4HZGA 5EJFA 3AR8A 1TNDA 5C46F 1IFXA 1UP7A 2FN8A 2PGNA 2XKJE 4C30A 5FNVA 3R9IA 3KOXA 3W90A 5E9AA 4Y9RA 1MV5A 2PT9A 3T7JA 2CNBA 5IT5A 4Q3KA 5L53A 3P8ZA 1CUEA 3H1PA 2JA2A 3IT3A 1XTQA 1R3UA 4DLKA 1P2GA 5IUNC 4C21A 4UEWA 2IW1A 1JWBB 1F2DA 1SQ6A 2NU9A 5JG7A 1H9CA 1N6OA 1KMHA 3HR4A 2ECPA 3T5PA 4QSHA 5DIZA 2G67A 4DUGD 5TQ2A 4UDYX 4ZVUA 3JAKA 1ZMXA 2WJJA 4ZYWA 4LHXA 1WZIA 3GDHA 2OHOA 1FNDA 1RSZA 3B1WA 3K5WA 1KDPA 3JQGB 4JEUA 4KFCA 5AO9A 3ACBA 1RHUA 4NATA 5A5EA 4KJXA 4W7IA 5F1OA 1ZU4A 1GV0A 3WNZA 2DTDA 4BE7B 4YALA 3WLIA 1OJLA 1E7MA 4PBRA 4MQEA 4MW7A 3VH4A 1UZLA 1W59A 3DDWA 4BV8A 1LDMA 3HKEA 3T95A 2Y1OA 1WETA 4BFLA 4Z4IA 2C59A 4R31A 3UVEA 1XZ8A 2B1QA 2Q3FA 4BMYA 1EX6A 3BJRA 1UT5A 3NCHA 4TTIA 3QMWA 4EUKA 2DECA 3LV8A 1JYSA 2I2FA 3H11B 3MPOA 3P2MA 2YWGA 4Q82A 2VP9A 4DA9A 4ZJPA 1ORHA 4KRGA 4MWCA 2SKCA 3VBEA 2NUPA 5JS8A 2DPMA 2PS0A 2WJ4A 2FPPB 3E9CA 3DVAA 4GICA 4HPJB 4FQ8A 4JJZA 1F7VA 4DSNA 5GWXA 3G9UA 1OLUA 3K70B 3MMSA 1FDSA 4K9MA 2H1IA 2A0UA 3SVZA 5EFZA 5ITWA 3GLIE 1EG2A 1RZRD 3WDKA 5C8VA 3DDZX 1TTQB 2QD5A 1V48A 5FO0A 3UG7A 5DP1A 2GARA 3MCWA 1M2VB 4Y67A 3GIWA 4IIEA 4ZIRA 4A23A 1ENOA 1ZX1A 2H2AA 4FWTA 1Z7YA 2I4OA 4N7MA 4WUTA 5TVKA 3T41A 3DE3X 2C2HA 2GAFA 3DAYA 3QVVA 3TX6A 1AHIA 3BWMA 4FMDB 1JEDA 4FVTA 4JUCA 4EO9A 3L7NA 3MW8A 4RMGA 1E3QA 3IXQA 1XI2A 4R9SA 2GZRA 1U2GA 3QRWA 4Z5XA 1N1DA 1OW3B 3HVKA 3O0TA 4JX9A 1GQFA 3LDHA 1NG9A 4JH0A 4Y3UA 1M2WA 1C9DB 1ZMBA 3VH3A 2J0QA 2FEAA 3ZNNA 3AW8A 3B5JA 3JQ7A 3QX8A 3TH5A 2J5XA 5EINA 4ZDWA 3TOXA 1TT7A 1KJZA 3ZGVA 3RREA 1UZAA 3EIFA 3MWGA 1E60A 3UJBA 2H4JA 3GMIA 2B82A 4K88A 2CT8A 2VSNA 4GX5A 2HRQA 3IP9A 4KQWA 5IT4A 2QLLA 2ZIXB 1PQYA 3KQYA 3KEGA 4KREA 3BGWA 5DISB 3RBZA 1DE0A 1L0BA 1E9FA 2ZXEA 1Z4IA 2HRRA 1F48A 1H2EA 1CJUC 2DFPA 2O4CA 1SQ0A 2V6IA 2YJZA 4A82A 5ALHA 1OLSA 2P2CA 4YCAA 1ZRMA 4BGIA 4EY3A 5FRDA 4UTNA 3X43A 2Y0CA 4OTZA 1KFJB 2R6CA 4MB2A 1DXHA 3LT0A 5HGJA 3W78A 4BS9A 2OORC 4TS9A 4S05A 1U28C 1Z18A 4HZIA 4LGMA 1OIVA 1TD1A 4ZGWA 1G21E 4RSGA 3GYGA 4F2GA 1XD2A 5B4VA 1EX7A 2AD1A 5FPYA 5IABA 3FUTA 2QPAA 5B7NA 2C3OA 2ZJ1A 3GRKA 4ZCSA 3NYQA 2DHQA 3PZBA 1L4KA 3LT5A 5K2MA 2WJWA 5JY6A 1N75A 2UYYA 5JI2E 2Q2VA 5HUQA 1SHJA 1D6MA 1A8UA 4RM2A 2CHQA 3PNLA 3M3HA 1K98A 1FSSA 3VVCA 3VZBA 1KDTA 3GQVA 1F2TB 3OIFA 4C7VA 2DB3A 1CRPA 4R5HA 3GJZA 3SJZA 4ZYXA 3SMVA 3SJCA 3L1UA 1RBQA 1MOPA 3EEIA 1SKQA 4B4WA 3FTDA 5FPHA 3OLQA 4V1CB 1Z63A 4G5HA 3EIXA 4BCBA 1I1QB 3I4CA 3T5GA 4EMBA 1CVRA 2HRBA 2XF2A 4WMLA 2FJPA 4B5KA 4F7DA 2WF7A 1V1MA 1SZDA 3BA1A 4EUFA 3K4PA 1BMQA 2RI0A 3B89A 3OVMA 2GESA 4HDRA 2XOEA 4ZALA 1YACA 3F1LA 1IN8A 4FSHA 2XCLA 3BD9A 4HS4A 1D2NA 1TU0A 4RDIA 5DLQC 4UQLA 5ADHA 3C3EA 4BLRA 1U94A 1YOVA 3EYWA 3ZV3A 1JVNA 7MHTA 2C1EA 2QN3A 1F8YA 2ZREA 2VTVA 3WMEA 3WA7A 3JWEA 3H4MA 2J3MA 2ZWIA 4TXHA 5DHQA 5HS4A 1MB2A 2E4XA 2QS9A 2WAAA 4IUCS 5KQLA 4YCMA 4PLCA 3K7EA 1OLXB 2XT0A 1R5NA 2QL6A 4WERA 1J24A 4DIOA 1ZICA 2D7JA 2HREA 4K05A 1Q1BA 1NMXA 1D8AA 2I65A 3KLOA 4A1FA 5FOSA 3B1ZA 5HRUA 4P80A 2QD2A 3F7NA 4IUBS 4Z4QA 1JZSA 2AUTA 1YDFA 1S9HA 1WSAA 2H7VA 3CVXA 1THTA 3KDSE 5LQRA 3R6WA 2D59A 3V1TC 1RE0A 4Q9JA 1RT9A 4HH3C 3TLYA 2VJKA 5CBKA 3G2MA 3NGXA 4QJ3A 4OHXA 1DBVO 3P94A 1R0XA 4PQYA 2DQSA 1KARA 4J16C 5F35A 2Z3WA 2K7ZA 3KT6A 4TUYF 4DQKA 4ZD6A 3AF6A 3ZS8A 4B5LA 5JY1A 4UEOA 3LX5A 2QMYA 3RIYA 1MORA 1E4YA 5K6TA 4PGHA 1HFJA 3ILXA 4ZZIA 1DUSA 1Y9DA 1PZXA 4WZBB 4ABYA 3VR6H 2R5WA 2CNNA 2MSCB 3DD5A 1B74A 2ADFA 3OJOA 4INAA 2DUNA 3R75A 2I6UA 1TLLA 1SRQA 2QNBA 4JDPA 4NU5A 2VN8A 3JQCA 4C20A 4PYQA 1FNBA 3UUGA 5BYKA 4G4JA 1YVUA 2GXQA 2C4WA 2DBRA 4FNMA 1C3LA 1F5SA 1BXKA 2YN2A 2WJ6A 4Q12A 1D1PA 4V02A 1VE6A 2F43B 4QBKA 1N8NA 2XD9A 2YXBA 3M6MD 2I67A 4NFYA 2VTBA 3D8NA 2DUMA 5IG2A 4CTKA 4XD7D 3EZ7A 5EA2A 4QG7A 1U9JA 3C5CA 3EGWA 3LX6A 1L6IA 4U7PB 3V8RA 1IQUA 1I3LA 2PO5A 3DKVA 3SDBA 3T4UA 4EZEA 5F23A 3RKSA 2G9RA 4RD3A 1W0KA 5I9MA 1T2VA 2JI7A 4J1TA 1ZGHA 4YCBA 4E33A 2V0NA 1B0UA 3ER9A 3HA2A 4EW1A 1U2QA 2OAQ1 2GZAA 1E1QD 3OD1A 4ZICA 3KQVA 5AKHA 5AVXA 2IDJA 3L9XA 3E4DA 4Q47A 3RRNA 4NP6A 4XVHA 4L6IA 1ETHA 2JCSA 2J3KA 1WZ2A 1E2BA 1N5KA 1T0PA 5E8JA 2LP4Y 3ECSA 5L3VA 3CZQA 5ADVA 2J4CA 3DNPA 2ZT5A 2JFFA 3LUKA 3FI0A 3GC6A 1IB0A 3LT2A 1RXIA 2NPOA 5I48A 1F12A 2B36A 2CLMB 1LI7A 1WL8A 2RC5A 2JZNA 3R2JA 2WFZA 1WV0A 1VCHA 2BFWA 3SFTA 5K6RA 1TMGE 3VQTA 3RV3A 2CE2X 4UOQA 4ML3A 1NF3A 2GDZA 1G5HA 2JL1A 1I33A 1NMQA 2PHZA 1ORWA 4NQRA 2X4LA 3EQ9A 4EO7A 2R00C 4JT2A 3QVJA 5L7YA 3BL5A 1Y6FA 2HJRA 1KK3A 4AMBA 1ZGJA 3ANXA 3LFTA 5A3JA 3OF3A 2C4TA 2CWWA 4R8VA 4W7SA 4B6JA 5BUSA 5CDSA 4GE3A 2QT1A 3EIQA 4RFSB 3SN6A 3V1UA 3PXBA 2JJ2A 4WCFC 1JGTA 5ALZA 4HP8A 5DXFA 3W5IA 5K01A 2HCRA 3GLGB 3EG9B 5ICGA 2VO1A 4OXQA 2HTFA 4HAIA 3U4GA 1D5CA 2PT7A 1QS0B 3PX7A 2BKEA 1QP4A 2VUIB 3IBFA 5JSUA 4NOLA 5DNYB 3LY5A 4ER6A 2W6QA 3QPWA 1WPQA 1WXXA 4HATA 4K28A 4L07A 5AKKA 3RF7A 3TDMA 1KO7A 2NXEA 6REQB 1W52X 1VL0A 4K86A 3S6JA 2XECA 1ADJA 1AF7A 5C4MA 1JEAA 4DTCA 5ALQA 3T3PB 3NXSA 4UUAA 2F6RA 4Y1FA 4WY8A 4HDMB 1HETA 2EZTA 2XBUA 4Y8VA 3QXSA 4MW4A 3WL5A 3WWOA 3RUHA 3VPSA 1H8HD 3L3BA 4U7WA 2OM6A 5DM60 5BSGA 4CLOB 3K9GA 1G8PA 3ZYZA 4D26A 1VL1A 1RAGA 4DB2A 3QI2A 3IT2A 4LGVA 2AHOA 4ILKA 2R2AA 1PNTA 5LZ8A 4B3GA 5K8JB 5A4IS 1CXZA 4FHEA 2Z6UA 1B41A 2HXSA 2ZB8A 2CLKB 3V2HA 4KR3A 1DLJA 1X0XA 1CUBA 1WW2A 3DYVA 4ZAGA 1S2IA 3VR5H 3AJEA 4Q5IA 2XUZA 1E2FA 4HN9A 3DDSA 2WDZA 3UT0A 2I2DA 4KXFB 1KY5A 1OREA 2QUAA 3LRTA 2QJRA 4UMFA 4XA8A 3GELA 2O7SA 3OUTA 1Z26A 2QVYX 1DHRA 1MRNA 2A86A 3NHBA 5E3IA 1ODCA 4CF5A 1NF2A 1TB4A 2FSSA 3BXPA 3GFSA 1J8VA 4TMFA 4HRVA 1D03A 3FMGA 1DJQA 4TL9A 3REQA 3ZD6A 1BX0A 1SUPA 2Q9UA 2B6NA 4RL4A 5ALEA 1A2BA 5EXDA 5CEJA 1BDJA 4JBNA 1ST2A 2QAJA 3T7EA 5JBNA 4OHVA 5DP2A 1EHCA 2PMKA 4JWKA 1X7HA 2AEFA 2W6OA 1NASA 4H3VA 2OCLA 2P7IA 3T34A 4U0JA 2JVKA 3BKXA 1A9XB 3C0KA 1Z8HA 3GAZA 1AUOA 2H2IA 3GUHA 3X2SA 2Y9MB 3SVTA 1A9PA 1G8HA 1XRQA 2HA5A 3KFLA 1CE8A 3OPYA 3NBQA 5CTAA 1GT6A 1TADA 2QZ4A 2FE1A 4CR8A 2GM4A 2GVDC 3DZBA 5DYTA 2I66A 8AT1A 2DFLA 5DTIA 4PX5A 3MTDA 3TW8B 2EBFX 2R60A 3NYIA 3RTEA 5IASA 4IICA 3PF8A 2O50A 4CLOA 5J3JA 2MMGA 1A88A 2APJA 2AR7A 1R6BX 1KPGA 1VJDA 3EA4A 5JCJA 4MXDA 2WAXA 2P9CA 3N5KA 1WHTA 2JH3A 1EUCB 4UJ5A 5KTYA 1MJFA 4X7PA 2FMUA 3AUUA 3ZHXA 3TGLA 4RQBA 3MQ4A 1GGNA 4IDGA 1UOOA 1VJ1A 1X8LA 2C7VA 2XRFA 2YZ2A 3NAZA 4UVDA 3U4DA 1WNFA 1R00A 1CWUA 10MHA 1J8YF 3VOSA 5BUCA 3AVQA 3FKJA 3CUTA 1X80B 4D6PA 1ZJZA 4EVSA 5LMZA 4LYEA 4LXTA 1SK9A 2YN4A 2Q3MA 3GP5A 3DOHA 3O1IC 4Z86A 1PN3A 1MW8X 4KWEA 1RWOA 5TE9A 2YXDA 4OFWA 1EFVB 4RACA 4G0NA 4ZO8A 2K87A 4AUMA 3Q12A 2GPYA 1LGYA 5LA6B 1YE3A 2PZFA 3G0IA 1IQPA 4R51A 5BUZA 2E37A 2FPGB 2PV7A 1QO7A 1TO2E 2Y67A 4KQFA 4MAMA 2DTXA 1WU7A 5FBLB 4QTYA 3HCPA 1WPGA 1P4AA 2O2XA 3PKIA 5FYQA 4ZCTA 2Z08A 3LUCA 1IBLB 3HO1A 3A58B 2EEZA 2G9UA 1RWNA 3B53X 3HNRA 3WGLA 5C1DA 2AMYA 1QX4A 1AJEA 1M7HA 2EZ9A 4CMGA 4MIEA 1Z07A 1TCCA 2BRUA 2R97A 2XQJA 4IX9A 3RVNA 1VL8A 3DT9A 1D9XA 4J76A 1W44A 4BVBA 2ZBEA 3S40A 2C97A 1K68A 1XIVA 5F2OA 2X7XA 3VTAA 3W6PA 2W2MA 3IR6A 1TQDA 2FJ0A 2XDQA 3FPKA 2ZSAA 3D4PA 4MUFA 4R2MA 4U2CA 3UKJA 1IHDA 4YAGA 4EDHA 3TNYA 2A4MA 3OPNA 3NUZA 4IDDA 5SYNA 4MJ7A 3BHNA 3WQQA 2JJ8A 4ZI7F 2O6HA 5JJKA 3HYCA 3DYIA 4PC7A 2GGSA 2C8LA 1YR3A 4MLZA 1Q6YA 4R81A 3SIXA 2FZEA 4U6NA 5CCEA 3HXQA 3G2HA 4RKFA 2WVAA 5CA0F 3JCZA 4GM1A 2XUDA 3REFA 1YIDA 2Y66A 2ISSD 2O3SA 2O0KA 4R1SA 2J3DA 1Q16A 4UJ3A 2CDBA 2FSFA 4D3DA 1JQ3A 2YFQA 2Z9DA 4FZJA 4MV3A 1QNFA 2P9JA 3D8TA 3E8XA 3ND5A 4IEIA 3LA6A 4D4IA 3H9QA 2ENWA 4GPEA 2B8NA 2VXBA 1DUIA 4QGHA 5BN5B 3OKCA 4ACBA 1WBBA 3IOBA 4RJKA 5C5IA 3KM0A 5TXGA 3DVRX 1KA9H 1EK0A 2E89A 1NU6A 4YGXB 3ZHSA 3DM9B 2ZPTX 3PTAA 2EHDA 5BNWA 4A8PA 2Q6KA 5BO5A 2W00A 4TT3A 4C1NA 5YASA 1AMNA 4JL5A 4QYXA 3HJRA 3STWA 3BCRA 3UFXB 5I7UA 1Q0TA 1SWVA 5ALJA 1XLTC 3DE5X 4X1IB 2QIPA 5BV0A 4KR6A 2RGYA 4CF6A 1ZH6A 2PX0A 3FDXA 1TW2A 1YGPA 3M6XA 2XTNA 1GSAA 3DL0A 3BK1A 5KB3A 3HHPA 4RTRA 1I36A 2Q29A 3FLEA 3A3PA 2G83A 1TZJA 5CR9A 3JYQA 1CNFA 2BGTA 1QP8A 1ZD9A 1PTKA 1XKLA 5LXTF 5JMOA 2NVBA 3CZCA 2C88A 1JXMA 3T5BA 1H66A 3EVTA 4WNAB 3UOAB 4B7XA 4TYNA 3GFOA 3ONEA 1GTVA 2RBGA 3TOVA 4AP9A 4H1TA 2QMQA 16PKA 2NU8B 2J46A 1BA3A 3JD0A 2JAXA 3E15A 2FPPA 1FFXB 2JI6A 2WILA 4LNAA 3UPTA 3KV1A 2FW1A 3AM5A 4D3SA 3R5KA 3PA6A 2RHHA 3C3XA 3KB2A 3FNIA 4OKSA 5ENVA 2COKA 4YRLA 4A6EA 1C9EA 4PG8A 1GQYA 2QTCA 4FFRA 4JBLA 2O5EA 3DFZA 5DYYA 1KYTA 4LBYA 2WFMA 4YUVA 4PSCA 1SIWA 1Q1ZA 4RK0A 3G5TA 4OB6A 3HP1A 1RZRA 1DBQA 1TL7C 2QSJA 3IUQA 1YJ8A 3IAS1 4GMXA 3W6ZA 3RR2A 4N40A 4PZAA 5HA5A 5J2TB 3H8VA 3O4IA 2Z2KA 3LUFA 3H5RA 1ZA2A 1N3YA 2PGOA 4GKAA 1K8YB 1KJ9A 1SU7A 1UPUA 4FUQA 4JGIA 5BMVF 3ER8A 1YRQA 3IAHA 3H75A 1DBSA 1LQTA 1M73E 2HGSA 4JJEA 4RKYA 4FFSA 2WFAA 2D8AA 4NYIR 4HJRA 4P86A 5JV5A 2GT1A 1QHHB 1V41E 2F64A 3C1UA 2XWPA 4DQLA 5EIEA 1XZFA 4OPMA 3SYMA 1M0WA 3H4IA 1P31A 4N9WA 1H0RA 2BT4A 4ZVNA 4DM7A 2Y8EA 1T2EA 2FFAA 2I4LA 2QZZA 5J5AA 3WE7A 3H84A 3A70A 3H65A 4KV9A 5GZ6A 1ISHA 1ENPA 1EZZA 2CLSA 2YJNA 3DOUA 3O4VA 4XUEA 3V9AA 5AM3A 3U6KA 4HQKA 3WKEA 4HZUB 2N42A 3L8ZA 3AJ8A 1CZKA 1Q0ZA 1CERA 3W6UA 3GRPA 3NNDA 4CMEC 3GLGE 2IUUA 1OZ0A 1DZIA 3EAGA 3SSOA 4BC0A 3IDQA 4RU1A 1F2TA 1GEEA 1UP6A 1P7VA 4YJ2F 4IIUA 3A9TA 5IX8A 1VYTA 3I9OA 4MR8B 3AM1A 3IUPA 1E96A 2ZIGA 3L7YA 4MRMB 4NR0A 3S2IA 2F1IA 4C4TA 2BCEA 3ZW8A 1IHXA 2J08A 1TEXA 2ZZNA 1CEEA 3HKBB 1NBIA 5DNVA 1GLVA 3JASB 4MROA 3UHAA 4PW0A 1SVLA 3MUOA 3CIOA 3E3OA 4G24A 1M2HA 2B37A 1RABA 3KUDA 3VPCA 4AXBA 1A7UA 3BWYA 4MW5A 3TQHA 4NBLA 3LC1O 2CK3A 1JHAA 4GXTA 4P7JA 1BVUA 2OHXA 4QPZA 4O4LB 5BRJA 3IR5A 1J5XA 2CUTA 3THXA 2XA1A 5F2EA 1V4BA 4OBEA 2EJCA 4WLUA 4GXNA 4JB0A 3RYFB 2JGEA 3VNSA 4LBZA 4CV3A 5I47A 3HXOA 5MGBA 1GNTA 2VDRB 5JAZA 1V9SA 2YS6A 2PFSA 4BAUA 2QLMA 3ZWQA 3OOYA 3IUMA 3TLKA 2EFHB 4RE5A 4URYR 3RBAA 3SHFA 4DQVA 1B6TA 3FR8A 3P9XA 4G6ZA 1G20A 1XXHB 1AOXA 3D7RA 3IMCA 5GONF 3B5IA 1JHUA 2GBLA 3VVBA 2VTEA 2WJVA 3TZHA 4ETIA 3H2ZA 2P6PA 4HNSA 3HWRA 4F6RB 5CDGA 4WASA 1P5ZB 4K9KA 1LW6E 4RK6A 4WVLA 2G72A 5C34B 1R7RA 2ZIEA 3O6VA 4UFPA 4OSOA 1Z7GA 3K2QA 1I5OA 1GGFA 4QYWA 4UXHA 5LIRA 3SLKA 1QZTA 3C16C 4QDZA 4IUYA 3BXFA 5IF3A 5C32A 1ZOPA 4WZAA 2J9YB 3UV3A 4OLHA 3CB2A 5FBHA 1XJWA 3H13A 1EWKA 4QE3A 3V1NA 1IVSA 1H3EA 2GJ9A 5HBGA 5IS2A 1QDEA 4DUGA 3EWSA 5LP1A 4TWRA 4KE9A 1PVOA 1SXJA 3L5OA 5JCOC 1LTQA 2G6BA 3AEUA 2RKWA 4UUOA 2G71A 4XQ9A 4HV4A 2HA2A 4B9AA 3C14C 2V8OA 2J5KA 2PEZA 3CVVA 1KFBB 3T3HA 3FMOB 2GZHA 1LX7A 1WUJS 1YCFA 2HOQA 4N7JA 1SU6A 1L7OA 4HWSA 3MJDA 3VR5A 4FD3A 2IHYA 1OVGA 2Y0BA 2ALJA 3ESYA 4BFYA 3IILA 1XRRA 3DTVD 4QYIB 5H7XA 2WSYB 1Z28A 3CNBA 4CFYA 1AZWA 1OBOA 2HFJA 3GT4A 1V8DA 3P96A 5EKDA 3ZJ5A 4FSDA 4L4UA 4EVQA 1QIGA 4PR3A 4QQNA 1QO0D 2ACVA 3GVXA 2O4UX 1Y4SA 1MTOA 5KHLB 4LISA 3T3OA 2P1DA 4K8RB 3MCTA 1D1TA 2FVYA 4KNWA 1NGSA 2FGKA 2E0IA 3RPEA 3BBPA 4ILEA 4CF7A 1ZMTA 4DR6B 2H29A 4QGAA 5H3LA 2OXRA 3TLJA 3QEOA 1GGJA 5BV8A 5DBHX 4C2TA 3C7DB 3ESQA 3COSA 1NV9A 3IQZA 1GQSA 3F5FA 2ZUSA 2I2WA 2GCNA 2VAXA 1KI2A 2Y9PB 4J94A 2H1LA 2CL7X 2GPNA 1PZGA 3DO6A 2DT8A 4QGSA 2WJPA 1QV9A 1UPXA 2WUFA 4AFNA 5MDHA 4OMCA 3VM6A 3Q9UA 2C31A 2WTBA 3OFSA 4WCDA 3HPRA 4QNNA 3AMVA 3ZK9A 3BFXA 1KI8A 4PAGA 3TR6A 1AXGA 3U7IA 1G8YA 4BPBA 4EZBA 1ORVA 1SURA 3DEJA 5AJVB 2GTIA 5EL0A 2C5LA 5CK4A 4CIXA 1ETUA 1SJ9A 5JAUA 2QF7A 1YNOA 3HPQA 3GD5A 3OEED 2G1KA 3CN9A 4IWNA 2HSDA 4QEDA 3K1AB 1Z6QA 2GVZC 3KZKA 1B3BA 4R8RA 3A9SA 4BQRA 4M9UA 1K7EB 1HTBA 1T24A 1SULA 4RTKA 4Q93A 3R3SA 4E0BA 1VHTA 3CSSA 4BNUA 1EUDA 3A4VA 4KWTA 1IONA 2WD7B 1TQHA 4QQ8A 3VTKA 2Q3CA 2OBMA 2Z5FA 5K0SA 1EM6A 2D8MA 3L6CA 3VJMA 4P5PA 1G20E 1NIPA 2KQUA 3E3AA 3SJAA 5CDTA 5FOQA 4ALJA 3NEJA 2P8SA 1D09A 2YWEA 2GJSA 4L08A 5AI5A 4QKQA 2IXTA 3ICOA 2NWQA 3P9RA 3KVVA 5FWXA 2FR8C 3NKFA 1GU7A 3AR6A 5JD6A 2HO5A 4RTPA 3E1SA 3EW9A 3GAAA 4U00A 4BBZA 1S7GA 2O8EA 1RQ2A 3A4MA 4FNAA 1O08A 3FFTA 2GA9A 2OEPA 4BUZA 1I7PA 4PAMA 4V39A 3JQ8B 1I3OA 2FLWA 5H81A 4DRZA 4DR4B 3K6JA 3ZV7A 1P1KA 1G60A 4LSWA 1OWLA 1LD3A 2BTQA 1N6LA 4DEXA 4NZMA 1BWSA 1FLVA 2MINA 2E5FA 1TF5A 1OV4A 1DWQA 2LTAA 2VHJA 1BIFA 2WD9A 2CVQA 4YBZA 3SLGA 1TVCA 2XNHA 3ZY5A 3DDNA 1NI4A 3PGXA 1NP7A 4TLBA 2YCBA 1I4TD 1VM6A 3C2QA 3OU2A 3CCFA 1SBIA 3MM4A 4LE2A 3ZGOA 3AONB 3U44B 2Y92A 5FR1A 5JJIA 3CW9A 1AMOA 4QUHA 4DDVA 1EZ4A 3GRZA 2OK8A 4G36A 5IMBA 3N28A 2QAGC 1E3EA 2LNDA 3MGBA 3G9QA 4MYUA 5DX0A 4ZT3A 1WB9A 1GPAA 1X15A 3WL6A 2JGLA 1DHTA 3BMQB 4GP9A 4RV4A 5ALMA 2WB2A 3PX2A 3KDAA 1M8KA 2IYWA 1GJRA 2Z2JA 4RIFA 1XNJA 1YMUA 3BERA 3D59A 2CZGA 3SAJA 3DM5A 2R8ZA 3C74A 3NQ41 4F7WA 1MT3A 1ONSA 2Q1WA 4P3PA 5IH3A 2XZLA 1BDIA 2H2HA 4RKWA 2V0GA 4DYHA 1OILA 3H9JA 1UANA 3GUVA 4HXGA 2MDTA 1Z4NA 4JHLA 1A1VA 3RVOA 2R7LA 2IYTA 4TSFA 3AVXA 2V6BA 1G8KA 2FMFA 4KHPB 4X1YA 2O59A 2AQHA 2DHDA 3A3YA 2BN4A 4QGFA 1FK8A 3RVDA 4DIDA 2YHIA 1F6BA 3CLTC 3ODGA 5ITSA 1OOEA 3ZK8A 4NBNA 3EVEA 1X74A 1H3NA 3EBLA 3NO4A 4G5YA 3UN1A 1W36C 4PCVA 2OUIA 4I2NA 1Z2NX 4FFBB 3RF6A 1GR0A 3A37A 3L7BA 1HMPA 1P2DA 3EF1A 3R0QA 3X1WA 1TE2A 2B94A 1DRWA 1Y9ZA 2XMDA 1QHGA 4TLMB 4W5OA 2J6IA 2FXIA 3CX8A 4MEAA 4MOWA 2YZGA 4NZ9A 4F5EA 4NMMA 3HUTA 4H2DA 3TG8A 3E9MA 4FP9A 1UWLA 1ADFA 1YIAA 2ZS8A 4PY2A 3AI7A 5NLLA 4CE6A 1VLMA 5IBQA 1NG1A 4X94A 5HGXA 1XAHA 2CYBA 2HV8A 1XQYA 1CJVC 1BD4A 4TV9F 4DBZA 4EUEA 3VFDA 2Q8QA 3PLRA 5L40A 1N9GA 2GPJA 3K9FC 4DCNA 3FCYA 1QS0A 1NOJA 5DHTA 1WVIA 4B80A 3QVOA 5C18A 2ZWOA 3A2LA 3SM9A 4NNJA 3X1JA 2GPTA 1HE2A 3CBQA 1VJ0A 2X42A 3LCRA 4OAOA 4FXOA 3UGJA 4B82A 1T8UA 4FYYA 5IWAB 4YACA 3KBBA 1HURA 2ZJ7A 1I1HA 3F8TA 5I7SA 2DUJA 2C0QA 3LHIA 4GM0A 4U2EA 5CT8A 5ALVA 3U7EB 5JNWA 2NO9A 3FPCA 3AP1A 4XFJA 4CGZA 3UO8B 1W46A 2REQA 2JVIA 1MB4A 1VCIA 1ZOLA 2FFRA 4FPXA 1F3LA 5JU6A 5FORA 5HG0A 2W2KB 5J4KA 1VSTA 4BGUA 2OTCA 4YT8A 1CDZA 1JUDA 3O8NA 2N1MA 4HGRA 3WK4A 2H4WA 1EXMA 4KU4A 3WGMA 5KYWB 1U6KA 3PNKA 1H8ED 3JVIA 3MCVA 1P4SA 4TLLB 5JNUA 2OMKA 1GNLA 1EB9A 3F3YA 1GLGA 4B3TB 3L0SA 3VPFA 3W3AD 1XZHA 1VRWA 4W1SA 1IRXA 2OV6A 4GZ6A 1CDEA 2IJGX 4NCNA 1Y9AA 3AHHA 4HB3A 4AG3A 2QN1A 2DUUA 2F2TA 5EKUA 2HIMA 1M54A 4UTPA 2PKCA 2Q3BA 3GFPA 2OWEA 4GLLA 3KOUA 1ZGCA 1JS1X 3F90A 1JAHA 1Y89A 4NNPA 5IYZF 2R8PA 3ADOA 4C89A 1F4VA 3OQOA 3L8CA 3L4EA 2QQ5A 3WISA 4Z1OA 3RGWS 2CK3D 2PJZA 2WWHA 1LH0A 1M2GA 5AESA 3PXDA 3Q2IA 5AW4A 1DV2A 1S2LA 1Y6QA 4S1WA 3UGQA 1LSSA 1ZM7A 1LLQA 3AHJA 2X58A 5FTKA 5A71A 1XCLA 2QEQA 5A4AA 4EG6A 1BH6A 4QZVA 5K8LA 5ISMA 1ECFA 1N5LA 1SVUA 3RVRA 1TM5E 4M76B 3ZW9A 3TIVA 3UWOA 5SYAA 1JHVA 3S5JA 4XB6B 4DCOA 1OH6A 4IIGA 2DU8A 4JROA 1DAGA 3TG2A 5GIOE 2MMCA 3FLMA 4RPCA 1N57A 1Y98A 2RHGB 4KK3A 3TW8A 1Z39A 3C85A 1TKCA 3ROGA 4DCMA 5CYOA 1J2YA 1E58A 3KPUA 4E5UA 1YU6A 3L1IA 4GF5A 4MTLA 4ZQCB 2CLEB 1I3MA 1LBTA 1IOWA 1XCBA 1AQ6A 5L4NA 4MLDA 4Q1EA 3V2UA 4FBMA 4D80A 1B00A 2JFXA 4NFSA 2QE7A 3M5CA 1SR8A 2WHEA 3WQSB 2CNKA 4WNAA 1U0LA 4O1MA 1W581 2AC7A 2W90A 5C35A 5J2UA 3K0AB 3AEXA 2OORA 1NW7A 4PZCA 1KZHA 3STVA 4U2GA 2WY2D 4CF4A 2XLBA 4B40A 5C5DA 4JS0A 4JZYA 2QUHA 1GADO 4Z49A 3I3OA 5AQ1A 1OVMA 2YCLA 1O1YA 5KREA 1R0BA 5CVUA 1YDEA 3H6HA 2HLNA 3R5TA 3GMSA 1MFZA 4EUSA 4BP8A 1HI9A 1SBCA 1NKTA 3DSRA 3DE0X 1DAOA 2EFCB 3FSJX 5B1DA 1CQPA 2AOUA 1WD7A 2AT1A 4G9BA 3RVJA 4D0NA 2O8CB 1GAQA 2TYSB 4HRAA 1S96A 5CX1B 2GZ2A 5ALNA 3H0CA 2CDRA 3EXHC 3W2FA 3E0XA 2BTEA 4CMAA 5LQNA 3CLHA 3GUYA 2HUPA 3TXAA 3UMSA 3KU1A 3ZIAA 4HNGA 3H3JA 4HQRA 4KB5A 3JAKB 5K8TA 1E9RA 4PO1A 3CRQA 3EJ6A 2B4AA 3IQDB 3KKKA 4GYJA 3NHRA 3TQTA 4Q02A 3BICA 4PLHA 1PR9A 3GF4A 3SYKA 4CM9A 1XRMA 4ZVOA 2JZCA 3IP3A 4Z2YA 4DCSA 4ZYZA 1P33A 4RHFA 3HUFA 1XTUA 1OU0A 4RVUA 2CB9A 1NVTA 1P9RA 5ITZA 4MVJD 4CKWA 4X65B 4GFDA 2UXDB 1UM9B 4V1CA 1KYQA 1MU0A 3ZZ1A 2ZETA 3JWHA 2CFRA 4WCFB 1N1EA 4DT1A 1C7EA 3DTNA 4KK4A 4AJEA 3BMNA 2C2GA 3Q2OA 4HN2A 5HHTA 4IO1A 1XB2A 1TIKA 4CCYB 4B46A 4CCAA 4FFLA 4PYKA 4GYWA 2WV9A 3T5AA 1SGWA 1TTHA 3CX7A 3H4TA 2R6ZA 1QX3A 5KYWA 2F9FA 5CJ2A 3EASA 2VNHA 4RHUA 3QE3A 5B4UA 5EE1A 5I6DA 4MYSA 1WCYA 5BVHA 1ZI9A 5EGSA 2QNRA 5K3BA 2JHFA 1VTKA 4PLFA 4PQGA 1ZD5A 4YXFA 2FWNA 4PCUA 5G1NA 1UXHA 4N12A 2X0JA 1SIOA 2VTKA 3I8SA 2OHVA 5J40A 5JVDB 4L8GA 1L5LA 3U7QB 1G8FA 4D3XA 3P9SA 3V7WA 2CL6X 2IPOA 2NNLD 2XLCA 4NCIA 4ZRDA 2HLDD 2WYHA 3QBJA 1KEUA 2A2ZA 2Q5IA 5C8DA 5IVPA 3RU9A 2V1XA 3SHOA 1YULA 2KX7A 4OH1A 1F8XA 4FBGA 3VISA 4EFMA 3IBYA 5FLYA 2CNWA 5TQ0A 1KEEA 1EUYA 1WXFA 4G85A 4DB4A 1GKYA 1CK4A 3IXMA 3C6XA 4KFRA 2IHZA 5KYXB 1U2RA 1B0PA 2AZDA 3KYJB 4EHKA 4MEBA 3HYLA 3MTGA 1I0IA 1NN1A 1VSBA 2FR8A 1TK3A 2A84A 2QP3A 2YIVX 3L9WA 2OPHA 1XMVA 3ZDZB 4RTSA 1OFIA 1YRHA 1XTTA 2NU6B 4FW8A 1HT1E 4KWCA 1LF5A 3LBHA 1F7UA 1XQ9A 2IBTA 1SUIA 1X8KA 2WMYA 3HCRA 3ITDA 3TQFA 1DCFA 1P0IA 3GGDA 1X2EA 3RC9A 1WCWA 1CY2A 3S5UA 4DMUB 4AF8A 2H5EA 3FFBA 4ARVA 4TTSA 2PGIA 4P36A 3IODA 4HYYA 1D6SA 3UKOA 3QITA 1RVDA 3OQPA 3IJEB 1ZIDA 2I8CA 3J81k 4G0ZA 1WB6A 4PLTA 5DIFA 2ZTMA 5T6BA 1DPFA 3NHJA 2O2DA 3OZVA 2JFPA 1Z4KA 4ZCRA 3Q40A 1XN1A 5AW2A 2PX5A 1G17A 1CZOA 3HMQA 1ZH0A 1WMDA 2O0JA 2C3YA 4MR7A 5JWRA 4QOEA 2BW0A 1JHXA 5CXXA 3CV3A 3MS2A 4ZJUA 1RFLA 4YDQA 2OV8A 4TRRA 5HFJA 5ED4A 1GY8A 1F3OA 1TMYA 2XE7A 4EAAA 1EVEA 4LY3A 4X5OA 3UB4A 3R4VA 3F1KA 3NP7A 2C9DA 2J3JA 2QE7D 3CKMA 3OOEA 5AKIA 1SNYA 3WBFA 1SC1A 3GO4A 3KAPA 3I2IA 3C3WA 4JB3A 4PVDA 4R3NA 5JISA 5AUPB 3GL9A 3HCNA 4R84A 3RRJA 4FMPA 1JEOA 3ABRB 5DHUA 1Z5ZA 5DCLA 3BHMA 5BQOA 4BKOA 3QQ5A 4WKNA 4QAJA 4WLEA 1C9NA 3IUBA 4N8SA 3ZUPA 4IGKA 3VU1A 1E1RD 3N39C 1RQNA 1R9MA 2R8YA 4RD0A 2LZ0A 2CXSA 3LWDA 4GL2A 4OLBA 4JXJA 4I1SA 2PVSA 4LV5B 2C82A 2VQEB 2HWXA 1TYZA 3LCMA 5ALUA 3JQAA 3URKA 1RLJA 2VSYA 1T2FA 2OCYC 3WKAA 5LMUB 2O3UA 5U9CA 3E58A 4MP6A 2UAGA 1HG0A 1OGIA 1ZY2A 2GN6A 1V2HE 3LYAA 2X5XA 2X0DA 4GGPA 4LYYA 3B6JA 4BLWA 2J0VA 3JX9A 3RGGA 3RVBA 1JE1A 2NO4A 3ETDA 4UZFA 5EP3A 2COEA 1GVNB 3V97A 3F74A 3IHWA 2ZJ8A 1ZHOA 1R8JA 1HLFA 1UFQA 2VH2A 3EPJA 1GQQA 4F5WA 5DTMA 3WGGA 4LF7B 2NU7A 4IM7A 4DCCA 1TO1E 1ZOSA 2R8EA 5EWMA 2IYAA 5IBPA 4YUYA 1H1DA 1NTRA 2WOOA 2Y1FA 4BZQA 4E5YA 4LCEA 3AH8A 5K0GA 1A9RA 3H3FA 3ZU4A 2PS9A 3OG9A 3ZVKA 2WU8A 2ZIAA 2BFDB 3F8SA 2ZWPA 5MN6A 2CXNA 1GU1A 3OQIB 4KXNA 4M36A 4XFDA 4ZAYA 1WUKS 3U9TA 1I2AA 3LPAA 2HC9A 1J2JA 3VI4B 4C29A 1XZCA 1ZXLA 2AXNA 3DOOA 3TLAA 2QD3A 4CEHB 1JYFA 1Z6TA 2C78A 4C7XA 1AQLA 1OI7A 1QGUB 1RLIA 4B6OA 1NYLA 1IOLA 3FOCA 2EJVA 3GJYA 4GZ5A 2IX3A 3T15A 4ESHA 4MWZA 1PR6A 4OI2A 1E0JA 1AV7A 5LZ9A 3QEMA 4NU6A 2LDBA 1QTNA 5FWXB 1P6QA 1QGUA 3TX2A 3FPFA 5GINE 4WY5A 3A6ZA 2ZB2A 1HZJA 1YI8A 2LCIA 4C4ZA 4DV6B 3OX2A 3KPWA 4W9NC 3A7EA 2FSVA 1E4OA 5CIQA 1O6GA 2R68A 2X23A 4OHUA 1X94A 5G4KA 3WJ2A 5FAKA 2ANBA 5A4DA 5HMMA 4KW7A 4D9KA 1XDWA 2JPDA 2FZWA 2VXYA 1VI2A 2BDEA 3EEBA 3PC6A 3QKUA 5EP2A 4NC9A 4EI8A 1PHPA 5GJVC 4F4JA 1R0RE 4G5RA 1KEVA 3L43A 3HV2A 4RK1A 3ZZ0A 5C1BA 5FWNA 2O8DA 3JRXA 1YB5A 4DT1B 4E46A 1JZTA 4LJ6A 2JJ2D 2ZJZA 3HYNA 2K6GA 4BVKA 4M98A 2GFHA 1ULZA 3DMFA 3FAKA 1HQKA 1U0SY 3NOOA 4OIFA 1QRSA 1E2HA 4DLPA 4LOJA 2B3TA 4P33A 2VTBB 1Y1TA 4LJYA 4ZQFA 5FBKA 4EPRA 1ORRA 1RLOA 2JW5A 4MAAA 2XUOA 3VSDA 1I3NA 2FFBA 5C7YA 2ZYDA 1A4IA 3EXIA 3R3HA 2F55A 3WHKA 4BRSA 2FDCA 1YTLA 1TXGA 3FCAA 3W5VA 2EWWA 3EN0A 2B5OA 4WJZA 4TMZA 4X95A 5AICA 3PJFA 2B99A 4M0MA 4MZDA 3TL3A 4JIMA 5ESWA 2H06A 1RD4A 1E9CA 1W85A 2XE4A 5FHQA 5JXHA 1FP4B 4I0WB 4EKYA 2CMHA 3SIRA 3NH6A 4LC9A 4UM7A 4ZEXA 1SQSA 4MRRA 5IVHA 4U2BA 1XRSB 5MHTA 4P2GA 4AYXA 1BFKA 1IZ7A 2HN9A 1C1YA 4DSUA 3FVVA 4XVQA 2FWAA 4A9AA 2YWFA 3V4RA 1JSZA 1E69A 2OHFA 2WD8A 1XNQB 4XJXA 1LEHA 1A77A 1B93A 3I32A 3K0BA 3PR2B 3BTVA 2FSPA 3C15C 4HUQA 4JQCA 4WZZA 3WNDA 1Z06A 4WBSA 4RXUA 2HUNA 4BFCA 2A0WA 3CNLA 3N2YA 4LZPA 1WEHA 1KPIA 3L8EA 3I83A 3QVMA 1P81A 2JJ1A 5AK4A 3W3ZB 1T8WA 3KWFA 1YR7A 3TRKA 4AWBA 1GTSA 4DM4A 2RHMA 4K9SA 4ZU3A 5D5QA 1O0BA 4NDNE 4PPYA 4ALIA 2CJPA 2EP8A 1U0EA 2P6NA 4HGNA 3RODA 3OTOB 2PYIA 2VRBA 1W5SA 3G2QA 3L6DA 4EY8A 1ZOIA 3G5UA 3PYMA 2FWMX 4XRGA 1CZHA 1F0NA 1Z5WA 2AG6A 4Y1RA 2Z4RA 4CEJA 4LVOA 3FOWA 2JLXA 2XPCA 1UL1X 4QU5A 2Z1MA 1CQWA 2W6MA 4LYAA 4KTTE 3ZU6A 3THYB 1FCJA 1J9GA 3GEIA 4HX5A 4DQDA 4XYGA 1OGYA 1KAGA 4H27A 4F46A 2P1ZA 5AVOA 3M3DA 1IHPA 5GJWC 3UUWA 3WRVA 2PH3A 4GVPA 5JS7A 3SMQA 1AK9A 4ZFNA 2VNIA 1EVKA 4D92A 1H2XA 3HSSA 5ILQA 2HLDA 3S55A 2G5PA 3RTGA 3UJDA 2XGOA 4JI7B 3MINB 5EMJA 3DR3A 3SQOA 1GPJA 5FA6A 3VC1A 2JH9A 1YL7A 1GPUA 4IILA 4XVUA 2V8BA 3LQRA 4LZNA 3DAPA 3F9IA 1P1HA 4LJLA 4BRZA 3ORSA 1P44A 4NPHA 4AKGA 1WPRA 4KIGA 4QD3A 2QOEA 3LJKA 1T5BA 1TU3A 2DPYA 2ZSDA 3AIMA 4IHJA 4L9SA 1NQUA 3UAYA 4QJIA 1EFRD 4E22A 1DEAA 1ZPDA 3KVNA 2VLBA 3O38A 2CNLA 3ZQJA 4URUR 5JQGA 4DMGA 1YS6A 3EIOA 1MX5A 2RARA 3FJOA 3GEDA 3IHLA 3R23A 3R4CA 4TLEA 4X8MA 4P35A 5WRFA 1L1FA 5IJ9A 1FVXA 3UJ8A 3QI7A 1JLRA 1ZRNA 3I53A 5J9FA 3RIMA 2CUNA