4KE9A

Crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with an 1-stearyol glycerol analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
b'EQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermostable monoacylglycerol lipase
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke9A00
1MTZA 1FFDA 2G4LA 2PL5A 4X6UA 1SCQA 2QUAA 3I2JA 1GPNA 2OCIA 5AKJA 2QXUA 2OQIA 4DMCA 4BP9A 4CI9A 5JD4A 4BVLA 3D3NA 4CCYA 5A7GA 2PBLA 3NGMA 4CG3A 3O9MA 3DL4A 4WY8A 2VTVA 3FSGA 5D7BA 1QIGA 1DWOA 5AI5A 1T4MA 3QZUA 1ZIXA 3HLKA 4DYHA 3HEAA 4BVKA 5ALYA 3ZI7A 3TGLA 1LPSA 5HF8A 3N2ZB 3SX4A 2G63A 3KXPA 4X95A 4B7ZA 2GZSA 2Z3ZA 4AX4A 5EI5A 2C5GA 3UUEA 1CRLA 4N8EA 3X3HA 4HXEB 4KE9A 1JI3A 5JAHA 5HQ3B 1XRMA 4M0FA 2WFZA 1HL7A 2GBCA 2RHWA 3I2GA 3O95A 2IX9A 6YASA 3EQ8A 3V1NA 1DINA 1ETHA 3V9AA 4GBGA 3WIBA 4Y2TA 1ACLA 4G1FA 5AK4A 5IH7A 1M33A 4B6GA 1O6FA 2B20A 5T4BA 4J0DA 1CV2A 4U2GA 2J4FA 1W75A 4EY4A 4BDTA 3E0XA 3WLAA 4H7DA 3WK6A 3JW8A 4TPKA 5IVDA 3DKRA 3W04A 1KEZA 2QOEA 3WWDA 5LZ5A 3IA2A 2VJDA 1THTA 4HRXA 2OPHA 4OB7A 4Y2YA 1VA4A 5ALUA 4M0EA 2QRUA 3MGAA 2WU3A 4EA6A 1BU8A 3GFFA 5SYNA 4F21A 3H19A 2JEZA 2XUDA 4JUIA 5LZ2A 4OPMA 2GBGA 3G0CA 3O4IA 4RPCA 3KD2A 1X2BA 4Q3LA 3SC2A 3C6ZA 4GI1A 3WKEA 1K6EA 3HACA 1QGED 3C6XA 5ALOA 4W9RA 4KAFA 4DLNA 4EY6A 1CUUA 1XQVA 5CTAA 4FOLA 4FLFA 2H9YA 4O08A 4X3CA 3LCRA 5A6VA 2C58A 2XMSA 2ZYSA 4H35A 1VA5A 4F5ZA 2AJCA 5HF6A 4X91A 4G9GA 1CUCA 2XUQA 2B9VA 2WHPA 2BUCA 5LZ8A 3ZPXA 2I3DA 4FNMA 4GDMA 1TRHA 5ALEA 3WK8A 3CCBA 2CB9A 2HDWA 1EHYA 3O4GA 1QTRA 1W76A 1WPRA 2AJ8A 4KR0A 2XUFA 1R50A 2DHCA 3DD5A 4PQEA 2XUJA 4CG1A 4FHZA 5JYCA 1AC5A 1MNAA 1BEZA 1ODSA 1MNQA 1CUWA 1H2XA 1BCSA 2XUGA 3DEAA 2Z5GA 1QO7A 4RE5A 3VVMA 2ES4A 2QTBA 5CH3A 3DYVA 5HCUA 1AGYA 3S2ZA 4QLAA 4H7IA 1R88A 3JYHA 1DWPA 3KOOA 5ALFA 1WM1A 4ZREA 4H77A 2Y2UA 1C7JA 4U2CA 3ANSA 3WKCA 3YASA 4G4GA 1JFRA 1UKBA 4KYVA 1TK3A 1C7IA 2WFLA 2ONCA 4K6HA 3WL7A 1N5MA 2VAVA 1SFRA 3IB3A 3R3XA 3Q8WA 3WJ1A 2FUKA 4BP8A 4X97A 2JGMA 5CH8A 2HRQA 2XMDA 1XROA 1VE7A 4AZ3A 2ZVDA 2EDCA 2VF2A 3R41A 1IUOA 3H04A 4G4IA 3U1TA 5FUMA 5AHXA 3F97A 1L7RA 1B41A 3FYTA 1N1MA 5AJHA 5FPPA 5K3AA 2QJRA 1ZD2P 2WM2A 4MWSA 4BCCA 3AILA 1VKHA 3H1BA 1QIEA 5AKHA 3A70A 2Y6VA 3K2IA 1YA4A 5AKGA 2G5TA 4I4CA 5ALGA 5AM0A 2WSLA 4ITVA 4AO7A 1UK6A 2ZSHA 4D9JA 3PF8A 1TIBA 5JAOA 1CQWA 3F8SA 4Y7DA 3Q0TA 2CKMA 2BAGA 4W1SA 4EBBA 5ALXA 3VKFA 2QKYA 5HK9A 1IZ8A 1HKHA 5EIAA 4X92A 4B84A 1UOPA 4G5XA 5T4EA 4F60A 1VOTA 1FFCA 1PFQA 1XFDA 4Q3KA 2J3QA 5AI6A 3WL5A 3SWWA 3DL7A 3H2JA 1XQXA 1YS2X 3IUMA 4U2FA 2WUDA 5E4JA 3DNMA 4UUQA 5E4YA 5AM1A 2XB6A 4OUKX 3HSSA 2X5XA 3QBJA 4W1RA 3WWPA 3PUHA 4DIUA 1R9NA 3WMRA 1KU6A 3FCXA 5JARA 2V97A 4Y2JA 5ALPA 4B9AA 3P2MA 3BIWA 3FNBA 2I78A 4OD0A 3HRHA 2O2IA 2HFJA 4EUSA 2XLCA 3E3AA 5CT9A 5JATA 1ORVA 1ZI6A 3FAKA 3AJAA 3WZMA 4BAGA 3BDVA 3STVA 4CG2A 1QIMA 5DWDA 2FJ0A 4RGYA 2Z8ZA 1USWA 2BUBA 1Q83A 4LYEA 1I6WA 3HABA 4G8BA 4K6KA 2GYUA 5IVHA 4IH1A 4DNOA 3FCYA 3QPAA 1DQZA 1DT5A 1XRLA 5DNVA 1MX5A 4QWMA 3WKDA 3A6ZA 3FSGD 2WHRA 1DTEA 2CEKA 5K3CA 4LXIA 5A7HA 3H0CA 1SC9A 3BL8A 3D7RA 5CURA 1Q0RA 3WI7A 4QA9A 1GPKA 1WB5A 1UFOA 5CRIA 2J3DA 4HAIA 3WK7A 2Q0XA 4KAJA 5CT6A 1ZI9A 2I03A 2XQKA 3QPDA 5CBKA 2XUPA 2O2HA 3WWOA 1FFAA 2PSJA 3M3DA 1HLGA 4XWGA 5AK3A 2PSHA 1EVEA 5FXMA 1NX9A 4EY7A 3ED1A 4N8SA 1F0PA 2WIGA 3R0VA 1JT2A 4LKOA 5HFNA 3QH4A 3G9XA 4Z49A 3FBWA 2PUHA 2XMQA 2IIVA 4CCYB 5AKXA 5AM4A 4W1QA 1U4NA 5FKJA 3I6MA 2JGLA 1P0QA 2OXEA 3D59A 4UFPA 4BAUA 2O7VA 2VJAA 2XDWA 3PF9A 2WQZA 5CT4A 1VXRA 2C0QA 3MUOA 4IHAA 4RE6A 4BRZA 1A8UA 3R3UA 1LPPA 4NMWA 3BXPA 3WK4A 2XQFA 1XZLA 3GA7A 1RWQA 4N5HX 1LPAB 1N8SA 3FWHA 4WY5A 3HYSA 3NOXA 1P0MA 5ALIA 1UOQA 2PUJA 2OGSA 4AZ0A 1QE3A 4X90A 1RP1A 2O7RA 3F67A 4FLMA 1LZKA 1CR6A 3AZPA 1QONA 3HJUA 2YASA 2XQGA 3AFIA 1U8EA 3T52A 1KU0A 3HC7A 2XUOA 2DQYA 4Y2UA 1BCRA 4BCDA 1C4XA 1PJAA 1LBSA 5LKAA 4N5IX 1ZGBA 4DNFA 1U65A 1X2EA 2UZ0A 2XUKA 3PUIA 3H2IA 5DTIA 2EDAA 3MVEA 3H18A 1EVQA 3PE6A 4B83A 4B9EA 4GEGA 1Y37A 2ACKA 1EK1A 1LPMA 1XZAA 5DLPA 4J0CA 1G66A 5ISMA 1OCEA 1L7QA 5AK6A 5FV4A 5JZ9A 2WG0A 4BC0A 3LLCA 1RYYA 4KJXA 5E4TA 2YXPX 1YS1X 3F98A 2BKLA 4C4YA 3AIMA 3SK0A 3M82A 4CCWA 5AI8A 3HXKA 5DYYA 3D5EA 5AM2A 1CUHA 2ZJ7A 4LXHA 4G4JA 2XMCA 4QEKA 1JKMA 4KE8A 1PV1A 2BCEA 2GYVA 3DQZA 2VAXA 1YASA 3EQ9A 2QMQA 1UWCA 4QWWA 3C70A 3RK4A 2WJ3A 1H22A 1E66A 5FP0A 1MPXA 2ZYRA 4FNGA 3RM3A 1HQDA 5LZ7A 3DCNA 4BATA 3R3ZA 1H2ZA 3CXUA 2HL6A 3HI4A 1GGVA 4I3FA 3VXKA 1R4ZA 2IITA 1WPXA 2C0PA 5JIBA 1J07A 2WIKA 4FDMA 4C6HA 3PI6A 5EIEA 2VSQA 2PKYX 4C4ZA 2J4CA 4WDRA 3V1MA 4Q1VA 1VZ2A 1Y7IA 1WB4A 1MU0A 3O0DA 4AN0A 4L9AA 3STXA 5JZSA 2K2QB 1EB8A 3RKSA 1XZIA 4OCZA 5HQ3A 5AI9A 2Z3WA 3R3YA 5JD6A 2R8BA 3FYUC 3I1IA 1XZFA 3BE8A 4Y2SA 2HA0A 1EK2A 2QUBA 1YR2A 4YPVA 2ZSIA 2JBWA 1THGA 5LKRA 4MJ3A 1E8DA 1H2WA 5D6OA 5ALKA 4ZGBA 4YX9A 1UK7A 3STYA 4QZVA 4U2DA 1TCBA 5I7UA 4X7BA 2DHEA 1UT6A 1EDBA 4QDZA 5ALQA 2PU5A 1QZ3A 1LPOA 1IUNA 1E3QA 4PSCA 4ZXFA 3GBSA 4AMYA 2WKWA 4UHEA 2EEPA 1EINA 3UMJA 3I28A 3F9CA 1JU4A 3GELA 4Y2XA 3WA7A 1CIJA 3FLEA 5AH0A 3IUQA 1BN7A 4TGLA 4FMPA 7YASA 5ALWA 3AIKA 4Y9SA 3ESDA 5C81A 3DLTA 1XZEA 1XZKA 4ZV7A 1W52X 1XQYA 4XJVA 5CXUA 4EHBA 2HA7A 1K5PA 3PDCA 4JYMA 4J0KA 1TKRA 2CBGA 3WWCA 1CUAA 1YB7A 5KWJA 1UXOA 3QMWA 2VEOA 5AP9A 1UKCA 1XRNA 5A71A 2QZPA 4W1PA 3C8DA 1JMYA 3FVTA 5AKLA 3WJ2A 3R40A 2HA2A 4UPDA 4PO3X 1MAHA 3TJMA 1N5RA 1VE6A 4ARBA 1E8NA 2RGUA 4UHBA 4A16A 1LZLA 5IVKA 4BTVA 2WJ6A 4IQ4A 2XQIA 4GHWA 4PSDA 3I6ZA 4X85A 1YAHA 2YH2A 1UK8A 2VATA 4PV7A 3IURA 4FBMA 4G8DA 3ICVA 5ALMA 3G0GA 2OGZA 5HKBA 4WFJA 4CIBA 3OPMA 1GPLA 1SCIA 2V9ZA 2WHQA 4TVKA 5ESRA 5AOAA 1AZWA 5CT8A 2OAGA 4KAAA 5K3FB 1UKAA 3JWEA 3QMVA 4OU4A 1E8MA 1ZJ4A 1J1IA 1ACJA 3B5EA 1GKLA 1R9MA 1GQSA 4YK7A 4H7EA 4W63A 1XZBA 5T4HA 1WOMA 3GUUA 2WU4A 5JD5A 2CZQA 3W2TA 4EY5A 2Y1KA 3W9UA 4DMHA 4YASA 1XQWA 4QDXA 5CT5A 3N0TA 3IBTA 3B3QA 5DNWA 3EIOA 3CCCA 5CH5A 1QFSA 1DWQA 3QYJA 4IH9A 1TAHA 3M81A 4E15A 2D0DA 3ESCA 2QXTA 5D3ZA 3KWFA 4AMZA 3ZWQA 4L72A 3BF8A 3G02A 1JMKC 5A62A 5JALA 1ZGCA 1CUYA 4L0CA 4G8CA 5CW2A 5BOVA 4P9NA 4CFSA 1JJBA 5CXXA 3L1JA 4XX1A 2HA3A 4ZWNA 4BC1A 2CJPA 3VJMA 5I9IA 1YSCA 3D2AA 1WHSA 4UFNA 3D4LA 4L3WA 2R11A 4BZZA 2QJWA 1MX9A 3I2IA 1K8QA 2WUEA 3OC0A 4GWLA 4UFOA 2VJBA 5J3JA 3C5VA 3D2CA 3W06A 4B0OA 4AXBA 4UHHA 3STTA 2ROQA 2XMBA 1T2NA 4JEIA 3W05A 1AMNA 4OYLA 5LZ9A 1XRRA 4H7FA 4J7AA 5BWBA 3OM8A 4KEAA 1QLWA 1ZD4A 3W9BA 1UZAA 4BCBA 4KE6A 3E1GA 3G0BA 1YA8A 3BF7A 1A8QA 3QPCA 4DMFA 1A8SA 1CUJA 2OCLA 1LGYA 3C43A 3K9BA 1DX6A 4QDOA 1HDEA 1MN6A 1LLFA 5YASA 5AO9A 3EBLA 4H7JA 3BIXA 4H18A 2BJHA 3BJMA 1SOMA 3LP5A 1QIKA 4J3JA 2BGNA 2XMGA 1H2YA 3FLAA 5AKKA 1BE0A 1EXWA 1DX4A 4JYPA 4WFIA 5H3HA 2PSEA 2PSFA 5K3DA 4PSUA 3FYUA 4FLEA 3T4UA 5ALVA 1D07A 1XZDA 1TCAA 1BN6A 2XQJA 1P0IA 1W1IA 3VJLA 5BV7A 2H7YA 3WL6A 3OOSA 4OSEA 4BB0A 1TCCA 4GW3A 4I19A 1QIDA 1CUIA 5HK8A 3WKAA 5CMLA 1XZJA 4QLOA 2JGFA 5T4FA 5F4ZA 2XE4A 5AI0A 3C6YA 4AO8A 3VISA 1XKLA 4BRSA 1ZJ5A 1W6RA 4G9EA 3WYDA 5JAPA 3BDIA 1XLWA 2GYWA 4Y2RA 5JANA 1G42A 2QS9A 1GXSA 1XLUA 3IULA 3KDAA 3FVRA 3IDAA 5DYTA 5AKYA 4OYYA 2HU7A 5AIAA 1CQZA 1CVLA 1QTIA 1XZCA 2ECFA 4FTWA 4FKBA 3ANTA 4XVCA 4X71A 5DTJA 1K63A 1IMJA 3G9UA 5DNUA 2LIPA 4X93A 3RLIA 1ORWA 4HXGA 1DT3A 1CUZA 4Y2VA 3CN7A 3O4JA 2XUHA 2JF0A 1QO9A 2RIPA 1CUGA 5AK5A 3DYIA 4P93A 4BE4A 5HF9A 3M83A 3H1AA 4PF1A 4DSAA 5EHQA 2I3ZA 4E11A 3UUFA 3AINA 3D0KA 4MEBA 4Y2QA 4BZWA 2JEYA 4DGQA 1MX1A 2Y2VA 2VT7A 2XLBA 2V98A 1P0PA 3OTQA 1K4YA 1BEEA 1IZ7A 1BROA 2WIFA 3WK5A 5JZBA 1ZD3A 4HS9A 5BWCA 1UK9A 1XZHA 3DOIA 5AIBA 3H2HA 4UBIA 4J03A 2CUTA 3S8YA 3B12A 4DMKA 1F0NA 1MT3A 5AOCA 4B82A 2ZYIA 4ROTA 4MYDA 3G8YA 2XI4A 2BFNA 4HVTA 1R3DA 4DNPA 5ALZA 1G5FA 2WIJA 4B80A 1XZGA 2HM7A 4CIAA 4UHDA 2RONA 4UBMA 1CUVA 4X6XA 1QJ4A 5C7YA 2OGTA 3PFCA 2GZRA 2V96A 1EI9A 3DOHA 5ALDA 4UBJA 2RI6A 1OILA 3U0VA 1EX9A 5AICA 2GBIA 3KSRA 1B6GA 3G9ZA 2WG2A 4BBZA 2HU5A 1L7AA 1LPNA 4FFVA 4Q05A 1S8OA 3C6BA 1F8UA 4MQLA 4EY8A 5C8ZA 1CUBA 2PU7A 5AKZA 1UOOA 4UHFA 5ALLA 3H17A 5AKEA 4EB0A 1EB9A 4MXDA 4BDSA 2WHPB 4B81A 1Z68A 4BE9A 1FJ2A 1FFBA 2XMZA 4ZRDA 5ALHA 1GT6A 5EHZA 1BRTA 2DQZA 1CUEA 3AZQA 4K6GA 2X8BA 1W4LA 1WB6A 4X00A 1J2EA 1CPYA 3LS2A 3VJKA 2OCKA 2WILA 3QM1A 3V48A 5JASA 1ZOIA 1E89A 5FDFA 5LP1A 2D5LA 4J0JA 4P08A 3DKKA 4AO6A 2DFPA 1H23A 4PNZA 4QDTA 1F6WA 3NWOA 3IUNA 1R1DA 4E46A 2O2GA 2VJCA 1EA5A 1DQYA 2HIHA 2WFLB 3WQHA 5FRDA 2ORYA 3OG9A 1HPLA 2JGKA 3WZLA 2WG1A 4A5SA 3D2BA 4M0MA 4DM7A 4LIPD 1QOZA 5ALTA 2B4KA 1YCDA 4WFKA 4K2AA 3EF3A 5ALSA 1Y7HA 3LIPA 1A88A 1XRPA 4PW0A 4K5QA 5ALNA 1ZICA 3DS8A 1AX9A 1GZ7A 2WLSA 4GXNA 4J0HA 2HRRA 2Y6UA 2NW6A 1SCKA 5JADA 2G5PA 4MEAA 1AKNA 1NU8A 4F0JA 5EHNA 3QMMA 5EIHA 1EDEA 4E14A 2XUIA 3I2FA 2HADA 1QIFA 3WYNA 4EZIA 1ISPA 1OXMA 2WIDA 4BYMA 3IVMA 3WK9A 4DNQA 4H0CA 3R3WA 2WUGA 4AN1A 2ACEA 3ESBA 4Q82A 3FOBA 2JGEA 5IVIA 4JH0A 5EFZA 1GKKA 1JJFA 1HBJA 4DSZA 4NS4A 1IUPA 2DR0A 1LBTA 5LYYA 3PFBA 3DDUA 5ALJA 2B61A 1E5TA 2AJLI 5SYMA 1LPBB 1Q84A 4MQMA 4HZGA 3WA6A 3I6YA 2HA5A 3I2KA 4J0IA 4IO0A 2DCMA 3AUKA 2HA6A 4UBNA 5LIPA 2XMRA 1CEXA 3E4DA 3H2KA 2PSDA 4B85A 1BS9A 4KRXA 4JNCA 5FOQA 2HA4A 1CUFA 4KRYA 4S0XA 5K5EA 4ARAA 1YB6A 3DJYA 1CFJA 4C89A 5KREA 1XRQA 2CMFA 3ESAA 1O6GA 2HHAA 3ZV7A 1AQLA 3MUNA 4BAZA 2ZJFA 3ZLVA 3WL8A 5I8PA 1WCYA 2GBFA 4NZZA 4ETWA 3R3VA 4GECA 3BJRA 5K3EA 2AXEA 1G4HA 5HFAA 4A23A 4U2EA 3G0IA 3FLBA 5A7FA 4KACA 2QT9A 4UBOA 5AI4A 5JAUA 4U2BA 4OU5A 2QM0A 2C4HA 4MWTA 1VXOA 3OURA 2JGJA 4LHEA 2OCGA 4BTLA 3A2MA 1FSSA 2ZJ6A 2XUAA 3IIIA 4WDQA 1DU4A 2PVSA 3STUA 5HKAA 3G9TA 3VVLA 1FFEA 5K3BA 3KWJA 2X76A 5KWIA 4B0PA 1Q0ZA 1A7UA 3C87A 3HZOA 3O4HA 2WJ4A 4C4XA 3C8HA 4V2IA 2HFKA 1IVYA 4DTCA 2WTMA 2C5FA 1CUXA 3G0DA 2OLEA 1ODCA 2VQ6A 5A2GA 4XIIA 5DJ5A 1CUDA 2W6CX 5K3FA 2PM8A 3I2HA 3STWA 3F96A 2QR5A 2JIDA 3C5WP 4BVJA 5FLKA 3NUZA 4FWBA 3GROA 2XT0A 3FYUB 1TQHA 4HXFB 4NVRA 4OB6A 3WWEA 4X94A 1GQRA 4Y2PA 1QIIA 1U2EA 5LZ4A 1VJ5A 2W22A 4UHCA 3O9VA 1JJIA 3QITA 1XKTA 4X6YA 3TEJA 1ZI8A 5KBYA 4HRYA 2OG1A 3CN9A 1WHTA 1NU6A 4QE3A 4H7HA 3AZOA 4KE7A 5AKIA 3QVMA 4ZI5A 5ALRA 1MAAA 2WFMA 3TRDA 4MYSA 1ZIYA 3C45A 2AJBA 3V1LA 1ZD5A 1J06A 4C88A 3K6KA 3WIOA 5HZGA 2JGIA 3ILSA 1VLQA 1EDDA 1JU3A 2RAUA 2E3JA 1XZMA 4C87A 2H7XA 2P8SA 3WKBA 4WJLA 2WUFA 2QVBA 2DSNA 1MJ5A 4J0GA 3A2NA 3ZLUA 2BUAA 4RNCA 3I1YA 1EH5A 5FPQA 5C8XA 2PPLA 4IH4A 5E2IA 4GLBA 4UBKA 2BGRA 2AJDA 5AM5A 3PICA 5C8VA 3LIIA 4UBLA 4LYDA 3G7NA 4QDUA 3L1IA 3V1KA 1CLEA 2OAEA 2PX6A 3A2LA 3ICWA 3GZJA 2H1IA 2VA9A 4INZA 5DYWA 5IKXA 1LNSA 1VZ3A 2VT6A 1X70A 5AM3A 4AB1A 4LXGA 3L1HA 2RHTA 5EHXA 4FFWA 4Q34A 2OQVA 1AURA 4H7KA 1CUSA 3ZLTA 3AIOA 3BWXA 3EQ7A 5LLSA 4N8DA 5HF5A 4FBLA 4WCVA 2FX5A 1QFMA 1XLVA 2HU8A 4OB8A 2C7BA 2H7CA 1QIHA 5AOBA 3RARA 5D3KA 1ODTC 1QIJA 4AQDA 2ZYHA 2Z8XA 4C01A 3IUJA 4ZV9A 3VDXA 1MO2A 5EGNA 2YYSA 4P92A 4QNNA 1YAJA 4Q3OA 2FJPA 1AUOA 3H2GA 2WTNA 4HTAA 2DHDA
chains in the Genus database with same CATH superfamily
1DZIA 3QE3A 2QTHA 2CHFA 3OCXA 4XSVA 3GEMA 4MS4A 5FA8A 4GDFA 2GN4A 5ECDA 4CTJA 1PUXA 3AUFA 2C4NA 1SCQA 1STOA 5JBIA 4MPJA 1HM5A 1U0NA 1Y6QA 1Z17A 2QUAA 3WOHA 4E07A 3I2JA 1GPNA 3DB2A 1T9KA 4EFMA 2OCIA 2ZB8A 5A5EA 2EKPA 1U2GA 2R8XA 3AFOA 2C9BA 4BP9A 4DZZA 1YDGA 3ROFA 4FFOA 3HXLA 1XJ0A 1F17A 2ATCA 4GKAA 5LYJB 5KOIA 5D1NA 3EC2A 2J6CA 1VIYA 2KLBA 4FHGA 1D04A 5KSWB 1EAYA 2AUMA 1BG6A 5FD8A 1RHJA 4BNDB 4MR9B 4MVWA 1Z0FA 3VA7A 1J21A 3KIPA 4W5TA 2VC2B 3V55A 2BVNA 2XKJE 1IJBA 2Z2ZA 3D0OA 3DLCA 5AW5A 1XZNA 4AWBA 4Z54A 3HVRA 2WC1A 4HPJB 3UWDA 2W8ZA 2H18A 3H5AA 3VR6D 4DPMA 5J63A 4OQQA 2W4QA 3NPAA 3L0YA 1SNYA 2O1XA 4RJ2A 2GHTA 3CT4A 5D7BA 4E09A 4HX9A 1DKQA 2JLCA 1U9YA 3JVDA 1OWPA 1Y5MA 1KJ8A 2YN0A 3QZUA 4MPPA 2B34A 5AI5A 2OBBA 1PR4A 4ZT4A 3PVZA 3Q6IA 3U9TA 3GMDA 1GFSA 1NXPA 3BFXA 3NX4A 1ZRNA 1J1UA 1XSEA 3VNRA 4IFEA 2MSWA 1A4IA 5CYFA 1ZG3A 3ONEA 5L3SB 5F33A 2QW0X 2G71A 3K70B 2EHJA 5HF8A 2H1HA 3RVJA 3TKYA 1XTPA 2FPIA 3S70A 2WJVA 1XHFA 2BGGA 2AMFA 1E5DA 3N3AC 4RJJA 3CUYA 2E4UA 2ZJYA 3HB5X 4EHKA 1OTXA 1ZMTA 1H66A 1BRMA 3W5SA 1ABBA 2C5GA 3MJEA 5WRFA 4EHFA 4Z7JA 1NXSA 3QVSA 4BNZA 1WIWA 4CR8A 4D6YA 1LUAA 2F8TA 2R1VB 3GB9A 4TMTA 5HS4A 1U8YA 1U2PA 5LQKA 2ZQ5A 5HQ3B 3IQDB 4OUDA 5CFZA 4XIFA 1XRMA 5J2UA 2L0XA 3IR6A 2GZ2A 2NSJA 4RK5A 2ZJ1A 3MQ4A 3ZVKA 3ZJTA 1FJGB 3NM6B 1P1RA 4P1ZA 4FE3A 1FMJA 3R7BA 2XZPA 4M0FA 1X3SA 3PEVA 2WFZA 1I80A 2HMWA 4MCAA 1CLUA 2O8CB 1L4GA 3K9WA 1G9XA 4QSHA 2Z2KA 3NEYA 2XCSB 1BKSB 4YAKA 5JI3E 5JMPA 4B48A 3DHYA 1YIOA 2B83A 4JSYA 1OT3A 2BHTA 2OUIA 3ACCA 3V9AA 3U7HB 4ACAA 4NCAA 1VL1A 5E6RA 1AUVA 3A9WA 2I87A 2H8KA 3CX8A 4GBGA 4GXTA 1QU2A 2NUAA 3WIBA 2VLBA 3K72B 4I4TB 4BBPA 4RF2A 1XD8A 2E4YA 4RVHA 5JS1A 3WIUA 2W2VA 4PN7A 1ACMA 2JVJA 4ND5A 2CK3A 3KTFA 2GF2A 1VE5A 5AK4A 2YXBA 3SYNA 5JXWA 1UKYA 5D3QA 2JZNA 5IBQA 5IEJA 3KCQA 1M33A 4LYGA 1OWMA 2IP1A 3RBVA 1ZIPA 3E05A 1N3LA 3NASA 4WASA 3X2EA 1SCJA 1B3BA 1G9TA 4NOMA 4XGKA 1IN7A 3UMFA 1KHTA 4QC2A 1TE2A 2GPWA 1U8FO 2ZJ3A 3CNQS 3DHEA 4FOTA 1XTSA 5T4BA 1HLPA 3GPCA 1RYZA 3CUTA 1H1TA 5BVGA 1WZNA 4AT1A 1QTNA 5CJPA 3IVGA 3VX4A 1BEUB 1O95A 5DBEX 4TV9B 3BYZA 4PYIA 3E1SA 1W75A 2NVUB 4FUTA 2ZTVA 3UGQA 1Z0ZA 4WBNB 4DIFA 1K7EB 2FFRA 1AMOA 1TCUA 5CFRA 4QT0A 4UDNA 4OKSA 2CF5A 5EMJA 3WK6A 4BQEA 1JMVA 3MMXA 4R2HA 1N6KA 4TPKA 3DKRA 2BGKA 5CA0A 3QF7A 2CVOA 1KEZA 4PLFA 1BQ4A 5CK5A 4YFVA 4ZAFA 2XT9A 3WWDA 4HNAA 4C3VA 2VDQB 2VJDA 3AJRA 1K8XB 4HRXA 4IDHA 1C0IA 1KYQA 4ZQBA 3K6JA 3KXIA 4L8VA 2A5LA 1FNNA 2Z56A 4ZI2A 5AXBA 3W3AD 3W5BA 3RUPA 3GUYA 4GC9A 2CXHA 4M0EA 1YB2A 1NF9A 2JRCA 1MABB 3CF4G 3MTJA 1RAIA 3KVOA 4MI9A 3HUFA 1BU8A 4EB6A 4F45A 5TLSA 2RGXA 1N7HA 1WPGA 4KGZA 2IYAA 2PLRA 4XTRA 5SYNA 3WWZA 4YY3B 4EW2A 3GBVA 3LLVA 3CX6A 3G8AA 2FR1A 1Z5GA 3GZTB 4OQEA 2FOIA 2R79A 4R8RA 1RJ9B 3RS0A 1IPEA 2JEZA 3Q5GA 5BV1A 4DC0A 3AGQA 4MA0A 4OXIA 3O4IA 4ZC1A 1HDZA 1GLNA 3DTVB 4BO3A 3RSHA 1N3BA 3Q9UA 1A0OA 1MDFA 1YNOA 4KXUA 4LYYA 4AI6A 3RV3A 5DGTA 1JX6A 5J2TB 1QGED 4YXWA 5ALOA 5IF3A 4QO7A 4S24A 5JC8A 1ZINA 3DW3X 4QPJC 1T26A 1OU4A 2QY9A 3GJZA 5TJHA 3SSAA 4F1KA 4DLNA 2IBSA 2WWGA 1KERA 5A3VA 3UUWA 4DJ5X 3UT5A 1LQUA 2QLTA 5CTAA 2IZ1A 4I6EA 1II8A 4FJ0A 4R2WA 3HYNA 3VR3A 3WHLA 5LU8A 1DWUA 2H9YA 4D74A 3RODA 2JD0A 2AOTB 4O08A 3KEOA 1U2SA 1NDHA 2VYFA 3O2NA 4JQOA 2Z1MA 4YRDA 3TW8A 4IILA 3LQ4A 2DF8A 2WV9A 2WY2D 1IOZA 2GKOA 3IKTA 1DOAA 2OFXA 4MHTA 1VGVA 1UWVA 5HTKA 1T0UA 1Y3CE 1T2AA 4X91A 4E2WA 4S1TA 4QTYA 3EXHC 5LWQA 1KAMA 3A6GA 2CLHB 1NFFA 1X7XA 4FD2A 4BKMA 3EZGA 4CTMA 1S8NA 4BN0A 1NW7A 1LRLA 3BTUA 4U7TB 4HY3A 2I3DA 5FOXA 2I4LA 1RYEA 3E9ZA 3ZPXA 4TYQA 5BUQA 1UJ2A 4MAMA 2YNMD 1ORHA 1KJWA 2PR2A 3NQ41 3MTQA 1N0UA 3OEYA 4LG1A 2ID7A 3FZQA 4BO8A 3O4GA 3ZH9B 3IIEA 1MB2A 1T9DA 1W76A 3EXIA 3FWKA 5HOQA 3EPJA 4JXJA 1F4LA 1QQAA 1HDXA 1ZBDA 2SICE 5DCLA 1FDWA 2A9JA 3B82A 2OD9A 2TMKA 2RDMA 2PYIA 2CUKA 4P3OA 3MMZA 1E2QA 4PC1A 4RVOA 2P62A 5L3ZA 2LP4Y 1MNAA 2CLCX 3PLAE 3WGUA 1G41A 3PNOA 4HTFB 3EZ2A 3K3PA 1YZFA 3RB8A 4MWDA 4DIBA 3QA9A 1WMDA 1P7VA 4R9RA 3SPXA 3OTHA 1W0KA 4YCDA 3DVAB 5FAKA 3SG0A 4DAOA 2IYQA 4OAPA 5CH3A 4RD1A 2QF7A 4HDRB 3H2BA 5FBWB 7MDHA 5HCUA 3GOHA 3KUKA 3EA5A 3RYCA 4OYRA 1AGYA 5IT9A 1YQQA 1R15A 2YICA 6REQB 1RC8A 1R88A 3HFRA 4JXKA 4NJEB 5DHPA 4OH7A 4GICA 4YALA 5ERXA 1U80A 3GCZA 4AMVA 4PPFA 1X39A 1IQRA 4TV8B 3K6SB 4R2MA 4XIYA 5I48A 3L0PA 4FYVA 3F6RA 1C7JA 3DOEA 2XDQA 2ZYGA 3ZY5A 3KOZA 1KVTA 2IX3A 1YV9A 2XZDA 2ZAYA 2G3YA 5EOVA 2HJSA 3D1VA 5EJ2A 5B1YA 4IY1A 4PPYA 2RGCA 4C0SA 1E3WA 1XCJA 1Y1KE 2QSUA 4IDOA 4RIEA 1RRCA 1P6QA 3LXXA 4BNWA 4DIKA 4KLAA 1N2SA 3AF1A 2ZM6B 1EFVB 1K2VN 3U80A 4BNMA 1GAXA 2NXWA 1O57A 1WP9A 3TRIA 3T4EA 5FWYB 1TAGA 3PC8C 2ZE6A 3HLYA 4RVNA 3WL7A 3CR3C 3JQ8A 3IAXA 4MWZA 3QTBA 5EMKA 4BQNA 4MCJA 2G8LA 1F2VA 2VAVA 2HHHB 4QM7A 3QE2A 4BJHB 1EBFA 3KQLA 1HE5A 2X1LA 4KPGA 2H54A 3Q98A 3R3XA 4JBWA 1JR3A 1KY5A 4KHPB 2O07A 2WA2A 1DDOA 3WJ1A 5HJ5A 2UAGA 3LF2A 5G4KB 2FZCA 1HX7A 1YK1A 2FUKA 3OQIA 1T4BA 3DLAA 3TSZA 5KNDH 1H2BA 4X97A 3QU4A 4P58A 1PKXA 3QELA 2ZJ8A 3TM5A 3X1MA 3ZE2B 2EYQA 1GILA 4MP6A 4QU8A 1FXSA 2XMDA 2ZROA 3CZAA 3F6PA 4GG1A 3AY3A 1XROA 2DX7A 4P5EA 2M6KA 1YZKA 2BHSA 5H83A 4KVAA 5C9ZA 4U7GA 1YBHA 3KFVA 2YOGA 4BV2A 3RVMA 2GAAA 3UHFA 3WGNA 1LDBA 1QGAA 3TG8A 4TMVA 1E4VA 3IILA 2AX4A 2G0AA 2PZLA 3V4VB 2LPMA 4TYYA 1B8PA 2HDNB 4MVJP 4JKYA 5K8UA 3IRVA 5FUMA 2G0TA 2CNDA 4CPDA 1E1QD 1X92A 2R66A 1J8DA 1U1IA 1QUFA 2G4VA 5K3AA 2BR4A 3BFPA 4M0CA 5ICEA 1TIPA 1UWLA 3NBFA 3GLGA 2WM2A 1TTQB 2NVBA 1G8MA 3QG1A 3S6JA 4GMFA 4LF5B 3DEYX 4BX2A 3AILA 4JJ8A 4CWAA 1ABFA 3WGJA 5JSFA 3DPIA 4HAZA 2OSVA 1QR2A 2FUNB 3B13B 1MVLA 2YXLA 1WHSB 3IALA 4N12A 4ESOA 3DNFA 1KS2A 4NZOA 2ZYUX 3WRVA 3PKJA 4Q4AA 5CLLA 4Z53A 2P6NA 1QR6A 3A70A 2IY7A 3EIUA 1UXHA 1Z62A 3OZIA 5DW0A 5JPDA 3QNUA 4HNTA 3TTXA 2VF4X 2G5TA 3PC6A 5IAJA 5ITWA 1UPCA 4XJTA 3K1ZA 3UFXB 1HG1A 1U2RA 2H3HA 3AW8A 5CLFA 4E33A 3SQWA 3Q6MA 3GEDA 4WFQA 4MQFB 3SHTA 2Z08A 4DWOA 2PS9A 5JV5A 1TIBA 5L4NA 3S2FA 6NULA 1QZTA 1WSBA 1E79A 3BG5A 3DTNA 1CQWA 1UH5A 1Q11A 4C2AA 5KOJA 1KI7A 1E59A 1J22A 1SGWA 3K0KA 3NAQA 4W1SA 5DBIA 3LK7A 4GE3A 4B33A 4HC4A 5KINB 3AVQA 1PEYA 4YRRA 2Q99A 1W5AA 2A94A 1X7ZB 1S2MA 4IGIA 1YQEA 3TBKA 1E2HA 3E22A 2QR2A 3PUJA 1ORTA 3GGOA 4BMSA 4ZIRA 1CWUA 4WBNA 2OHXA 2JLSA 4G5XA 2CCKA 3VV2A 2ACWA 4JS0A 3RJZA 1EMDA 5JXGA 2PUAA 2EWMA 4HDKA 4D8WA 1XFDA 4NFHA 4AWAA 3LBYA 4Y18A 2YVLA 2J3QA 1R5OA 3IXMA 2ZWVA 4CG0A 1Z6TA 2ZIVB 4KQ2A 1ICIA 3D7MA 4HWGA 4MTLA 4FT4A 2P68A 3BAFA 3GRVA 4M1YA 3H2JA 2KWIA 5JNVA 3R4VA 8MHTA 1KZ6A 1XQXA 4X1YB 4IKPA 2D1FA 5FUXA 4U2FA 2TS1A 3WZ2A 3HXTA 2ZIXB 1P29A 3CE6A 2ENUA 5E7JA 1RYBA 3G85A 3I34X 1X14A 4TLDA 3EFOB 1KKMA 1JIJA 1TGYA 4OM7A 5GGXA 1SZCA 4OUKX 1P9RA 3A3YA 2YWBA 3KR9A 3KU1A 1FFXA 1BXRA 2CSXA 1DDIA 3NIFB 4URVR 1CT9A 4DCNA 3L0CA 2PIAA 2GRUA 2IUUA 4ZDIA 1YFKA 5JNLA 1C4OA 4DIUA 1J8VA 1R9NA 4GL4A 1KPIA 3WMRA 3TRJA 1CY8A 3WR5A 2QTZA 4B6OA 1SKQA 1I0ZA 2Q21A 1N77A 1QG4A 4BUCA 3I6QA 2LWIA 4Z86A 4MROA 1DAGA 3ZHQA 5AQ1A 1WY7A 3DXFA 4J7CA 3X1ZA 2H29A 4UEKA 1FL9A 2FMKA 1B23P 1BYIA 1FRNA 4NJMA 2JFBA 5TF0A 4MUEA 3TTUA 2O06A 3AI1A 2I78A 1M3SA 3GLRA 3ZGLA 2WJAA 1CQJB 1YF3A 4REQA 2ZRAA 1EJ6A 2BT4A 1L1QA 3OLWA 4HYEA 4L1KA 5U4QA 1D2RA 3EVAA 1P18A 3JY6A 4ZXPA 5FNVB 1U28C 1X7DA 3AFNA 3KPJA 3E3AA 3WNDA 3BERA 4BS9A 1B4DA 1GNTA 3LFHA 3O3NB 5CT9A 1R8QA 3OZCA 2PUWA 2ERYA 4W5WA 5AVXA 2OCDA 2OAQ1 1KK3A 3THWB 5B55A 1N6IA 1PR1A 5DSTA 3A1NA 3HPQA 2HK7A 3OFND 2NPOA 3FAKA 3AJAA 4IGEA 5CJJA 5EXSA 2IZ7A 1UOEA 1YR8A 3A10A 4BAGA 5IUKC 2GLUA 5A5GA 2ZKLA 3AHHA 2O9JA 1K9VF 4IMJB 3BSSA 2HHJA 5I5EA 3VR4D 5DWDA 1T1JA 1C0PA 1OYOA 2YN4A 3DE0X 1Z7EA 4DDVA 2ODQA 4JL6A 1TT5B 2VEDA 1KIFA 2VQFB 5CR9A 4ZHSA 2IUTA 3QEAZ 3UAZA 1PR2A 1USWA 4G97A 1ULHA 3JAKA 1RM4A 3R7WB 5BN3A 2D0PB 4R9SA 2R1TA 3X44A 3GGPA 3Q3EA 4LYEA 5JVDA 1TJYA 5HQJA 4UQPA 3KZVA 3DP9A 1P5ZB 2ORWA 5K8TA 1VHLA 2SKCA 1I6WA 1VC2A 2GTPA 4ND2A 5IFLA 4RZ2A 3GFQA 4HDSA 5CA1B 4ZI7F 5IVHA 4IH1A 2L2QA 4XWAA 3RNOA 1KKUA 1K97A 1DC4A 2HJRA 3UC9A 3F4LA 1W4ZA 4HT3B 2O7SA 4HLCA 4C06A 3KZXA 5DX1A 4L8FA 4RCZA 3S2UA 5EZSA 2AFRA 5DNVA 1MX5A 5TQ0B 4F6RA 4QDJA 5FQNA 2TYSB 4ENWA 3COJA 1NULA 1GZVA 1VMEA 3QYAA 5JHHB 1H2RS 4I1OA 3FSGD 3J80A 2PGIA 1ZR4A 3PC4A 4FN5A 4EL0A 1O94D 1XA3A 4LXIA 5DP1A 5A7HA 2HN9A 4JB8A 3H0CA 3I2YX 5DM60 3BL8A 2J32A 5CURA 4ZYTA 3WI7A 5M29A 2PTHA 2WAYA 1FCJA 3A4MA 3DR3A 5HE9A 4EHJA 2WTAA 1GPKA 1WB5A 3GLQA 3RD5A 5IEBA 3AUTA 2VZEA 5KPDA 1KP3A 2O5VA 1LX6A 5KJ6A 1OFVA 5C2JB 3ONNA 1A1VA 1TOAA 5FPKA 1QC5A 2J46A 1SUAA 3PRHA 3OF3A 4KVFA 4UVIA 2E4ZA 4R8KA 3N86A 1JIKA 2LBPA 3P8ZA 5CT6A 1CVIA 1KF0A 1O6ZA 3BMCB 1LLQA 3FPBA 3QXHA 4TTRA 4TSKA 1GDDA 3KB2A 4UU7A 1TMYA 3RTDA 4XWOA 2XGSA 1CDOA 1E5LA 4Y9TA 5TEVA 2LCQA 1KBQA 1P4JA 2QMZA 3RANA 4ZT2A 1FFAA 1P1KA 4G0MA 2PSJA 4U63A 3M3DA 1HLGA 3AEQB 2GEJA 1XI2A 2HNBA 4EJ2A 1EVEA 2P2SA 3HJCA 4PTYA 1YB5A 4DLVA 2O2SA 1ZFNA 4NNJA 2PGLA 5F3DA 4OBWA 3IO5A 1F8XA 3BEOA 3PKZA 4J0FA 1NN3A 3PXUA 4B3RB 1NX9A 2F7SA 4ZO6A 4B34A 2O8DA 1PGPA 4M38A 5DM0A 3UOAB 2XBMA 3H4MA 2IGTA 4X3OA 5LXTB 1UZUA 1ETUA 2F67A 5TX7A 2I2DA 4EY7A 5H5JA 4N8SA 3BWEA 1N2IA 1SKYE 3CBGA 4PONA 3HA3A 1G8JA 2I6FA 4I5IA 4BNYA 2CDCA 2UZIR 3M1LA 4KWTA 3ANXA 1JT2A 4D9CA 1OYVA 4YYEA 2QD4A 4LY3A 5DLDA 3M70A 3A1UA 3QH4A 3IQEA 4NHEA 1Z2PX 1DKOA 1HYQA 2C4UA 1L5FA 4G4SP 4GZ5A 4RVFA 4E5NA 2IH5A 1DIRA 2B3DA 3EXHA 4N82A 1Q17A 3B60A 4TLBA 2UVDA 3P19A 4RF3A 5JS6A 2XMQA 4EPTA 1JEYA 3BA6A 2UV8A 3OOEA 2QIPA 1L5YA 1E9RA 4LSZA 1M5TA 2IXEA 3DEIA 1B3RA 2ZWIA 3U7QA 5IDVA 4QSMA 3LSYA 1BMTA 1RXYA 4YHBA 3V2UA 2HF7A 4BTEA 2VSFA 1LDYA 4QQNA 1V2HE 1XRJA 2DUMA 4ZPXA 3X0DA 3BJEA 3CLVA 1VPWA 1EWYA 1MRSA 4AY6A 4IIFA 3ZX5A 2PDAA 1JWLA 4NBUA 1IBRA 2JGLA 4O63O 5AJUA 1BU5A 3EPLA 2XADA 2X23A 1K5HA 3C98A 2JJYA 3IDOA 1NRJB 4RABA 2V7VA 3IMKA 3NDIA 3UUGA 2NSDA 3A3KA 1T3GA 1X1CA 3PBKA 4N3NA 2ZVJA 1U1EA 4BE7B 2XDWA 3IP7A 2ZTHA 3E9EA 4ZVSA 2V0GA 3MRTA 4RKYA 1WD5A 1EFRA 3JARA 3WBBA 3D5TA 2LKDA 3LFUA 4BRZA 1FSFA 1Q0QA 4I50F 1LPPA 3U56A 4RZQA 4FP9A 1V8OA 3N2LA 3VPCA 2Y4NA 3L4BC 2WWWA 3NH6A 4CEJB 4OXYA 2OLJA 2V7EA 2XH8A 1KC3A 1FK8A 1FLDA 2H1FA 4IZOA 4NQZA 4AJEA 4C2BA 1XZLA 5LQSA 1AIPA 3GA7A 3MCUA 5ICMA 1RWQA 3KX2A 2E5FA 3INYA 1H9AA 2ZIUB 4TUYA 2FPRA 3DBOB 5IANA 3U60B 3FWHA 1Z2OX 5DB4A 2CVPA 4U0KA 2GA9A 1KJQA 1F5NA 3HYSA 4RCVA 1N92A 5DH9A 1V48A 5KS2A 3K53A 3ZDDA 1QMGA 5GJVC 2ONZA 3LY5A 4MUKA 2AFIA 1Y6ZA 1JBKA 5E4FA 1P0MA 5LDGA 3T7IA 1XO1A 1LI5A 2ZBVA 4MGHA 4QYMA 1M83A 3OQJA 1S9DA 3GNTA 2AXQA 1RXSA 1TKAA 1VCNA 3NIBA 3P9QA 3PQ3A 3QLJA 4R1LA 1MA3A 4BJ6A 2FSPA 4P3XA 5FOUA 3B1XA 1RP1A 1C0KA 5GOZA 1VI6A 4NYJQ 1J9GA 2UVPA 4MVXA 4WV3A 2D06A 3GQBA 5A9SB 1QONA 3L8ZA 3WX0A 2J8ZA 1X8LA 1SQ5A 2W90A 3HZZA 5CDHA 4V1CA 1YKSA 3Q3CA 1C3OB 1L5HB 4CLXA 3EQ2A 4CU5A 2YASA 3L7KA 3OZVA 3COSA 4KQFA 3PC8A 3UANA 4A8TA 3OJXA 1M2EA 2P9HA 2AYXA 3QWFA 4LC0A 3IVCA 4TKUB 1R16A 4L8YA 2OCXA 3BSFA 5FTMA 3EZLA 4P86A 4N6NA 3CWQA 5JZVA 3DZIA 4RMJA 1C9KA 1MP0A 2YQZA 4A3SA 5IDXA 3DUFB 2R47A 3K5IA 5JXJA 2FQYA 3SBXA 5TDHA 1YDMA 2XV1A 1L8AA 1UC5B 4IDGA 2FFQA 4CFYA 2J7PD 3OSZA 3U61B 2PQ0A 3HVKA 4F9TA 1E3LA 4XI9A 1GPJA 3HU3A 5EIFA 1YL7A 3PUIA 3V3KA 3UT0A 2EDAA 2IS1A 3H18A 1CB0A 1K4KA 4B83A 1RLMA 3VNBA 4B9EA 4D4LA 4J3FA 4GEGA 3C5EA 2O19A 2AE1A 1L7NA 4K9LA 1XZAA 5TPWB 4J0CA 5AW4A 5HWSA 1I9GA 1RTTA 1V8BA 5J40A 3T4PA 5CDFE 1OW3B 3ZUPA 2YBDA 1L7QA 3MT0A 3FKSD 4K9QA 5AK6A 1FSPA 2D7JA 5FV4A 4QG7A 3NC1C 2V7WA 4F8JA 1D09A 1U7WA 2JS7A 4JODA 3DDWA 4NC9A 3PG5A 3C74A 1GTL1 5E1DA 4BC0A 1FFGA 3MTGA 5JCOC 1DOZA 2O0HA 1SVKA 1DHTA 1B0ZA 1SWVA 3IP8A 4S1VA 4G0UA 4KFSA 4WQMA 1KDRA 4R84A 1YL6A 3M4JA 3CO5A 1YS1X 3U7EB 2PZFA 1U0SY 2OA0A 3F98A 4B3XA 2AMYA 4OK3A 4XCQA 3GVCA 4BXOA 1UXJA 2JJ1A 3OI7A 4K05A 4I9FA 5HFJA 4JQCA 4LRWA 1ZM4A 3HY3A 3O8LA 2ZPTX 1XT6A 2XYRA 3H11B 4BO7A 4ZT3A 5FTLA 1JEJA 1CE8A 2XA9A 4CMKA 3UAYA 5J23A 3OPYI 1NJSA 4P7GA 3PPWA 1ORIA 4Z1OA 4UMFA 2WF7A 3TE6A 3ZHBA 1J1ZA 3GEGA 3RKRA 3HXKA 3M5CA 3ZH2A 1M2WA 3CPJB 2P2LA 3AKYA 1GCOA 3FUUA 5H02A 4AF8A 3AM1A 1SIBE 1D6SA 1P2DA 1I3MA 1NQ5A 4AKIA 1TRKA 5L4SA 1HEIA 3ELUA 4YDHB 1GTZA 2FSFA 3IMGA 1X6VA 4XSHA 4YAUA 2P6RA 4UNPA 4RMNA 2Z5VA 4ZOBA 2Y1DA 2WV7A 5AYVA 4DMRA 3SF8B 1C29B 1W5BA 2GTHA 3FY4A 3PB3A 4UHJA 1JV2B 2QMQA 4YRIA 1UWCA 3CINA 3EBPA 3BCRA 1H22A 1UPTA 4MKIA 4YECA 4ETIA 1E66A 5FP0A 1MPXA 2NV2B 1BWRA 3GH1A 1QB7A 3QQPA 2HXYA 4FNGA 1UJBA 2DBVO 2ZRPA 4HH3C 3KTDA 2Q41A 2YOFA 3OTWA 5LZ7A 5HILA 4G84A 3DCNA 4BATA 2O8FA 1H2ZA 2FE1A 4FGSA 3RNLA 2WD9A 2BBTA 2HL6A 4RY2A 1T0IA 1GGVA 1T0HB 1A2KC 2L18A 3JQDA 3GCXA 4RO0A 3VXKA 1LV8A 3G7UA 5KHOC 1WPXA 4FWTA 2C0PA 3W8RA 3B20A 4A1OA 3TQOA 1JE0A 5EIEA 3CJRA 3M8KA 5AOVA 1HE4A 3D6VA 5JD3A 2C8KA 2H11A 4DA6A 2QZSA 3F5SA 3EAFA 4JIMA 4P33A 1GAQA 1NLMA 1GTMA 4FK8A 1TCVA 3N2NA 1WB4A 3ZZMA 1C1DA 4QBFA 3ONWA 4DEVA 1FXWF 4AN0A 3FOWA 2E87A 5REQA 1J0CA 1EB8A 1OHHA 4HGPA 2GM4A 4AJ4A 3UEOA 3W2EA 4G1EB 1UBUS 5DTQA 1UC9A 5BUSA 3O91A 4WSOA 4KQ6A 2YW2A 2GKSA 2G9UA 3SR4A 1GADO 2JKYA 2X41A 2BMAA 5CX1A 4C0XA 3E84A 3PXCX 4NMMA 2O14A 3BXGA 2GZHA 2Q27A 4IDQA 4AKGA 2IFTA 2AA3A 3BCHA 3FSRA 3BE8A 4YJ3F 4Y2SA 1Z5OA 4Z2YA 4RTJA 3CTPA 1MEOA 2Y77A 3FHOA 3QTLA 4HEQA 5DF1A 1YR2A 4HQNA 4PHHA 2GJ4A 3HRKA 1WJGA 1I6LA 2HSEA 3QOWA 1F20A 3N28A 4CM4A 2OV8A 2M1ZA 4A2QA 4H3KB 4KIGA 2IA5A 2YVAA 1G21A 2HLDD 3CIOA 4J6FA 3WMWA 1DC7A 1ZNQO 3URMA 3ZI4A 2AEEA 1A77A 3FTDA 3NTLA 4IIXA 5D6OA 3ZHTA 4YX9A 4ZGBA 1GVNB 1UK7A 4EJSC 7REQB 1W8IA 2JFZA 2PZAA 4U2DA 4FYHA 1BA2A 4YJGA 2OYSA 4JI8B 4PYLA 1UT6A 1AKUA 1YR1A 5KNLA 4CU2A 1MRZA 4LBWA 1VM6A 5T64A 4BX3A 3AU8A 3U17A 2PU5A 5FL3A 1L5QA 1GCIA 2YWXA 1LKZA 1GA4A 3IEXA 2V7PA 2XKKA 5DM1A 1GL6A 4KPEC 4IV5A 4NCXA 3SIXA 2I9PA 3BGWA 4H31A 4NEHB 5CP8A 3UOGA 4OQMA 4QRHA 4N54A 3UZUA 3BMNB 1RD4A 2GLXA 4GXQA 3QX9A 5K7SA 2HGZA 1JQDA 1CQIB 3TTVA 3ACBA 3GIWA 3R5XA 1MJFA 4FVTA 4CW7A 4DR5B 4IJUA 3RTAA 3ZXXA 1KO7A 2FVXA 3GELA 3IL2A 1W0JD 3WA7A 1WEHA 1CIJA 4PC2A 4I7EA 4JUBA 3FLEA 4ZCPA 4MA5A 4WUVA 4X20A 4O33A 4QFDA 2XITA 3N6XA 4GRDA 4TTAA 3AG6A 3OLCX 2UZ1A 4IVQA 2EP8A 2HQBA 1QFYA 2EJUA 1P9WA 3AIKA 4Y9SA 4ZRMA 3O21A 2O54A 1FC0A 2R7KA 3B1ZA 3GW8A 3S4YA 5C81A 1V25A 3OCZA 4LCBA 2G7MC 4JC4A 3DLTA 3PYMA 1BD4A 2QIOA 5A3JA 2NYAA 3FFTA 5C32A 1LQTA 3D8HA 4B40A 1E9SA 1U9IC 3NVMB 4J2TA 5AJVB 3ZEIA 1KI3A 1C1HA 3MWDA 4RMGA 2AF3C 3TRFA 1XPOA 4COOA 4XJVA 1XQYA 4CMGA 3LLSA 3OA2A 4Q1DA 3LC2O 2OXIA 4NRDA 4EHBA 8ATCA 2ISCA 1K5PA 3L4EA 4EK9A 4JZYA 4UUMA 1UAAA 1G3MA 2P6PA 3P26A 4YCNA 1U2DC 4BJ1A 4PXAA 4KR7A 2NU9B 3QEOA 1CUAA 2IXDA 3OLQA 1T6BY 3N2EA 4HKTA 2GN2A 4MICA 4HNUA 1UXOA 3QMWA 1AQNA 1Y5IA 4GWGA 4HGRA 5AP9A 3ILXA 3KHKA 4ZYLA 2GCIA 4PBRA 2QZPA 3Q7EA 5K2OA 1QBKC 1HDOA 1PK8A 2EIXA 3FVTA 3OE1A 4P4GA 1T2EA 1UEJA 2VYVA 4Z0PA 2ZUWA 5KCZA 1H4QA 1JPUA 2MINA 4ER6A 1FX0B 3Q0IA 1ENOA 4YLEA 1L5LA 5CFLA 1E0AA 1MAHA 1VE1A 2BEUB 2VVTA 4WKGA 3LHKA 1N5RA 3ZVNA 4YJ2A 3EPPA 4DREA 1E77A 2GAJA 3P52A 4QQFA 1KDZA 4A16A 4TTQA 4C7KA 2X3UA 4C7BA 4W9MC 4X41A 2EXXA 1M8PA 3P9SA 5DKFA 4RSHA 2WJ6A 4YWJA 5HMMA 1NPYA 3RVNA 2FKNA 1NHGA 3IEUA 2XQIA 1DADA 4YRNA 3JU3A 4E2XA 3M0EA 1RYFA 3ZHYA 3R5HA 4NOLA 2B0CA 3D6MA 1MJGM 3ZGOA 3NTXA 4QYSA 4PSDA 2G70A 4X85A 4QVIA 1WG8A 1AU9A 2OZPA 2QV7A 4MZDA 4ID3A 5KQGA 4IGKA 3JZMA 3D8RA 4UZEA 2G1KA 1T5TA 3FNFA 3T0FA 4COKA 4F46A 4XWKA 1MZVA 1ZHHA 2Q3MA 4D9IA 1QQTA 1SUIA 3G5MA 4XH9B 3OMLA 2JLYA 2X42A 4XVQA 2I2BA 3EGDA 3IJRA 3GEEA 5KWVA 1BJKA 2ZIWB 2F3UA 3D0QA 4JP2A 4PPGA 4Y1FA 1Q2XA 1UMKA 2IPAB 2RHRA 3ICVA 4TL8A 5ALMA 1RRMA 1TAUA 4XD7A 1BS2A 3HEBA 2OGZA 4YAFA 4WFJA 3N75A 4MVCA 5F4BA 2JI4A 4II7A 2HF2A 4LRUA 5IKMA 4LDPA 3IH5A 3ITNA 4K6OA 1GPLA 3IIKA 2HIMA 2C4VA 13PKA 2HBQA 3IP5A 3U7JA 2WHQA 1W36B 2J0QA 1D0VA 3KB6A 3H5RA 1AZWA 3N3BC 4L5YA 4X6LA 3L4BA 1FNDA 1O58A 4KAAA 4DR7B 1HMYA 1L3IA 2ZUBA 1R4NB 3PX2A 1MHTA 2FOXA 1F14A 1WD7A 5K3FB 1SUFA 4J6EA 1Z63A 3FUWA 4DHEA 1UKAA 4JC0A 2HY7A 4NAUA 3RS5A 1E8MA 2PA0A 3AEZA 4G5OA 2FPLA 2QUJA 5JJBA 1A7JA 3F4KA 2PMEA 3DZDA 5EZYA 2N42A 1GPDG 4N3CA 5L45A 1ZIOA 2OAP1 2P9QA 4GR5A 5D2CA 1NKVA 3VFDA 1Z39A 5I4CA 3M5WA 1CY4A 3NORA 3HKCA 2VP5A 4WZAE 4BO1A 1L8OA 3UGKA 2ZRIA 4FW9A 3PNMA 4JUFA 3THYB 1EFCA 4DDUA 3FH0A 1WSAA 3L7CA 2FPOA 4M8IA 4S12A 3T3GA 4AJ1A 4HLQB 2CZQA 5K3SA 4HNHA 3D31A 3GLIB 1W2WB 2YZMA 4D26A 1TK9A 2B9EA 2EBWA 2Q7OE 3W2TA 1KJZA 3EYWA 3KKPA 3I12A 1TVKA 3ZJUA 1DJMA 4KDEA 5BSRA 3EA0A 2PBZA 4P80A 5IK2A 4EECA 3W9UA 1N2HA 3V2HA 3DT9A 2JFVA 5LDDC 4PYQA 2H08A 5CT5A 2ZWOA 3N0TA 3F7MA 4MYRA 1NW9B 3T7KA 1CEYA 2R8PA 4RIGA 1ZA2A 1XCMA 3TQIA 4CQMD 1VCMA 1H0KA 3CCCA 1SU7A 4IIJB 4WVFA 2NU7A 4Z4GA 1NM5C 2NXEA 4AP6A 1JXMA 1AUPA 1AJEA 1R0BA 2A9OA 2AF4C 3Q40A 2VHCA 4E6PA 4U7DA 4B76A 1C3EA 1BHQ1 1JEDA 2CNKA 3ESCA 1IVNA 3G13A 3OY7A 4M7RA 2QXTA 5D3ZA 1YMUA 1I3KA 5J5AA 2F1OA 1XTRA 4LXTA 1UMBB 3B1FA 3F9RA 2W2LD 2AV6A 3LUBA 3BF8A 1O7JA 2RHOA 4C05A 3OX1A 5FFMA 1TFUA 3BE4A 3MCTA 4IDDA 4IIUA 3L6CA 4MQBA 4UE3S 1GNPA 3NT4A 2QBYB 2MTBA 3KTOA 1PKEA 3RTCA 2FJUA 4CN8A 1RIIA 4PQRA 4YMVA 4GM4A 4C7OB 3AVYA 2VK8A 3NRCA 1UQUA 4NULA 1UP4A 3ZY3A 3GJYA 4M0UA 4IJWA 3ZK8A 1M2OA 1CUYA 1NATA 3FCOA 4QTXA 3SQNA 3ZHOA 1G2QA 4IM7A 3FMPB 4CL2A 2V6JA 2NXCA 4BNIA 4EF6A 1YJ5A 1XWIA 3K8ZA 2V7GA 4IINA 2HA3A 3B48A 2I3GA 4GMGA 4NWIA 1OVMA 4XPIA 2D6FA 2VTDA 2QEQA 1SBIA 1TM1E 2CJPA 1Y1TA 3CVOA 3LLMA 1ZK4A 4L28A 5DBOA 4AJIA 1IQPA 5JCOA 4CLEA 1DTSA 1GO2A 2X0RA 2XRYA 1J4AA 1KETA 1LB1B 2KJQA 2PVPA 2WM8A 3GU3A 1RVDA 5CJ2A 2FLWA 1FPQA 3AK4A 3V7FA 1I0LA 3H86A 4X84A 3EDQA 1KEVA 1PZXA 2I7XA 2R11A 4G09A 2BLNA 3A36A 1J49A 4LYAA 3W5CA 3VVBA 4IS2A 2H2GA 5CGZA 1UZMA 3TEMA 3KVNA 2I4NA 1MEEA 3MB5A 5ARCA 1K8QA 2WSBA 4OV6B 1QH8A 3OC0A 4GWLA 3RUAA 4UFOA 2V54A 2GTIA 3KYDA 1NVBA 2QI9F 3TOCA 5J3JA 4FYMA 2F55A 5HGJA 3DL0A 4BFCA 2BFBB 5IJ0A 1ZS9A 4TT3A 3TB6A 1S8AA 3WFZA 4D4JA 1C0LA 5D1HA 2ROQA 2YUIA 4YRJA 4AJHA 5LNK1 3OLXA 1D03A 2HT6A 4JEIA 1JQ3A 3UFBA 1AMNA 3CR7A 4R1QA 2W0MA 3LDFA 1T1SA 4DV0B 1DIBA 2BKVA 3BGOS 2XBLA 4MYCA 4Q16A 1T8YA 2PJUA 5CUQA 4FFLA 2A5DA 3EEQA 1VKNA 3H2SA 2QN6A 2HK6A 2PYDA 5LQAA 4CDMA 1NZFA 1OIVA 2VQDA 1TM2A 1SK8A 4KEAA 2FFJA 1ZCBA 1ZD4A 3W9BA 4EDHA 1WV0A 1KXZA 1GU7A 2RIRA 3E1GA 1FYXA 1BXZA 1IWOA 1T6NA 1T36B 2FWJA 2YMLA 4IDCA 3SIPA 2GPJA 3UJAA 1A8QA 4R1NA 2GD1O 2HWUA 3GVXA 2J4DA 4RFVA 5C37A 1A8SA 3AESB 2PUGA 4JV5B 4QKQA 3RIXA 3A27A 3BRCA 3D1JA 4IZ6A 1MUUA 3HNPA 3KZNA 3BD8A 3IPXA 3C43A 3K9BA 3PFHA 5EUCA 3OJEA 4TTVA 1DX6A 1Y8CA 1Q0TA 4Q18A 5KAMA 1IU9A 1YR9A 1HDEA 1XVAA 221PA 1LLFA 1NMXA 3C41J 5AO9A 1CJTC 5YASA 3RVQA 3FMGA 2IEDA 1O4WA 1E99A 1GL3A 2VAMA 3QVWA 1EP3B 1TC1A 2GH1A 4I6JA 4JBHA 2VPIA 5M3BA 4H7JA 2B2CA 3U3DA 4RPJA 2QX4A 5CGQB 2QD5A 3BTSA 3GJ7A 3QENA 4FYXA 1AQYA 1LY1A 1OX4A 3I9NA 3D4OA 3MYYA 5HRCA 3OTOB 1R66A 4LNHA 4NYMQ 5A4MS 2EG9A 3I73A 1GG2A 3QXCA 4A36A 3ZWWA 1OV6A 3BRSA 4DDWA 2A3RA 3IC5A 1KH3A 3CT6A 1E1DA 3DZBA 2RBKA 4RVSA 3W3ZB 4WN3A 3FLAA 3PX7A 1G55A 2FRXA 1BVYF 5JCJA 2NPFA 4B73A 4D92A 3L9XA 3UV6A 2C2WA 4E5DA 1BE0A 3VU3A 2GFQA 4B46A 4BN4A 2JVIA 4OHKA 2QRJA 1JWAB 4WFIA 3ITEA 3LC1O 2I1VB 5H3HA 1KO4A 1ZX1A 1XP5A 1RC1A 2PSEA 2PSFA 4JT8A 1DJPA 5AK0A 4BECA 5K3DA 3GN2A 3JXEA 3M9XA 4PSUA 4HGOA 1GVHA 2R60A 4C7VA 2H07A 1P77A 5G3YA 3Q3JB 4O2AF 2RH9B 1RQRA 1MOQA 1W30A 3VO1A 3PEWA 4A6EA 1CF2O 1BS1A 3F6BX 1QRUA 3VC3A 3AM4A 5E3IA 5BV7A 4L4XA 3B89A 3KSBC 4M0KA 3WL6A 1JFSA 1ECCA 4D9GA 2XA1A 5G0TA 4BLPA 2WE7A 5ESXA 1L4NA 2LDBA 4URHA 5B6IA 4OJNA 3TLJA 4BB0A 2ZRQA 4L0DA 1TCCA 3TLZA 3WS7A 3KSAC 4UDOA 4X54A 1TZKA 4JYZA 3SXUA 1E2NA 3PPXA 4ZOEA 3T1OA 3EXFB 1YU9A 5CMLA 2J0EA 5C8YB 2XNCA 4UU8A 1PHPA 1IPFA 3VH4A 2H52A 4EJSA 5AI0A 4CMEC 2NG1A 1RM3A 2YHIB 1MO6A 2JAPA 1WMBA 4TTTS 5F52A 4AO8A 5BR1A 2QX7A 4RFSB 3TSAA 4BRSA 3A4VA 4PGHA 2QTRA 4R6XA 1ZPDA 4EYEA 2A2ZA 3HBFA 4R41A 3SICE 2X0NA 5DM2A 4ZO4A 1ZN9A 3EARA 4Y2RA 4ZTBA 4TXHA 5IMBA 4W5QA 2HEGA 1G42A 4R69A 3LTNC 3H87A 4PFJA 2PZGA 7GPBA 3VOSA 5LOVA 3OOYA 1P2UA 1A98A 3IT3A 4CKXA 2GD6A 2YHBA 4R68A 5J47A 3KDAA 1XHLA 1H1DA 4KJZA 2PKWA 3PNVA 4OYYA 3JCZA 3OF5A 3L8DA 1CQZA 3KRTA 1JA9A 1OBOA 4M8LA 4C3UA 4FYIA 3RRMA 1OT5A 4ER7A 2EP5A 2FZVA 2GNOA 4JXZA 3GRPA 3O3MB 2EFJA 2DPLA 4FKBA 3RRYA 1FVHA 5FI3A 2OCYC 2GDZA 4QICA 2WD7B 3FNHA 4GMXA 3RYIB 1IMJA 2QM7A 4RJKA 4DR3B 3LUCA 3O8CA 1ORWA 2WMNB 3A1FA 3EFEA 2Y4OA 1XVLA 3SCZA 1KTVA 2EKZA 1DV1A 1G38A 3LUFA 1QV6A 1KGDA 2BR5A 3Q15C 4ND1A 5A1JA 4HAXA 3RAJA 3CPSA 3IV6A 2ZT6A 4DCCA 3VU9B 2JF0A 3LL7A 4PZDA 4RTKA 1QO9A 5JNUA 2R6JA 4FN4A 1C7RA 5JAZA 2RIPA 3MTEA 3P20A 3WGQA 1IBLB 4DSOA 4K9PA 4HFJA 4I9UA 4BE4A 3M83A 3PT9A 3N8HA 4YREA 1V16A 4ANFA 1A9RA 5LMZA 5CHYA 3K30A 3F5QA 2I0FA 1U2DA 4LOAA 4U7PB 1Y7LA 2EATA 1VSVA 3U39A 3KQMA 4WOCA 3RC2A 4R71A 5JW6A 2ZSEA 3DE2X 3OY2A 3WBKA 2QU7A 4Z99A 3W8EA 2NZWA 1W581 3WMFA 2D7DA 3CCFA 2OBXA 1UUFA 2YDYA 3PHHA 4MEBA 4BZWA 1H2EA 2XE7A 1A5BB 3ISJA 4IEIA 2NPIA 3H99A 3T7SA 2BJWA 2QN2A 3M2PA 2Y66A 4KKVA 1F8FA 1LTQA 1MIOB 1NVXQ 1NNSA 2VT7A 1OFHA 2XLBA 4IXNA 2OKGA 4M9UA 4F2DA 4NEQA 4ZZ0A 3G0HA 3OTQA 5JRZA 2Y0EA 2JFFA 3LYAA 5C4GB 1XJCA 1M67A 1S2NA 1A9XA 4GRIA 3IBSA 1R9GA 2XHZA 3HB9A 3GH3A 5FO0A 2WUWE 3V4RA 1MO5A 3BCSA 1ZD3A 2QTCA 2YNMC 3I9OA 5BMOA 5BWCA 1JHRA 5I7EA 2W6OA 3ETCA 5EKXA 2HUPA 3KB8A 4AD8A 4KR3A 1PQUA 1JIVA 4R1TA 3S99A 4ZEVA 3SSOA 1JLLB 2HXGA 4IWNA 2HMSA 1L7EA 2NV0A 4J03A 4D3ZA 4YV1A 4TX1A 2H06A 4ILEA 3TMKA 5K6TA 2RH4A 2C7PA 2VYQA 1W19A 4LWPA 1ODJA 4KYUA 4DR6B 3I09A 4YBRA 4HAVA 3FPGA 4B82A 5ADVA 4DJFC 4ROTA 5E3JA 4TZ0A 1P73A 3G8YA 3THSA 1MVOA 1O77A 4TLLB 2XI4A 3THXB 3LY8A 5DLEA 5BW6B 4HVTA 1I51A 3KSUA 4IWYA 4LK2A 3RS2A 3E5NA 2VTBA 1IVSA 4K2HA 1P0CA 3JWJA 2WIJA 4K6MA 4RUKA 3RDPA 4GBED 1I5RA 4I1PA 3MOIA 5DXFA 5LB2A 5C80A 3MFYA 3TQFA 1XZGA 1FNBA 2HM7A 2Q6KA 1MG5A 2H31A 3TVYA 1P7CA 2AFHA 4UHDA 4Q9LA 4YV7A 2TMYA 1FQOA 1YC2A 3CNEA 1DJNA 2AI2A 4MB6A 1QHXA 1UM9A 2C20A 2GEDA 2FF5A 3FIJA 4ARSA 2HDHA 2FW6A 1KSGA 4X44A 1UCFA 3DFFA 4LSGA 2ZU0C 3RT9A 1VPTA 4O1IA 2ZM5A 4IG9A 2R00C 3T5GA 2XVXA 3ZXYA 1LJ8A 1NXQA 3DBLA 1VSUA 4LMRA 3W5UA 3F7TA 2JG3A 1O97D 5F5NA 2V96A 2X2OA 4UVGA 2IPNA 1SU6A 4R1SA 3D3QA 1R18A 1A2BA 1IN5A 2RI6A 3NDJA 1P9NA 4K40A 2FA9A 3I1JA 5FQOA 5LBTA 2ZBRA 3M7IA 5JYEA 1L4YA 1T25A 1OXBB 3ECCA 4PLPA 3SC2B 5IMSA 1QRSA 5AICA 2AG0A 1M74A 3KSRA 5E6UA 2I54A 1XK6A 3IQHX 3I6IA 3N2KB 4Y0NA 5H82A 3BS4A 3H3JA 4LVNA 4RLSA 5ESDA 4YRFA 2JA1A 5G1NA 1SU8A 3EAQA 3AHDA 4J07A 2D2XA 4NBLA 1D3AA 1TYBE 2GPBA 4PINA 3EBOA 3N70A 5AWFC 5LYJA 3SBDA 4QPCA 4RY8A 3RSZA 1KFBB 2AYZA 4FFVA 5CDSA 4LECA 4MRSA 4Q05A 1S8OA 4YCAA 3OO1A 1FB5A 1QVRA 1VLVA 2QRPA 2PUBA 4FSDA 4MQLA 2DH5A 2FSSA 5C8ZA 4B3GA 3FRHA 3TIGA 2VDOB 1JIIA 2HQRA 3HKEA 3RUFA 5J43A 1NM5A 4IIDA 4R8SA 2AXPA 3ZQ6A 1ISFA 3H17A 5HIAA 5I7VA 4BDSA 2WMDA 4KNWA 2WHPB 4B81A 1WXEA 1Z68A 4C29A 3ENZA 5AUOB 1SCBA 2PJRA 3GLHE 3E6AA 5ALHA 1YZ3A 2DRIA 4BMPB 4BNHA 1JB1A 3L4SO 3OECA 3T06B 3GRFA 4PAGA 3Q41A 4XQ9A 1O03A 3G1WA 1TD9A 2B25A 2J6HA 2JK0A 1CUEA 3GCWA 3TF5A 4JQYA 3DSRA 2QN3A 1W4LA 1EFDN 4FC7A 3WLPA 2AOVA 3NMUF 3D6NB 3HDTA 1ISJA 2OECA 2Y0CA 1DJOA 2ONJA 1T5BA 3RFFA 1LWNA 2AHOA 3VJKA 2HJHA 2D0IA 4OMUA 2IKQA 4RD2A 5E9AA 5JCPA 1NBHA 2QMUA 1R0YA 2ZUUA 1BCSB 2ZG6A 1Z6GA 3F7NA 3KPVA 2UDPA 1PEAA 1IJKA 3T5DA 3T9BA 4HEJA 3U44B 3TLGA 1NBOA 1XD2B 1GUYA 2QE6A 5U1PA 4P2GA 3K35A 4NU5A 3MCAA 2QVGA 1TKCA 4Y8VA 2ICAA 5B1HA 3UJBA 4CZ2A 4J0JA 1K3FA 3DDOA 3L7OA 4TXMA 5CB4B 4RKFA 3T15A 1JLSA 1WKCA 5AFSA 1EWQA 2R9VA 3P9CA 1RJDA 4PX5A 3QTTA 4AJ9A 3KALA 3HWX1 5T3YA 4W7HA 2A1UA 1YGYA 1PRYA 2VTKA 4WPGA 4WACA 1QQBA 1FLNA 1IHXA 4LQ4A 4QYTA 1F6WA 1R4MA 1JKJB 2IHVA 3NWOA 4GUAA 4ZZ2A 3N2IA 1GSOA 3G2PA 5AJYA 1R1DA 1SVMA 2ZIGA 4P54A 2ZDGA 5TEWA 3U48A 4XCVA 3GJ8A 3QLVC 1U5BB 3TN7A 3TZ6A 2D00A 5IBRA 4C4YA 1EA5A 3K0FA 1DQYA 1PLJA 2QSYA 4MRMA 4V39A 3AV3A 3PTZA 2XECA 3QBDA 4ZYZA 4JA0A 2NP6A 2JGKA 3TXYA 5IXSA 1NVGA 3DFMA 1ATIA 5B53A 1GL9B 3OHMA 1VBNA 3VR6A 1E20A 4LMAA 4J1SA 2Z2JA 3UO8B 4G26A 1USUA 1KE1A 4LCJA 1QOZA 5ALTA 4RTRA 3RQIA 2JGAA 3CNNA 2B4KA 1JFFA 2CXXA 4K9OA 4TV9A 4EYOA 1IQ0A 4N01A 2Q50A 2ZITA 3EF3A 5ALSA 4OXKA 1H3FA 3KHSA 4HH1A 5E7QA 1VRVA 3KXLA 1Y7HA 1UDWA 3DTYA 3LIPA 2OM6A 4R0VA 4IL5A 5TQ2B 4OJMX 4F4JA 2BMJA 2JCVA 4PW0A 2P90A 3ICEA 1ZICA 2IK8A 2OBNA 2ZS9A 2IOFK 4I46A 2FHSA 2IYNA 3MPOA 4XLLA 5FTWA 5H80A 3OZBA 3RS3A 3U2QA 3RSFA 3KCNA 3OU2A 4NDZA 2X4IA 1JEQA 2IHBA 3WFIA 2GCOA 1CEEA 1CF9A 2I6UA 3UJ3X 3CM0A 1ZRMA 3QEMA 4YMWA 3ZDQA 4JI1B 4L4YA 4MUIA 5E9WA 4F06A 4E2YA 4C04A 2G5PA 3HXQA 1MQAA 3LKBA 1AKNA 5P8WA 4NPCA 5IYZB 3LYHA 3ME5A 1QRDA 4WN9B 4EO9A 4RA6B 3T5BA 1YHNA 2WT8A 4C4SA 1ZU5A 1FLAA 2DTDA 1J09A 3C3WA 2GF9A 4MR8A 4M9SA 3QMMA 2MMGA 3O84A 1JFTA 1B00A 3IDQA 4H6XA 2J30A 4RV4A 1ULAA 3A06A 1I2CA 4R9VA 5FTJA 3AU9A 4TKLA 1MW8X 3DTVA 2DPYA 2C9YA 2H2FA 1CJSA 1IZ9A 1V45E 2Q8QA 2VP6A 5G53C 2HADA 5IKOA 1UDCA 4RIHA 5KMGB 1IMOA 1E0JA 1THZA 4OHUA 4LZZA 3H1FA 2AG5A 4YLGA 1Z4MA 1A72A 2PV0A 3J81k 4GKJB 2GD0A 4F4HA 4FQ7A 4GYWA 2XXAA 4D2IA 5DTMA 3A9SA 1UEIA 4XD2A 3LWDA 1YS6A 1RDFA 4M8SA 2TMGA 3IVMA 1AXEA 4H9GA 3K5HA 3ZGYA 4DNQA 5FBQB 5FBKA 1ZEJA 2QPTA 4QRIA 3WVNA 4CRWB 1JDVA 4MMZB 1W9HA 1OUMA 3JTMA 3ANNA 5K8IA 2BFEA 1YR6A 3FVWA 3UHPA 2VPXA 3FOBA 3T0IA 4KPFC 2NU8B 1OMOA 1VMAA 4DV2B 4QXPA 2FSHA 1RP7A 3IPRA 1JJFA 1HBJA 2GPAA 2JAUA 3KAQA 3CZ4A 5FOTA 4BRUA 4CMEA 4DHWA 4UAJA 5BP7A 2JHFA 1OZGA 2PGJA 3G2OA 3EG9A 5CVDA 2B1QA 3AX6A 5LVAA 2DR0A 5DGDA 5FA6A 1TFRA 3G2JA 1WBBA 2PKEA 1T8SA 3IB6A 5ALJA 2QA5A 4QOJA 1HY3A 1E5TA 4GR4A 2AJLI 3JALA 1AA9A 1LPBB 3AY7A 1Q84A 4Q3NA 5SYMA 3VYRB 3WA6A 4E7OA 2FMHA 3PENA 4IVRA 4QOEA 2HA5A 2LUOA 1RBMA 1NXTA 2X4DA 4GM1A 2G9ZA 5B5SA 1QPZA 5EEGA 2ORED 3SLRA 1O94C 4IO0A 3AUKA 3S1LA 3W9YA 2HA6A 4UBNA 3O74A 2J9ZB 1B8VA 1GL7A 3G2KA 3ZQUA 4F2WA 4YAGA 2BE7A 3UXHA 2IYSA 3I9LA 1HFEL 2J0VA 3GT3A 4CCAA 3K0BA 1YI0A 4LZWA 1R27A 1SXJB 3SU8A 1ZLYA 1FTGA 5BWNA 3W3AA 2ZRJA 1MC1A 3TLEA 4QUGA 4KRXA 5A4FS 1CK4A 4F7DA 4ZDJA 2IEYA 3WL3A 4Y3UA 1ND6A 1P80A 1JTEA 2FRDC 2UZAA 3JQPA 3Q88A 4BKOA 4LQCA 1GP2A 2DH6A 3O1LA 4IDBA 3DVAA 4OK6A 1KWKA 3OX2A 4IOKA 2A1IA 4KRYA 3TUIC 1JLMA 3DEJA 3AMVA 5C7LO 3U4MA 3AYZB 2V55B 3DFIA 3H5OA 3HKDB 3INRA 3DJYA 1P0FA 3SX2A 1HEUA 4C89A 3ZD6A 2PZMA 5KREA 4LF8B 1XRQA 4KREA 2CMFA 1O6GA 1M9NA 3DMDA 4RQTA 2IRWA 4PYOA 1DPGA 1JSZA 2HHAA 4DLLA 1OROA 3JRXA 1YDHA 3INGA 3ZTTA 2ZJFA 4BAZA 5L6MB 3WL8A 1NUAA 3BD6A 3L18A 1I2DA 4NZZA 3MBIA 4ZI7B 3R3VA 4O3FA 2QQGA 1CZHA 5BQPA 421PA 1VYVA 3GF4A 3ZJ4A 4O5OA 1G4HA 3I8SA 4BY9E 4A23A 1TMGE 3TMYA 4U2EA 1V5EA 1G64A 1M6VB 2BF4A 2JIOA 4M1OA 3VZQA 2Z4TA 1WZEA 3G0IA 3KJZA 1L5RA 4KACA 5DRYA 3B3FA 3U26A 5I7UA 5IFKA 4CL8A 2XBUA 3M1YA 1Y8AA 4U2BA 2CXQA 2DFTA 1EWVA 2LKCA 1NMQA 3FFBA 3TDNA 3K4HA 3RVPA 4D56A 4UW9A 2V3WA 4P5PA 5KTYA 5LPNA 4P0QB 4MWTA 4LCEA 2WICA 5JWRA 2H5LA 2C92A 1Z0JA 2F9LA 2JGJA 2LVBA 1CYEA 2LCFA 2Q5HA 4LHEA 1JG2A 3LI2A 2QVXX 3EIHA 1IZYA 1U90A 2FX3A 1UFVA 2CZGA 2XQVA 3EW7A 1BMFD 3N9IA 4QUIA 4RHFA 4JI6B 1OV4A 4H3VA 1W36D 1TQ6A 1UBTS 2YHUA 5G4KA 5JDIC 2ZTMA 1I01A 2C2OA 2O7NA 5KTKA 1P7WA 2YNMA 3ZLJA 2DR2A 1ODIA 1OAOC 1PWXA 4MW0A 1P1JA 4WDQA 3NGLA 2O50A 3GP3A 4GI3A 1Q7EA 3Q2IA 3VVLA 3E7FA 1I1QB 4C20A 2QTVA 2XW6A 3INNA 3OMWA 5GGYA 1U7XA 1FFEA 2VDKB 4KN8A 5AVWA 4LF4B 1PR0A 1A4UA 3KJNA 3MS7A 4FM9A 2JH8A 1F4VA 1Z6XA 4PZZA 4ZARA 3HBJA 2KW5A 1REQA 2CJYA 3DMGA 4GKBA 1W29A 3PITA 2I3AA 5B2FA 4PANA 2QUHA 4BMCA 3HCFA 2GA8A 5FEMA 2VJLA 4GX1A 5I01A 2ERXA 1OLXB 3C8HA 2NAPA 5FV7A 2QNIA 4Q00A 3R76A 2GCNA 4DDMA 2HFKA 5GMOA 4DA0A 1L2TA 1FMFA 3TVTA 4QODA 3W5HA 3ADCA 4R1UA 4O8ZA 5EWMA 1PFGA 1ZUWA 1SOWA 4M1TA 2AD1A 3H6GA 3GLKA 3L8FA 3SXJA 2BY4A 4EGJA 1QHFA 3RFTA 2DUUA 1CUXA 3NHSA 1HMPA 4U4AA 4Q12A 1QF7A 3QF4B 3DBRB 2FN4A 3VR2D 1SVLA 1VJTA 3C6MA 2QORA 1EK0A 3LXMA 5KYTA 2NU6B 3VVCA 4M49A 1VTKA 2W6CX 1HT1E 4X5OA 2AWOA 3G5LA 3LA6A 3KB1A 5F5XA 4EDFA 3P5SA 2PM8A 2R00A 2JIZD 3BCUA 3ZWKA 1EEXB 1Z2NX 3F96A 2H9IA 2W98A 1Z56C 2ARKA 4G4SO 1NUUA 5KC8A 2AKEA 5FLKA 3BFJA 3E7XA 4TM8A 1L4EA 2HB6A 2OK7A 2A9KA 3RRJA 1PI3A 3VH3A 2FWIA 2WKQA 3EDYA 5B3JC 8ADHA 5F9HA 4DLWA 4KTTE 1I32A 3JQBC 3LXUX 1K68A 4HXFB 1U3TA 2UVQA 1NSYA 3TFQA 3USES 1NT2A 1R6UA 4DT1A 3VPAA 1U2EA 4ZCTA 5LZ4A 1UT8A 1SHJA 1YONA 1PL8A 5BUCA 1Z5ZA 2IXBA 3CHYA 5J4HA 2ZW9A 1X8JA 5DCWA 2C7QA 1ECJA 1WZCA 1OFUA 4I50B 1RVV1 2VT2A 4X6YA 1O6CA 3K0CC 1A9YA 1P19A 4HRYA 2JGDB 5TMPA 1VJ0A 1M66A 2AN9A 3M6IA 4B32A 4UEOA 4ASUD 3JR3A 2GILA 3CN9A 1VPLA 3RCBA 3ST7A 1T5HX 5JPIA 3FHCB 1FJXA 2POCA 1A8HA 2QGFA 2A57A 5EESA 4BEBA 3KV3O 4MEJA 1HDCA 3VNSA 1G20B 3QVMA 1JHZA 3WGVA 3RAFC 1DAPA 2Y0PA 2ECPA 4JLVA 2OFPA 3L93A 4FNOA 4AK9A 1MAAA 1T6YA 1V3UA 3DMTC 2WFMA 1NUQA 2I6QA 3HY6A 2OV1A 1U1FA 3WLKX 3X43A 3CY6A 4QGAA 4B71A 2MWMA 3C45A 5K8JB 3RAPR 4KSYA 4PZLA 3ZU5A 4P0PB 3MWJA 3NHBA 2Q9BA 2NXJA 1O6BA 5EE1A 1AK2A 3V1LA 4YIKA 1E1QA 3QPVA 1VPDA 1FDIA 4BMXA 3WRXC 3NH9A 1H5NA 1DUIA 2VKQA 2AQIA 5JJ5A 3GQVA 2D1YA 3DE4X 3ILSA 3GRRA 3IQGX 4FDTA 3UF0A 3MUFA 4Z3OA 1N6HA 1GRNA 1MTOA 5SICE 3HR7A 2ZU6A 1HORA 1XZMA 3OD5A 1A4RA 3V8VA 2P8SA 1K0UA 1A82A 4RORA 3C14C 1ZXXA 4F38A 4PWYA 2CFTA 4KPUB 3WNQA 5AUNB 2BHRA 4NX2A 4WJLA 2B6NA 2CLDX 1DEAA 4JKOA 3C3MA 3MWEB 2NO5A 3AF5A 3H4TA 4Z1MD 3CONA 5F2OA 1HETA 1NRWA 1XIVA 1RE1A 1YB1A 2G40A 1MJ5A 3DGFC 3H4IA 2C8LA 3HHEA 5AVJA 5SY4A 5ELMA 3DLPX 5A4IS 5GIPE 2XCIA 1Z4QA 3V7NA 4D81A 4RNCA 1K88A 1XL1A 3Q3VA 4I4NA 3AERA 3CISA 4OJTA 4EX7A 2P2CA 3FZYA 1J97A 5CIYA 3DE5X 5CLQA 2PVCA 4YAJA 2GO7A 1T5DX 1U98A 1ISSA 3FTCA 1SC1A 4NH4A 5EJ5A 3VR0A 3I92A 4QGFA 3E82A 2WD8A 3PICA 3V97A 1BGVA 3G89A 5CLGA 3P27A 1T5SA 1GIAA 4AQ7A 1DC6A 1WDWB 4RA9B 3QLVA 3RYHB 2OWEA 3TIFA 5BYKA 2XY4A 3H13A 2BBSA 4L4RA 1RYDA 1Y80A 1JL3A 3V6MA 1DAHA 2WJYA 2YS6A 3Q10A 1VDZA 4YDQA 3Q7IA 1KZHA 4CJXA 4BASA 3L1IA 5JSZB 5BMVB 4D3SA 3TNLA 3SYKA 2OAEA 1LTKA 2UU9B 1VJRA 4EI2A 2W83A 3IP1A 3GZJA 5E0KB 2H1IA 3NALA 1RAEA 1Z33A 2VA9A