4KE9A

Crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with an 1-stearyol glycerol analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
EQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermostable monoacylglycerol lipase
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke9A00
1GQSA 4DMCA 3DQZA 5D3ZA 3VJKA 2QOEA 3D5EA 1CVLA 3BXPA 4GW3A 3MVEA 1VE7A 3E0XA 3CN9A 2DHDA 2B61A 2J3DA 2WG0A 2WJ3A 4XJVA 2C5GA 3L1HA 4IH9A 2RIPA 1XZEA 3R3WA 4C6HA 4QEKA 1CUIA 2HA5A 1BEEA 1E89A 3GROA 3DCNA 5FXMA 1J06A 2IIVA 3A6ZA 4KJXA 5AM5A 4P08A 4Q05A 2GZSA 3A2LA 5ALJA 1YR2A 3DEAA 5AP9A 4E11A 3WK9A 1CUXA 3QBJA 1QIGA 4RE6A 3WIBA 1UKBA 3FVRA 2JGIA 1CR6A 4WDQA 2XUOA 5HK9A 4PW0A 1AX9A 5EFZA 4PQEA 5K5EA 5JD5A 2OCLA 4X95A 4ETWA 1QLWA 3TJMA 1H2XA 5FRDA 5DNWA 3LP5A 3OG9A 3K9BA 4ITVA 3K6KA 4H7JA 3G8YA 1DWOA 5FDFA 2AXEA 3O4IA 5ALKA 1ACLA 2AJDA 2CZQA 2QZPA 3GUUA 2PUHA 1K6EA 5IVDA 4C4ZA 5ALTA 2HRQA 4DNQA 5JIBA 2GBIA 3ZLUA 3FSGA 4K6GA 5ALSA 1UOPA 3C6BA 4DNOA 5ALFA 3HC7A 1CUJA 3JWEA 4KR0A 3JW8A 4GBGA 4KEAA 1YA4A 3EQ7A 5AKJA 4W1RA 1ACJA 1LGYA 2XUKA 1DT5A 3AIKA 5DWDA 5HKAA 2VATA 1T4MA 2C0PA 3I28A 4GEGA 4QNNA 5LLSA 1XZAA 3RARA 3OURA 3QH4A 2PSEA 4MYSA 1E8DA 1DX4A 3IUQA 2EEPA 3H2JA 5A7FA 1XKLA 1BU8A 5AK3A 3EIOA 4FLFA 2HU5A 3PF9A 3WK7A 2VJBA 2C5FA 2J4CA 2DFPA 3EQ9A 1JJIA 3N0TA 4PSUA 2JGEA 4V2IA 2GBGA 1MX9A 2JGFA 4U2CA 4AZ0A 3AZOA 4JH0A 4AZ3A 4AN1A 3I2IA 4K6KA 4CG1A 4ARBA 5AM0A 2HU7A 3TGLA 5E4YA 3A2MA 1SOMA 2XB6A 2YASA 1YCDA 1F0NA 1ZI8A 3SX4A 3EBLA 1AZWA 1QJ4A 3PF8A 4U2GA 3W04A 1MNAA 2WFLB 2Y6VA 4PF1A 3DLTA 4ZWNA 2XUPA 5FOQA 2HA0A 3ANSA 2EDCA 3ANTA 1SCIA 3FYUB 1XRLA 4Q82A 1AUOA 2QVBA 2XDWA 4FOLA 3I6ZA 3WWPA 5CW2A 4G5XA 4PO3X 2FJPA 5CTAA 1CUBA 2QRUA 3R3XA 2H9YA 3C43A 4DM7A 4C4YA 1R88A 4IH4A 1IUNA 5T4BA 3BF8A 1QONA 3WL5A 1PV1A 1VJ5A 4EZIA 1J2EA 1XZFA 5EHQA 1ZGBA 2WJ6A 3L1JA 4NMWA 1FFBA 3WK6A 4X7BA 5A7GA 2JGKA 2X76A 2Z3ZA 3C87A 1X70A 1YB6A 2Z5GA 1GZ7A 3IUJA 1JT2A 3HABA 4AB1A 5EHXA 4K2AA 5AK6A 2FX5A 3Q8WA 3WL6A 1AQLA 4YK7A 3C6ZA 3WKAA 4DTCA 3I2GA 3C6XA 4UHDA 4OUKX 5AI0A 2P8SA 3DYIA 4AO7A 1DT3A 4UBLA 3HXKA 5BWCA 2JIDA 3LLCA 3KWJA 4LIPD 2QM0A 3DOIA 1P0MA 2RHWA 1ZD5A 2WIFA 5AKGA 1QFMA 1GXSA 4XIIA 1F6WA 5CT4A 5EIAA 4DNFA 1FFCA 5CT9A 5AI6A 1XZKA 5LP1A 5JD6A 1H23A 1DTEA 4G8DA 2VF2A 4HS9A 3BJMA 4U2DA 4X6UA 2AJCA 4TPKA 2AJBA 3SC2A 1J1IA 4IO0A 5AIBA 1XRPA 4HXEB 5ALYA 3H1BA 3G0GA 2DSNA 3LIIA 3RK4A 5AIAA 4KAAA 4G9EA 4JEIA 4J03A 4YASA 5ALRA 1W75A 1N5RA 4X3CA 4UBOA 5ALOA 1LNSA 2QXUA 3CXUA 3A2NA 2ZYRA 4RE5A 3ESAA 1QIFA 3WA6A 5BWBA 3O95A 3H17A 4UHHA 3VVLA 3S8YA 3C6YA 1UWCA 3O9MA 1Q83A 1UKCA 2WHQA 1LPBB 5A2GA 1AGYA 4OCZA 3YASA 5H3HA 3WLAA 4JUIA 4LKOA 4Q3LA 2I03A 4MYDA 4HTAA 4J0IA 1LPOA 2FUKA 3M3DA 4FDMA 4EB0A 3STTA 2QJRA 5EGNA 3IB3A 1XZJA 3E1GA 4BVLA 3MGAA 5C81A 4BP8A 2XE4A 2E3JA 2QT9A 3H18A 2O2HA 5EHZA 5JARA 4JYMA 4B9AA 2JGLA 3GA7A 4PSDA 1YS1X 3BF7A 1TK3A 1QO9A 1JU4A 4G1FA 3UUFA 3DD5A 4BAUA 4RPCA 5HQ3A 2NW6A 3AIOA 3EF3A 4K6HA 2PUJA 1Z68A 5E4TA 3TEJA 4IHAA 1UZAA 2I78A 5ALQA 3WWDA 4X92A 3I2JA 5KWIA 3R3VA 2R11A 5CRIA 3FYTA 4UHFA 2DCMA 2HA2A 1XZMA 2Y1KA 3F67A 2XQIA 2RAUA 1H2ZA 1GT6A 4AO6A 5DYYA 1FSSA 1MT3A 4LXHA 2C7BA 3I6MA 1XQXA 3FNBA 4Y2YA 5D3KA 2ACEA 4KAFA 1L7RA 2PPLA 1LZKA 3G0IA 3W06A 4Y2XA 3WKCA 2PM8A 1EH5A 1TIBA 4BCCA 2PSHA 1PJAA 1DWPA 2CB9A 4G4GA 4B0PA 4UHEA 2XQKA 4W9RA 3VJMA 3I2KA 2B9VA 4ARAA 3R3YA 5A62A 3PICA 3GELA 1A88A 3G0DA 3F8SA 5AOCA 2WLSA 4Y2UA 3DL4A 1UOQA 3FOBA 4XWGA 2YXPX 5AK5A 1I6WA 2C58A 1CUAA 1T2NA 1WPXA 1WPRA 1YAHA 4LYDA 4N8EA 3ED1A 1H2WA 1L7QA 5KBYA 3PI6A 3H19A 1MN6A 2WFLA 4U2FA 2D0DA 3WA7A 2O2IA 2ZVDA 3FYUA 1F8UA 5LKRA 4B0OA 4BZWA 4P93A 3G0BA 1IZ8A 3HZOA 1P0PA 3ZWQA 2WU3A 3VKFA 5FV4A 4UBKA 2WILA 1E5TA 3D3NA 1H22A 5JANA 3DYVA 5AM3A 2AJLI 2XMZA 3IBTA 1A8SA 1QOZA 3FSGD 1ZD4A 4DMFA 2WHRA 3FWHA 4WJLA 4C4XA 5C8VA 2W6CX 4BTVA 1W1IA 5ALEA 1U4NA 3AZQA 3FYUC 1FFAA 2XUQA 1N5MA 4S0XA 1VZ2A 4H7DA 4A5SA 5ALXA 1S8OA 1KU6A 1WOMA 3CCCA 5I9IA 1CV2A 1JI3A 4L72A 2PSJA 1UK7A 3KOOA 3C70A 4I4CA 1XQYA 2XUGA 5T4HA 5JALA 3IUMA 1U65A 4X90A 4UFOA 2XUDA 4C88A 1GPLA 5AM1A 1KU0A 3MUOA 4WFJA 2VT7A 4EBBA 4JNCA 4A16A 5AOBA 1JJFA 3QPDA 3PDCA 3AJAA 1THGA 1C7IA 4Y9SA 2GYWA 4GECA 3I1YA 4M0MA 3WJ2A 1ZD2P 1UK9A 3FCYA 1VXOA 1LPSA 1VXRA 1H2YA 3PE6A 5K3FA 3VXKA 5JZ9A 2GYVA 5ISMA 4H18A 1BS9A 5DYTA 4UBIA 1XZBA 3V1KA 4I3FA 3WKDA 1QTRA 3ZLVA 1HDEA 3C8HA 2QUBA 2RONA 3AZPA 3HJUA 4ZI5A 2WSLA 3STWA 2OQIA 1ORVA 1UOOA 2WIJA 3M82A 1QE3A 2PL5A 3OOSA 3RLIA 3DL7A 1XLVA 1QO7A 3NOXA 5SYMA 1MJ5A 1VOTA 4CI9A 5AJHA 3DS8A 1EXWA 5LZ2A 4YX9A 3O4JA 4X91A 2PKYX 3BL8A 3WL8A 3QZUA 3KXPA 3IIIA 4YPVA 4Y2TA 3GFFA 1LPNA 3H2IA 3PFCA 3F96A 4MXDA 4F0JA 3QMVA 1UK6A 2CBGA 4B80A 1Q84A 3WWCA 4UBNA 4ZV7A 4H77A 2V98A 1YAJA 3L1IA 4TGLA 2G5PA 2JEZA 3KDAA 5ALZA 3BWXA 1CEXA 3WKEA 1A7UA 4B81A 2W22A 4B6GA 2G4LA 5HCUA 1M33A 2IX9A 2BUBA 4JYPA 5AKZA 3H2HA 2OXEA 4FWBA 1PFQA 3AIMA 2OGZA 4X71A 1EI9A 4XVCA 1CIJA 3WI7A 2VTVA 4DGQA 2XUHA 3STVA 1MTZA 2RI6A 5ALNA 4UBMA 4FNMA 3DJYA 4GLBA 5DTIA 5HF5A 4Q34A 2ZYIA 3H2KA 2VJAA 1TRHA 2JF0A 3BE8A 3O0DA 3ESDA 5D6OA 5LZ9A 4BE4A 1JFRA 2V97A 2PBLA 5K3CA 3ZLTA 4CCYA 4Y2RA 3ZI7A 2V9ZA 2C4HA 4Q3KA 2Z8XA 2Z8ZA 1Y7HA 2XUFA 4GI1A 5HF9A 1DWQA 1QIDA 4AN0A 4BRSA 1EA5A 4AMZA 2HADA 4LHEA 4CCWA 3FLEA 1WB4A 3DKRA 3W05A 2LIPA 1CUCA 5DTJA 3I2FA 1UT6A 5F4ZA 1N1MA 4BB0A 1ZJ4A 2O7RA 2VAVA 5ALHA 2ZJ7A 1EVQA 1TCAA 5DNVA 3W9BA 2J3QA 5CT5A 4BVKA 3KWFA 4L0CA 4UBJA 1R4ZA 2B4KA 2WUFA 5AM4A 1A8QA 4Y7DA 2HA6A 1O6FA 4EY4A 2XMDA 3I1IA 5BV7A 2ECFA 3Q0TA 4OB8A 5KWJA 1B41A 4MQMA 4UHCA 1XRMA 5K3BA 2H7YA 4IQ4A 1NU8A 4U2BA 2YYSA 3WWOA 4MWTA 4FMPA 1HKHA 1MNQA 2HIHA 1L7AA 4G4JA 1P0IA 4UFNA 4W1PA 1CUSA 3KSRA 4BZZA 5IVKA 2ES4A 4X6XA 1SFRA 5EI5A 1E8NA 2WFMA 2WTNA 1J07A 1YB7A 3G9XA 2PU5A 4DNPA 1HLGA 5IVIA 3D2AA 4ZV9A 1TAHA 4WY5A 5LZ8A 4PV7A 3ESCA 4FNGA 1XZIA 2PSDA 2VJCA 2XT0A 4FLEA 3D7RA 1R50A 1XZHA 4OB6A 4H0CA 4X85A 3PFBA 3HLKA 1EB9A 1XFDA 4QWWA 1BEZA 1AKNA 5A7HA 4N8DA 2Y2VA 4Y2QA 3WK4A 3OPMA 2PX6A 1GPKA 5JZSA 1DQYA 1GKLA 1N8SA 1GKKA 2AJ8A 1ISPA 2XQGA 1AMNA 1CUDA 2J4FA 2ZJFA 1CUHA 4OSEA 1AC5A 1XZDA 1EX9A 4FLMA 4MEAA 1A8UA 4F5ZA 1GQRA 3QMWA 5AI4A 4INZA 4G8BA 1LPMA 5DYWA 2OCIA 4NS4A 3S2ZA 4BCDA 4EHBA 5HF6A 2WM2A 1CUWA 1LLFA 4AO8A 4C89A 1XLUA 2ORYA 4BDSA 4WDRA 3C5VA 1ODSA 2GYUA 1DX6A 1KEZA 4M0EA 5E2IA 4X93A 3G02A 4QDTA 1XRQA 1K4YA 4Y2PA 1UK8A 4LXGA 3STXA 2WHPB 4W1QA 4Q1VA 4HVTA 2ZSIA 3VISA 1WHTA 4J0JA 5HZGA 4E14A 1R3DA 4F60A 4PNZA 1W52X 3IDAA 4BP9A 2XQFA 5JYCA 1SC9A 3W2TA 1MO2A 2CEKA 4KRXA 1CUGA 2EDAA 3STUA 5CBKA 5CT8A 3R3ZA 4H7IA 3WK8A 5ESRA 5HFNA 1EHYA 3WKBA 3M81A 4J0DA 3R41A 1EDEA 3WZLA 5ALVA 1ZD3A 1BN6A 1CUZA 4UHBA 3W9UA 1XZCA 3M83A 5I7UA 4NVRA 1EINA 4NZZA 5ALWA 4Y2SA 4HXFB 2PU7A 3QYJA 5DJ5A 3UUEA 2DQYA 5LIPA 4OU4A 4B84A 4HZGA 4J3JA 1W76A 1VLQA 4X00A 5AH0A 1EK1A 5K3DA 3ZPXA 2HDWA 4HRXA 4H35A 2BGNA 1E8MA 3G9UA 2O2GA 4BDTA 2CJPA 5KREA 3DDUA 1C4XA 2XMBA 2CMFA 5E4JA 1FFDA 4EY7A 3WYDA 1ZIXA 3WWEA 2H1IA 2Q0XA 1AURA 1MPXA 1ODTC 4EY8A 5JAHA 3CCBA 3F97A 4QDUA 5AKYA 3O4HA 1QTIA 2WQZA 5CH5A 7YASA 4I19A 5IKXA 4G9GA 1WB6A 2ZSHA 4ZRDA 2I3DA 4ROTA 2X8BA 2XMGA 4U2EA 1BCSA 1XRRA 5HFAA 2DR0A 1ETHA 1OCEA 2OLEA 2HA7A 5EHNA 4W1SA 3U1TA 1QIKA 4DSAA 4DYHA 5A6VA 2HA4A 2BJHA 3AFIA 1BRTA 2H7CA 3BDVA 4FFVA 2QJWA 1FJ2A 4H7EA 4H7HA 4P9NA 5CT6A 2WG1A 1K63A 3E4DA 5ALDA 2JBWA 1ZI6A 1NU6A 1YSCA 4BAGA 2VQ6A 3LIPA 2OG1A 1IZ7A 4HRYA 3C45A 1YS2X 1G42A 4BC1A 5SYNA 3DOHA 1Y7IA 3WIOA 3QPAA 1HQDA 4G8CA 3HRHA 3H0CA 5CXUA 2OQVA 4EY6A 1SCQA 3O4GA 3NGMA 3BIXA 3QPCA 2WU4A 1RYYA 4BAZA 4Z49A 4E46A 2ZYSA 2XQJA 5AICA 2XI4A 1G66A 2RHTA 2BUCA 5FKJA 1BN7A 1B6GA 1BROA 2OGSA 4P92A 3WZMA 1LBSA 4HXGA 4WCVA 2XLBA 4FFWA 4DLNA 1JKMA 4ZXFA 4X6YA 5AKIA 1ORWA 3C5WP 4FTWA 3D59A 1MX5A 5LZ5A 5AOAA 2OGTA 3WYNA 2B20A 4L9AA 1GPNA 4J0CA 1BCRA 4PSCA 5LKAA 1JJBA 1MAAA 4H7FA 1FFEA 2UZ0A 2DHCA 3RKSA 4CIBA 2WKWA 5AO9A 3IA2A 2QUAA 4BVJA 3C8DA 5HQ3B 3OM8A 5AKKA 1YA8A 4OYLA 5K3EA 4KE9A 2I3ZA 1HL7A 5D7BA 2G5TA 1IUPA 2PSFA 3HI4A 4AX4A 3UMJA 1CUUA 4M0FA 4CG3A 1QZ3A 4QE3A 5FPPA 4EUSA 4LXIA 4E15A 2QMQA 1QIEA 3PUHA 1RWQA 4OYYA 1CRLA 5AKEA 3QM1A 3WMRA 4W63A 4QWMA 2K2QB 3BJRA 4KYVA 5CXXA 4UUQA 4EA6A 4J0KA 1QIJA 5T4FA 1USWA 1CUEA 2XUAA 3ZV7A 3LS2A 1VZ3A 5DLPA 1LPPA 2VJDA 1XRNA 3FLAA 1EVEA 2ACKA 1R1DA 2WIKA 2ZJ6A 4QDXA 3I6YA 1QIHA 3HYSA 5ALUA 2OPHA 2QTBA 3R3UA 3AILA 5CURA 2WTMA 3T4UA 1TCBA 4UPDA 4FBLA 5ALIA 1TCCA 1G4HA 2WHPA 1EB8A 4F21A 4AXBA 1R9MA 5HK8A 2FJ0A 1TKRA 4N5IX 2XMSA 2HL6A 3VJLA 1DU4A 4WFIA 3JYHA 2WG2A 1LBTA 3N2ZB 4HAIA 4J0GA 4O08A 4GWLA 4BCBA 4DMHA 4C87A 2Y2UA 4GDMA 1MAHA 1ZJ5A 3X3HA 1CLEA 1XQWA 5C7YA 5JASA 3GBSA 5AM2A 3ILSA 4MJ3A 3NUZA 2BFNA 2OAGA 2WIDA 1XKTA 3D0KA 2RGUA 3G9TA 4LYEA 3WK5A 3AINA 4RGYA 3SK0A 1TQHA 5JAPA 3ICWA 1THTA 4X97A 4MQLA 4CFSA 4MEBA 3T52A 4EY5A 3IVMA 5ALGA 5JATA 2Y6UA 4QZVA 6YASA 1R9NA 4KE8A 4KE7A 1CPYA 5AK4A 2D5LA 2BKLA 5JD4A 5FLKA 5YASA 1U2EA 1C7JA 5AI5A 1K8QA 5C8XA 5AI9A 2Z3WA 1CQWA 2VSQA 4X94A 3CN7A 2JGJA 3DKKA 1NX9A 2BGRA 4CIAA 2XMCA 3VVMA 4L3WA 3B3QA 1VKHA 1ZGCA 4DMKA 1RP1A 5LYYA 4AQDA 4OD0A 4A23A 5AKLA 1QIIA 2CKMA 4N5HX 3QMMA 2QKYA 3ESBA 1UFOA 2XUJA 1LZLA 1MX1A 2HA3A 1QFSA 1IUOA 5JADA 1G5FA 4ZREA 1MU0A 2VA9A 5AI8A 3IUNA 5A71A 3OC0A 4B9EA 3OTQA 1Q0RA 4Q3OA 4Y2VA 3V1MA 5C8ZA 3HSSA 4ZGBA 1CUYA 4B7ZA 5AHXA 2V96A 4CG2A 2OCGA 1QIMA 1Y37A 4N8SA 5J3JA 2H7XA 5K3FB 2WUEA 3LCRA 3FCXA 3FBWA 3STYA 5ALLA 1ZIYA 2QXTA 2HRRA 4Y2JA 2BAGA 4QLAA 4BRZA 2X5XA 1QGED 2R8BA 1U8EA 3G9ZA 4QDOA 2VT6A 2WFZA 4KE6A 1VA4A 4AMYA 4J7AA 2XLCA 3QVMA 4XX1A 3B12A 1EDBA 5AKXA 4DIUA 3H04A 2O7VA 3HEAA 1Q0ZA 1EK2A 5EIHA 4FHZA 5HF8A 3A70A 3TRDA 3O9VA 4QLOA 3VDXA 1X2EA 3F98A 1BE0A 2GBFA 5BOVA 2WJ4A 3D2BA 2ONCA 3RM3A 1XZLA 3DNMA 5LZ7A 1ZI9A 1OXMA 4J0HA 2VEOA 1HPLA 5JAOA 3B5EA 3U0VA 1EDDA 3V1NA 3R0VA 2XUIA 4BE9A 4BTLA 1JU3A 1ZICA 3E3AA 4K5QA 5JAUA 2ZYHA 3FLBA 3WL7A 3ICVA 3WQHA 1GGVA 3D2CA 3FAKA 3H1AA 5EIEA 3WJ1A 5CH3A 2WIGA 3QITA 2GBCA 5ALMA 1XQVA 3SWWA 2C0QA 1K5PA 2HHAA 1UKAA 2QS9A 4B85A 4BBZA 3F9CA 1DQZA 4BC0A 4WY8A 3AUKA 1DINA 3R40A 5AKHA 1IMJA 4BYMA 2IITA 2YH2A 3KD2A 1WB5A 1VE6A 3P2MA 1W6RA 4KACA 2ROQA 2WUGA 1X2BA 3IULA 1P0QA 1ZOIA 4B82A 5K3AA 2HFJA 1CUFA 1ODCA 4FKBA 3V1LA 4DSZA 3K2IA 2WUDA 4QA9A 2QR5A 5T4EA 2DHEA 3IURA 1XLWA 2HM7A 4KRYA 5I8PA 3NWOA 3V48A 1CUVA 4TVKA 2PVSA 5DNUA 1YASA 5ALPA 4CCYB 3V9AA 1LPAB 4H7KA 3H2GA 3PUIA 1HBJA 2BCEA 1WM1A 2OCKA 4G4IA 3EQ8A 4B83A 1UXOA 2XMRA 3FVTA 2JEYA 5IH7A 1JMYA 3HACA 5LZ4A 1F0PA 4FBMA 4D9JA 5FPQA 2HU8A 4IH1A 1XROA 5CH8A 1SCKA 2OAEA 5JZBA 3GZJA 4QDZA 1E66A 1IVYA 5CMLA 2DQZA 1OILA 2XMQA 1E3QA 4OPMA 3BIWA 3G0CA 4WFKA 5IVHA 1JMKC 2CUTA 1VA5A 4C01A 2VAXA 4BATA 4UFPA 4GXNA 3MUNA 1D07A 5FUMA 2HFKA 5FP0A 4OU5A 4RNCA 2BUAA 4OB7A 5HKBA 3I2HA 1O6GA 1W4LA 3G7NA 1WHSA 4MWSA 1CQZA 4KAJA 1XZGA 2JGMA 2GZRA 4GHWA 3D4LA 3BDIA 1CFJA 2G63A 1WCYA
chains in the Genus database with same CATH superfamily
1GQSA 1TGYA 3FX2A 1KOLA 2BDEA 5D3ZA 2PA3A 3BFVA 3QVJA 4FFRA 2CXRA 4LMRA 3VJKA 5CXQA 1L8LA 3HKEB 3RUEA 3GNSA 2VP5A 1CVLA 4Z86A 3VNRA 4GW3A 1C8BA 3GR6A 4I4TF 1T6BY 5EZ5A 1NPTO 3E0XA 5DBOA 5CVUA 1H6DA 1T8WA 2B61A 2R6GA 2WG0A 3CN9A 4QYSA 2CMGA 3AJEA 3L77A 1DBIA 1SQ5A 4Y2GA 2QG4A 5BV1A 2K5UA 1MR3F 2PX2A 1GPAA 1L4NA 2C5GA 3DHEA 1E7WA 1E60A 2A9RA 3FUUA 2RG1A 4HZUB 4K6OA 2K7FA 4D56A 1YQGA 2WNSA 1Q7GA 2GZMA 1JSZA 5DHUA 4QEKA 3D8NA 1CUIA 1U2DA 3NVKI 2GUWA 2XXBA 4G37A 2Q0SA 1GFIA 4ARZB 2R751 1QV7A 1RZRA 4LHSA 4N76A 1HG0A 2A4KA 2O6LA 1GGMA 4YRKA 5JY1A 2NX2A 1V48A 1IM8A 5DGIA 2PO7A 3EXIB 3CLRC 3OPQA 2IOQA 2CDAA 3GH1A 4X1OA 3GLKA 4ZQBA 3MWGA 2IZ1A 4P08A 4LFCB 4HBGA 1ZHFA 4TZKA 1NFRA 1KO5A 5EE3A 2ZSFA 1UFQA 1R0BA 1ZRNA 2WF7A 3MFQA 2R60A 2WMOB 2Q5LA 3P96A 4Q05A 4TKUB 5JCOA 3T8YA 3FB1A 2VJMB 2WV9A 1MIOA 3ZV4A 5JNRA 3GAFA 3A2LA 5ALJA 4KUHA 1Z39A 3IT3A 3QUBA 4JC4A 2WSYB 4RJTA 3HCAA 3QW4B 1FNNA 2D4HA 2Q4OA 3AY7A 4OMUA 4RL4A 4E11A 3AHHA 3NHSA 4OK6A 3R7AA 2NO1A 1SUIA 5IT5A 5LYJB 1H0RA 3GVIA 1R6AA 2YXLA 2ZTVA 3WMGA 3PUYA 4PNPA 1JVSA 1QE5A 2FA9A 3C0KA 4CBVA 2BGJA 1NIJA 2OV1A 1U3DA 4A2QA 1ZKMA 5LB4A 1B6SA 1E3WB 4RE6A 2EEZA 4AM8A 4ENWA 2JGIA 3H1EA 1RQXA 2ZJ1A 3RV4A 5TQJA 4CKBB 4WDQA 5A5VA 2E4YA 5HK9A 2IEDA 2ATXA 3TK1A 2P6PA 2LGJA 5EJGA 1AE1A 1UBRS 1W94A 4DLZA 4OKNA 5JD5A 1PS9A 3HYCA 4X95A 4BRWA 2AF3C 5B4VA 4ETWA 2ATEA 2WAMA 3OIUA 4YRAA 1L5GB 4NKRA 5B5SA 1DBPA 3QA3E 1XUOA 1C30B 1US8A 1OX4A 2WC1A 2EZUA 5TPZA 4L4RA 5B2FA 4CEHB 2NG1A 3OQ1A 1X7ZB 4V38A 1GSHA 1T1JA 1KDPA 3L0BA 4J4HA 4CM5A 4FNOA 2Z57A 2V3WA 1HTTA 2WSSD 2C4UA 4JP5A 4UPVA 3WNBA 5K45A 3TMKA 1JDBC 3HB7A 2JAQA 2CCGA 2HI0A 1RMTA 4QXPA 1U1FA 3WXBA 3GJTA 3N05A 4O1MA 3ZVLA 4A0HA 3WC4A 4FC7A 1QKJA 1PWZA 1LK5A 4JLUA 3ER8A 5C4GB 2I4RA 4JB2A 4EF6A 5FDFA 3SR0A 3H4TA 4TSKA 4YO7A 2XTJA 3VPAA 2XMPA 4EHIA 4ZCRA 3N59A 2C00A 3X2SA 1KK1A 3BCSA 3NEPX 5C32A 1J2UA 3DFFA 4WT7A 1T5BA 1O96B 4JY7A 1PWXA 4F6RB 2ISCA 1Z75A 2Y9MB 4ESVA 1OIXA 2OG2A 5HDQA 2PUHA 1K6EA 4B31A 4PZEA 5ALTA 4GMDA 5JV5A 2CXSA 3TIFA 3N58A 2X0IA 2H00A 2BFCB 4WMLA 2XKAA 3WV5A 3KYCA 3GYGA 4R16A 1OH5A 5EJEA 1YDMA 4KQ2A 1ADGA 3FFBA 5AYVA 3ZK7A 3CPEA 3SM3A 3UMCA 3N8NA 3UJHA 1XPUA 2VBCA 4UPEA 1VG0B 4L57A 2V6JA 1H3FA 4V24A 5DTQA 4OUDB 2COUA 3TB6A 4ZFNA 1GOTA 1ZUWA 5KNLA 4MRMA 4RHCA 4TRRA 1WHTB 4EGCB 4HDKB 3K1AB 3ESZA 4WK2B 1R4NB 1UFRA 1T9GS 2CL7X 4IIHA 3W4JA 4BIIA 5A9SB 2J31A 3OX2A 3BB3A 4WXMA 1UJ4A 1P0FA 2P1DA 3L01A 3ZHOA 3PGMA 4JIGA 3RIMA 3PFNA 3HP7A 2WUVA 3N74A 2XUKA 5DGCA 3RVSA 3W8EA 4AJOA 4QGSA 1I1OA 4YTEA 5DWDA 2EZ8A 1KRWA 1PD1A 4KQXA 2DPMA 3C98A 1NP7A 5FL7A 1M6VA 5A4DA 3EVGA 3I28A 4HDAA 5EGSA 3WRVA 4CKCA 5J4HA 2CV2A 5EJIA 4Z3DA 2VSOA 4EYEA 1I7SB 3TUJC 2ZRAA 1C3JA 4W8HA 1QVWA 3UCXA 4MNTA 4PCAA 3GLTA 1K97A 3PXCX 1ZJYA 5BQXA 1C2YA 2H2WA 3KT0A 1FUIA 1HEUA 4ME6A 4QJBA 4Y6GB 3G23A 4PPFA 3AF2A 1EZ4A 3LTNC 4RKYA 4NL4H 4A2WA 4DANA 2JI7A 4KZKA 3HMQA 2GVDC 3HBJA 4H4CA 4OFWA 3QUSA 3IAM1 1BU8A 3ENNA 3LBFA 1TEXA 3FI9A 5KNDD 4UHKA 4OGWA 1ZD9A 4XDHA 2H8KA 1OT5A 5ICGA 4OLAA 2VRWA 1M2VB 2EL7A 3MOIA 5I5EA 3WK7A 2JH3A 2IHKA 3MCVA 2PWBA 1RHMA 3VTZA 5I47A 1A3CA 3BMCB 1V95A 2C5FA 2G9QA 5EJ8A 4O0MA 2PZGA 2ZRLA 4K9SA 1XPOA 4GYKA 4PSUA 4C6TB 4DWVA 1Z2OX 3TZKA 1U0SY 3FF1A 4MYTA 5DULA 3I23A 5FUVA 4MS3A 3VR5D 2CE2X 2RKBA 4Z53A 3ENKA 4MIKA 2O2EA 3KT8A 1QRDA 4O2LA 3Q3EA 5CGQB 3UH0A 4BGUA 4JQCA 2IDMA 4JH0A 4POOA 5JROA 4AZ3A 2GFIA 4RPHA 4O3MA 1U9IA 4X1YA 3OQOA 3S2FA 2BSXA 2ZUFA 3JQGA 4L4UA 1ND5A 3H2SA 4O02B 4W9NA 4XVRA 4ARBA 4CG1A 1E7QA 2R44A 3OU7A 2W2QA 4ALNA 3U3RA 2AX4A 3TFQA 3TGLA 3QSGA 2AD1A 1VLZA 1F14A 3FKSD 4Q3AA 3X1ZA 3VJRA 4NG4A 4F5WA 5JJCA 1KXZA 4BN0A 3B2EA 3S0JA 1S1CA 2ZPUA 2BKVA 2FZWA 4RD4A 1AS2A 1BIFA 3SX4A 4LF8B 1V4NA 1VKZA 3DB2A 4N03A 1AZWA 5TGZA 1EFPB 5CDUA 4F5EA 1QJ4A 1F0KA 2DT5A 4MKHA 4U2GA 2FZGA 1RQPA 4PZZA 1MNAA 5B1YA 4I50B 4PF1A 3M7IA 2RGAA 4PS1A 3GC6A 4KXWA 1ZAKA 5DM0A 3DLTA 4ZWNA 4F72A 1OLUA 5FOQA 1VIMA 5LU8A 1V5WA 1Z0DA 2FSFA 3ANSA 2MOKA 3I8XA 4CEHA 3K31A 3AG6A 3IP1A 3ROEA 5B7NA 3FYUB 3RIYA 1XRLA 1UPTA 1RXUA 4ZYVA 2YNMD 3ZE9A 4BFYA 4ZANA 2XDWA 1RJ9B 2JLVA 3I6ZA 1T4GA 1U3WA 3E8MA 2H31A 4JYCA 3TW4A 1K7YA 5FJIA 5DMXA 1DAFA 1R5OA 4G5XA 3WAKA 1CEEA 1ORIA 1W2GA 2DFKB 1GTL1 4EJFA 4CKEB 3BA6A 1I5EA 4X61A 1U0BB 1X7YB 3JD2A 2CK3D 3INYA 4YRIA 2WTBA 2BKXA 4NE7A 5JJ5A 1JIVA 3GEEA 1YUMA 3DFMA 1JP7A 1FX0A 1QONA 3OJXA 5DHPA 5T4BA 2QX9A 5IABA 2BE9A 3D4OA 1J20A 3OU6A 3TDMA 5BORA 1VJ5A 2ECQA 4O4LB 4U63A 2UUAB 4GI3A 3FZYA 4MCHA 1EGVB 3BIJA 4IHJB 3AONB 3EH2A 2G7MC 3V4ZA 1AZLA 5E38A 5IBQA 4DV1B 5JNLA 5IASA 1FFBA 3EQZA 2ZB8A 1AHNA 3K6SB 3IVCA 4ND3A 1ZNWA 4URHA 1B8UA 4NABA 1NRXA 4ZA2A 3R6DA 4E2WA 3QEAZ 1E1DA 4GWGA 2Z5GA 2FG6C 1R7RA 1GZ7A 4XIYA 2JA2A 2HUNA 4KTVE 2DCUA 4UQPA 3W2GA 2A0KA 1AU9A 3EMVA 1I80A 1JAHA 2CBZA 4K2AA 2GHRA 1H65A 1BKYA 4JOQA 2GRAA 2XTMA 3E1SA 1S2OA 2FX5A 1DQPA 3NWJA 4YP0A 4YK7A 4X62B 1Y8QB 3WS7A 5COBA 5JAZA 3I2GA 1WXXA 2WWFA 1IWOA 3CNEA 3EOZA 1NPDA 1M2FA 2ZU0C 3LY8A 3GG9A 2QP9X 4AO7A 2C57A 3Q87B 1VGRA 1T9BA 4M7WA 4NZOA 2ZUDA 5FA5A 5EKXA 5D00A 4A82A 2JGDA 3EMBA 2VPTA 1R8YA 1N25A 3HA2A 3T94A 3CWQA 6ADHA 4IOJA 3FWZA 3HZRA 4LIPD 1ZN8A 1NN1A 2ZUWA 4NH0A 1N1GA 3VDRA 1L3CA 1UDWA 2IOFA 1Z6ZA 4HH4A 1T1SA 2Q3BA 1VTKA 4TM7A 2NUTA 2W2LD 1BH6A 1DKNA 2FPRA 4L1KA 4Y6PA 3FGPA 1YT5A 1RAIA 2A0FA 5JEDA 2GEVA 1GXSA 1UDBA 4XIIA 1KK2A 1AQUA 2BE7A 4RA9A 5EIAA 5IF3A 4G65A 3PDWA 2DLCX 1ORHA 2GLTA 4LZWA 5FJJA 2L42A 4D4IA 2C4MA 3D0OA 4PPGA 1KMHA 3LF1A 1E4YA 1U7PA 1QFJA 3CUUA 1FFCA 4QAQA 4HLUA 4X7PA 3RK1A 1JG2A 3SIPA 2GTIA 3PK0A 5LD2B 4KC0A 1L1QA 1C1HA 1XZKA 2A4MA 3LLVA 1XTBA 5LP1A 1VB5A 2CY0A 4EUKA 4OHXA 1K8ZB 5LB2A 4ND6A 5JD6A 1DTEA 2PXXA 1QG0A 1WUJS 4GKBA 2H63A 1NJFA 3BJMA 3JQQA 2DFLA 3OCJA 3QKTA 1E1MA 1NFQA 3PNOA 3HEBA 4YC7A 4R6WA 5DI9A 4X6UA 1XK6A 2AJCA 5CVTA 2LW7A 4FEYA 5KS2A 3K6RA 2JD1A 5J2TA 4FFSA 1D0IA 3K9CA 3U3DA 1S2IA 2UAGA 2W6JD 4DCNA 3Q72A 5IULC 2O1SA 2W70A 4NEHB 1BXZA 2KS6A 3JQDA 4IO0A 5D85A 3SOPA 3ZY2A 5AIBA 1JEQA 2XNDD 4Q21A 2WTEA 3ZH2A 1ESMA 1XRPA 1G7SA 2ZSUA 4JU8A 2J09A 3TYXA 2IHUA 4C7BA 1GITA 4JR0A 4CM9D 3MJDA 1FSGA 1XCMA 3L46A 2I80A 4P5PA 3RFXA 4BX2A 4PS0A 5BMVA 1E98A 4YLYA 5KX5A 2DSNA 1PX2A 4I1OA 1CRQA 3AHDA 1YL7A 3DL0A 3F1KA 4GOKA 2SKDA 1WEKA 2GEJA 3WLOA 1K6MA 4W5TA 2BZGA 2WJPA 1P2FA 5ALRA 5FTNA 3TW8A 4CKZA 3COJA 3ERCA 3IOEA 5DCYA 4PN3A 2ZKIA 3A6DA 5ALOA 3BB1A 2HLDA 5AJTA 5GVSA 3CXUA 1PEAA 3TLYA 5K8LA 1Q16A 3L8YA 3M6XA 1F3OA 4ZVSA 4WXPA 4RS3A 2R2GA 3UG6A 4UXJA 3ESAA 4Z0NA 1Q44A 1MVNA 1U94A 2W2TA 3P4XA 3QWHA 3QXCA 3TLBA 3WNDA 3WYCA 2QF7A 4Q9HA 5BWBA 2D1RA 1NN0A 3LG2A 4PAOA 3VVLA 3I83A 3AW9A 5EWLB 5K0TA 4Q37A 2P90A 1UWCA 2BD0A 2HOQA 1MP0A 3GMDA 5CYFA 3KK0A 3ETLA 3IHTA 1IZ0A 4ZK2A 1QHHA 3JVDA 2AW5A 3SG0A 3TZ6A 4CM1A 5BPHA 5KOYA 3LVFO 1I7QB 1D3AA 3TR6A 1FDVA 5ADVA 3EEQA 2YY7A 3O8NA 4KO8A 3K0HA 3BKXA 3S55A 3BGVA 3S70A 5BUQA 1LPBB 5CDGA 5JXWA 5KWSA 3V8VA 1YA6A 3K9QO 2QMZA 3B3FA 5FPSA 4YUXA 5DBHX 5DKFA 1Z4JA 1KI6B 3WJ7A 5ITVA 1U7XA 2ODNA 1HTWA 4BMXA 1GCAA 2JIMA 4GR4A 4AK9A 1QPZA 3WLAA 2Q6TA 2ZUBA 3K1TA 4HT3B 1G8PA 4DMUB 1P7ZA 4LZNA 1B0UA 2AYZA 2RIRA 1T1EA 2ORVA 3QMPA 4FT2A 1YS6A 4FIZA 4RKFA 2IUYA 3NASA 4H7PA 1CJSA 2W90A 4LC0A 4MCIA 3VPFA 1NKVA 1HEYA 2ZUVA 1ID1A 4EMUA 4KWCA 1YR1A 1Z2DA 1RC1A 1UJNA 2OORA 4H3SA 4A8JC 1AQYA 1KMNA 2R25B 4J0IA 3ZU3A 2JVKA 5H4GA 2QPTA 4DV3B 4MUHA 2P78A 3KTFA 2FQYA 2Z6UA 4I6GA 3M3DA 1NFFA 4RJJA 2H2IA 3JWJA 4YRZA 4EB0A 3STTA 1CRZA 2WJHA 3KV3O 4RA6B 1CFZA 1JLLB 3SIWA 2ID9A 2QJRA 3ZGYA 3B9BA 5JYDA 1OBOA 3IB3A 4P4TA 4KZPA 1T25A 5DNYB 4XDYA 1Z5WA 5MDHA 3MCAA 3BK2A 3MGAA 3PUZA 2F9FA 4AG6A 1FTQA 1COZA 2JIRA 3KB6A 2A0XA 5EP2A 2QT9A 3UBMA 1JA0A 2O2HA 5EHZA 5JARA 5K99A 5AVWA 3RNLA 3F5DA 3M8KA 5DCLA 4XYMA 3ZWNA 3GVCA 4HR7A 2WJVA 1A2KC 1DFIA 4PLWA 3WZ2A 1DC3A 3GA7A 2Q6OA 4GWKA 5DX0A 1EDOA 1YS1X 1IAVA 1U6IA 3BJIC 3ZXIA 5LU9A 1DARA 3GOQA 3OH8A 3CR8A 1LLDA 3K20A 5M29A 4TL9A 1U7DA 4YJHB 4FW8A 2PLRA 4U7HA 4DKXA 3KXLA 5A0FA 3NDBB 4UTOA 4ZOBA 3AIOA 1UPXA 1C9EA 1WZCA 3Q3VA 5EWJA 3HCEA 1V2HE 4NMMA 3NTOA 1CETA 4EO9A 4K6HA 2PUJA 4X24A 2B1QA 1ILWA 1KBOA 3TEJA 5GONA 5J43A 4XYBA 3ZC3A 2NWQA 2Q4DA 4JROA 4K26A 2D59A 4LRWA 1XWFA 3DKIA 1Z28A 3EZFA 4LCBA 4ANFA 3THYA 1I51A 3F6PA 3KHKA 5DM2A 2RHCA 4OXXA 1I9CA 2WZQA 2AW3A 3ZEAA 4PGAA 2XPCA 2FP3A 4IWNA 4CF6A 3O91A 4UHFA 3AR6A 1B14A 1OLXA 1SKYE 2DFVA 3D7KA 1SKYB 4XPIB 1X77A 1J70A 2RAUA 3M6MD 2HSJA 3PHIA 2GILA 2UZIR 2EHDA 4JBNA 1W5FA 3VNAA 5BVGA 1WNFA 1CVIA 1E6KA 3OLCX 3ZHRA 2DKFA 2YJ3A 1SZJG 3HRKA 4GP7A 3UV7A 1KZGB 2FLWA 3KFVA 3LX6A 1ZOSA 4WZ6A 3MELA 3JQAD 3KQOA 1MT3A 4FYMA 3ODGA 4XCQA 3U5ZB 4XRGA 3ROXA 3KBBA 3QOWA 3SKVA 4NJEA 2PEYA 2RB4A 4ZYUA 1O95C 1NJGA 4EFDA 3IIKA 1V3TA 2BFDA 2XCOA 4FN5A 2XDQB 1SUCA 4Y2YA 2O1EA 1YC5A 3AF1A 3G8BA 3VU1A 4AC9A 4LGMA 2Z30A 2PH3A 5ICSA 5AVKA 4WBNF 1K98A 3LQ2A 4FZJA 4DDVA 1NSTA 4WNAA 2G0NA 5EC8A 5KJ6A 4IIJF 1J2TA 2YXBA 4K6CA 1EH5A 1TIBA 3H83A 2UVQA 4FONA 1FNSA 2D5BA 3LGXA 1PJAA 2PWPA 3RT7A 5JW6A 1G21A 1H1LB 4GX1A 2H85A 2X0KA 4QU8A 4G5RA 4UHEA 3JALB 2XQKA 4KIGA 3T06B 4V1CI 2YWJA 4W9RA 4R69A 1OSNA 1P72A 2FWMX 2QT1A 2TMGA 2ZIXB 4RM2A 2G5GX 4EAAA 4B73A 2PEZA 3BL6A 3RODA 2HK8A 1EVLA 1N75A 2A3NA 3QJ5A 3JPYA 2JAWA 4FGLA 4UNPA 2FG5A 1JKXA 1NW9B 3ZXXA 4AS1A 4DAOA 1GAWA 5KQRA 3M0EA 3GELA 3OCYA 3VYRB 3G0DA 4LTDA 5AOCA 3WISA 3FMPB 2PKQP 4AL4A 1JLHA 2IOFK 4BV2A 4CI0B 3NJRA 4HCJA 1ZM7A 2BFFB 3FTPA 3PRJA 2HCTA 3B8EA 3GDGA 1CUAA 1T2NA 1XI2A 1ZEMA 3RU9A 1DFHA 1OLSA 3SZRA 3GWZA 2OBNA 3F74A 3H6HA 4LYDA 1ZS9A 3IFSA 3H42B 2ZJBA 3AR9A 2RGGA 3Q2KA 5B1DA 5KNBD 2B5WA 4EHFA 2UKDA 4QT4A 4GL2A 1H6BA 1L7QA 2I1QA 1T2AA 4H0FA 4YREA 3RGWS 1ECCA 3B89A 2PG3A 2A7QA 1IOWA 3H19A 3I9JA 4AROA 1PLJA 3PDIB 1EJ2A 1VE1A 2WM8A 3U60B 1MN6A 5LQNA 2RARA 1WRBA 4B6SA 3MCZA 1KWKA 1T91A 5ER9A 4IV5A 4BFTA 2LPMA 1ZWLA 5BQOA 1EBUA 3AUFA 4C07A 4PAWA 1JJ7A 1VLJA 3H8WA 4GQIA 5EE9A 1TQ4A 3OTWA 4EUHA 1G1AA 2GPTA 3HZOA 2JPDA 3UV6A 4K8OA 3V2IA 2VVTA 3I6BA 3ZWQA 1RTTA 1XDZA 1QF6A 5CCDA 2V9CA 2CLFB 1M8JA 4FS8A 3TLGB 3UMFA 4BBJA 2F3RA 4REQA 2IZ6A 4HP8A 4UBKA 3UHOA 2MR5A 2DH5A 2VUHB 1NN3A 2ZWPA 1E5TA 3A1UA 5JANA 5EYPA 3KZKA 2C5BA 4DJDC 2X3UA 2X7JA 1UKYA 4JBGA 2AJLI 4IDQA 4K05A 3ITEA 4KMSA 4ONEA 1XD2A 2JATA 2VBIA 3BHNA 1V11A 2Z83A 4J0FA 4MUJA 3IQZA 3KSBC 5B64A 2Z4RA 3FSGD 1ZD4A 2A1TR 2AZ4A 3G13A 4MQFB 4Z9AA 3T54A 4F4HA 5KU1A 3A6FA 2IDKA 1V8ZA 5D84A 5GQSA 4LY0A 3VHLB 1Z8FA 3L93A 4O4HA 4DB2A 1S02A 3THXA 2NZUG 4FCTA 5SZJA 4KDEA 4BTVA 3U13A 3WMXA 4IILA 4WPGA 3AZQA 3PSHA 5A1JA 2F8SA 2XWPA 4LHVA 1DLIA 2XUQA 2H1VA 3H1GA 3PITA 1Z6AA 3RIXA 1ABFA 3AQIA 3PT5A 1PBNA 4MVWA 3X2EA 1V2GA 4U9IS 4ARSA 1QH1B 4RTOA 5FNVB 1T0HB 1TDJA 1GNSA 1IONA 4TXJA 5DOZA 4DLTA 3KLOA 5FBVB 4O5OA 1PCXA 1MEOA 1JLRA 1I8TA 1OYYA 4KVFA 4MRAA 2V4ZA 521PA 3U4AA 5B7PA 1WOMA 4J29A 4EB3A 4KREA 1FP1D 1U7ZA 4BE7B 2YYZA 1Y8RA 2AH5A 1YR7A 1JE0A 1GLVA 3KVOA 1G63A 2CNLA 1Y3FE 2C2WA 3W34A 3KOOA 4D0RA 4DR5B 3GHYA 2Q2NA 3EZ9A 4MUGA 4RZXA 3ZYZA 3D8BA 1F60A 2NV0A 1UAGA 3JQ7A 4K81B 1ATIA 2V4UA 1QRUA 2HLHA 3GBVA 5IT4A 2ECOA 4A8TA 4DHWA 1UJ2A 4O2AA 1F17A 2NTVA 5TRTA 3F0TA 3IA7A 4PPNA 3PNBA 1F20A 3C7AA 4KQHA 3A31A 2IWRA 2A84A 1G9TA 3JASA 5K0CA 4WQMA 4LDPA 4JFRA 2VT7A 4L7QA 5A4AA 1CB7A 5EP4A 2O0MA 3U4QB 3OJWA 1THGA 3UT5B 3DLHA 2HW8A 1X86B 2H1FA 4JBYA 1EFRA 2WAOA 4P58A 1J0CA 4GECA 4HFJA 1SKAA 1SHUX 4M0MA 5IYZF 3F7MA 3TFWA 4BQPA 5IAAA 1RS0A 4HJXA 1ZD2P 1UK9A 1KI9A 2QK4A 2X9GA 3FCYA 4YAFA 4EJSB 3F78A 4FB4A 5LDGA 1ISHA 1SVOA 1HDGO 3R7NA 4BB6A 1ZZEA 2JFQA 3C15C 1G1MA 1DZ3A 4NSNA 4BLQA 1J24A 1VXRA 1H2YA 4WJZA 5DBEX 2HN9A 5KNDH 4IF6A 1OFUX 4BLUA 5ENZA 1H69A 4L8FA 3N7UA 1NHGA 1W5SA 4GRDA 2GYVA 4NC9A 3Q0EA 2OLKA 3W5HA 4Z4HA 2CSUA 4RZIA 3HJBA 3PNMA 2A2ZA 3LHFA 1PJCA 4JOSA 4AZTA 3FNIA 4GPAA 2PGLA 3LDAA 3P4UA 1QH8A 2FWJA 3WP0A 3HGMA 3IDSA 3R6TA 4AXXA 4NOJA 3RF7A 5K6AA 2EWVA 2JK1A 4BFZA 1A97A 4I3FA 1JKJA 2EIHA 4NI5A 3O7WA 5E95A 9ATCA 2LCIA 3VR5H 3TVDA 3L8FA 4E94A 5H3CA 1XTKA 3B2NA 1PDWA 2YC4C 3FSEA 3G2IA 1HDEA 3C8HA 5HDBB 1DAHA 2YJ5A 5KVQA 3PG5A 5EMMA 3EODA 3HJUA 3QPBA 3V1UA 1ZMOA 2WSLA 4KR7A 2WJIA 3ROFA 3WBJA 4DIMA 1NVAA 3I3OA 1FRVA 3N2KA 1ECBA 3NIDB 2WIJA 4FMCF 4ALJA 3U9LA 2BC9A 3JYNA 3K0CC 2P41A 1TRKA 2H5IA 5E9AA 4Z49A 3N9IA 3NOXA 4RDHA 3HB1A 3KVNA 1NIPA 3WB2A 3V8QA 1U0RA 2DKNA 4OMFG 1QS0B 1GZHB 3A32A 4G0PA 5H68A 1UMBA 1WL8A 1IU9A 1RRVA 2RSLA 1PSWA 3F5MA 3FDJA 1OF1A 4X7MA 4JI0B 4HUQA 2AK2A 4QLBA 5C80A 5LZ2A 1R0SA 3DS8A 3O2NA 4YX9A 1MGOA 1GN8A 4CVNA 3N0VA 1L5SA 3O4JA 4L9RA 1QCCA 3ACBA 1QKIA 1RKBA 1YI8A 3QZUA 4D3XA 4E3ZA 4MVJI 3KXPA 4EL5A 2CLHB 4BX8A 3PLNA 2QAIA 3IIIA 1C9KA 4DCGA 3ZX4A 3RE1A 3DFKA 1QVAA 1MJGA 3GD7A 1H4TA 3H2IA 1OFVA 2JDID 2C9CA 2HY7A 2A58A 5DGDA 4PLPA 2HLPA 3B85A 3OA0A 4NV3A 5J1TB 2VXYA 2V6FA 5HE9A 1NBME 2BGWA 3GJ0A 4KBGA 3DUFB 4WOPA 5L40A 5P21A 3VU9B 3ICEA 1N0UA 4W5RA 3N76A 3CRZA 2LVBA 1JPUA 1T8UA 3LUPA 3JQFC 3QLJA 1AA6A 1I5RA 3MINA 2EJTA 2C4WA 2G5PA 2AHRA 2I2AA 3M2TA 3I9KA 1LH0A 1T5DX 3OQVA 3QTLA 2VDNB 4QASA 3KOZA 4R2HA 3FDZB 4RDIA 1YJ5A 5ALZA 5EIXA 4IEFB 4L4XA 4KHZA 1P75A 4TYQA 1NXQA 2GUGA 5ANRB 4YPOA 1ZONA 1GHTA 2G80A 4MLDA 3TMAA 2O59A 3FOCA 5B4TA 1IDN1 3DVAB 5CIYA 1KAOA 1PKXA 1KOFA 3ANNA 4MV4A 4PBSA 5EJ9A 3TNFA 4B3FX 4UM5A 5J2UF 3LLSA 1IZZA 1NVDA 1M33A 2OCXA 3I4FA 1V96A 4ZPJA 4QOJA 4DBLE 3T61A 3NXSA 1GTMA 4KSBA 1DBRA 1XQ1A 5BNFA 5LXTA 3PPYA 1THZA 5A2QA 1GILA 1FF9A 4O25A 2G8LA 2H1WA 1E99A 1Q12A 3PR3A 1OI2A 3I42A 1I1HA 4DDTA 2YFYA 5BN5A 4KWHA 4HFMA 4HL6A 2XWSA 2XJ4A 4Y1FA 4COKA 1IC6A 3TLCA 4YACA 2XVAA 1YVUA 3A4NA 4Z7QB 3V7UA 1HQKA 3IAM6 4GX5A 2QTZA 4L9SA 4OSPA 5K51A 3U62A 1KTVA 3E9RA 5LLTA 1N8KA 3KX2A 1SNYA 1KI7A 2O50A 3STVA 5FORA 4I1UA 4IVQA 4NLLA 3DAHA 2W6QA 3OWXA 1X80B 2V0NA 2WSSA 4MVYA 3TZCA 4B1FA 4QPPA 2P67A 1W4RA 4MWZA 1SEPA 3LO8A 4O1IA 5E1OA 1FUYB 3DJYA 4KX3A 1NBOA 4GLBA 5DW0A 4PYKA 1D2GA 4M0CA 2OZKA 5HF5A 3RLFA 1P1JA 1TJ3A 4Q34A 3R76A 3D02A 5L6LB 2BEUB 3QOXA 4JLKA 3H2KA 4NU0A 1ZN2A 1FU7A 3HKBA 1TRHA 4WWHA 2XV1A 2JFFA 3ZVNA 2HQSA 2DBVO 2W8BA 2Z1MA 2IPLA 4JXXA 4JJ4A 4JODA 3SX2A 3WGJA 5K01A 3B8HA 4BFCA 3U81A 4D3ZA 3NX4A 3Q5EA 1U2RA 2GI4A 1E0DA 1U9IC 1JFRA 3ZCTA 1KO1A 2YC2C 1XU9A 4HLDA 4WZBE 3KTAA 4WZBB 4IDBA 3EFOA 1O97C 2O0HA 1NUSA 5DB4A 1A5BB 2HHCA 3CE9A 2V9ZA 3O03A 4IJUA 4P3YA 5GZ6A 3RUHA 1ECFA 1XVVA 1GLGA 4FFBB 4R54A 4BV9A 2Z8ZA 1QP4A 1Y7HA 2B5OA 2IRWA 4GI1A 5F3WB 2HWWA 1JAIA 1DUSA 2Q6VA 3G79A 1QRTA 3ZD6A 1VHQA 1JTVA 2Y1LA 2BSQA 2GZAA 3ZHTA 2P9TA 3REQA 4BRSA 1EU1A 3TXYA 2POQX 1ADCA 1RRFA 2ZJ0A 5AW1A 3PX7A 4MRVA 3W05A 1Y4SA 2LIPA 4UM9D 2LIVA 3OO0A 4J1NA 1WKBA 1PTKA 1XU7A 2ADOA 2G09A 5FLEX 1K6XA 1J8VA 2EJVA 4QYIA 3W79A 4F3RA 3AL2A 3T9BA 3OCZA 2ETVA 2O7RA 4Q00A 4ZAWA 4N7RA 2BMJA 4U8GA 1H93A 4TVOA 5TF0A 3HKCB 3TUZC 2WJAA 4KIUA 3T34A 1T35A 2GTPA 3OTHA 4KJZA 4PO1A 3FYDA 2P9HA 3AGQA 4ED9A 1SWWA 3T5AA 3OQHA 2J3QA 3UKOA 2AMFA 1V6AA 2HYIC 1D7OA 1DRKA 1BRMA 3OX3A 5CEFA 4L0CA 2EYQA 2AN5A 3K32A 1GV0A 1J22A 1JPNA 2CFTA 4Y6SA 1UP7A 1R4ZA 4A0SA 1JVBA 2WUFA 3ENZA 2HSEA 3BIFA 1DCFA 1T3HA 1USGA 1ESZA 2BLLA 1W85B 4Y7DA 5JSZB 2H4FA 4CLOB 1DNPA 2XMDA 1NQVA 1FRNA 2E21A 1E1CA 3Q8XB 4Q4JA 4QSMA 4S1OA 3FHLA 4JZKA 3CZMA 5HIJA 4PIPA 3V6MA 4AY4A 2PGJA 4JJIA 3KKNA 2GZ2A 2OV6A 4MJ7A 4BNZA 3FPHA 4UHCA 4BL5A 2IX3A 2DXIA 3NB0A 3CLSC 3BXHA 3O8OA 3R8FA 3CHYA 4HYTA 3OJEA 4ZT2A 1XXLA 4IJMA 2XY4A 1CIPA 3GRRA 1BVRA 3NKLA 1XEAA 3JQ9A 3OU2A 4QU0A 4CGZA 1SQSA 2G4VA 3D6JA 3EN0A 4HWPA 5I7FA 1HKHA 1KKUA 1XVIA 4YPFA 2UZ4A 1MNQA 3B52X 4RK5A 4R7TA 1QG6A 4MP3A 4TN5A 1DJOA 2HIHA 1GQFA 3CSDA 3P2JA 2G70A 3KUXA 1SVUA 2ZVPX 1EKXA 2H16A 4K9PA 3MWYW 4EW6A 2J0VA 5ICMA 1CHNA 2XYQA 3PSAA 2W2OA 1NBHA 1U5BB 4RM3A 4JLJA 3DP7A 2J5XA 2C8KA 2O14A 3MUFA 3K9FC 4X60A 5H81A 1NC1A 3SX0A 1N7GA 4KYIB 2PX0A 4L07A 1E8NA 4JQZA 2G0AA 5HZKA 2IS6A 2WTNA 3RTCA 4OX9Y 1A2BA 5HS6A 5LOVA 5AHRA 3FJYA 3H4VA 2Q4TA 1ZD1A 4XVUA 3TLMA 2GK4A 2MHCA 3UFBA 1FP6A 3BWDD 4HGNA 2EJBA 4OBEA 2QZZA 4OFZA 3FKSA 1WDMA 3MXTA 2JJ2D 1TAHA 3AEUA 4WY5A 4E4RA 5TQ0A 3TSCA 3FFXA 5G1PA 1S8FA 2VEDA 2KYRA 2IYAA 3GLSA 1VL1A 1A5TA 4G4SO 4HYQA 4D3YA 4FNGA 1XZIA 3GBPA 1C14A 1S9HA 4PRKA 3Q12A 5IG2A 2DR3A 3GN2A 1EUDB 3ES9A 4EB6A 1X1TA 4OO3A 1AF7A 1JYSA 1QNLA 5TQVA 4RFSA 4WLUA 4BNXA 5KTRA 2JFHA 3V2UA 1KI3A 2EV9A 1U2GC 1TQ2A 4EKNB 3NCHA 5AVXA 1GQOA 3PEWA 4ZMRA 5CBKA 2ZRPA 1KS9A 1JAXA 4PG8A 4GC5A 2YNMA 2J48A 3PFBA 5DYIA 3OAAA 4LGCA 2P6RA 5BN3A 3SBEA 1NI3A 2WVJA 3HLKA 1Y1LA 4Q93A 3NR2A 3ZBPA 3NDJA 3C3PA 3KOXA 4XI9A 3TO5A 3MW8A 1V9LA 4QWWA 1GTJ1 2A5JA 4AF6A 1OX5A 1BWQA 2UZ1B 3EUAA 1BEZA 5D5PA 3BOSA 1AKNA 4LY9A 5GTDA 1DSSG 4NFYA 4YH1A 3WE7A 4ZN6A 1GQQA 1RD4A 4HQ6A 1OB2A 1XWWA 1KEUA 1U0OC 4HDMB 2FN8A 5L4NA 4B8WA 1QK5A 6NULA 2BPOA 3D8TA 4C4SA 4J1TC 5HGXA 5A7HA 4N8DA 3SKYA 2O8BB 2X40A 2F3UA 2W2KB 3HJGA 2QQ5A 1D03A 1NXTA 3BEOA 4D8XA 4ZDJA 3AX6A 3D43A 2FW8A 2AZTA 2C59A 2GASA 1GKLA 1GDDA 3CR7A 1G55A 2ZQZA 4ZKEA 3DQPA 2GHIA 2QTWB 5BR4A 5LP6C 3R7DA 1L4GA 1ULTA 2SBTA 4MK4A 4F3CA 5KVVA 5L3VA 1U31A 3NOOA 4KK3A 5TPWB 1S3GA 2XQGA 1AMNA 2OXRA 1TAUA 4Y0AA 2IEYA 4KPEC 4CV0A 1SUPA 2R6FA 5CDYA 1TM2A 2HBQA 1I10A 4JBLA 2AOXA 1PFGA 2Z9CA 4PLZA 4Q0MA 4L0DA 4QUJA 3ZZMA 3HJRA 4TL6A 3KXDA 3Q7TA 3I32A 3IV7A 2EFDB 2RK6A 3JD0A 1EX9A 1OAKA 4TXLA 3KYBA 1A8UA 5I9SA 2GN0A 4BVFA 3GUHA 4G56A 4U3JB 1L7BA 1XO1A 2IA5A 1U3VA 2JFYA 2RK4A 1II0A 1YB5A 3ADKA 4N0MA 1E9DA 5AI4A 3R44A 2EYUA 2QI9C 4P0PB 1FDOA 5C5EA 2NGRA 2BY4A 3BH7A 1JA1A 4XQ9A 4JMLA 4OY3A 5FIUA 2OSBA 4NS4A 3GJZA 3KTOA 2N1MA 4EHBA 3C16C 2YZGA 1FLAA 3ER9A 3PEFA 4I4LA 1G20A 4V0NA 4P7KA 5LSAA 4YI3A 5JDIA 1DC7A 5IUJC 4CEJA 4WXYB 1GUAA 3O6VA 2PH7A 5ILGA 3O8CA 2OHXA 3FUWA 5KC9A 4ON9A 1GSOA 3UM9A 4LV6A 3UGJA 1XD8A 1X39A 3DVQX 3JQ8B 4NCIA 4RCVA 2ORYA 3H9QA 1JJAA 1N6NA 4G5HA 1ODSA 1GTSA 2XDYA 1T9AA 2YDYA 3ZGZA 1SCAA 2NVUA 1JBQA 4B6EA 4MQ5A 2FRVA 1OGJA 2DB3A 4QDTA 2H59A 3SLRA 1XRQA 4ENVA 1K4YA 4RJKA 2AUMA 1UK8A 4J49A 4P4SA 1KJQA 1ISSA 1RWWA 2WHPB 4LJ6A 4YUVA 5FB3A 2P3OA 4RV5A 1XGKA 3GDWA 4IRUB 1TM4E 2ZSIA 4HGRA 3VISA 2L82A 2F2TA 2ZYUX 1OXKB 4JR1A 3W7BA 1R10A 3L79A 4J0JA 1NW3A 2ACWA 3OTIA 3V8PA 5HZGA 3CMMA 3PUKA 4RSHA 3PT9A 1Q7TA 3H5NA 5FI5A 1ZHOA 3UK0A 3BDAA 1DWUA 5EIBD 3D7NA 3FPEA 3RTBA 3HY4A 1AV6A 3M3PA 5B53A 1EYZA 3SJZA 3MK31 4BP9A 1HV8A 1ST2A 1SC9A 2FEPA 4CM9A 1JQDA 1FDSA 2K4MA 1O5IA 5SZKB 1I3NA 4HVAA 1CY6A 1ESNA 4Y1GA 3STUA 1NJSA 3NBMA 3UA4A 3PFHA 2X58A 1JAZA 1PE0A 4ZGWA 1JG4A 1JEDA 4MKIA 1TVMA 3CNOA 2XGSA 3PL5A 5IM4A 3DV9A 4UOQA 2VXBA 2DOKA 5ESRA 5KTSA 4C5CA 4BKQA 3HDTA 3WKBA 4AKGA 1SG6A 4NEGA 3E9DA 2GFHA 3R41A 3VO9A 2PA0A 1C3EA 2AOVA 1SZCA 2I33A 4P3XA 1IG3A 3WZLA 4MV7A 5ALVA 4FYHA 1MXFA 1UXHA 1BN6A 1CUZA 5M34A 1M5RA 1HEIA 2Y1FA 4JBHA 4PHHA 1KH3A 3DTVB 3M83A 4IINA 5E1MA 2OXIA 3OE7D 3NUQA 3IESA 1AT1A 1Z12A 2Y67A 2QE7A 2WWIA 3RRMA 1BDBA 1NQOA 4TSRA 4UULA 4DJJA 5AW5A 4RMJA 4HJRA 3HYTA 4QYXA 4E5SA 3GVXA 1L5YA 3HYLA 3RVBA 2YJNA 2DQYA 3NHZA 1JDTA 4C4RA 5JAMA 1I6KA 3DBLA 1TW2A 3ZJ5A 1W36D 2F48A 5AHOA 2AMYA 5CLIA 3ZD9A 1EUYA 3B51X 3TIGA 3EIFA 2ZYTX 3DOJA 1X1RA 4I9GA 4CUKA 2OV4A 1W76A 3HHEA 2CJXA 1DUIA 1CK4A 4YWJA 4Z7NB 1Z88A 4JLWA 3CR3C 5T5QA 2HBYA 3DOOA 1P8AA 5IW8A 3G2OA 3IQDB 4KQMA 4XM1A 2HDWA 4K2HA 1PKEA 3I9LA 1AA9A 1L5QA 1KKMA 3LT2A 3ZBQA 1QC5A 1F8GA 2M98A 4NENA 1YKSA 2ZRDA 1WE2A 2AFIE 2RHGB 1V5GA 2AFIB 3G9UA 2O2GA 4ZDKA 3BWVA 4JJ8A 4FOOA 4G0QA 2QW1A 1LQ2A 2ON6A 3IEMA 2CJPA 3TLAA 1DC6A 3PZBA 4AULA 1AUPA 3DDUA 3VO1A 2HJVA 2HT6A 2R6ZA 2YWHA 3DAGA 4HOYA 5E4JA 2H5EA 4DDUA 3E8XA 5AW7A 3DV0B 1Z25A 4BQSA 3H5IA 4QPJC 2Y3IA 4YRRA 5DPMA 3RWMB 3UJAA 3ZNPA 1P2GA 1QGZA 2X0FA 4AG5A 5KQSA 4YAUA 4P3PA 3DULA 1FU4A 2JLSA 2XADA 5GWXA 5IC6A 3ZIAD 5E3HA 1AD2A 2MSWA 1QHNA 2E2WA 2H54A 1EDZA 4O5AA 3CCBA 3F97A 3QI7A 2DTDA 2I3AA 5F73A 1M1ZA 4UJ5A 4XDZA 4YDSA 2ZU6A 3N2GB 1JW9B 5J63A 5FBQB 4HEHA 4R2MA 3ROGA 1N0WA 1DDOA 2YR0A 4RQTA 2Q9BA 4NPHA 2RDMA 5IKXA 4QXOA 4ZCQA 2OCBA 1AQ6A 1OFIA 4L8YA 3IP5A 4HNAB 3IVRA 4G24A 2ZSHA 1CE8B 4GVXA 4ALMA 2OTCA 3I6QA 1RYMA 2GX6A 2C8VA 4K1XA 3KZNA 2Q3HA 3WGKA 4RENA 4N47A 4BNDA 1AG9A 1MEJA 3RRBA 4UNSA 3BBPA 1NMYA 2XMGA 3ZUPA 3IIJA 1RYNA 4U2EA 3CLVA 2CVPA 3HDGA 2XBUA 3BL5A 4I14A 1FNDA 2W2PA 4IZ6A 3T3GA 3WLSA 1PYDA 1LF5A 2OLEA 2HA7A 4JJFA 3FMIA 1YQTA 2QRPA 4IUDS 3M49A 3OLQA 4BMPB 4RK4A 1CZOA 2AEJA 2FRDA 2WF6A 4DAEA 4EJ2A 1YB2A 4YJ3B 4XSHA 3GCDA 2VUSA 1DEKA 1QIKA 5BT8A 1T1IA 5AFSA 4RTSA 1RW4A 4FEEA 4QRDA 1T5HX 4DSAA 5CM8B 5K9ZA 3P94A 4LJ9A 4R8KA 5CLLA 3CVVA 2WPNA 2P30A 5K4HA 1RFGE 5EZ6B 3EGWA 1VBFA 3CLUC 3HFGA 1G59A 2JIBA 3QUCA 2GFQA 3M6UA 2AGVA 3BSWA 1I32A 4KFSA 3GRKA 5ESWA 3U19A 2R00A 1DTSA 4GNKA 4F9EA 5KYUB 1EVZA 1TTQB 1R6TA 2QJWA 3HDHA 5I51A 1G5TA 4H7EA 2J3KA 5LQSA 2VIIA 2P62A 3E22A 2WG1A 3JQAA 2C2YA 3E4DA 4O2BB 3O75A 2PBRA 4XJSA 3NI2A 3UB3A 4F4JA 1NU6A 4S1PA 1EFVB 2YBDA 2ZTHA 4KN9S 5HFJA 2VQ6A 2QYTA 3RWOA 3W5JA 4G07A 3Q7PA 4AF7A 1M0EA 3BD9A 4TLDA 1R16A 1SBYA 2GRJA 5LQUA 1DTWA 1RC8A 1JE1A 1V3QE 3H5TA 4GGOA 1JH9A 4TMFA 1I7LA 4I55B 1IZ7A 5KYWA 2XF2A 4RV9A 1HC7A 1S9DA 4EG8A 3U7GA 1Q7EA 3CQ9A 5I7WA 1CJMA 2HIGA 5FWXA 5C1PA 2QTVB 2QBYA 3SE7A 1XDBA 4PHTA 5G53C 1AH2A 1I4TD 3LTEA 1E5XA 4Z51A 4EFNA 3QKRB 4FGKA 4G25A 1HYQA 1CRPA 1MA0A 2FJUA 4QXQA 4A4DA 3H0CA 3QWBA 4MGEA 4PX9A 2R5FA 3E61A 3THRA 2DWOA 2EFJA 5DK4A 3WXMA 1H4QA 4LZLA 4JLSA 1NUHA 1HDIA 3AUYA 4FGSA 4IWXA 4YJFA 4WLFA 3RREA 3SQOA 1KZ6A 2NO4A 2L19A 1J9ZA 1H6CA 3LH5A 3HXPA 1GTG1 3KHUA 5AICA 4OQYA 4HLQB 1F51E 3U7IA 2EJUA 3RASA 3NC4A 4Q3NA 2FOXA 2IGBA 2RC5A 4X3OA 1OB5A 3Q5GA 4Q6BA 5FKJA 1VP3A 2O23A 4YFVA 2VP4A 2BGLA 1EX7A 2VJLA 1X7DA 2IUEA 3EHEA 3WFJA 3DAYA 2IXGA 4PZLA 1A9TA 2OGSA 2NTEA 2P0AA 4LCJA 5EZQA 1NW5A 2CDBA 3U3KA 3Q0IA 3AIIA 3GLRA 3WTCA 3WZMA 3OWHA 3H6GA 3UAWA 4MS4A 4TTQA 3EEOA 3NDRA 2JG3A 4EG3A 2XX3A 3LUCA 4PLFA 4F96A 2GNPA 4QL3A 4XD2A 3U2QA 1D9ZA 2MR6A 4YRTA 1C3XA 1O3YA 1EQUA 2FZCA 2NU7A 5BW6B 5LUAA 1YQUA 5LZ5A 5AOAA 4DYVA 3X1JA 2WY2D 4HAOA 1MDFA 1U0GA 1VBKA 3AR8A 4NZ9A 5CB4A 3O5AA 4P80A 3OPYI 4L9AA 5ADHA 3LGAA 4I8XA 3JARB 1KDZA 1K6IA 4C7OB 4O1HA 2EF0A 4NBUA 4V1CA 1MOQA 4Y6RA 1AMUA 2UVPA 3LZ6A 2I91A 4F5YA 4R2XA 4B3IA 3L0SA 4WACA 5JD3A 1JHVA 1P7WA 5EA2A 2QJTA 4XB6B 3THOA 4TWJA 5ES4B 2HWUA 3LKBA 2ZDGA 1SC4A 1Y5IA 2UZ0A 3K5WA 1E5VA 3LPNA 3NATA 4ZI3A 2FPGB 2QR3A 5EJ4A 2CXOA 1YXMA 4J75A 1B1AA 4D0LB 5KHOC 4LKRA 5AK0A 4YO8A 2AZXA 2QUAA 3C6KA 3HB0A 5AVJA 1DKRA 5HQ3B 5AKKA 2BEKA 1UINA 3Q1LA 2FCRA 1WLSA 3RS5A 4IIJA 2IGTA 4BFLA 3EGOA 5FUBA 4XVQA 3N2EA 3PC8C 1SKBA 2E48A 1I3CA 3LBAA 4AKSA 2NU9B 3RAFC 3EYAA 2FPIB 3A7DA 1Z07A 2G5TA 2OCAA 3F7TA 2L17A 1JQJC 4F2PA 1AHHA 3FPBA 5KJCA 1DKPA 4OP1A 4RS4A 1PU2A 2ETXA 1Y6RA 4Q4HA 2ZITA 3Q7QA 3LL4A 3OSUA 3QX8A 1BSVA 3D3WA 3TQHA 5HYVA 5FI3A 1O5OA 4QE3A 5BSRA 3R3HA 3TTYA 4EG0A 2A8YA 1BO6A 2NUAA 3L8GA 3LQ4A 5D5HA 2YFQA 3PPXA 4IVNA 2JJ1A 4CIVA 2XAAA 4D8TA 3KZMA 4CG0A 4WCFB 3DE0X 1T0UA 4INOA 4PAMA 1D8AA 4W63A 3S68A 3LXXA 8GPBA 5K0NA 2BR3A 2I7XA 3IPAA 5CX1A 2A59A 5GV7A 1YJBA 2XE8A 3ZCUA 4CL8A 5D1HA 2UYHA 3EY9A 1GEGA 3IPCA 4UUQA 4YGYA 4YJGA 4EA6A 4ER7A 4ER5A 5IXYA 4ZAFA 2I34A 1CULC 3IT2A 1U8ZA 3PX2A 4Q15A 3K09A 4V39A 1QIJA 4MWCA 1BX1A 4B8ZA 3PKZA 1G8FA 5AW8A 4JYZA 1OFHA 3L84A 4XGNA 5G3YA 1DKUA 1M9NA 1VZ3A 2YX1A 4LOJA 1ZW6A 4QC2A 2IH2A 1IB6A 2YS6A 4XWYA 4YI5A 3RC3A 4P98A 4GSKA 1PT5A 3T5CA 4G0YA 1M6EX 1ZUHA 4A1FA 3WLKX 4LXTA 2VK1A 2R7MA 3NFRA 1F2TA 3BXEA 4PU0A 2O8CB 4JLDA 2VPPA 1U8XX 2WTMA 1Z13A 3OC6A 3OZRA 1PWHA 4MJXA 3WGHA 3NC0C 2OFWA 3CO0S 5JNWA 1NA5A 3Q2IA 4UPDA 3SEZA 3FUXA 3U7FB 4LDZA 3UAXA 4C22A 1Y0BA 2P5SA 3HSYA 4P4NA 2ID4A 1MQ8B 1UFVA 4PR3A 5DP1A 4G0OA 5C31A 1RWOA 2ISQA 2J7PD 4G85A 4E03A 3K92A 4PZAA 1QPBA 2Z0MA 4PXYA 2H8GA 2QP3A 4C2AA 4CIWA 4M87A 3PC2A 4C9BA 2VH5R 4H3HB 4LRXA 3NTQA 1QHGA 1IOZA 3LCUA 2Q2QA 2HL6A 3L82B 2AFHE 2ZM6B 5MN5A 1Y3CE 2AFHB 2D1FA 4Q1FA 3H5AA 2XKJE 1DIOB 2GEDA 3P0RA 2X8JB 2KLBA 3BMOA 2CYAA 1M0SA 4QTXA 1LBTA 3PHJA 2COKA 5F77A 5AUNB 1C9YA 3S44A 3MGCA 2O8FB 4FDVA 4J0GA 4S1VA 5ULLA 1JEAA 3C97A 4C87A 1LLCA 4R1MA 3GCXA 5HIIA 2PMCA 1R5NA 3EA0A 2JC3A 3K0AA 1ZJ5A 2BDTA 5CDFA 4XLLA 1YFKA 1NVVR 3GBSA 1RIFA 2HV9A 3L6OO 3ILSA 3O3CA 4MUEA 5H16A 4G1VA 4DSUA 3K4PA 4CEIB 5F4BA 3LQ1A 2REQA 4ACAA 4F1JA 4UVDA 3PQCA 5AJYA 1Z0JA 1EJ6A 1C9MA 2FB9A 2PD4A 2PX4A 1XNHA 3GRVA 1C8VB 4UAVA 2HCFA 4JKOA 4MEJA 4QGAA 1NLYA 4ND1A 1M2EA 1RJFA 4OKIA 4XARA 3RSHA 4EEXA 2ZR9A 5KNCD 2O8DB 3EGEA 3VPCA 4OQ4A 1UC5B 3ICWA 3O31A 4Y67A 3MWEA 1PR4A 4IFEA 4YAOA 1ECLA 5SZIA 4ALLA 4PG6A 2OFFA 5HRCA 1WV1A 3I0MA 1EBBA 2WMDA 4CFSA 1FLVA 3DC7A 5JNTA 2VSFA 4Z3OA 4MEBA 4M37A 4RIFA 3VH2A 5B6IA 2P35A 3HZHA 1PZXA 2VRCD 4Y3UA 3ZY4A 3D31A 2P9JA 1RAGA 2JDIA 3QVGA 5GP1A 3T41A 3W3ZB 1Z2EA 1K9SA 3NBZC 3P9PA 5F2KA 3VH1A 2IS4A 3PQ6A 4LRQA 4KX5A 3K4HA 1EJ0A 4O8ZA 1KQNA 3L40A 2D5LA 4QICA 1IAQA 1L7MA 4HWOA 1IVSA 3SHWA 5YASA 1U2EA 2QUIA 1QVRA 1VYUA 2CUNA 5A3VA 1NYLA 2NNWB 1QHXA 2NXCA 1TJYA 4IXWA 4TSFD 3CLHA 2Z3WA 5DYGA 2HBRA 3CN7A 3A10A 3PBKA 3Q40A 1B0AA 3NHWA 3PKJA 4RD6A 3RC7A 1TEVA 1GWNA 2FW6A 4PZCA 3GLHA 1XLTC 3HA7A 3MJVA 1M1NB 1JG1A 1P7VA 3B3QA 3RSLA 4CGYA 4E5PA 3UMVA 1VKHA 1OUMA 3FNFA 3GX1A 1B43A 1RP1A 5DT2A 4DMKA 5INTA 1DO8A 2FMHA 4LX8A 1IY2A 1J2YA 4OGLA 2ZRBA 5GIOE 1EHIA 3CNHA 2X1LA 4FWIB 4I3GA 3KD3A 4A23A 1RP7A 5AKLA 5A1TA 5BQFA 3AKDA 4BLPA 4HAZA 2P9BA 3LC1O 4WKNA 1XMPA 4MVJA 4M36A 5GAJA 4AJLA 8ATCA 1U28C 5CCXA 3ZD8A 3CKLA 1CF2O 5BNTA 5HP4A 4PZYA 2A1UA 3RJZA 5BR7A 3LL7A 1E6MA 2PKWA 2J8ZA 1ZPDA 1JB1A 2C07A 3BD7A 3KNZA 3RROA 3ZU4A 1OH7A 3OLWA 4D4JA 4IYJA 5JMWA 1BEUB 4AY3A 4D9BA 2IYEA 1PD0A 2C4KA 3GIDA 1A9XB 2O2DA 1MJGM 5A71A 1QV6A 3D7SA 3D4BA 4NECA 4JLOA 2D00A 2JAOA 2E5LB 2H2AA 4B9EA 3E5MA 1IM2A 2IYRA 1JTEA 5J5AA 1YS9A 2HD4A 5F5LA 3WX0A 2VP6A 3RYCA 2G04A 4TYWA 2PDAA 3HSSA 4JK3A 1NSFA 3G1TA 3G2PA 3AVVA 3FR7A 1Y3AA 5IS2A 2PUGA 3VSBA 5AHXA 1FVOA 2V96A 5CFQA 2IFTA 3EEYA 4NMHA 3OOEA 4ZVRA 3RS3A 3QKIA 4N8SA 4WKOA 1WXQA 5CHEA 5AVQA 4PZ9A 5FFFA 2Q07A 1QGUA 1TYEB 4IDDA 2GXAA 4LQCA 1OC4A 3FCXA 1F4PA 4PGFA 4EUFA 1NWCA 3FGNA 4G1MB 2AR9A 4R05A 1W49A 1ZIYA 4A7PA 1LQTA 2HRRA 2C9DA 4U02A 1WZ2A 4Y2JA 1JI0A 5JCXA 4BVHA 3FROA 3QU2A 2PJRA 1Z5VA 3HLYA 3TNJA 4BRZA 1OZFA 4YIKA 3QE9Y 3TE7A 4DADA 4DT1A 4EHNA 1V1MA 5BQPA 2XBMA 2H11A 1OBFO 1U8EA 2HSWA 2QL7A 2YMMA 4HQRA 4KLRA 4QDOA 4RIGA 2QRLA 4RLHA 4UXHA 5DHFA 2WFZA 4KE6A 3ZW7A 2QQEA 2QMOA 2QN8A 5E1BA 2IEBA 1COWA 1VA4A 2CV0A 3OVMA 1TLLA 3MMSA 3N7AA 3OLZA 3W78A 4A8PA 2NSHA 3E3OA 3GT7A 3QXJA 2V3CC 3SJ7A 1Z2PX 2W93A 1G5QA 1QOPB 1L4KA 3CJTA 3QU7A 4RESA 5FBWB 3ZK8A 1P1BA 4AS3A 3QQPA 7ABPA 4KQ1A 1P33A 3V1TC 3KV1A 4UE6A 3CPSA 4DIUA 2I54A 5DNCA 4C03A 3VPDA 1JMVA 4JR2A 1N2GA 1K5GA 2E55A 3KKLA 4E2FA 5J2UA 4TLMB 2RAFA 1I7DA 4DDKA 3TRDA 2CLIB 3K7EA 2FQWA 3CZ5A 3PQ7A 1IHXA 4JL6A 4OFBA 5IARA 2VTEA 2YNMC 3NYQA 2R3SA 2XA2A 4IGFA 3L4KA 2VDLB 3HZZA 2GBFA 1E2KA 3II6X 5B30A 5I7RA 3SSNA 3N5KA 4CR7A 1X94A 4LWQA 3GNLA 5I7SA 3ZTWA 3ECCA 4L6CA 1NPYA 2PWYA 2AA3A 1DCMA 5IK2D 1ZI9A 4L50A 3NMUF 3KIPA 2ZWMA 2R65A 2XW6A 2VEOA 4D4MA 1XR3A 2RHJA 1FP4B 2I6SA 3V7YA 5MF6A 1Z08A 1NQAO 1DIBA 1ML4A 2R2AA 1NAHA 2X4IA 3LPMA 3U0VA 4CKCB 1QQAA 1CF4A 3F6YA 5K4GA 1K08A 2BBSA 4UASA 2XT9A 2I4OA 5HTOA 5DOVA 5F3RA 4AJ1A 1FRQA 3W7VA 2FKNA 2FX2A 1ZICA 3E3AA 4G0ZA 1MFPA 2Z1DA 1NURA 1NXOA 1W25A 4K5QA 1DOZA 5EEGA 4V0MA 5A3JA 2QORA 1NOKA 4FE7A 4RCZA 3U3XA 1Z37A 2OT3B 4QQRA 1GGVA 3MMZA 2ZI3A 4ZIRA 5KZMB 3UY4A 1M34E 1M34B 4NPAA 2ORIA 4GOOD 4OM8A 5HGJA 5CH3A 3QITA 4ND2A 1O94A 1WOYA 5D3QA 4INPA 2DULA 1PLKA 1XQVA 2YZ7A 3G2KA 2CLDX 2IKSA 2W6ZA 4MYRA 1K5PA 2X2OA 1QZXA 1KFKB 4B85A 3K2EA 1A5SB 2QW8A 2RGXA 4IDPA 4N0DA 3TM4A 2E1RA 1OHHD 4HNUA 3MJSA 2ZWIA 2IYSA 1VDZA 1HYGA 4U9HS 4BC0A 4LWPA 2P9GA 5AVYA 1UM9A 2CSXA 1P1IA 4M53A 3VOTA 4ZCIA 3FETA 1R0XA 1CEYA 4MS3B 4BYMA 2C5LA 2YH2A 5MFZA 4P7FA 3OZIA 5JFOA 1VPDA 5KSYA 3KD2A 1VE6A 2J87A 1Z3CA 2CVZA 5JUWA 5HKOA 3PC7A 5C35A 3P0FA 4HD8A 3GP8A 4AZ3B 3AV0B 3EX7C 3DEJA 3L05A 1XNGA 1X2BA 2REOA 4X1YB 1YS7A 1ZOIA 1GCOA 2A57A 3NNNA 5TE9A 4MDEA 4LXXA 2V65A 1C2TA 3RVNA 3C41J 2JJ2A 1Z6YA 4IP0A 1ODCA 2NAFA 2ZI4A 5T8KC 3RU3A 4GR5A 4DPMA 3BFJA 1RBQA 1ULHA 2I6QA 3LY5A 2IPOA 1VGQA 1E0SA 2EJCA 3INGA 3MAGA 4IOMA 4NRDA 4UKDA 2OHGA 1JEYB 4KNYA 3KSZO 3D3EA 4BNTA 5JHHB 4C3OB 5BWOA 2C61A 3GJ7A 1DP4A 4MB0A 5TMDA 3L4BA 2EKQA 3B9QA 4PBRA 3R6LA 4RSMA 5G4LA 3V48A 2IYNA 1WBBA 3A3OA 4YN3A 3SMQA 1EK5A 4YBZA 5E7IA 3GLIE 2F4VB 1K8XB 1ZK4A 3OZFA 3GLIB 4BYGA 1X1CA 3S2IA 4D42A 3U9SA 1AGPA 4M8KA 4GYJA 2AHOA 4R8SA 5FOTA 4CT0A 4F4CA 3KPVA 1T3SA 3PTZA 2PS1A 2YWCA 5KYKA 3VR6D 4CCYB 5HOEA 3OMLA 3GIWA 1EK0A 4D3FA 2AN9A 3PKIA 3ND6A 1BYIA 3IEXA 3V9AA 2RBGA 3EQ2A 1JDJA 3CX6A 1LBIA 4H7KA 2AN4A 3H2GA 2IHJA 3V6LA 1B15A 4RADA 3JVEA 2PBFA 3URKA 4C0XA 1RE0A 2F55A 3BQ9A 4F6LA 4IZHA 3WLRA 4TQAA 1UXOA 1OU0A 1PZFA 4H1HA 3FVTA 2OK8A 1KYXA 3H5LA 3EUWA 5IH7A 1PJLA 1V1RA 5DISB 3EDYA 1II8A 2FX3A 4OGFA 3AUXA 3K1ZA 3CX7A 1F0PA 3D6TB 3L1UA 3A25A 4FBMA 1WVMA 1XIVA 5JWHA 2I87A 4NBWA 1R8QA 1XEXB 3GLFB 2OV8A 3ZHUA 4D02A 4ARCA 3RVMA 3TBKA 1YFZA 2H4JA 4IICA 2FV8A 4IH1A 4N3GA 4P5DA 5AWFC 3RVOA 3U80A 1JHRA 5CH8A 3U6BA 3RHFA 3L04A 5B12A 3LT4A 1H2HA 4QFDA 3GZJA 2YVKA 3MS7A 4KH0A 1P6XA 3RIEA 1Q19A 1QNFA 2IYYA 4ROSA 1E66A 1GIAA 1T2UA 4DLUA 3V4SA 1IVYA 3O92A 5E3JA 2P65A 4JAVC 4PVCA 5CP8A 2XNKA 2C04A 4P4UA 3R0IA 4X20B 3TAXA 2WZCA 3VTKA 1E3QA 1SRQA 3P9NA 4GE0A 4QOHA 3EGVA 1PSDA 121PA 1UF9A 1G4UR 2NYUA 3BIWA 3NW9A 3CVYA 3LRTA 2BMWA 4WFKA 2MCFA 1TM5E 1WP9A 1BD4A 1YJAA 2EKDA 2I6TA 5K7SA 2W42A 2BWJA 3RYIB 2G88A 5IVHA 3EBPA 2PZEA 2E18A 3E81A 1SIOA 3OFND 3C24A 3HDVA 2R84A 3CZ4A 2C3PA 1NUTA 3AETA 5F7JA 1R8JA 3OZUA 3WLFA 3FI0A 3VHXA 4UFPA 3HXOA 2ANCA 1FYFA 3Q7EA 4GXNA 4MHOA 1GNLA 1J7JA 1WZUA 1D07A 5TMEA 3M6IA 1TUBA 2HC9A 3MT9A 4Y1RA 5FUMA 5IC4A 3ZCVA 3RFUA 3M4NA 4TT3D 2B3TA 4MW9A