4KE8A

Crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with monopalmitoyl glycerol analogue
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
248
structure length
248
Chain Sequence
SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 88
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke8A00
2AJDA 4QNNA 1Y7IA 4X6YA 2PPLA 3QH4A 1LPMA 3O9MA 2QUAA 3I2FA 1ODSA 2R11A 3FYUA 3I6MA 3G0BA 5YASA 1C7IA 5AI6A 5K3FB 3DYVA 2PSDA 3L1IA 3R3YA 4FOLA 1GGVA 4INZA 4Z49A 3QPAA 4O08A 4H7DA 2ZJFA 5AKZA 4BBZA 3SC2A 2GYUA 4YASA 4BP9A 4DNPA 1ZIYA 4PSUA 3QVMA 4KRYA 5ALXA 1XZKA 1N5MA 1YR2A 2HA6A 3STXA 3G9UA 4QDTA 5CURA 4BRZA 2HU5A 3E3AA 2OGTA 1UFOA 3KWFA 3PF8A 3MUOA 1K5PA 3FSGA 4HXFB 4EHBA 4RNCA 2HU7A 3D4LA 3V9AA 3G7NA 5AO9A 5JAPA 3W04A 2XUFA 3V1MA 5C8VA 4C6HA 4EUSA 2B9VA 1BCSA 5JZBA 2B20A 3BL8A 1AGYA 3DS8A 2XMSA 1QIMA 4WFKA 3F9CA 1TRHA 3R3ZA 5HFNA 5CXUA 4EY5A 2HDWA 3AIOA 4UBOA 3EIOA 4M0EA 3M3DA 3T4UA 2PKYX 1JJBA 4X93A 3I2KA 5A71A 3DD5A 4Y2VA 3BIXA 1AKNA 4BP8A 1CFJA 1KU6A 1UOOA 5JANA 1N8SA 2CKMA 4PSDA 2XMDA 1NX9A 2PSHA 5K3BA 1P0MA 5FOQA 4UBIA 3RARA 1K63A 1L7AA 3WZMA 1N1MA 2JGMA 1MAAA 4UBLA 2HFJA 1Z68A 5FPQA 4B9AA 1K8QA 3UMJA 3WWOA 1ZOIA 1CUGA 1FFEA 4MEBA 3WJ2A 5E2IA 1YA8A 3F8SA 5EI5A 2K2QB 4OU4A 4X94A 1YCDA 1E8MA 4FNMA 4Y2SA 5AI9A 1MN6A 1JT2A 5AKIA 5A62A 2V98A 1XRRA 5ALIA 1DQZA 1MPXA 1EXWA 1AQLA 4X7BA 4IH1A 5IVHA 2FJ0A 2WFMA 3BJRA 5A7FA 2XUIA 1HLGA 1WOMA 3HI4A 4DMFA 1ZD5A 3IUJA 2Z3ZA 3H2IA 4B83A 4MYDA 5KBYA 4Q82A 4E15A 1UK6A 3C6XA 4J0GA 5KWIA 3DQZA 4XVCA 1LPBB 1BROA 3W06A 5SYNA 1CLEA 4CI9A 2BKLA 5AKJA 2OGSA 1XZJA 4PO3X 3G8YA 4ZXFA 1E3QA 3E4DA 3WLAA 2XMGA 2HA3A 4OB8A 1TQHA 4JYMA 2BGRA 4PF1A 1VLQA 5AIBA 1I6WA 1OXMA 5HQ3B 1ZI9A 2B4KA 2WUFA 1F6WA 1LZLA 1DTEA 6YASA 3A2MA 3CXUA 3WK8A 1PV1A 3VJMA 4XJVA 4J03A 1XLUA 2WIJA 5K3EA 5AKEA 5KREA 4RE6A 3A6ZA 2CBGA 3PF9A 4B6GA 5DTJA 2JGLA 3WK6A 4C4ZA 1G42A 3F97A 3GA7A 2H9YA 1EH5A 1SCKA 5DNWA 3IUNA 5H3HA 4AQDA 4FLMA 4QLAA 2DFPA 5EIEA 4I4CA 5AK6A 2RAUA 3HEAA 5AK3A 2X76A 4Y2QA 3WWCA 1QIDA 2OAGA 1DWOA 1ZIXA 3IBTA 1TAHA 4UPDA 5HF5A 1A88A 1QIFA 1UXOA 4AO6A 4X6UA 3H2GA 2QOEA 1JMYA 1JMKC 2DHCA 2XUHA 1WPXA 1ZD4A 3TEJA 2PVSA 4AMZA 1YSCA 2C5FA 5CT8A 5AKLA 2Y2UA 4K6GA 4UHHA 3C6BA 3HRHA 4G4JA 1CUXA 3B12A 3F98A 4G5XA 1WCYA 4MEAA 2BUCA 2XMQA 1UK8A 3CCBA 5IVDA 3G0GA 1YASA 3A2LA 5HQ3A 1YB6A 3N2ZB 3I2GA 5AM5A 5AI8A 4KAJA 4X3CA 4KE6A 3H2KA 1R1DA 5HZGA 1P0IA 5DNUA 3LP5A 4J3JA 1Y7HA 3O95A 2DSNA 3R3UA 4GXNA 3IURA 3R40A 1F0NA 3FSGD 2CB9A 2DQYA 4AXBA 2PL5A 4G8CA 4CCYA 4N8DA 5JD5A 1XQYA 4PV7A 3DOIA 2FX5A 2G5PA 3K2IA 4JH0A 4X91A 2XUDA 4LHEA 1VA4A 3C70A 3W9UA 2QJRA 4JEIA 3ZPXA 4A16A 3HZOA 4Y2TA 3M82A 3I6YA 4FKBA 2P8SA 1LPSA 4M0MA 1XZBA 5DWDA 5FP0A 4B9EA 4DM7A 3C8HA 2VJDA 3GBSA 2XUGA 4G8DA 4Q05A 5EFZA 4CFSA 2WU4A 1MO2A 2DHEA 2D5LA 4IHAA 4UBJA 4JNCA 1BN6A 1QLWA 2QXTA 3WKEA 4Q3LA 2C0QA 2QRUA 4K6KA 5K5EA 3DDUA 1CUEA 1X2BA 4CG1A 5FV4A 1ORVA 4OUKX 4BZZA 3V1KA 2QR5A 4L9AA 3HXKA 1RP1A 3WWEA 1CUUA 3PE6A 2OLEA 4FHZA 1P0PA 2RIPA 1UWCA 4AZ0A 4L72A 1H2WA 2XUPA 4X85A 4NS4A 4BVKA 2C5GA 5AKKA 1XFDA 1MNQA 4ZWNA 1ZI6A 5HKBA 2XMBA 3O4JA 4AX4A 4W9RA 1A8UA 3Q0TA 2AXEA 2QZPA 4Y2PA 4AO8A 5AI4A 2ZYIA 3RK4A 1H2XA 2E3JA 2G4LA 3G02A 3QM1A 3U1TA 2RI6A 1PJAA 4I3FA 1EDDA 3IUQA 4BATA 1UZAA 1ZJ4A 4Y2UA 1U2EA 4KJXA 1O6FA 1WB5A 1DWQA 3M81A 3TGLA 2J3DA 1W4LA 3LIIA 3WKDA 5ALFA 2QXUA 3BDVA 4B81A 5CRIA 1CUDA 1VE6A 3D59A 1W52X 5A2GA 4ZRDA 1IVYA 1MU0A 2PU7A 2PUJA 4HTAA 2W6CX 5CT9A 2HM7A 1ZI8A 3F96A 1VJ5A 5AM2A 2GBGA 5AIAA 2G5TA 4OCZA 4X71A 4K2AA 1IUOA 1SCQA 1XZEA 3WA7A 3R3WA 5JYCA 5D3KA 1SFRA 1QO7A 2JBWA 1P0QA 4OPMA 1T4MA 5ESRA 4GHWA 5A7GA 3L1HA 2HRQA 2PU5A 4OSEA 5DYTA 3TRDA 5CW2A 1AMNA 3MUNA 2YXPX 1XKTA 1W75A 5AOBA 1YA4A 2CZQA 3FVRA 4Q3KA 4E11A 2IIVA 3IIIA 1LPOA 5EHQA 4MWTA 3KOOA 4WCVA 4U2DA 4HVTA 1XZIA 3NWOA 3I6ZA 1O6GA 4UHEA 1UK7A 5I7UA 1EI9A 4FLFA 4EBBA 1IMJA 2WG1A 3GELA 4AZ3A 2JF0A 4G8BA 4CIAA 1YB7A 5HF6A 4U2GA 5ALYA 2WSLA 2OCGA 1EDBA 3VVLA 1XZCA 3K9BA 4OYYA 3FCYA 4XIIA 3UUEA 4F5ZA 2H1IA 4AO7A 2CJPA 2BFNA 2R8BA 4XWGA 1R9NA 2XMRA 2WJ3A 4DMHA 1GPLA 4DSZA 1MX1A 1LZKA 2PUHA 1X70A 5FXMA 3BF8A 1MX9A 3M83A 1VE7A 3DNMA 3WL5A 5JASA 4ZI5A 2Y2VA 4BDSA 1EB8A 4Q3OA 3W9BA 4DSAA 1OILA 1CUIA 1EX9A 4N5IX 4NZZA 4QLOA 2VT6A 3T52A 4YX9A 1LPPA 5LZ2A 4H77A 5AH0A 1E8DA 2X8BA 4A5SA 1EB9A 3KWJA 1IZ8A 2ZYSA 5DJ5A 2WFLA 3WWPA 3AIKA 2BUAA 1GKLA 5DTIA 3S8YA 2O2IA 1XZMA 4GECA 3ZLTA 3ESDA 3AIMA 3L1JA 3IB3A 2GBFA 1VXOA 4JYPA 2VA9A 3R0VA 4EY4A 5LZ9A 1TCBA 2WJ6A 4BVJA 3QPDA 3V48A 5BV7A 1BCRA 2XUAA 2WJ4A 1W1IA 1QIGA 1XRMA 2VJBA 3S2ZA 1QJ4A 1LBSA 1USWA 5ALDA 2HA4A 5T4FA 3H1BA 1QE3A 1XZHA 3RM3A 5CMLA 1G66A 3OG9A 1HBJA 3STYA 3WKBA 4BC0A 1XRLA 4UHDA 4MXDA 5LZ5A 3VISA 3QMMA 4W1PA 3I1YA 1TIBA 4QDZA 5AM4A 3EQ9A 1XRPA 4H7FA 1H2ZA 5ALJA 3NOXA 3HC7A 1AX9A 5FPPA 5ALKA 5KWJA 3ED1A 1Q0RA 2PSJA 1GPKA 1U8EA 4Y2XA 3P2MA 4KR0A 3WWDA 3QPCA 3WJ1A 1UT6A 3FYTA 3OM8A 2O7RA 3EF3A 2WIFA 4OB6A 4KE9A 2Z5GA 3VXKA 3GFFA 1H23A 4B0PA 3O9VA 4FTWA 2OCKA 3EBLA 5JD6A 3H18A 3A2NA 3C6YA 5AI5A 4KAAA 3PICA 2WLSA 1A7UA 2AJLI 2DCMA 1ZICA 5AICA 1XLVA 4UFNA 2FUKA 3X3HA 4BE9A 3NUZA 1IUNA 1ACLA 2D0DA 4EY6A 5JAUA 5ALRA 2RGUA 3WQHA 4HRXA 4B80A 2EDCA 4DMCA 1U65A 4QA9A 5AOAA 4X95A 5K3DA 1U4NA 4JUIA 4W1QA 1H2YA 3R41A 2WHQA 4B82A 4B0OA 4FMPA 5D6OA 1WHTA 5EHXA 1E66A 5LKRA 3H0CA 2LIPA 4ZV7A 2HA0A 1MX5A 3NGMA 3YASA 1F0PA 3WKCA 1Q0ZA 2ZYHA 2WG0A 4UHBA 1WPRA 5K3CA 5LLSA 3QBJA 5D3ZA 4DNQA 1R50A 1G5FA 2BUBA 5ALMA 1F8UA 2HHAA 4BZWA 2PM8A 5T4EA 4J0IA 4BCCA 1AUOA 3WL6A 4CG2A 1CUHA 3V1NA 4LIPD 2UZ0A 3FOBA 1J06A 1VXRA 2EEPA 2J3QA 2XB6A 3JW8A 3PFBA 4HXEB 1WB6A 4CCWA 1NU6A 4H7EA 1DU4A 5I9IA 4AMYA 1ORWA 3DL4A 3JWEA 5LIPA 1XZDA 1CUJA 5HK8A 4J0KA 5JIBA 3HSSA 3FYUC 4QDOA 4C87A 5CT6A 3G0IA 4IH4A 4AB1A 2C7BA 1VKHA 2YH2A 3O4GA 1JJFA 1L7QA 4UFOA 2JGKA 3ILSA 4C88A 2ONCA 3PFCA 1ISPA 4BCBA 2JEZA 2QS9A 3R3VA 3SK0A 2JEYA 4P08A 3D2BA 2HA7A 2GZSA 1CUCA 1CUVA 1ODCA 3WYDA 2XQGA 4CG3A 1CQWA 3PDCA 4E14A 1CUFA 4GI1A 1CUAA 4QEKA 1L7RA 2IITA 1VA5A 1UOPA 2WQZA 1CQZA 4YPVA 2VJCA 4RE5A 2BCEA 1J07A 1CUZA 4UBMA 5HFAA 1ZD3A 4H7KA 5IH7A 5ALUA 1KU0A 4FDMA 2XUJA 1ZJ5A 5IVKA 1FSSA 3B3QA 2WUEA 3WKAA 4MJ3A 2C0PA 1XZFA 2W22A 3C43A 3STWA 1OCEA 4W1SA 2AJ8A 2VTVA 4DGQA 1GT6A 3LS2A 2XMCA 1BEZA 4PSCA 4PQEA 5E4JA 4WY8A 3OC0A 5EGNA 4FBLA 2XLBA 3FLAA 4E46A 3ESBA 2I3DA 1D07A 4L0CA 2RHTA 2C58A 2ZJ6A 5ALWA 4HZGA 1WHSA 4G4IA 2ACKA 4KAFA 3BJMA 1DX6A 1JU4A 3OOSA 2CUTA 3SWWA 3VKFA 5IVIA 1W6RA 5JADA 3CN7A 2C4HA 4EA6A 1XKLA 1J2EA 1XQVA 4KACA 3BWXA 1THGA 1QIJA 3LLCA 3IA2A 4LYEA 1LLFA 1BN7A 5LZ8A 3QMVA 2HL6A 2ZVDA 2WM2A 4DTCA 4NMWA 1LGYA 2VJAA 4X97A 4BC1A 3HABA 4L3WA 1R4ZA 4G9GA 5ISMA 4BYMA 5FRDA 1XZGA 3KSRA 1ZD2P 3VJLA 1XRQA 1YS1X 4W1RA 2WFZA 2O2HA 3MGAA 5AK5A 2QM0A 1FFBA 2V97A 1JKMA 4BAZA 4P92A 1S8OA 3G9TA 5ALHA 1B6GA 4J0HA 1HDEA 5LKAA 2PSEA 1K6EA 2EDAA 3WMRA 2WHRA 4XX1A 1VZ3A 4H7JA 5ALQA 4ZREA 2XUOA 1ACJA 5DYYA 3C8DA 4U2FA 5HF9A 3QYJA 2ACEA 4S0XA 3PUHA 1MNAA 2XDWA 1DWPA 1R3DA 4BE4A 1E8NA 1JU3A 1XROA 4WY5A 3WK4A 4WDQA 4J0CA 1HQDA 4FLEA 1WB4A 3QITA 1UOQA 5HF8A 1FFCA 1DQYA 1BS9A 4KE8A 5CT4A 4TGLA 5C8ZA 5E4YA 4FBMA 5T4HA 3VVMA 4BAGA 3OPMA 4V2IA 1A8SA 5EIAA 3QZUA 4U2CA 1J1IA 1LNSA 3DKKA 4B85A 1BU8A 2PSFA 2CMFA 3AFIA 3BDIA 3N0TA 2Z8ZA 2GYVA 3AINA 5AI0A 3W2TA 2VSQA 1TK3A 4MQLA 2WILA 3AUKA 2ROQA 4MWSA 1Q84A 4N8EA 1ODTC 4EZIA 5AKHA 2JGFA 4C4YA 2JGIA 2Q0XA 1BRTA 5DNVA 4KRXA 4G9EA 1FFDA 4G4GA 4WFJA 1AZWA 4BTLA 1W76A 5CH3A 1CUYA 4H18A 3EQ8A 1CVLA 4Y7DA 2XE4A 2Y6UA 4QWMA 4AN1A 5ALGA 3BF7A 1K4YA 1CIJA 1CUWA 4QWWA 4W63A 3ZWQA 4BDTA 4N5HX 1C7JA 3STTA 2I03A 2HA5A 2WKWA 2Z8XA 3BXPA 3F67A 2AJCA 2O7VA 3B5EA 3IDAA 1LPNA 5C81A 1JFRA 2JIDA 4FNGA 3ZLUA 1DX4A 1QTIA 5CTAA 2BJHA 3ANTA 1QOZA 3AZOA 3ICWA 4WJLA 1ETHA 1LBTA 4Q34A 4I19A 4UBKA 5DLPA 2OPHA 3RLIA 2Z3WA 5J3JA 3BIWA 1SC9A 4OU5A 3AILA 2AJBA 3DOHA 5IKXA 1IUPA 5ALLA 2HIHA 2CEKA 1JJIA 2VAXA 4LXHA 1CPYA 1EA5A 1EVEA 4X6XA 3VJKA 1B41A 3H19A 1AC5A 1R9MA 1HKHA 2OXEA 4YK7A 3G0CA 1QIKA 1RYYA 5SYMA 3D3NA 5FLKA 3H2JA 1QFSA 1CR6A 1QO9A 5ALNA 4QDXA 1XLWA 3OTQA 2I3ZA 1ZGBA 2ES4A 3STVA 5JARA 4B7ZA 1QFMA 1GZ7A 1DINA 5FKJA 2BGNA 2GBCA 4M0FA 3AZPA 4BCDA 3D2AA 2VF2A 3DEAA 2WUGA 1FJ2A 4HS9A 4QE3A 4OB7A 4KEAA 1QIIA 2XUQA 1DT3A 3DLTA 3WK7A 5A7HA 2OCIA 2VT7A 2DHDA 3AJAA 1FFAA 1YAJA 4FWBA 2IX9A 2WFLB 4IQ4A 3DYIA 1TCAA 5K3AA 2WIGA 4GBGA 5EHZA 2VAVA 1BE0A 3KD2A 4BVLA 1NU8A 5CXXA 1GKKA 3CCCA 5EHNA 1CEXA 4DMKA 3U0VA 4KYVA 2QT9A 1YS2X 5AKXA 3CN9A 4J0DA 5ALTA 2JGJA 3GROA 3GUUA 5CH8A 2WU3A 4UHFA 2ECFA 2QKYA 5LYYA 4EY7A 4PW0A 4EY8A 2OAEA 3ESAA 4RPCA 5AKYA 1EK1A 2QMQA 4J0JA 5ALEA 4LKOA 2V96A 4DIUA 1DT5A 4BRSA 4WDRA 5C8XA 5AK4A 1R88A 1UKBA 3A70A 4BAUA 1TCCA 3C5VA 3WIOA 4A23A 3WL7A 2OQIA 3G9XA 3MVEA 4ARAA 3JYHA 2WTNA 1UKAA 3HLKA 4X90A 3Q8WA 1TKRA 4RGYA 3D0KA 2RHWA 5ALVA 3STUA 3C45A 2XQFA 4BTVA 1UK9A 1KEZA 1XZLA 4PNZA 3E1GA 4Q1VA 2HU8A 2OQVA 3D2CA 3C6ZA 2QTBA 3QMWA 1VOTA 3HACA 4GDMA 3ESCA 1WM1A 2J4FA 1BEEA 3IUMA 3GZJA 4F60A 2XQIA 3DJYA 2V9ZA 2J4CA 2VATA 1ZGCA 2B61A 4X00A 3KDAA 2ZJ7A 1YAHA 2RONA 4J7AA 2XUKA 3ANSA 2XT0A 2ZSIA 2H7XA 4IH9A 2FJPA 3I28A 3HJUA 4TVKA 2ZYRA 3RKSA 5HK9A 3KXPA 4FFVA 1N5RA 4H0CA 3ZV7A 1XQWA 1AURA 4MYSA 4ITVA 1M33A 1HPLA 4WFIA 4LXIA 4F0JA 7YASA 4EB0A 2H7YA 2YYSA 3H17A 2OCLA 4Y9SA 4D9JA 1THTA 1GPNA 2G63A 3DKRA 4N8SA 1QTRA 1QZ3A 3R3XA 4AN0A 5HKAA 5I8PA 4HAIA 4GLBA 5FUMA 2OGZA 4DNOA 2H7CA 2VEOA 1CV2A 1GQRA 3O4IA 1X2EA 1MT3A 1LPAB 1CUSA 1MAHA 1XZAA 3WZLA 2GBIA 5CBKA 4OD0A 3HYSA 3FNBA 5AM3A 3PUIA 4F21A 2Y1KA 4LYDA 1XRNA 4K5QA 3C87A 5ALOA 1IZ7A 3ICVA 5HCUA 1UKCA 4ARBA 2X5XA 1A8QA 3I2IA 3G9ZA 4GEGA 4NVRA 1SCIA 4CIBA 4DNFA 2GYWA 4Y2JA 3H04A 4TPKA 1GQSA 5JATA 4HRYA 1G4HA 3O4HA 4HXGA 5C7YA 3C5WP 4UHCA 4UBNA 5AOCA 1MJ5A 3DL7A 4C4XA 4KE7A 1RWQA 5JALA 4Y2YA 4C89A 4ROTA 1EINA 5BOVA 5DYWA 1E5TA 2XI4A 3H1AA 3I2HA 1PFQA 5BWCA 2WIDA 1EK2A 2QUBA 1E89A 2WHPA 2GZRA 2HADA 3VDXA 5ALPA 3IVMA 1EHYA 4OYLA 2XQKA 5JZSA 4P9NA 5T4BA 3AZQA 1T2NA 3DCNA 3FAKA 3FYUB 4C01A 5LP1A 5AM1A 1JI3A 5A6VA 1CUBA 4ZGBA 1CRLA 4GW3A 3UUFA 3SX4A 3V1LA 3BE8A 2O2GA 1EDEA 3FLEA 3OURA 3ZI7A 4BB0A 3IULA 4FFWA 4UUQA 5F4ZA 1QGED 4H7IA 1QIEA 1C4XA 3LIPA 5AM0A 2WUDA 1QONA 2WIKA 4DYHA 4CCYB 2ORYA 3FLBA 4MQMA 3WK5A 2PX6A 3EQ7A 4H7HA 2XMZA 3WL8A 4B84A 3D5EA 3K6KA 2DR0A 5BWBA 3E0XA 4GWLA 4G1FA 4P93A 2HFKA 5JAHA 3WA6A 1H22A 2HA2A 4ZV9A 4IO0A 1Q83A 1GXSA 4U2BA 4ETWA 5JZ9A 1EVQA 1MTZA 3LCRA 3PI6A 4K6HA 2I78A 2QVBA 4X92A 3W05A 3I1IA 3ZLVA 2XQJA 3O0DA 5LZ7A 3G0DA 4DLNA 3FCXA 5JD4A 2PBLA 2WTMA 2ZSHA 5FDFA 2WG2A 3FBWA 1QIHA 5E4TA 5ALZA 3FWHA 2HRRA 3WI7A 5CH5A 3WIBA 1HL7A 2YASA 1VZ2A 2NW6A 4H35A 5CT5A 2DQZA 3WK9A 5AP9A 2QJWA 4QZVA 2OG1A 5ALSA 4QDUA 1Y37A 4Y2RA 2XLCA 2Y6VA 1SOMA 2BAGA 5D7BA 5K3FA 4UFPA 3D7RA 5AJHA 3I2JA 5JAOA 5AKGA 2JGEA 5AHXA 5EIHA 3TJMA 4LXGA 1XQXA 4U2EA 3WYNA 3FVTA 2WHPB 3H2HA 5LZ4A 2VQ6A
chains in the Genus database with same CATH superfamily
4GLFA 4LOAA 4ACAA 1C5KA 1T2FA 4X6YA 1GTJ1 4HPWA 1L4YA 3K4PA 1VBFA 2QYHA 5IJZA 2QTWB 2F3PA 3SGLA 1QG0A 2VDQB 2E4UA 5HCNA 2IIPA 1TEHA 1ODSA 4MQUA 3TW4A 4R4JA 1E2KA 2P2GA 3O8QB 5DASA 3I5AA 4G5HA 1ESEA 3I6MA 3C3EA 3K8YA 3LG2A 3LBHA 3TQRA 3G0BA 5YASA 4K81B 2QZJA 2VP4A 3B6EA 3BMNB 4FE3A 2ZCUA 4O4JA 3MGCA 1OX5A 3VX3A 4YAIA 3A9VA 1EX1A 1CVIA 2D8MA 3F6RA 3JWPA 4LI3X 4YT2A 5JW6A 4JP8A 3AF5A 5ETJA 5B7GA 1TJ5A 4GZ6A 3R3YA 4FC7A 2JI4A 4G0ZA 2QX8A 4EELA 5KJEA 3QJGA 4WL0A 4A8HA 4F38A 1V11A 1FNDA 5AW3A 3CLRC 3OP4A 5K0EA 3HR4A 3HB0A 4HGZA 3SG0A 1RR6A 2FPIB 4H7DA 3E3NA 3ODGA 3QFFA 4W5JA 3WIDA 2ZJFA 5CLIA 4K3UA 1DIBA 3EZNA 3F74A 1Y6JA 4BBZA 4DPKA 1AV7A 3I8OA 3LQRA 1GKYA 4DLSA 4OGKA 4YUXA 2VPXA 4PGMA 2GM4A 4OFWA 1ZIYA 3OEHA 5GJCA 2C2GA 4OY3A 2BKVA 2PJUA 4QXQA 3QVMA 1BVRA 5T67A 3SX2A 3VTAA 4YXWA 1XZKA 1SVIA 2Y4OA 5KKCA 1PUIA 1SAYA 1N5MA 1U3DA 1YR2A 3STXA 4DLWA 3ITNA 4CF5A 1FTWA 4BFCA 5GP1A 3WMEA 4EO4A 2BYTA 3BL5A 1M2OA 1PFUA 2H07A 4B33A 4BFLA 3KWFA 3GB9A 1E4EA 1FQJA 3PF8A 4PZLA 4MRNA 1NXXA 3PIRA 4P3KA 2Z4SA 2R48A 4RORA 5H7XA 4EHBA 4RNCA 2JL1A 1EK6A 4I8XA 4LVOA 2ONYA 1EXMA 4EF6A 5E9WA 2REXB 2WWVD 4YYEA 2D59A 4HWTA 1HNXB 3OZWA 4LC1A 2Z2IA 1IJFA 2D1RA 3QXXA 2HR1A 2E6KA 1Q3HA 2GUGA 3FWZA 3ZDXB 3W04A 5BVGB 4EI9A 4QNMA 4EKEA 4TUYA 3WVNA 3PWSA 2LIVA 2A1UA 3OTGA 2DP4E 4FD2A 4Q02A 3RUAA 2AT1A 3TZCA 4IMJB 1FRQA 2XUZA 3QNMA 2C57A 2JLUA 4WH0A 4XPZA 4DARA 3G2HA 1U7WA 1PW7A 4G1CA 3R3ZA 2XY4A 1FFHA 2HWWA 5DGCA 4I5EA 2QV7A 4YWJA 1IEWA 1I3CA 4BPRA 5HFNA 5CXUA 4K05A 5I7OA 5K0SA 3K7EA 3GBVA 1NC1A 1T9AA 2YZNA 3AIOA 1V45E 1D2NA 2MMGA 3LT1A 1Z5WA 4UBOA 5EN4A 2BL4A 4NCAA 3G3EA 4ZVQA 1GD1O 3OQMA 4XIFA 3T4UA 1UEJA 3JQBA 4FYIA 5F7JA 3CE6A 2YCBA 2WTXA 1JJBA 5U9CA 3EGVA 1PJZA 3I53A 3LYUA 4LDQA 2G1PA 2EEZA 2HWXA 4RSRA 4AP9A 4IKEA 3DD5A 2DUUA 1AQIA 3VC1A 4RIHA 3DF7A 5JNSA 1VSUA 3QV2A 1T9HA 3RRYA 1SBZA 1KU6A 4KGDA 3SR4A 3T1HB 1F4PA 3P9PA 5LDDC 5IT9A 4DV4B 4TRRA 2EFCB 2I80A 1LVHA 4PX9A 1N8SA 4BJ1A 2HJVA 4HGRA 1U7OA 2W2NA 1JHRA 5H4GA 4DR1B 4Q7MB 4JUFA 4OK6A 1KDTA 3N8NA 2PZJA 2VHZA 4YYZA 2ZI4A 4I2VA 2G3YA 2V74B 3T7CA 3TOXA 4JOQA 5JXWA 1JJVA 1K63A 1U31A 4EBFA 4HUQB 4XX0A 1NXVA 3BFXA 3VI3B 3KJNA 2LUOA 4YJ3A 4C03A 1JQKA 3N86A 2OHGA 3QA3E 1M1NA 2JGMA 4QQ8A 2XNKA 5J2TF 4TOIA 2J9GA 1Z0UA 3O2SB 3WO0A 1JDNA 4HDCA 4OHWA 4UULA 2MU1A 5HKKD 4MCIA 3T1OA 2XGMA 3FMIA 4YQZA 3ZV4A 2YKGA 4AD8A 4DJEC 2NZWA 2QSUA 1MGPA 3NBAA 4Z7OB 1HRKA 3E8MA 3GAAA 1WZUA 4RF4A 1KDVA 5HMLA 4MEBA 5KC9A 4L85A 2JLXA 3PGMA 3PFNA 5TQJA 3AY7A 1S2DA 3ZX5A 5JXGA 1XNRB 2Z2JA 2L42A 4E2WA 2OK7A 2CVQA 4MR7B 5F5LA 5BUSA 5HTOA 2PZLA 4DNXA 3DXYA 2DKFA 2GFQA 3H5IA 2PUFA 1FS6A 5AI9A 2LCQA 2H5EA 5LQRA 1RLIA 4B2IA 2WDPA 3E9MA 4O5OA 5AKIA 5JU6A 4UMVA 3E23A 2QT0A 2GJSA 1XRRA 2JI6A 3FUCA 1DQZA 5ALIA 1XTTA 5F64A 1MPXA 3GJ4A 3K5PA 5HZMA 1YQEA 5JDIC 3EZXA 5IC6A 1WP4A 1GL9B 1EXWA 4IIXA 2J67A 4D3FA 1WZ2A 1W36B 1CTQA 3GT0A 3K96A 4MIOA 4CMEA 4U0KA 5B4VA 2BEWB 3VKHA 4X7BA 4IH1A 4NJMA 2EKDA 5IVHA 3LC7O 3BJRA 4FFBA 1CQPA 2WR8A 1PQUA 3IQDB 1X13A 3LCCA 1FYDA 4OL0A 1WOMA 2P9GA 4R9UC 3MJVA 4EVQA 4MAFA 4YV2A 1ZS9A 2PLWA 4ZZIA 1WXDA 4MQ4A 1ZC4A 5D01A 4LOHA 1Z9BA 4IHJA 3LJKA 4X20B 1E9FA 3T4PA 5KBYA 4IXMA 3P52A 4TSFA 4E15A 1TZCA 4NBSA 1AQUA 2XWQA 4J0GA 1A7AA 5KB3A 4R9NA 1C1HA 5CHEA 1T1JA 4WZAB 1Y8AA 4JDPA 5EIXA 2R7LA 3TPZA 2HBRA 1LPBB 2JRLA 1KSJA 5HIMA 4JGGA 3RYIA 3W06A 1M73E 4MROA 5SYNA 1L8OA 1RBMA 2D4HA 3TBHA 3KKMA 2EATA 1CLEA 2EGUA 1KVSA 3MJCA 4CI9A 4C0LA 2BKLA 5AKJA 3DV9A 4DIKA 3U17A 2VPYA 4XVHA 3R9KA 5FPHA 4AUEA 1FVHA 1QZUA 2QZSA 5I47A 2ZXFA 3NONA 2IYQA 1BXGA 4KO8A 4F6LA 4MV8A 4W5TA 5EWJB 2V6GA 1Q19A 2ACWA 4YP9A 3O1JC 2HB6A 1N6PA 3E4DA 3L7LA 2H6EA 4KFRA 2XKJE 3I37X 2QMYA 3C7AA 4LN1A 1SURA 4O1HA 3CMCO 1Q11A 1YZUA 1U2ZA 3UA4A 3L6CA 3N2IA 2GNPA 3U16A 3H9JA 2GD0A 1XDZA 4ND4A 3U7IA 3WO1A 2BGRA 2OV2A 3B38A 3MEQA 4PF1A 4ZVRA 4AMVA 4KQCA 4HAUA 1YONA 3WLNA 3OHSX 3AVXA 2QSYA 2MYUA 2TMKA 4QSHA 2P0EA 4EHDA 2FN9A 4I4TB 4M98A 1JHDA 2B4KA 2H2IA 2WUFA 3GDWA 3LT2A 1P7PA 5CB4B 3I9V6 3Q3GE 1H8ED 4PCUA 3PPVA 2GF0A 2C7VA 4HDAA 3F9RA 3CXUA 3EW9A 3WK8A 4R1PA 1O57A 3CINA 3G17A 2XKBA 3ZU2A 2YBDA 1XEWX 3QYPA 4F5YA 5KYYA 3UC5A 2ZIGA 3RUHA 3S70A 3X1KA 1X7XB 2VKQA 2NO5A 4XJVA 3FHJA 3OZDA 5LD2C 1NRXA 2WIJA 4PCLA 5FUXA 4S12A 3R5XA 3VO2A 3JALB 5K3EA 2EG5A 4UDYX 5KTPA 5DT9A 3ZD6A 4L4RA 4Q1EA 4TL6A 4ZHQF 2CFIA 1HT2E 1ZA1A 5JMWA 4OLHA 3RAFC 1UFKA 2B5OA 5BNWA 5L40A 3PF9A 1Q6ZA 2JGLA 3COPA 3UCEA 1HFWA 2FR1A 3QHQA 4RAQA 2PKQP 1K7SN 5DE3A 4ENWA 1XVLA 4FK8A 2YFQA 1G42A 1RKXA 2ZRHA 5DO9A 3R9WA 3COWA 4V39A 1GSAA 2QTVA 4LMRA 4EFDA 1NIJA 4EGQA 2O4UX 4IG4A 4Y1RA 3MWDB 3DZHA 2AXPA 1R0KA 1NQOA 1X1RA 5F7ZA 3W2IA 3ENQA 4YRMA 1R8JA 3HJTA 3AVPA 4RV5A 3HV0A 1GZHB 3I6IA 2IIBA 3SNHA 3ZWDA 2GBLC 1NVEA 3ELUA 2VK4A 5HGXA 1IZYA 1E5LA 1FMCA 5K6AC 3RJ9A 1C4KA 2DFPA 3IP3A 4XW2A 1JSRA 2IE8A 2L69A 2BIFA 3WWCA 1TLTA 2I8AA 4Y2QA 4PFQA 5F9MA 3RSFA 3WSWA 1QIDA 1DWOA 2XW6A 2ATVA 1B8OA 1RP7A 2IYNA 3PFHA 3Q12A 4YALA 4ZDWA 4QEDA 4ZO9A 1V95A 3IQZA 3E05A 1JWAB 3NB0A 3QGMA 4D02A 1QIFA 1YI1A 5KOHB 1YRAA 2JA2A 2OECA 5CDSA 1UXOA 2IDJA 1JJ7A 1OZHA 1FU7A 2QQFA 2IZ5A 2HCFA 2PFKA 3NJ8A 5F12A 3NUQA 4NV1A 4RF2A 3ELDA 2ZIZA 1JMYA 4TWJA 4Q4AA 2O2JA 1H2BA 4D82A 5L53A 3JWIA 5CA1A 3VNSA 1WPXA 4JROA 3TW8A 1NJ8A 4BY9E 5F2NA 5FA5A 4AMZA 3UAWA 1L8LA 3INNA 3WYCA 2W6JD 2Q45A 3WL4A 5E6UB 2A1IA 5B58C 5BSEA 4UHHA 4HNUA 3JQQA 3N0VA 4CDRA 1YIDA 2GAIA 1CUXA 4DLVA 5BN3B 4B3HA 1ZFNA 3TUJC 4H0NA 4YP0A 4BQRA 4ARCA 2OESA 3T9EA 4EIWA 2YYAA 2CCJA 2JFWA 2WNSA 5C4GB 3AEUA 5TDHA 3TMKA 4EX6A 4TXJA 5FAKA 3ZVKA 4B4WA 1H9BA 2ECKA 4BVFA 2VDPB 1ZQ9A 4CM7A 2XMQA 3B2NA 3KB1A 1C30A 1AQJA 4B87A 1UL1X 2AE1A 1YASA 1N7HA 1EVJA 1ORRA 1ISIA 2WF6A 4D46A 4B3RB 5HQ3A 1H3NA 1X77A 3A1VA 3ITDA 1BKDR 5FTKA 1A7JA 1F20A 4E7PA 1GFSA 3B7GA 3BB1A 1P2BA 4JLAA 5AM5A 3ISTA 5AI8A 2G17A 3OTWA 5DLEA 3FGOA 5TQVA 4KAJA 3HVJA 4P4NA 4TV9A 4KE6A 4V0LA 4X3CA 3FUUA 1A97A 4RKQA 2HQSA 1N5LA 1XD8A 3H4MA 1R1DA 4M88A 2J3EA 4S0ZA 4TMKA 4BFVA 4EFNA 4OFBA 1ISSA 1HLFA 2B6HA 4AFNA 1P81A 1Y7HA 3LZDA 3PQ4A 4PM4A 4C7XA 4BGUA 2A1TS 3AR2A 3PSAA 2PMWB 2HF7A 1QVWA 2NVUA 2Q4DA 3EQ2A 3IURA 3JPYA 4ZOAA 2PMEA 4AX8A 4BNGA 4D9KA 3FSGD 2XADA 3ERCA 2ZBPA 2PN1A 5HR5A 4KGVA 1W2HA 2NU7A 2PL5A 3IIMA 2WD9A 3WOVA 3P9IA 4G8CA 4MRSA 4AS2A 1OJ7A 4L5BA 6ABPA 1KJIA 1MAVA 4QBGB 1FP7A 1OR8A 3LOQA 3KOUA 4WXMA 2FX5A 3OKFA 5AIBA 1G19A 1XEAA 2LVBA 1TC1A 3ADPA 3HN2A 3EA4A 1TM1E 3ND9A 3OJOA 4OJTA 121PA 5I9BA 4B71A 1US8B 2W6QA 1EFVB 4D4HA 2QE6A 3QKSB 3ZPXA 4A16A 1OVGA 4B4UA 1Q0HA 1JR4A 3I6YA 4OP2A 3C41J 1P1BA 3ABZA 5MN6A 1LPSA 1W9HA 4MS1B 1XHFA 1XYVA 3G2PA 1RPAA 2Q9CA 4FHEA 2FRVA 3OEWA 4KYUA 4QGFA 4ZVOA 3UB3A 1QHNA 4KDCA 4F7WA 1Z35A 4GUDA 1U0LA 3ROXA 2UYHA 2HK6A 2W2TA 4ZVNA 4FGWA 4U7FA 4DM7A 1Z0KA 1HSOA 3ZE7A 1QDEA 2CL0X 1TZMA 5EFZA 4CT0A 1BWSA 3LHIA 2G77B 1MO2A 2WU4A 2IEDA 1KAOA 1OWNA 5KU1A 5FCDA 1ORDA 2D5LA 2GGSA 4UBJA 2QRHA 1UZUA 3VYTB 1XL0A 5FBVB 2GD1O 3IQHX 2QXTA 2PGJA 3V4VB 1TT7A 4NAHA 3VR3A 2EKBA 2V0NA 4CM4A 3DDUA 2B8JA 2HPVA 4BYGA 4F2DA 1XO1A 1PR2A 2XWJI 4FMDB 4M9RA 4EJ2A 1EUCA 4IG9A 4JWKA 1UQUA 1YTLA 2OVBA 3ELBA 5F4BA 3FNRA 4DLPA 1NMYA 4OKIA 4ECAA 3GCZA 2GTHA 4D9GA 4GEKA 1J56A 1NUQA 4XEHA 4R1UA 4BZZA 3CX6A 3AEQA 4TRJA 2QR5A 1J8QA 2JAQA 3HXKA 3BH0A 1RKQA 2GPSA 5KNBH 1LTKA 4FQ5A 4MAAA 2YWEA 2DG2A 1R0YA 2YFKA 2CL5A 3TIIA 2Q5QA 3G2NA 1ZSVA 3PIIA 4JYAB 4HEQA 2RGXA 1D2CA 2N46A 3G7SA 3ZEIA 2GA8A 4MR9B 3I8SA 1TYAE 4PRKA 2Q8PA 2Q7OE 3EEYA 3EH2A 4X5OA 1FU4A 1AF4A 3JARA 3OJXA 1TPZA 5EKDA 5G1OA 4W8GA 5C5DA 3TK1A 1DUIA 3PXXA 2ECQA 2OOKA 3R7NA 2C9OA 1Y8ZA 3GYBA 3C3DA 3PC8A 1LFAA 4BFXA 4NH4A 4JI4B 1VG0B 3GN1A 4C4PA 4F9FA 1KY3A 3IR5A 1KZ6A 2RSLA 4A10A 3DSRA 5FPKA 3G2IA 3TTVA 4K9NA 3W5IA 4A0HA 3NVDA 3KJQA 1UQTA 3F1KA 2QN1A 2YUTA 1U0TA 2Z2XA 3D4BA 5EMLA 1F60A 4GD3Q 4HQOA 4TWAA 3JQ7A 2B5VA 4IIJF 5IT5A 1MB4A 4Q3BA 5H3CA 4YPOA 3AB3A 2F1KA 4MV6A 4RSHA 5LMUB 5DRTA 5E1MA 4GT1A 5F5NA 2DPYA 5F78A 4HJXA 5JMTA 5KVCA 4HH1A 1WKCA 1N3YA 3O4JA 1DNPA 4PQFA 3WS7A 2CHVA 1KP2A 4J90A 1FMJA 4RK6A 3EZGA 4B3TB 1IN8A 4TKUB 3T7JA 521PA 5MDHA 4XZ3A 1H1LA 5FBZA 3G8CA 1YUNA 3I34X 2X1VA 3NRBA 3EK2A 2PJDA 2AK3A 4F3RA 4HPXB 3ROGA 5IS2A 1BHSA 1VDMA 3JR7A 1L7DA 1ZNZA 2H0QA 3K0FA 1KEVA 3E6AA 3QU7A 3PB3A 1F2TA 4HNHA 5BMVB 2I99A 8MHTA 2ZYIA 3UWOA 2Y1LA 2QD5A 2JGAA 3U3DA 2E3JA 1MOZA 4E3ZA 1F8YA 4I1OA 3UMMA 3IR7A 2C8VA 3IAXA 3G02A 2M2IA 2UUPA 3B20A 3TI9A 3I23A 4ZTZB 4O4HA 1PJAA 3NHMA 3HU5A 3IUQA 2BGWA 4BATA 1UZAA 1IXSB 4Y2UA 3IE1A 4EPVA 1UDAA 4JR1A 4PLCA 2DWPA 1ZO8A 4KJXA 2RH4A 4OUDB 1NYTA 2Q5FA 3BC1A 5BV2P 4MV7A 1G2QA 4GGMX 1KI8A 3N3BC 3HU1A 5K0FA 4HAVA 1DWQA 3M81A 2J3DA 2HLDD 1J9ZA 5AK0A 1BH6A 5ALFA 2LDXA 3KETA 1A95A 1NW5A 4IWNA 5CXSA 1KAMA 2VHYA 3JYOA 5CRIA 1CUDA 3VC3A 2CXUA 4YMUA 5HKKA 1W52X 3V7UA 1DOZA 2JH9A 3CPHA 4ZRDA 2XITA 1MAWA 3KEMA 1DJLA 1MU0A 4K86A 4CKXA 3GLGA 5LJIA 1Q1EA 1DQSA 5FBWB 1DADA 5BSRA 5CT9A 1SZCA 1ZUNB 2CJWA 3JARB 2HM7A 1ZUIA 2BBOA 3EGOA 5TEWA 5CHYA 5EAIA 1Q74A 1ZI8A 3QNWA 5HKOA 3WRXC 4ERNA 1ZINA 1VJ5A 3F96A 4MR9A 2NPOA 5JFOA 1GGKA 1WS6A 5AM2A 2HMYB 3T7TA 3FOAA 1GKIA 3OPVA 3CZ9A 4OCZA 1B6RA 3TTYA 2JEOA 3W2GA 4MO2A 2O23A 4HUJA 1KSFX 1FFXB 2DSTA 3VU9B 4HF7A 2VUTA 4M8LA 1IUOA 3RDPA 4EP1A 2HIMA 2G40A 2AFIE 3TDKA 5LQDA 3WA7A 2NO9A 2I65A 5E6RA 5LNK1 3SLRA 1GAXA 5J63A 1NG1A 3R3WA 4PSAA 1FRFS 2G8LA 4Q1DA 4UDXX 1QJCA 1J9GA 1W5SA 3FNGA 1L5LA 4P4UA 4E21A 1VE5A 3FRIA 4IP0A 1QO7A 2HQRA 4BX3A 2XDQB 5D8DA 1Z4MA 2A33A 4Z6KA 3PXAA 1T4MA 3DMYA 1E3DA 1CU1A 4G5SA 1ZITA 3QPVA 5DTRA 2I54A 4RANA 3GZ4A 1NI4A 3FVQA 5ESRA 5K8CA 1KWKA 4AS1A 1SUBA 3OLVA 1LBHA 5A7GA 3HVIA 3DXXA 1TNDA 1DBRA 4P6VF 1S3FA 1U8XX 2C3MA 4OSEA 4Q24A 1QF9A 3MQ2A 2QR2A 4U9HS 1ZKDA 2FFHA 3DE2X 4BLTA 2Y1EA 4HEJA 2C95A 1FDVA 1EWKA 2ON6A 1SVNA 3MUNA 2HK7A 2RGGA 2FEXA 2YHBA 5EYPA 4ZJUA 1V4VA 1S3GA 2CK3D 2VK2A 3GH3A 3FNEA 3AF2A 3MWYW 4H3HB 4KCGA 3CZ4A 2FPOA 2I29A 4BO1A 2EF1A 2FXVA 1YA4A 4A2CA 2OMKA 4QGBA 1YKGA 1K5HA 1CJCA 3DEZA 3NS7A 2GN1A 1MP0A 3LV8A 4E11A 4MUGA 1NTOA 3BIOA 1V37A 1QYRA 3T4XA 3ZIAD 3EG5A 5DDIP 4DN6A 1Q7BA 1IU9A 4XM0A 3IIIA 3B1WA 4DYDA 2XBUA 2QRVA 4ZAVA 4IOLA 1IAQA 4RL4A 2ARKA 3FHOA 3KOOA 5EHQA 2G36A 3DT6A 4G23A 3BVPA 4IRUB 4N3BA 4XOUA 2CEAA 1N2CE 4REQA 2JKYA 1C7EA 1G4UR 3CBQA 3NWOA 4DWOA 5CVVA 1HDIA 1M34B 4UHEA 4URWR 3SVZA 1AQ6A 1D03A 1K9VF 1UK7A 3HG7A 4K28A 4TL9A 3EZYA 1SOUA 4KR3A 1G21E 3UV3A 4K2HA 1RBQA 4GC9A 1Q7EA 2XQVA 4RDIA 5ELMA 1WVIA 4BO8A 4EBBA 4EW6A 3EPJA 3ETLA 1EAYA 4PHCA 3TTTA 5CB4F 5EE0A 4AZ3A 3L02A 4LRSB 2FPPB 3QVGB 1Z5GA 3JRWA 4W4TA 3VR5H 5BSKA 1KY5A 1EMDA 1CZUA 5LP6A 2ZBEA 5ELLA 3U4DA 4XH9B 3BCHA 8OHMA 4MTLA 1V3VA 4TV9B 3M9LA 3L8YA 3QEKA 1EHIA 1CDZA 2HEIA 3VVLA 2A4KA 4CEIA 4RA6A 2BZGA 3V4OA 3U3XA 2VT2A 5C1PA 4ZAFA 3GUHA 3NHYA 1M0EA 1AOXA 1QO0D 2IYXA 3H2SA 1TVCA 3Q8XB 4G85A 4LA4A 4Z8XA 5G0TA 1YA6A 2BFNA 1KZ4A 5F7OA 3FVVA 1NW4A 4DILA 2A2ZA 4BFTA 4XWGA 4GOJA 2FY8A 4YDQA 2XMRA 4B7CA 1HDXA 1V8DA 4JLSA 5C1DA 2YIJA 4EITA 1GPLA 1GPYA 1M6VB 2C9YA 2HLPA 2J5KA 2PZGA 2QAGB 4CG0A 4JHXA 1NPTO 1ELOA 2RCNA 4PZAA 5H68A 4AMBA 3PX2A 5FXMA 5JCJA 1KAEA 1YDMA 2CK3A 1YVRA 1MX9A 2QX9A 2WD7A 3M83A 5IF3A 2GARA 4DCMA 1RS0A 2PUCA 2INGX 3I12A 4MMZB 3WL5A 1EXVA 2GK6A 2VDVE 1X42A 1XOIA 3ZNPA 3U62A 3AJ9A 1P39A 3GK3A 3ZV5A 3V4PB 4XASA 3CRNA 2QZ9A 3RSSA 3LZ6A 3A6LA 3P27A 5FA6A 1X8KA 1YMUA 4COKA 5LYJF 2PZBA 3CRRA 1QRAA 1W59A 4IIYA 4HDQB 4NSNA 4PSVA 4PG8A 5JYBA 5DGTA 1CQXA 3LX6A 2VT6A 2UXCB 1A7KA 2GVDC 4MV1A 1ZU4A 3CTMA 4YUWA 1K8YB 3TKLA 2GJAA 4NCXA 4I08A 1WSBA 4GVLA 5LP6F 4OQPA 1E8DA 2IQ5A 4BLVA 3EH1A 4QBKA 1MJGM 3OTHA 3IT0A 3VSEA 4ENRA 5M3BA 1Y33E 1Z08A 3SZRA 3RFVA 4MPTA 4EQZA 2NXNA 7AT1A 2G80A 5TF4A 2QENA 3QVKA 1N5OX 4D8WA 2J7PD 2MYPA 4GYKA 1L7BA 5CLQA 3DMRA 3ZY6A 2BFEA 4OXIA 2F59A 3VU3A 2VHCA 3P5BA 3GUYA 2FFAA 2WU0A 1G4AE 3HHPA 5KO2A 4R83A 2JANA 3L0DA 1FC0A 3TPFA 4F4HA 3GJSA 3CE9A 2Q6IA 2BGLA 3G1TA 4IJ6A 5E2BA 3L8ZA 4YRSA 3TQTA 3HWRA 1GKLA 4IIJB 2FHPA 4HGQA 4ZEWA 1Q95A 4QPZA 1UWVA 3KCQA 1AG9A 3H6GA 4TM7A 4MUAA 3ESDA 1VJ0A 2FLWA 2FMHA 3H11A 4LY0A 3V1TC 2C7QA 5AVYA 4KFSA 4K87A 1KARA 2ZRCA 3L84A 3JQ8B 3G8AA 3H3JA 1TDJA 1ONOA 2F90A 2GBFA 3IIEA 2CD9A 3AVOA 4S3MA 1CRPA 4Z3OA 1CERA 2RHMA 4JBXA 4TLCA 4Y18A 1MXFA 5F1KA 4EY4A 2VYND 3VPGA 4O2BB 4BVJA 1I4TD 3H6HA 1C0EA 4JI2B 4OX9Y 2XUAA 4LHWA 2DBVO 2NSDA 5D00A 2WJ4A 5F35A 1QIGA 2AR0A 2VJBA 3KDPA 621PA 4BL5A 1JIXA 1Z36A 1QJ4A 5B3JA 5GJBA 1CWUA 1LBSA 3HFGA 3IC5A 5I48A 1ZBQA 1DIGA 5EHIA 4UTPA 3EEQA 5DXFA 1JSZA 1SBYA 5KTRA 3L01A 5T4FA 3EARA 3VBCA 1J4AA 1QE3A 3M5PA 5IAOA 5BYKA 4ALNA 1FL9A 1RMTA 1W25A 3CISA 4P7BA 3H13A 2G4VA 2W2LD 4M0UA 1PNQA 3DDCA 2I0FA 4UHDA 4Q03A 4M7OA 3TQFA 4Q4CA 1GGHA 3RVRA 4YRBA 2ZFUA 3NDBB 1N6KA 3VISA 3LDHA 1Y9DA 2QQ0A 5BORA 2JLWA 3HNRA 1TIBA 1Q15A 4LJYA 4E5NA 3UGQA 5AVWA 4E5KA 3EQ9A 1XRPA 5KNCA 4OQZA 2IBSA 3QMPA 1MB9A 1N4DA 2JNWA 3V97A 2QX6A 4WESB 3U09A 4WCFA 1AX9A 5JSHA 4QOJA 4FEAA 3L7KA 4CT5A 4EX7A 2ERYA 2C97A 1ZUHA 3BWDD 1BKYA 1EWYA 1GPKA 2DULA 5BRAA 4BMSA 3JQGB 3GQVA 1NQTA 1BGVA 3SNKA 1T4CB 1G291 2BELA 2RGYA 1Z39A 4R54A 1TYDE 5GY7A 3VOAA 2MYNA 3A9RA 3B7WA 4H1VA 3WWDA 2FMIA 3I04M 2ATXA 3OPYB 1JXQA 3UWDA 4IDNA 2PIDA 2ENUA 1Q17A 3SHQA 3DEYX 1Z7GA 5BWLA 4KSBA 1AS3A 3T3PB 3EF3A 1QNFA 1Z7WA 1QGZA 1SVKA 2ZRBA 3UB4A 4GICA 1AB6A 3PHBE 3N8HA 4QJ4A 3E9ZA 2QTCA 4M9QA 1ST3A 3OO0A 5CPFA 4N1AA 4NIMA 3VXKA 4II3A 4XCQA 5BRJA 1Y9ZA 4YJDA 4NKRA 2ZWMA 3MBKA 1OVMA 3HN7A 5IBQA 5AVQA 5L4NA 3LT0A 4IFEA 4YLGA 4FFBB 1PR1A 5F9HA 3OX3A 2GLTA 3UA3A 4R51A 1HURA 2WVHA 1CJBA 2OCKA 2R3SA 4L51A 2EZ8A 3QLTA 1P18A 1FDSA 5COBA 4Z9BA 4O4LB 4DDWA 4HNVA 5JD6A 2NVBA 1CNEA 5TJ9A 4DIEA 3OQBA 2LRHA 3B1JA 5GV8A 4ZJZA 1NMXA 3G1UA 1RLJA 1OKKA 4AG5A 1NP6A 1LW7A 1NQUA 3MINB 1AK2A 4MI9A 5CVUA 4XB6B 1ZXXA 1XLVA 2I71A 3WYBA 4Q39A 2FUKA 5GQSA 1SBCA 4QATA 4A6PA 4YUVA 2W6MA 3CLTD 1IUNA 2BHRA 1M0SA 4PLVA 5ESDA 5L3QA 3DQPA 2X9NA 4Z4IA 2I55A 3GEHA 3ASZA 3NM6B 2CNWA 3MFQA 3W3AD 4WOJA 3T6KA 3SICE 2X6RA 5IPFA 3NTLA 5KTKA 4DLLA 2HXGA 3U3RA 3PDWA 3TB4A 5ALRA 5F23A 4WOCA 3M5WA 3WQHA 1M1YA 4D9NA 4YRRA 2NU6B 3HKEA 3OT1B 3RE1A 1Y6QA 2B1RA 2AOTB 1ABEA 3EXIB 3H8WA 4BXOB 3WIUA 1JHVA 1PQ4A 1ZK0A 3AM5A 2BKUA 1A8PA 2P9TA 4MQFA 2C5BA 1PAUA 3NATA 3H5LA 3VHLB 5AOAA 4X95A 4YJ3B 2CHQA 2VLIA 4PRYA 1LY1A 2QA5A 2EHJA 4W1QA 3O8NA 4D8UA 4B82A 1NYLA 4PR0A 1AUPA 2JK1A 1PP4A 3OFND 2GJ8A 1UR5A 2PKCA 3ADKA 3I6BA 5DHSA 3LHFA 2BW0A 1UPTA 2GBPA 4IOKA 2PUDA 2PRJA 1UT5A 4MVJE 2NOAA 4C0KA 3IBYA 4POAA 4N0QA 2Q4RA 3EUWA 3MB5A 1ZUD1 4NNOA 1JAHA 5PNTA 2GN2A 4A2WA 4BFZA 1F2UB 2AKYA 5GZ1A 4YJ2A 3RHZA 3JATA 1EVIA 1NATA 3WBFA 3Q2OA 4UHBA 3IKTA 1A5AB 3USCS 5JHHB 4LKRA 2O8EA 4LOJA 2B1GA 2K7FA 1SCDA 2E7ZA 1OBFO 1YZQA 1PL0A 5I7HA 2QM3A 2NPFA 1O0BA 2BUBA 5ALMA 4GLLA 1N2HA 1NQXA 1YR8A 1W8DA 1F8UA 4JR2A 3FZEA 1BRMA 1PJ2A 3EFBA 4BZWA 1MHTA 4LZZA 1HG1A 4B3BA 1O2DA 1AUVA 3VU8A 3ADCA 4DMMA 4DV6B 3VV3A 4BCCA 3TQHA 5F3WB 1DS6A 5H70A 2OORC 3UAGA 3IAUA 3K9HA 1EUYA 1CUHA 1IATA 2YWJA 4P54A 1Z4PX 4RUKA 4HHEA 4O4IF 4IEFB 1B4DA 1Y4UA 4JIGA 1NGSA 3RCBA 3GP5A 1VXRA 2BFCA 2BKEA 2OHHA 3MCZA 3ZCSA 4DQVA 1QYVA 4Z7QB 4IQ0A 1NNEA 4BAZA 2HWUA 3A3OA 3PFBA 2I22A 4HGNA 4XPIA 4BB5A 1GRQA 4DRXA 5JBQA 1OOEA 1AA6A 4QODA 2CBZA 1WG8A 3SIPA 4DR4B 3J80A 1DU4A 1U0HC 2VSFA 4TUYB 1IY8A 1ORWA 4GR5A 3HB1A 2Q8NA 1UJMA 2QN6A 4PS1A 3D7SA 5B6PA 2MCFA 3SM9A 1Z8HA 3N2LA 1LNQA 4J0KA 2O1EA 3S2GA 1QGUB 4ZOEA 3VNUA 4DSOA 1T2UA 4Q66C 3PC6A 1Q0UA 3FYUC 3FPLA 2GFHA 3A4LA 3RU2A 1SBNE 4G24A 3PNQA 4Z4GA 2X41A 1E4EB 3KJGA 1P6UA 4KIWA 1NBIA 3H5RA 2GFIA 4IH4A 1U0FA 4EG1A 3QFSA 3QU5A 1OYVA 4JQOA 2C5SA 1DV1A 3CUUA 4ZVPA 3LW8A 2C7BA 5E1OA 1IZZA 3L4JA 2WV7A 2GRJA 2VDKB 2YH2A 3O4GA 4OV6B 4PAQA 1YMVA 1JJFA 3CT4A 1XJCA 1TIKA 2C9CA 4MLCA 1W4RA 3G8BA 4LCEA 1AGRA 4WN9B 4UOEA 5JFTA 1DKLA 1M83A 4WKGA 3RRBA 3I09A 4BEJA 4CNBA 5BYAA 3ZCRA 5CXQA 4HB0A 4DF3A 4II2A 3QY9A 1ISPA 2VDUE 4GPD1 1I2DA 3NHRA 1ACMA 4X3PA 3E18A 4HLUC 2JIBA 2QZ4A 4P8RA 5FO1A 2J46A 3CKMA 2EIXA 2JEYA 4RD4A 3H3FA 2JIPA 4P7KA 5EOVA 1WUHS 4AP6A 3W79A 4JSYA 5FX2A 1C4OA 1GL3A 5KVQA 5LB4A 1CUCA 4V3CA 5IM4A 1E7QA 1ODCA 2IZ6A 5LYJA 3HUDA 3T15A 4UEQA 1E2FA 2AZMA 1CUFA 3DAGA 1GUDA 2GO1A 2YXLA 4N4AA 4F92B 3QXGA 3R6DA 4Z1MD 1J00A 4ZDJA 2Y0DA 4X41A 5DW3A 1BX1A 5KDOA 3HXMA 2AUTA 1PTKA 4CE6A 1EE9A 1FNMA 4C2UA 1JT9A 2VJCA 1KYTA 3K3PA 2DCUA 4QQNA 4AKTA 4JA2A 1ETUA 1RI5A 3KAPA 1YE3A 3LKBA 4UNNA 5MFZA 2VLBA 1XAHA 1X9IA 2BD0A 3AJDA 1KXZA 5CBPA 2D2VA 3AEYA 1X38A 4D92A 2X14A 1I3NA 4ZZ1A 3A3YA 3LUCA 2BFDA 1VE9A 4WEQA 1Y5LA 4P4TA 1FSSA 3B3QA 5L8VA 3UG6A 4E32A 3WKAA 3QWFA 4NRDA 1GR0A 4G86A 3TOSA 1XZFA 3DWEX 3STWA 3CLTC 1OCEA 4OKNA 4TS1A 2G9NA 2OGUA 2R8XA 1QHGA 3E9EA 2C2KA 3L8CA 4RLSA 2I87A 1L6IA 4KH1A 4RK7A 4OJYA 2VTVA 4B8ZA 5BOSA 4W5HA 5CDGA 1GT6A 4Q7JB 1EPUA 2C92A 1LBIA 3LUJA 2XMCA 3ISVA 4B3XA 2Q3LA 4RWZA 3ESZA 4GOLD 5K3SA 2WWGA 3OKPA 4D9FA 5E4JA 2P5YA 3ANLA 3K6SB 4QYIB 1Y9EA 4CR7A 3C4VA 4WY8A 4YPFA 4BX0A 1Y3AA 3OC0A 5SY9A 4XSGA 5B2EA 1NUSA 3IQFA 1Q20A 2XLBA 3PKJA 4OIMA 2BI8A 4FI3F 2EX0A 1E96A 2C61A 3EVAA 4MKHA 2PZ8A 4U7HA 5K0JA 3HDHA 4NZNA 1CB7A 1M8JA 2NZYA 2RHTA 1LS6A 1Z7BA 4JCCA 2ZJ6A 1P2DA 1Q92A 2E37A 4HZGA 4Y1FA 3TQSA 3OIVA 2GKSA 1IC6A 2WB4A 1ZH6A 2B7BA 3FHLA 3G9QA 3GDHA 3WGZA 2ACKA 2N42A 2RAPA 4BNJA 4FB5A 5F2OA 1GTZA 2ODQA 3L7AA 1FDWA 4MQBA 3I5UA 1YE8A 1Q2XA 2ZW9A 2ZI6A 3L77A 4IY1A 3VKGA 3T4EA 3VKFA 5IVIA 1DJNA 2OA0A 5C52B 4X65B 1JYEA 2E87A 1W6RA 1RQRA 4KXNA 3TSCA 1U2SA 4MP6A 4KFCA 5BT9A 2CXHA 2MSLA 5DGXA 4LSMA 4OXKA 4KOAA 4C7BA 3O21A 3OT4A 1ZMTA 3AB7A 4BJHB 1XCGB 1Q16A 4F86A 4AXXA 4ZYXA 3ECAA 1XQVA 3MYYA 3BWXA 3TLBA 1OV4A 1U02A 3LLCA 3W5DA 3PWZA 2OOSA 3OIGA 4RV4A 1V8ZA 5BNTA 2P8JA 5J4LA 3A6KA 2ZIUB 2JJ8A 3CUEF 1B6SA 5GJVC 2D1SA 1KYZA 4JUAA 4E4YA 2GN4A 2ZVDA 2C00A 1ZNWA 2E4AA 4DTCA 3GLIA 3PC4A 1ZRSA 4EYKA 2FW7A 2VJAA 1Z25A 3GBPA 4JP2A 4ZJPA 4MW6A 5AW2A 2O20A 3LNTA 1DEXA 3B51X 4J75A 1BOFA 3EC7A 4L3WA 1DPGA 3MT9A 5H9WA 5LMCA 3ZDCA 4YJGA 4XB1A 2O0LA 2IH2A 2PG3A 1RC8A 2FEMA 4KQWA 1FSFA 1B26A 3PYMA 3A6DA 3B1YA 3EWAA 1KMIY 5GINE 3S40A 4W1RA 2YWGA 5CM2Z 4CUJA 5KJ6A 1D2HA 1EE1A 4QXMA 3L0CA 1YDEA 2DQSA 2EQ5A 3MGAA 3HR7A 1HOXA 1ZESA 4KN9S 5AK5A 4MVJP 3EIHA 4XKJA 4M8IA 2PEYA 1ECLA 4Y6RA 1D2EA 2V97A 3F3MA 3H9EO 1MJFA 1QG6A 1S8OA 3LDGA 3PUKA 4O4HB 1I0IA 4OG2A 2P2LA 1D04A 1VPTA 3EGXB 5CLLA 1O89A 2C03A 2NXJA 4ISBA 1O77A 4XEUA 5I5GA 4QG7A 2WT8A 1HLDA 5H83A 1ZH4A 4DPMA 3PR3A 2AA3A 2PSEA 2DUMA 4JHLA 4TLEA 2G7ZA 1XK6A 3WMRA 4RENA 2WWYA 2GEJA 4XX1A 4W5QA 3MHTA 2W48A 2IHYA 4ZOQI 1M2EA 1FP4A 1TMYA 3KQOA 4UATA 1NLFA 3BMCA 4YGYA 5DYYA 4HX5A 1T5LA 4U2FA 5HF9A 4MZDA 3BCRA 4PGGA 3RRZA 2WWHA 4KAXA 4TWZA 1U8TA 1Q1NA 2RGEA 4LHXA 5DI9A 1J42A 3UTDA 1FQKA 2ACEA 3ZQJA 3QVOA 4IZIA 2QD3A 1N8KA 4HMOA 4LRUA 1J1UA 1P80A 1RXEA 4MW1A 3EDQA 1JUDA 3E7FA 3M6WA 1DTSA 1ESNA 3GV0A 4RS4A 4BE4A 1VKZA 5KYWA 3ME5A 4G37A 3WDLA 1IEQA 1ZGAA 4B79A 3L1VA 3THYB 3QEBZ 3HXQA 2R6R1 3MLAA 4WY5A 1YB4A 3JQ7B 4QU0A 5FUVA 4N7BA 3QA9A 4WDQA 2ZUSA 3C16C 1XDDA 3NFYA 4OOFA 5C51B 3LBFA 5G2OA 2KLBA 2P67A 1WB4A 4ZO6A 1BQEA 3R7DA 3SSOA 1YZVA 5BN3A 1T2DA 3DZBA 3IP7A 1V41E 3QITA 1ES9A 2BBSA 5JSKA 4EOGA 1AIPA 3WAJA 3H1TA 4W9NC 3WLJA 2CFRA 2W0MA 3DGEC 1OWOA 2O5CA 5CT4A 2BHNA 1OXUA 4LHYA 2WM3A 4HMPA 5KNLA 4XM1A 1M2NA 3MZ0A 4U9IS 1ADFA 5E4FA 3PTZA 4LYFA 5DHUA 2XYQA 5KTYA 1RYZA 5T4HA 4NG5A 2DWCA 3L8DA 4I3HA 3SS9X 1P9LA 2VUSA 4GP7A 1XZPA 4V2IA 3LXMA 1K8RA 1KBOA 3DBLB 5EIAA 4U2CA 5A05A 1XP5A 3NLLA 2R25B 4RMNA 3ZYZA 3RFCA 4B85A 5GMOA 4XSHA 4I46A 5GIPE 3E5NA 4KQ6A 5DBIA 1QCDA 3AFIA 1A04A 1PJCA 1VL0A 3AEQB 1RRMA 3SJUA 1SKAA 3MC1A 2VSQA 1A9RA 1KNXA 1OHHA 1RLTA 1WW8A 3MCVA 1C1DB 1VL5A 4L4UA 3AUKA 2P11A 2ROQA 2X4DA 3CX4A 4YA6A 3V4ZA 1ODTC 4NCKA 3EEOA 3QUTA 4N0DA 2COUA 3O91A 3ZWWA 1ESMA 5E8JA 1UJ5A 3KSAC 4OKSA 5DVZA 3HS3A 1JAIA 2P2CA 2JGIA 2Y76A 2Q0XA 3OWOA 5DFAA 5B64A 5HJ7A 1TQ2A 2E5LB 3BGOS 4G9EA 1FFDA 1NQAO 4RQAA 1USGA 2AUNA 3K8ZA 3FLMA 3UIEA 4CMJA 2XWSA 2AGVA 1AZWA 1XBTA 3R5JA 3RVKA 2GAJA 2V03A 1ZYUA 3FUWA 4BTLA 3EX7C 4QUKA 4OGLA 3W6NA 3R24A 4GFDA 2BMVA 1CUYA 1SKYB 2MIIA 1HQYE 1SXJE 2XE4A 2HQOA 2Y6UA 4HZUB 1JSLA 1FXUA 2CE2X 4QPPA 3UF0A 4MS1A 4JGIA 1MT0A 4NLLA 1PK8A 4NMMA 1U8UA 2Q2OA 1IULA 2QTHA 3DCIA 3EGIA 1X7YB 5FNVB 1JR3E 3F3SA 2W37A 3EUFA 1B8PA 3VYVA 4QWWA 1FUUA 1C7JA 4IDCA 4Q18A 4E5SA 1DKOA 2BI7A 2DLDA 3IGFA 5FOVA 1IH8A 5EKXA 3MINA 1JLSA 1ZK4A 2D5AA 4XB2A 1E58A 1WY7A 2R65A 4M83A 2I6QA 2ZRAA 2AE2A 4Z4EA 1D6MA 3K5IA 3D0OA 2Z8XA 2Y8EA 4U7JA 1S2IA 1LRJA 3N70A 2YNMC 3BXPA 5SZJA 5K20A 1UXKA 2HW8A 3H9QA 3SBDA 1IRXA 3MCWA 2YW9A 1P5HA 1YOVB 3B5EA 1C7ZA 1LPNA 3GPCA 4UUNA 3NGXA 1UAYA 2FHSA 3T9AA 3N58A 1XV5A 3SMVA 3PJFA 1MB2A 2BJHA 4O33A 3HFJA 1XJ0A 1ZMRA 3MXOA 2R5WA 3HJGA 1FPMA 2JB9A 4IF6A 3UMYA 2IT1A 4K9LA 4B8YA 3CZRA 3K0AA 2Q3CA 5LUAA 5JCOA 1TRKA 3K9GA 3Q8LA 4CGZA 4RU1A 5BV1A 2I3AA 2OLKA 1ETHA 4D4JA 1E9DA 1ZUWA 5BPFA 3C15C 1KKLA 2Z3WA 3UMCA 1KAQA 3JAKA 4H4CA 5GV7A 4ZC8A 3IV7A 2OCPA 4CLHA 2ASVA 5F5XA 1RABA 2JJQA 2G88A 4J3NA 5CBPB 4OU5A 4W7SA 2NIPA 1B15A 4HSEA 2Z95A 1YQDA 2NV2B 2LPMA 4MJLA 1ZRNA 2GJ9A 3DVQX 1MZPA 1U3WA 4URHA 3AF0A 3ZE1B 1H4TA 4B09A 4LXHA 1C1XB 1Z5ZA 4UAUA 5KSPA 1CPYA 3WYFA 4BQPA 1ISGA 1KJWA 3AOEA 5K7SA 4GSLA 4X6XA 3M1AA 4F4CA 1XCJA 3OESA 5C7IO 1B41A 4NV0A 5FHRA 1AC5A 1XU7A 1R9MA 2YC4C 3ROTA 2HWYA 1J8DA 1ZH0A 3A6FA 3QLVC 1K6JA 2OYSA 2Z8YM 3R0XA 1FX0A 3UG7A 1U99A 2PX4A 4BGIA 5KAPA 1MC8A 1VL6A 4DIOA 4EMUA 1E3EA 5EJ9A 4TZ6A 3KC2A 5SYMA 4XQ0A 4RTNA 3Q5DA 4BFSA 2IZ1A 2NXWA 3D3NA 5GADl 4S24A 1NMQA 5E3HA 1JTVA 2WP8J 1G8AA 3GYGA 3KIPA 5C31A 5SZIA 4EFLA 1CR6A 5ALNA 4B40A 3UV6A 2OO5C 2YJNA 2QRMA 2VQSA 4OHYA 1N2SA 4JUBA 2PUEA 1G8FA 1RKUA 1XLWA 3OTQA 3VPAA 3IHTA 2I3ZA 1GLGA 1ULBA 1DOHA 4Q4JB 2P2NA 5AXCA 4CV3A 5C7OO 5JARA 1N5JA 1DB3A 1NSTA 1NXSA 3RC9A 4JC0A 2HMWA 2NU8B 1FTYA 3UNXA 4XVUA 4RIFA 2ZS9A 2FUCA 3Q15C 4JLUA 1DX9A 2EAUA 2O2XA 2QLMA 3PNKA 2VF2A 1N0IA 2K7ZA 1GU7A 3M6IA 1SK9A 1ZW1A 2WPDA 1X86B 5LC1A 2XNCA 3IMKA 2J9ZB 3LGAA 3UWKA 3ECSA 3TSYA 1J21A 2WVGA 1FJ2A 4BWVA 3T3NA 2WJIA 3GRZA 2A7QA 3QUBA 5JJIA 1SB8A 4D25A 2FCAA 4KEAA 1E1DA 2PWPA 4XWOA 2XCTB 2PQ6A 3QTLA 2OHOA 3DMPA 2XUQA 4PBSA 4E6EA 1O5OA 1TEVA 4ZCQA 3TLXA 3WK7A 5A7HA 5DNCA 4RZHA 1YE5A 4DEXA 5HUQA 6ADHA 2QRKA 1WP9A 4OXXA 3AJAA 4PXAA 2PQMA 2R00A 1XEXA 3CEAA 2C96A 3PJRA 1K66A 3LYLA 5A0FA 4Q3CA 3MIZA 3DT8A 2V7WA 2ZCJA 2VS1A 3B89A 5EPOA 3REGA 4G07A 1X7XA 2ZUUA 4MDHA 4Z0PA 2X0NA 5EUMA 1T43A 2M6KA 1HA3A 2CMHA 4GBGA 4UAGA 5EL0A 1QAMA 2ZT8A 4Q3AA 2WZCA 4BVEA 2ANBA 4PC7A 4KMOA 4DM3A 1Y1SA 4DKXA 1NU8A 4LGYA 3RGWS 4LJLA 1JAZA 4P84A 4GI2A 2ODTX 1P2TA 1GKKA 3BX1A 4I2NA 4NYIR 3RQIA 4CT4B 1OI3A 1KS2A 1SVUA 4I8DA 5EHNA 2W6JA 4D74A 4NI5A 2G1AA 5KQRA 3DE0X 1EVKA 4MV9A 3U0VA 3A9UA 3BMQB 1GFWA 3IOYA 1KY4A 1DKNA 3CN9A 5FOUA 1EXDA 1HUQA 5ALTA 3TX2A 1GV1A 4E07A 3UENA 3AW8A 1UBNA 3DBOB 3ADDA 3RFFA 3V9PA 3BD6A 3ZY3A 3LFTA 3CKYA 4U8GA 2WWFA 3PGJA 2QRLA 2DLNA 3GEDA 2QUZA 2FSVA 4NAUA 4AVYA 1V8PA 4JJEA 1N6IA 1F2UA 4G5FA 3KQMA 4HOYA 4EY8A 1XR3A 3VC2A 3H83A 4M9XA 2FAXA 1BXKA 4UPVA 4IXDA 4JBLA 1U0RA 1HYGA 5JWRA 3OTIA 2D7DA 1Y6GA 1O8CA 1XTPA 5HFJA 3DBIA 5EJ8A 2OAEA 3U7FB 1S96A 4BB9A 3EVGA 4N6GA 4RPCA 5BW5A 3GMIA 4KQ1A 4LV6A 1DRUA 1EK1A 1MCZA 3FTEA 3ZNQA 1A5SB 1QZTA 3ICPA 4W5WA 3RKRA 5ALEA 3KDSE 3H1PA 1G6KA 4W8OA 4M8KA 1WPGA 4WKPA 4EHIA 3WLLA 3MILA 4CDMA 3EIFA 4MINA 5F33A 5G4KA 1P3Y1 2Z1MA 3QF4B 3LL7A 1UJNA 2HIGA 3H5WA 4DIUA 1DRVA 1N6LA 2P3QA 4KWTA 3UMSA 4BRSA 5IF9A 2W4IA 5H02A 2REOA 5KJ1A 1TLFA 4XQGA 2XNHA 1UKBA 2HCJB 1T9ZA 2B25A 1VMAA 1UMDA 5CNKA 3GDFA 4IIUA 3WIOA 1CRQA 4A23A 4Q9KA 3QIAA 5GOTA 1DBVO 1WU7A 5LB2A 4C0QC 2FE4A 2X5KO 3SQNA 1CEEA 1U2TA 3A58B 1TC2A 2AZDA 2P75A 2X19A 4ARAA 5HVNA 4J8PA 4LNAA 2VDRB 3JYHA 2WTNA 1UKAA 4Y9UA 4JQZA 4CM3A 4QVIA 3UGJA 4CEJB 1YULA 4PN3A 1KE2A 2H16A 1GCIA 4TMTA 3THWB 2FSPA 4MW0A 4UREA 2BKAA 4QAJA 3SDBA 4M46A 1Z0SA 2RHWA 3UYLA 1P2UA 4RCYA 1WRBA 4WBNA 4AY5A 4EA8A 2I91A 1K97A 1NI3A 2AHOA 5GGYA 3C45A 4EG4A 1OX4B 3BZBA 3CPJB 2HJWA 3C7CB 4Q1CA 1FJGB 1DV2A 4CQLB 2F8SA 2FPIA 4YECA 3Q4GA 4IIBA 2SCUB 4IIVA 2I6GA 1PO7A 1W2WB 1MDBA 4FDLA 2G1JA 2LTAA 1J5EB 2HXYA 3P19A 3DVAA 3LPMA 4JT2A 1RQGA 1POWA 2FZ4A 1V5IA 2NZ2A 3FMVA 3IUBA 4IQ8A 4KG7A 3DE6X 4M7WA 1FRVA 1R0LA 5FI0B 3QMWA 3NT5A 1Z63A 4XCXA 2DUJA 4QM7A 3DW1X 1ZIOA 1P1KA 3OECA 2ZB7A 1FX1A 3M6XA 4B6FA 2J4FA 5HRAA 1R12A 3ZQUA 2XKKA 3T1QA 3WHKA 2IC5A 5CA1F 2Q99A 4RJLA 1GDTA 3RSQA 2RGBA 3CNNA 1H1DA 2B1JA 1MQAA 3CYFA 1AY0A 3FE2A 3URMA 4RJIA 1RWPA 4C20A 2O3SA 4DR2B 1M6WA 1XTUA 3ZEAA 5KTOA 1G98A 2BM1A 2G8NA 2P4QA 3MOIA 4G1MB 3ICOA 2AYYA 1EX6A 2XQIA 3FNQA 2P7HA 3KLBA 3OPYA 3VDRA 4EG7A 2VATA 3ZD7A 2GR9A 2FPGA 1PZGA 5EE9A 1HZZC 1GG2A 3CZMA 3HCOA 3QEOA 3IOCA 2WJPA 1EUZA 1T5DX 4MJXA 3BWEA 4ZAWA 4J7AA 3FAZA 3VR4A 5LWHA 1RZVA 1KIFA 1GTMA 3ZXIA 5JNUA 1M2VB 1DP4A 4JYBA 3C98A 4EYGA 5TMPA 5BN4B 3EQ6A 5C35A 3BD9A 3KKEA 2ZSIA 3LLUA 4GLOA 2N3ZA 4JLPA 4EEXA 5E3JA 1G9XA 5CIYA 4JLWA 4EB6B 1JG4A 2BP7B 2VJPA 2GN9A 3H5NA 3OU7A 2GVNA 3HYCA 4FONA 5BN5A 3LUDA 3DE5X 3UHAA 4EQ6B 2FK8A 3FCAA 2ZYRA 2IYRA 5SY6A 4NPCA 3UM9A 1ZOLA 4FFVA 1NBEA 4A0FA 2BONA 3EIXA 2WZDA 5FJIA 3MD9A 3V8VA 1PVDA 5DK4A 2PT5A 4O29A 4ZD6A 1P19A 4ITVA 5LD2B 1M33A 1HPLA 4BVBA 2HI0A 5LQCA 4KODA 4HX9A 1Z15A 2BMEA 4IINA 1QH8B 4XD7D 4LFCB 5DIFA 5J4VA 1SXJD 4UMFA 7YASA 1G6HA 3BD8A 5CX1A 1QV7A 2HHCA 2OHIA 4M54A 1P3JA 3TQQA 1U63A 4NXMB 5BQFA 3H17A 2GK7A 2AI1A 1EVZA 3BZUA 1WZIA 1UBEA 2D2FA 2FMKA 3HDGA 4L4XA 4YO8A 1F6BA 1MENA 3OPYI 4U4AA 3U7QA 3SQXA 4D9JA 1THTA 1AZSC 6Q21A 3DKRA 3VOTA 2ZU6A 3R3XA 3RODA 5KSWB 2P78A 4HDMB 3R7WB 3WBJA 2QAIA 5FOWA 4ALMA 3Q7IA 3U19A 5HZKA 5DCUA 3Q7QA 5BRNA 3W6ZA 4F3YA 2VT3A 4DJAA 3MMPA 2B2XA 2H7CA 4GXTA 4MR8B 1VL8A 3VHQA 2BISA 3EDCA 3JQ8A 3UW1A 3JASA 2MSEB 3DZCA 4P5PA 3U13A 3FUTA 3H11B 1MT3A 4AJLA 2E85A 3MOSA 1NN0A 4MRMA 4U8HA 4B75A 1CUSA 4BNHA 1H5QA 1JJAA 4UOQA 2EKZA 1BW9B 2GBIA 3D4OA 4BNMA 2FDXA 3X2FA 4EHKA 5CBKA 4Y8VA 1SIOA 1XTSA 4YI5A 5I4IA 1ULTA 2WF8A 3HYSA 2LP4Y 5EWMB 2RJ3A 4EMSA 4NXNB 3FNBA 4S04A 1A2BA 3MS4A 4URVR 2UXBB 2J32A 1PL8A 1M2OB 1V7QA 2Y1KA 1J5XA 3K15A 3IX7A 3PFWO 4LYDA 3T7IA 3USZA 4K5QA 2YWXA 4N47A 5KPDA 2VCHA 4C06A 4S1NA 1GNTA 1UQRA 3NORA 2VZLA 4HQNA 1D6JA 2F9FA 4IIGA 3RVSA 4FVTA 3EUEA 1UKCA 4TKVA 2X5XA 2XT9A 1A8QA 1WL8A 2NYVA 2YL2A 1WJGA 3HUEA 3L9XA 3QVWA 2ZI7A 4KQXA 3M7IA 2V58A 4N7MA 4P58A 3NHJA 3HJRA 5BR7A 1KP9A 3WGLA 2JD2A 3PC3A 1NJ2A 2QNIA 4OXYA 4JLOA 5CVDA 3TNJA 4MO9A 4CKEA 4Y2JA 1JR3A 3PCRB 2YN2A 5JUWA 1HT0A 1SHZA 3G89A 1E1RA 1MABA 1ULUA 3IAM1 3BJZA 3L7IA 4JKOA 1MG0A 4RHFA 1WXHA 2IBTA 2IKSA 1G4HA 3O4HA 2I1VB 1U81A 2QL9A 4MI1A 1NONA 4PYKA 5KSYA 2OO5A 1C3OA 3L40A 1AKRA 2OM6A 5JI3E 1XTVA 1Z3IX 2VJMB 3C5WP 3LCJA 3MCAA 3Q98A 4GKVA 5B3LA 3UAXA 2QNBA 2J0SA 1QHHB 2Z4TA 1I3KA 4MH0R 5AOCA 5H3LA 2ZI3A 1YB2A 1K68A 1G0OA 1WPQA 3CX8A 4K46A 4C4XA 2PV7A 4J1TC 1YHYA 2UZ3A 4ZOLB 4ZMBA 3HP1A 1C8VB 4LQCA 3FRHA 4Y2YA 3SYLA 4BIMA 2FW0A 4GRIA 1KVRA 3KZXA 1JEJA 3LL4A 1CFZA 2BR3A 5DYWA 1WLYA 2CJYA 2UZ1A 2XI4A 3B78A 3OPQA 5JQGF 4RD6A 1WF6A 2KX7A 2JIOA 4OBBA 1X39A 4CF7A 1PFQA 5IWCA 3U6BA 4KO4S 2X77A 3KHSA 3FKJA 5BWCA 3OETA 5IXYA 3JQCA 1II9A 1NC3A 3H9GA 5EZYA 2CUZA 3I58A 4DXHA 1NN3A 1EK2A 1CVRA 1MMFB 1Q91A 2WHPA 5TQ0A 4I9NA 4ZU6X 3ZVNA 1YCFA 5JDCA 3EVFA 5HW0A 2NSHA 3I3SR 4Q9HA 4NX2A 1P1HA 1DBIA 4C6RA 1IZ0A 3HY4A 1UJ6A 1C50A 4QJ5A 5KDDA 1R74A 3FYDA 3RF7A 4G1EB 4CW7A 1XXHE 4OYLA 3VNBA 5JZSA 3SX0A 4D44A 1BX3A 4P9NA 4R16A 5T4BA 4AJKA 2JVIA 2QROA 3WMXA 2UYCA 3AZQA 5CIQA 3TPCA 1PR9A 5JC1A 3OSUA 4QUJA 2F67A 5CCDA 1G8JA 2ONZA 1LQ2A 1NOJA 2DH5A 3A1TA 4UASA 2A3RA 3GUCA 4CLEA 5A6VA 4OGWA 3K71B 2GF2A 1CUBA 1N5DA 3PGA1 4JT8A 4AWBA 2W71A 3GP3A 1W7AA 3G13A 2HREA 3K0HA 2J85A 4LJSA 4PAOA 1RAHA 4B31A 4HYQA 4P5DA 4E5YA 2I4OA 3OEHD 1ECCA 2NACA 1T6XA 3AETA 4V3BA 1KVUA 4EHJA 1TZBA 3GJ3A 1T3LA 3G0HA 2FGJA 1YQTA 3TFQA 3KT3A 2AOWA 3R0ZA 1F12A 4BB0A 5KEIA 2JLZA 4F6RA 3BWBA 3V2HA 2OFOA 1H0HA 1V1RA 3MYRA 5F4ZA 1O08A 1RHRA 3V00A 2FF5A 1QGED 2X8WA 4FGLA 2J9RA 3TEMA 2KI5A 3UJPA 3JYQA 4HDSB 1QIEA 1C4XA 1EFRD 2LWIA 3AHIA 1G5IA 1QONA 4DYHA 3GXBA 3IT1A 4QPDA 1SKUA 4DSTA 4YRLA 1UOEA 1TZJA 4MQMA 3N1UA 1NVXQ 3UK1A 1C3LA 4RHCA 4P2BA 5TS3A 4OMUA 3WL8A 5G4LA 3LY9A 3K6KA 2DR0A 2HGSA 1PR6A 5LPNA 1HYHA 5BWBA 5L51A 1U8AA 2A5FA 4MIEA 3Q5EA 4P93A 4L5YA 3U49A 3G2KA 1HNNA 4BWFB 3E1SA 2HFKA 1V96A 5JAHA 2P6OA 3TNLA 3WA6A 2Q4EA 1W93A 3IV6A 4YJHA 5ERGB 2PE5A 5TMDA 4IO0A 3P0JA 1T1GA 2Q8QA 3CX7A 2G76A 1H42A 4UUBA 3TL3A 1QAQA 1VPWA 5JZ9A 4D9IA 6GPBA 1GPAA 1NW7A 3LCRA 3SEAA 1NYQA 2BOVA 3V2GA 4RQTA 5B55A 3A0UA 1WX1A 4B3JA 4B4KA 3OWXA 2BPOA 2LKCA 2CVHA 3I1IA 4TXNA 1KSGA 1I4EB 4DUPA 5TEVA 2Y66A 5ITSA 1N6RA 3D3EA 4NMLA 1Y80A 2SBTA 2VNAA 3PUWA 4PLTA 5FNVF 1C29B 4NCHA 1T34A 2OHXA 1Z26A 1Q1GA 4I1UA 3AT1A 2W2PA 3TW0A 1RCFA 3KHKA 4XE5A 4XUGB 3RV3A 1ZUNA 2CJWB 3HM2A 1Y8QB 1EJ0A 4UNQA 3RGGA 2OMEA 3WMFA 3UYKA 2C7RA 5DLQC 2H1FA 2QP9X 3G82C 3QF7A 1C3VA 4IWYA 4LZPA 4BJ3A 4DDTA 5MGNA 4HBZA 4ML3A 4PPGA 3BG5A 3FW1A 4R8KA 1TJYA 2EWMA 3IAAA 3LHDA 2A5JA 4Q4AB 3VPSA 4OP1A 3ZGYA 5JWOA 3SFZA 3Q7PA 2KPOA 3B8EA 3P4YA 2ZSAA 2GMWA 3UEOA 3GFBA 5BSHA 3JD1A 3CKKA 2D8AA 2Q2QA 2FW1A 4G36A 5GONB 4YRQA 4REOA 4URZR 4TTQA 3ZZTA 3WK9A 4N54A 1NOKA 2VSNA 4QZVA 4ER6A 1JG1A 2C2WA 2UV8A 821PA 3BWCA 1NFFA 3W7VA 4QDUA 3MWEA 4RM3A 3A04A 1G3MA 4UCFA 1EYZA 2JCXA 1JALA 1R9JA 2Y6VA 5EWJA 3AIIA 4E12A 3ORQA 3PPYA 3R44A 4TV8B 4KR2A 1Z5PA 3RROA 2BAGA 2P3SA 5D7BA 1N2GA 1U6KA 3E53A 5EXEA 2NUPA 4BNYA 1E6EA 2YY5A 4EDFA 3UN1A 1KC1A 3UFXB 1C9MA 2BZSA 1EKXA 3UMGA 1NHWA 2COEA 2DM6A 4DADA 3I30X 2NUTA 2ZBDA 4LTNA 5BMVA 5KNDH 3FA2A 1SBHA 2JGNA 4LXGA 3TJMA 3OQIB 1JBKA 3LWBA 4TXHA 1T8TA 4J7CA 4U2EA 4ZVLA 3TWOA 4Y0AA 3C3MA 5KX5B 2ZTHA 3A9CA 3CPSA 4RDHA 3JQ9A