4KE9A

Crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with an 1-stearyol glycerol analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
EQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke9A00
3O95A 4QA9A 3E0XA 1UKAA 2P8SA 3OURA 2R8BA 2ZJ6A 2XE4A 4Z49A 4FFVA 3WK5A 3S8YA 2UZ0A 1IUOA 5LZ8A 1QIKA 3X3HA 5KREA 5AM1A 5AI0A 4AZ0A 2GYVA 2AJBA 4QLAA 2WKWA 4YK7A 4G1FA 1H23A 2D5LA 1DTEA 5ALHA 1TCBA 1CUVA 3KDAA 2VT7A 3WL8A 5AOAA 1VE7A 1GQRA 2XUAA 4C89A 1XKTA 5ALVA 1QFSA 3QVMA 1EI9A 4MQMA 3VJKA 4Q05A 3V1MA 5BWBA 5IH7A 2GZSA 5ALEA 2C5FA 1QTIA 4OB7A 1LBSA 4RPCA 1XQVA 2JGMA 1QTRA 4KAJA 4C6HA 5DTJA 1F0PA 4HXGA 3L1JA 4FNGA 4BCCA 2CUTA 1LPOA 1CUFA 3HXKA 4ROTA 1ODTC 2C58A 4B84A 4XIIA 2PSJA 3AZQA 1AQLA 1K6EA 3AIMA 1G5FA 3QH4A 3R3VA 4X97A 2HU5A 3G0DA 5EHZA 3WWOA 4IQ4A 5I9IA 1ZD5A 3BF7A 2I3DA 2CKMA 4BAUA 3FLAA 1CIJA 3BJMA 2X76A 4H7DA 4Y7DA 3DS8A 5D6OA 2AJCA 5EFZA 3H04A 2HA0A 1JJBA 3AIKA 3STYA 5D3KA 1D07A 2B9VA 2WUGA 3C43A 4IH9A 4BC1A 1QOZA 2OG1A 4OSEA 1XROA 5DLPA 4PF1A 4B9AA 4BB0A 1TKRA 4MWTA 2XQJA 2PSFA 2Q0XA 1UXOA 5FXMA 2C5GA 3V48A 3IUNA 3B5EA 4WDRA 3G7NA 2VEOA 3G02A 3DNMA 3STXA 4ZV7A 4GLBA 4K6KA 5A7FA 5AJHA 3C6BA 5ALYA 4NS4A 1QJ4A 3TRDA 2O7VA 4LYEA 4UBOA 4B6GA 1YASA 4Y2RA 4A23A 4C4ZA 4DYHA 4UHBA 3ICWA 5K3DA 4DNQA 2OCIA 4X3CA 3VKFA 5I8PA 3E3AA 2DR0A 4B80A 1KU6A 4Y2VA 4X90A 1UK9A 3DEAA 5HKAA 3WWCA 5AM2A 1VOTA 4EUSA 1QIMA 5E4YA 3I1IA 4BATA 2WFLB 1EINA 3OPMA 3C6ZA 1CRLA 1MX9A 1THGA 2WTMA 5FV4A 5HQ3A 1GKKA 3JW8A 1OXMA 1R4ZA 5JZSA 2ORYA 4EZIA 5EI5A 1XKLA 1T2NA 3WKDA 3DL7A 3V1KA 3AFIA 3FCYA 4U2GA 1DX6A 4DMKA 5JALA 2XUQA 4PSDA 3OG9A 1YR2A 1NU8A 3L1IA 1EK2A 4B85A 2J4CA 2IITA 2HA6A 4BTLA 5BWCA 2C7BA 2PSEA 3QPDA 2XMQA 4Q3LA 2OQVA 5CT5A 2AJDA 5K3AA 3VJLA 1VE6A 3HSSA 1ZD4A 2BUBA 4A5SA 4BBZA 3DJYA 2D0DA 4J0HA 5DNVA 1EDBA 2QM0A 3F96A 1WM1A 3HC7A 5KWJA 4EY8A 4XVCA 1JU4A 2H9YA 4N5IX 4DMCA 3WI7A 3DKRA 3DOIA 5AI8A 3V9AA 4QE3A 3F9CA 4P9NA 1ETHA 3PF9A 3OC0A 2WTNA 3BE8A 4MWSA 4UBJA 4BAGA 5FPPA 3QMWA 3GELA 4C88A 4DNOA 1C4XA 3G0CA 4CIAA 4W9RA 1N5MA 4BVKA 2CJPA 2VSQA 1EB8A 2H7YA 5JASA 4L0CA 5K3FA 2CZQA 4B7ZA 3IVMA 2HIHA 5HFAA 2JEYA 4BE9A 1RP1A 1BU8A 2X8BA 1BROA 4L9AA 4Y2JA 2QJWA 1MX1A 2DCMA 3WLAA 2HL6A 3WKCA 4A16A 5ALDA 1EK1A 3OOSA 1XZBA 1ORVA 1CUWA 4CFSA 2Y6VA 1LPBB 5AM3A 3RARA 4N5HX 3L1HA 4F5ZA 4QLOA 3WK4A 2EDAA 1PJAA 1LZKA 4WFIA 4QDOA 1DINA 3WL5A 3IUJA 1ZIXA 1HDEA 1H2ZA 2XMSA 4C4YA 3I2IA 2WU4A 3NUZA 1K5PA 2VJCA 3R0VA 1UFOA 4X91A 3LP5A 4H7FA 3VISA 4FBLA 4IH4A 2H7XA 4H7EA 5FPQA 1UKCA 3ESCA 5LKRA 2ACKA 4N8DA 3A2LA 5HF6A 1WOMA 5A71A 3LIIA 3T4UA 5JANA 2RHTA 2HA7A 2XUHA 3EQ9A 2WFZA 1SOMA 5LZ2A 4RE6A 5K3CA 1TCCA 1TRHA 1YAHA 1GQSA 4BDSA 3AZPA 3T52A 4F21A 3FSGD 4J3JA 3WJ1A 4BVLA 3HI4A 1BEZA 2WQZA 3EBLA 3AINA 4ZREA 4HVTA 4E11A 4FDMA 1ZICA 2O2IA 1EH5A 1RWQA 3IUMA 4AO7A 3DQZA 3ZI7A 2QJRA 4KRXA 4AN1A 2W6CX 2ECFA 2XUPA 2WHPB 1XZMA 1DQYA 3H17A 4O08A 2RI6A 1AURA 5AHXA 4J0GA 5AK4A 3STUA 3ZWQA 4LKOA 1QLWA 1QIDA 3H1AA 1JFRA 5AI6A 1ZD3A 1MTZA 4KE7A 1WPRA 3K2IA 2WFLA 2CMFA 5JARA 1EDEA 5FOQA 2WG1A 1J2EA 4XX1A 5FP0A 1MU0A 2ONCA 2C4HA 3CCBA 4G9GA 3H2KA 3FOBA 3I28A 3C8HA 4HRYA 5HF5A 2I78A 4UBIA 3ZLUA 2PSDA 1X2EA 1UOPA 4UBLA 5ALUA 4BC0A 1W6RA 1NX9A 1XZIA 4FLEA 5D7BA 1XRQA 2Y1KA 3W9BA 2HU7A 2Z3ZA 3AZOA 4EHBA 5AKHA 3WYNA 3O9MA 4B0PA 4CIBA 1J1IA 2BFNA 5AKGA 4GWLA 3R41A 3FLEA 5AM5A 1RYYA 3M3DA 4LHEA 2V96A 5AOBA 5AKYA 1H2WA 1BCSA 2PU7A 1P0PA 4OU4A 4X7BA 2OCLA 1CUBA 1FSSA 4I3FA 4M0FA 2VAVA 1BN7A 2J4FA 2XQFA 1MAHA 3H2IA 2VF2A 1CUAA 3FVRA 1UZAA 1FFDA 5ISMA 1MJ5A 2PSHA 1CQWA 1WB6A 3IB3A 2QUAA 1CUUA 3HABA 1LPAB 1SCQA 2X5XA 4BP9A 3FCXA 4AO6A 3IURA 4QWMA 2H1IA 3DOHA 3A2NA 1FFBA 5T4FA 2PUHA 5AKJA 2Y2VA 1CPYA 3K9BA 2HM7A 3A6ZA 4KEAA 2OGSA 1A7UA 4FBMA 3WQHA 2XQKA 1FJ2A 5IKXA 4G8CA 4E46A 5T4EA 2ZYRA 4W63A 4KYVA 1MX5A 4H7HA 4Y2PA 2JIDA 2WG2A 4P92A 1L7RA 1QGED 4TGLA 4B83A 1TIBA 4QWWA 3G9UA 4FOLA 5IVHA 1XZCA 2PM8A 5ALXA 1EVQA 2WIGA 1IZ8A 1VZ3A 2QMQA 4H7JA 3FWHA 3KWJA 1K4YA 3SWWA 4ZGBA 5AO9A 2HRQA 4LXHA 2FJ0A 2XMBA 1ISPA 4DMFA 1CUGA 2JGFA 4G8BA 1TQHA 1UOOA 2WJ4A 2B4KA 2WJ6A 3C5WP 1LNSA 2XMGA 1XZJA 3WKEA 3ESBA 4PNZA 2RIPA 5SYNA 5CBKA 4WY8A 3FSGA 1CR6A 5AI4A 1BS9A 1VLQA 3I6MA 3G0GA 4BZWA 2DHEA 1AKNA 1G66A 5K3EA 5ALOA 1W52X 3PUHA 4BRSA 4BZZA 4S0XA 4X6UA 1A88A 2HADA 1TCAA 5ALPA 4ZI5A 4ZRDA 5CH8A 5LZ5A 3Q0TA 2ES4A 5CH5A 2CEKA 3A70A 1W75A 5AM0A 1EB9A 4BP8A 3KOOA 2Z8ZA 1AX9A 1VXOA 2I3ZA 2VATA 3C70A 1QFMA 3I1YA 1FFEA 3WWDA 4UHHA 2PBLA 3SX4A 3ESAA 1EA5A 2XLBA 3HZOA 3ILSA 5AH0A 3V1LA 4GI1A 1ACJA 5JIBA 2YYSA 3R40A 1BCRA 2WHRA 3O4GA 4U2EA 4UFNA 2WUEA 1VZ2A 3FNBA 3FVTA 2OQIA 3M82A 3G0BA 1MNAA 4J03A 4HXEB 5ALMA 2B20A 1QZ3A 4PO3X 4ETWA 3KWFA 4Y2SA 3D0KA 3H0CA 4QNNA 5HK8A 1Q83A 1J06A 2XI4A 4GXNA 2ACEA 3O0DA 3WA6A 3FYUA 3GFFA 1XZGA 3KSRA 4G8DA 5DYWA 1IUPA 2DHDA 1HQDA 4M0EA 5K5EA 2LIPA 3G9XA 2DQYA 4U2DA 1BE0A 3FYUB 4NZZA 2VTVA 1F8UA 3HACA 4AXBA 3PFBA 5ALKA 3HRHA 2BUCA 3DKKA 1IZ7A 5ALRA 5A7GA 2QTBA 4QDZA 2R11A 5HF8A 2XUGA 4EY6A 1O6FA 3F98A 4DNFA 3PF8A 5CXXA 3HEAA 3WL7A 3BXPA 2HA5A 5HKBA 3PICA 1XZAA 3H19A 1J07A 1MN6A 3G0IA 1JI3A 3W06A 1ZOIA 3VXKA 2EDCA 4BDTA 4E15A 4Y9SA 3W2TA 3EQ8A 1A8QA 1W4LA 1XZEA 1CUSA 3CCCA 1UK8A 3P2MA 2XMDA 2PU5A 2WSLA 1XRNA 1HKHA 3B12A 1YA4A 2BCEA 2OPHA 3MVEA 1CUEA 5I7UA 4AMZA 4B82A 2YXPX 2Y6UA 2ZYSA 3OTQA 5EHXA 4QEKA 4X93A 2DSNA 5A7HA 2IIVA 3STWA 3D7RA 4IHAA 1PV1A 5FRDA 1F0NA 1HBJA 5AK6A 2ZYIA 1NU6A 1ORWA 2Z5GA 2XMCA 1EHYA 4PV7A 5JAHA 2WHQA 4OCZA 5T4HA 2HA2A 5LKAA 3WZLA 1CUCA 3WJ2A 4UHDA 3O4JA 4W1PA 1QO9A 3GUUA 4TVKA 2O2GA 3GA7A 1R9MA 2QS9A 1AC5A 5CTAA 3F97A 3G8YA 1UK7A 1MPXA 1GPLA 1W1IA 4MYDA 1CUYA 2BJHA 2WLSA 4W1SA 2JEZA 1L7QA 5A6VA 4Y2YA 4CG1A 2EEPA 4ITVA 1UKBA 2FJPA 2RONA 2QRUA 2RGUA 1ZJ4A 5AKLA 3RKSA 4OU5A 1XRLA 4EY4A 5HZGA 5DYYA 5AIBA 4X71A 1WB5A 4RNCA 1K63A 4UBNA 4P93A 4UFOA 4KE6A 5AKXA 4QZVA 4H7IA 3M81A 2RAUA 5EIEA 1WCYA 1THTA 3AILA 2FX5A 2G5PA 3DYIA 3O4IA 1XZDA 4RGYA 5HFNA 2VJBA 4AZ3A 5JD4A 4KACA 2XUFA 3WYDA 5LZ9A 1XLVA 5CURA 3C45A 5ESRA 1QIFA 2JGEA 2BGNA 2RHWA 3ED1A 2O7RA 4LXGA 5E2IA 4KE8A 4FLMA 3WK7A 4FKBA 1EVEA 1P0QA 2FUKA 3R3UA 1ZJ5A 1YCDA 5BOVA 1G4HA 1Y7IA 2JGLA 5CXUA 3R3XA 1FFAA 1GPKA 2V9ZA 2DFPA 4CI9A 1XQYA 2G5TA 2J3DA 3G9TA 4FLFA 2HDWA 4OD0A 1LPPA 3KD2A 2GZRA 3PUIA 4ZXFA 3I2GA 3D4LA 2XUIA 2V97A 4F0JA 1SFRA 4GDMA 1WHSA 3BDVA 4DM7A 4E14A 1EX9A 3FYTA 1ODSA 4DSAA 1Q0RA 1KU0A 3IIIA 4KRYA 1AZWA 4DTCA 5ALIA 3MUNA 2GYUA 3U0VA 1SC9A 2WUFA 3C87A 1C7JA 1XQXA 4UPDA 1OILA 4H7KA 1GZ7A 4K6GA 4OYLA 1DT3A 1ZD2P 3H18A 3HJUA 5JAPA 4QDTA 3KXPA 5HK9A 5AI5A 3DLTA 5ALGA 5DNWA 1MO2A 4UFPA 4U2BA 1Q0ZA 2HU8A 2O2HA 4L3WA 1B41A 5YASA 1E5TA 3BL8A 4GW3A 2WIDA 3NGMA 5C8VA 1N8SA 4GECA 4Q34A 1CVLA 4QDUA 4G4GA 2H7CA 4UBMA 4AMYA 3ANTA 4X6XA 3C6YA 2QT9A 4BVJA 3H2HA 3R3WA 1Y37A 5BV7A 3D3NA 2VJDA 2ZJFA 3NWOA 3ANSA 4B0OA 5DNUA 1LPMA 1XZKA 5AK3A 4FHZA 3JWEA 2XQGA 4JUIA 2Z3WA 3YASA 4CCWA 4W1RA 4CCYA 4WY5A 3F67A 4ZV9A 2OXEA 4ARAA 4X85A 1CFJA 3I6ZA 4FMPA 1XLUA 2DQZA 5JZBA 3EQ7A 4CG2A 2DHCA 4J0IA 1BN6A 4WFKA 1PFQA 2HA3A 3OM8A 4EBBA 3HLKA 1E3QA 2OGZA 4JNCA 2BGRA 1ZI6A 2QUBA 3GZJA 3STVA 5KWIA 1XFDA 4AB1A 4P08A 4FWBA 5FKJA 3SC2A 5C8XA 1H2YA 2W22A 3BJRA 3WK6A 1GKLA 2I03A 4DSZA 1L7AA 2OGTA 3ESDA 3F8SA 1WB4A 5AKKA 2XUKA 3H1BA 1MT3A 3D59A 4JYPA 3N0TA 3C6XA 2ZSHA 2ROQA 1CUXA 4G5XA 2QKYA 2C0QA 3ZPXA 3CXUA 4J0DA 4J0JA 4BCBA 5JATA 3IDAA 2QOEA 4J0KA 4KAAA 4ZWNA 3MUOA 1GXSA 2PUJA 4HTAA 2VQ6A 3ZV7A 1CEXA 3N2ZB 5C8ZA 1Q84A 1HLGA 3EIOA 2VAXA 2J3QA 2V98A 5AI9A 2HFJA 1U2EA 4YPVA 4OB8A 5ALZA 3UUFA 3PFCA 4X95A 2WFMA 4DMHA 2OLEA 5T4BA 3R3YA 3BDIA 4J0CA 1O6GA 1R3DA 5JAUA 1T4MA 5ALLA 3UUEA 1F6WA 2XLCA 5LLSA 3PDCA 2JGKA 1YB6A 2YH2A 2HA4A 2B61A 3MGAA 1ZI9A 1LLFA 2WIFA 1U8EA 4KR0A 2WIJA 2HHAA 1P0MA 3IUQA 1ZGBA 4IH1A 3WIBA 1R88A 2E3JA 5E4JA 3I2FA 3K6KA 5JYCA 1ZIYA 3O4HA 4QDXA 4AO8A 5E4TA 4X6YA 4DGQA 1S8OA 5HQ3B 2XMRA 5JAOA 1QIJA 2XUJA 5AOCA 1LGYA 4LYDA 1DT5A 1H2XA 4X00A 2NW6A 5ALTA 4L72A 3STTA 5CRIA 1HPLA 3GROA 3WIOA 4AX4A 3PI6A 4H35A 3QM1A 1G42A 3WKAA 1X70A 2WILA 3D2AA 1UWCA 1QIHA 1VXRA 2XUDA 4PSCA 5A62A 5IVKA 2WIKA 2GBFA 2WM2A 4ARBA 1YB7A 1TAHA 5CT6A 2QXUA 3TEJA 1IMJA 3I2KA 5AM4A 1K8QA 3R3ZA 4FFWA 4PW0A 4K5QA 4FNMA 1HL7A 1JJIA 3B3QA 2XB6A 3BIXA 4FTWA 3WK9A 4GBGA 5DJ5A 1KEZA 2WJ3A 4W1QA 3ICVA 4UHCA 1FFCA 2BKLA 2WU3A 3FYUC 3IULA 1VKHA 1QE3A 4MXDA 3TGLA 3QBJA 1MNQA 3DYVA 3FAKA 3I2JA 3QPAA 4CCYB 3LIPA 2PVSA 1XLWA 4PQEA 2WHPA 1XRMA 3DL4A 5JD6A 1E66A 3HYSA 4KE9A 5CT4A 5K3BA 2GBIA 3JYHA 5EHQA 1XRPA 3DDUA 1CV2A 1LZLA 5CT9A 1UOQA 5AICA 4UHFA 3W05A 1JKMA 2ZJ7A 4PSUA 2HRRA 5DWDA 2PPLA 2CBGA 4BCDA 3SK0A 1QIGA 4D9JA 4OB6A 5F4ZA 1R50A 4J7AA 2Z8XA 5C81A 1XRRA 3WWPA 2AJLI 4G9EA 2WG0A 4AQDA 3W9UA 4YX9A 2QR5A 3I2HA 5ALNA 4B9EA 4Y2QA 5LIPA 5EGNA 1WPXA 1GT6A 4G4IA 5A2GA 3DD5A 3I6YA 1LBTA 4H18A 4WJLA 1Z68A 4OUKX 3WA7A 4UBKA 4KAFA 4CG3A 4G4JA 4H77A 1AMNA 4Q82A 4X94A 1C7IA 5CW2A 1P0IA 4GHWA 1M33A 1QO7A 3IBTA 4WDQA 4MEAA 2WUDA 1E89A 2VJAA 3WZMA 3W04A 2JF0A 3AJAA 5AP9A 1N5RA 3ZLTA 1U65A 3CN7A 4GEGA 3UMJA 2PL5A 2HFKA 5CMLA 4DLNA 5JD5A 3AUKA 3H2JA 1ODCA 4AN0A 3QMVA 4Q3KA 4Y2UA 4HS9A 3QITA 1GPNA 1XZLA 2G4LA 5H3HA 3RLIA 1BEEA 1CUJA 5FUMA 4LXIA 3D5EA 3LS2A 1IUNA 1QONA 1DU4A 3BIWA 1VA5A 4BTVA 4C4XA 3WL6A 3ZLVA 3RK4A 4N8SA 2AXEA 1XQWA 1VJ5A 2ZSIA 4BYMA 4WFJA 3VJMA 4DNPA 3VDXA 5FLKA 1LPNA 3VVMA 1JT2A 5HF9A 1JJFA 3D2BA 2QVBA 2ZVDA 4MQLA 4MEBA 2YASA 1CUZA 3AIOA 2C0PA 5DTIA 3D2CA 2JGJA 1JMKC 1DX4A 3H2GA 3WMRA 1OCEA 1E8MA 5AK5A 1SCIA 1R1DA 1QIEA 3LLCA 1CQZA 2OAGA 4IO0A 2BUAA 1JU3A 1W76A 5IVDA 2XDWA 3U1TA 5D3ZA 4HXFB 2JBWA 1USWA 4YASA 5J3JA 1YAJA 4Q3OA 4K2AA 2CB9A 7YASA 4Y2XA 2G63A 4EA6A 1A8SA 1CUIA 1CLEA 2OCGA 1XZFA 3C5VA 3EF3A 3CN9A 4WCVA 3FLBA 1CUDA 3C8DA 3TJMA 4INZA 4EY7A 3WWEA 5HCUA 1LPSA 4UHEA 4V2IA 4HRXA 2XT0A 1B6GA 4X92A 1E8NA 1ZI8A 3QYJA 1VA4A 5SYMA 4NVRA 2VA9A 5CT8A 3VVLA 5LP1A 2OCKA 3A2MA 1E8DA 3GBSA 4TPKA 1TK3A 5AKIA 5JADA 4JH0A 3G9ZA 2ZYHA 4I4CA 4OPMA 2GBCA 2GBGA 1Y7HA 2BAGA 1R9NA 3FBWA 5ALQA 2PX6A 2JGIA 4DIUA 1ZGCA 5LZ4A 3NOXA 1DQZA 1CUHA 2K2QB 2AJ8A 5AIAA 3PE6A 5ALFA 1N1MA 4C87A 1BRTA 4JEIA 1YSCA 1SCKA 3IA2A 4H0CA 1X2BA 4XWGA 1U4NA 4Y2TA 1A8UA 2Y2UA 5LYYA 5LZ7A 5K3FB 3S2ZA 2XQIA 5ALWA 4K6HA 5DYTA 2QZPA 1H22A 2QXTA 5CH3A 3QPCA 4M0MA 1YS1X 5ALJA 4EB0A 2PKYX 4UUQA 5JZ9A 4I19A 4NMWA 5KBYA 3V1NA 5C7YA 1YS2X 1WHTA 1IVYA 2XMZA 5ALSA 4HAIA 5FDFA 3BF8A 4EY5A 1QIIA 4MJ3A 1MAAA 5EIHA 4HZGA 1XZHA 4C01A 4BE4A 1UT6A 1GGVA 6YASA 3DCNA 3QMMA 4OYYA 4BAZA 1JMYA 1DWOA 1DWPA 3WKBA 1I6WA 1AUOA 1DWQA 4BRZA 4U2CA 3WK8A 3E1GA 3LCRA 4KJXA 4JYMA 3BWXA 3E4DA 1AGYA 4F60A 4MYSA 4LIPD 3QZUA 2OAEA 2XUOA 5AKEA 5EHNA 1EXWA 3RM3A 2VT6A 3M83A 4XJVA 4B81A 1EDDA 3Q8WA 4Q1VA 1YA8A 4N8EA 4U2FA 1UK6A 4RE5A 5AKZA 5EIAA 3O9VA 2IX9A 2GYWA 5IVIA 1ACLA
chains in the Genus database with same CATH superfamily
1DP4A 1KH2A 3U3JA 1QOPB 2JZNA 1S0UA 1T25A 3DV2A 1CRPA 3O95A 2DGDA 1Q19A 2PWBA 4MQ6A 1IWOA 1SUDA 1P1JA 4LSMA 4BNYA 4QA9A 3QWIA 5CITA 3OFNA 3E0XA 2RHMA 2VVTA 4JS0A 3TM5A 2WM9B 4JYZA 3PVZA 3IV9A 1QFYA 3OURA 4PLHA 4NOJA 4EJ2A 3PR1A 4I1RA 2NT3A 1LWNA 2XE4A 2CXOA 2NUTA 4B3DA 1KIFA 1T8UA 2ZI5A 4OIMA 4Z53A 1EG2A 3PYMA 4E5DA 3I8SA 5LZ8A 1QIKA 1I1NA 1MO6A 1V2HE 1XHLA 1YR8A 3FGNA 4FFBB 4LC1A 4XOUA 3X3HA 1E2JA 4DPLA 5KREA 3RS4A 4R16A 3BUSA 3A6LA 3GCZA 3FNIA 2WAYA 1II0A 4C07A 2R7KA 1PW5A 3CLTC 1J09A 3C8ZA 3OECA 3QIVA 4ML3A 4C4SA 3HYLA 3WDKA 1EP3B 2GYVA 2VPTA 1ECPA 3ZWAA 2X0NA 1M8PA 5DNYB 5DVZA 4XLZA 5JLAA 3IRUA 5BSMA 2AE2A 4YK7A 2ZVPX 4G1FA 4R01A 3RE1A 1WDWB 1PWHA 2WP8J 4FYJA 4RTJA 5AFSA 1CY0A 4RK1A 3PQ7A 1PX0A 3BFPA 1DTEA 2VK4A 2Z4RA 1CUVA 2G7MC 5EE3A 1KS9A 4I50A 5I4KA 4YLGA 3HCDA 4PLFA 2CXPA 1P0CA 1N5KA 3GI1A 1NP6A 1PT8A 2VZ8A 4PX3A 4WVFA 1HR0B 1AN9A 4KQGA 5AOAA 1OXVA 1RBMA 1SKUA 2FTKE 2I4LA 3VO1A 2OD2A 3P9KA 4KMMA 1QFSA 1U3TA 3GMSA 3QVMA 4FCWA 1UBMS 4OQLA 1PS0A 2E9SA 3P2KA 4P7FA 5EE1A 3H8SA 4F8JA 1UBEA 4MQMA 5LYJA 3H5AA 3UAGA 3VJKA 4L8WB 1Z7BA 2GZDA 5BWBA 1GG2A 1KJYA 1JEQB 4I08A 2GZSA 4ZU6X 3BREA 1BVHA 4D5EA 1YDHA 4B4KA 2FXVA 2AXPA 1XQVA 1ZO8A 2JGMA 4ND6A 3JQFA 4N5DA 4W4TA 1BXZA 1PQYA 1YU6A 3GDOA 3B7GA 4YR9A 4HXGA 4GS5A 4LRUA 2PUEA 1BE8A 2D7DA 1AK2A 2DF8A 1XC7A 4ZZ1A 3F78A 4M7RA 3GR6A 3WYCA 4TKZA 1R3UA 4FDLA 4R2IA 1IY2A 1A9OA 1L7BA 1FDUA 3AHHA 4RA9A 4F85A 1BVUA 4P22A 5JROA 3NAQA 4HPXB 1LPOA 5DX8A 1UDRA 1NVAA 2QQ0A 4P80A 4F5DA 3NI2A 4L4UA 4PYLA 4OBXA 1ODTC 5IJAA 3PEYA 1VJDA 2DLNA 2ZI3A 1YH3A 1YIOA 3AZQA 4XIIA 3V4FA 1K6EA 2C3UA 4OFWA 3AVTA 5J23A 4PXAA 1W8DA 2HBYA 3G2KA 4BNWA 1M2VA 2M6SA 2ZUEA 2Z6QA 2P5YA 4ZAWA 4DIOA 3G0DA 4X1YA 3RODA 4K6MA 4DSNA 3WWOA 2X9GA 2H18A 3IFSA 3THYB 4HNUA 1DBPA 3EZLA 4U4AA 4Z9XA 5BY2A 4UHJA 4JWKA 4RMHA 3BKXA 4QBGB 5CU7A 2I3DA 1FNSA 1SZJG 3ZW8A 3EXEB 2RKWA 2I87A 4H7DA 4Y7DA 4AJ1A 4UCQA 1WMBA 4NAVA 5B7GA 3HU1A 1GKUB 3NIGB 1U1CA 5CLGA 1OH8A 4UU8A 4W8OA 3VZBA 3IAS6 3TSZA 2XGJA 3AIKA 3SC6A 5IJ9A 1CHNA 2B9VA 1X1BA 2G9NA 1OKKD 3H2BA 4GQAA 1VDMA 4R8LA 1X9HA 2DAPA 1FRZA 4AWXA 3ER9A 1MMFB 4N41A 4K0RA 2GTIA 1EYZA 1FQWA 1WLSA 1XTJA 3BORA 4LECA 4B43A 2RGRA 4AZVA 1WXFA 3OZUA 1OIWA 1G20B 1XROA 4N03A 5AD1A 3VKGA 4B9AA 4BMOB 1MGOA 3IE1A 1REQA 4KG7A 3R76A 2G9QA 3GQBA 2GLXA 4FI3F 1OBFO 4MLZA 4NCBA 4YH1A 1V1RB 1Y5RA 2OR3A 1N1EA 3K8OE 3BULA 4QLBA 2Q0XA 3AEUA 5CFLA 5B57C 4YJKA 3CQ9A 5IPFA 5FXMA 5B5SA 4J7UA 2Q2QA 2C5GA 3K15A 4LZLA 4YJ2B 3MN1A 1Z2AA 1K86A 2NOAA 1TZCA 4I0WB 4ENVA 3IX7A 2VEOA 2D59A 3FPSA 3GIWA 3DNMA 4OG2A 4BYGA 3STXA 5IDWA 3EG9A 1L4KA 5H68A 3OOJA 1ZNWA 4I8DA 4JI6B 2J67A 2ANCA 4RK4A 2NU8A 1R5JA 2GASA 4JLKA 2LDBA 3KE9A 5FX2A 4FONA 2CY0A 1P62B 3G17A 4G37A 3SC3A 1ECGA 5IP5A 2DEUA 4C03A 3ZVKA 1XAHA 3TF5A 1E4OA 2I1LA 2WA1A 4JK3A 4PTYA 1ZK2A 5AK0A 4GOOD 1L5WA 3NTRA 2O7VA 3C1UA 4UBOA 4B6GA 2QI9C 3KYDA 3DE3X 3QVSA 2O5VA 1KETA 4NNJA 4FP9A 1N2XA 1M8JA 2Q6OA 4E1VA 2FW0A 5IZ4A 3DZ8A 4OKNA 1IRXA 3NHMA 6ABPA 1C14A 2CXHA 3SMVA 1L3CA 3DC7A 5A6SB 2HK9A 1SXJB 3QLJA 1ZJ6A 2YHUA 3VKFA 4HNHA 4DCSA 1YJ8A 2PA3A 5DCYA 3K73O 4MCHA 3E3AA 2KI5A 2P90A 4ZEVA 4KXVA 4B80A 2VPWA 1RQ7A 4Y2VA 1UKEA 5G1NA 4B2IA 4X90A 2YZ7A 3D8TA 3DSRA 1P4GA 5JHHB 4ZMRA 1H3FA 2DBQA 3LX4A 1K7XB 1W0KD 5JCJD 2ZYTX 1Y7LA 3FUCA 1JAHA 2ZWAA 1U7ZA 4EX7A 5AM2A 1K92A 3ZK8A 5E4YA 3LPDA 2J33A 2O7SA 5IS2A 1OGJA 4KNVA 2DVMA 3A1TA 2WFLB 3QXSA 3RSHA 2GFHA 1EINA 4B6QA 4DYVA 2OV4A 1X7WB 3RPEA 3ZCRA 2BMJA 3LQ4A 2XUZA 2PH3A 3P9XA 1THGA 3CKMA 3E35A 1P1FA 4NKRA 3JW8A 1CE8A 1OXMA 2ZRHA 4PBRA 4WUTA 3TLCA 4XYMA 1H2EA 3NTUA 4E2ZA 4C6TA 4DPKA 1KVSA 3K71B 3I83A 3DEJA 4EZIA 1DTSA 3LXMA 3WKDA 3IAAA 2XYHA 3PFNA 2AOUA 2ZBGA 3ESYA 4N6NA 1B6TA 2AF4C 2FW8A 1XEXA 5ILOA 2D06A 4WNIA 1L7PA 3V1KA 2WBLC 2VZ9A 2CL7X 3PD1A 3FCYA 3HZHA 4U2GA 1DX6A 2XF8A 4AX8A 4H1HA 2DTDA 2O05A 2ZUCA 1ESZA 2HF2A 2CFSA 1YR2A 4OYHA 2GEUA 1E2MA 2IDKA 3QE9Y 4CLRA 2YXDA 2X0RA 5BXQC 4LCJA 5HPYB 5A1JA 3ONDA 2J4CA 4BTLA 2HA6A 5AW5A 3O6VA 3MMXA 1MC1A 2AK2A 2C7BA 4ID9A 3A06A 2NZXA 3KT0A 2P9BA 4JJ8A 1YACA 1V47A 3DEKA 5EIBC 5FNVF 4JLOA 3IMEA 5G1OA 5IJZA 3GJ0A 1W88A 2O50A 1VE6A 2Q4DA 3HSSA 1XYYA 3ITEA 4GR9A 2BUBA 1Y9ZA 3NZEA 1M2WA 1LNQA 2REQA 1RZRA 1ADGA 2FLWA 2IP4A 2GPYA 2G4VA 2XIJA 3P94A 2QM0A 4FYIA 2VP6A 4DGSA 3K9HA 4YRCA 3F73A 3WGZA 3UV3A 3HBNA 4E31A 1D9ZA 1UMCA 5F9FA 1Y8CA 1B73A 4W99A 3UMRA 1AQYA 3K0FB 4HD8A 4YMIA 1G2IA 2Q0SA 2W48A 3GNTA 5E6SA 4YJDA 2DBRA 3C0KA 4ZVUA 5DRTA 5EJAA 1G9XA 2L2QA 3VOSA 4JB2A 3T9EA 1R0CA 1SVKA 1J0BA 3EULA 5LWHA 4NEHB 3W4IA 5KTKA 3QWAA 3TEMA 5C4IA 1JQDA 1ZXLA 4YAEA 2ZIUB 3V9AA 2ZSBA 3NHLA 3C14C 4I99A 5JMOA 3KJQA 3IXLA 5DW0A 2R68A 2EU8A 3F9CA 4AKGA 5KNDD 5IN4A 1JDUA 1Q5PA 3EXIB 3PPVA 4P9NA 1UBGA 3PF9A 4UCWA 4Y1RB 3SYKA 3TVTA 5C7LO 1AB5A 1SXJE 3PNOA 2JCBA 4BJ6A 2QLFA 3HA5A 3KQKA 3QMWA 1H0KA 2IS1A 2V74B 1BA3A 2C9OA 1K5HA 4J90A 4DNOA 4K1XA 4GUDA 2O0LA 3BIFA 4MLCA 3ZVLA 4W9RA 1N5MA 4CIAA 1O4VA 3NOVA 4XVQA 2VSQA 1PL6A 4FS3A 5G0TA 1RYFA 2Q4BA 3F49S 3KJXA 4UM9D 1AO0A 2ORWA 3P9YA 2A7QA 2IZOA 3KZ1E 4MV7A 5JASA 4G5YA 5D1HA 4XCVA 3RAEC 4A36A 3I9LA 4RNDB 3T7AA 4EIWA 3LZ6A 1Y89A 3G23A 1I51A 3H9BA 1DAPA 4NBUA 4FFDA 4RA6A 5DGHA 2B37A 5G2OA 1DJOA 2AOVA 2HIHA 3JX9A 1KSGA 5JSZA 5HFAA 5LN1A 1WXDA 2ZUUA 2I6XA 1U0SY 5EEHA 5J2UB 2ZSUA 1BU8A 1WR8A 1XALA 4JJ6A 3U3DA 1G41A 3QPUA 3I23A 2QJWA 1FZQA 1FFHA 2JGDB 1UZLA 1K7YA 5HIMA 5KKNB 2E89A 3DZCA 4O4HA 2C4WA 4NOLA 4FU0A 4CKZA 2VHWA 3FOZA 2RBEA 2GEVA 3EY9A 1DUSA 2J48A 3OOSA 4GP9A 5FBWB 4J76A 4A16A 4N3BA 5FYDA 2RHGB 4CFSA 4IIGA 4X1IB 3T3NA 3ND6A 4R98A 3PDWA 5SY6A 3ONNA 1S8FA 3GHYA 5CYGA 3FE2A 5IM4A 3L1HA 1KZ9A 2CDNA 2ODBA 1E18A 1GPH1 2VXCA 3RABA 5JR3A 3JXEA 3WK4A 4R1OA 3ADKA 3KETA 3ER8A 5JOQA 1EGVB 1Q57A 4Z0TA 4Y0NA 2X4DA 5D3QA 2R1TA 2RGDA 4WFIA 4GBED 5CVVA 3ICEA 3GY0A 1HMYA 1ONNA 4YYZA 3G79A 3Q2KA 4ZCTA 4IDNA 1EUZA 1H2ZA 2LKCA 2XMSA 3HUEA 4PO9A 5K4AA 5IG2A 3I2IA 3CBQA 4X1YB 3TL3A 2MJLA 1QRRA 4JLMA 4WBXC 1K5PA 3KQHA 1UBSB 2GB4A 1DQRA 2HBZA 3R0VA 4QASA 3AMVA 1YZHA 2ZJ5A 5CLHA 4U63A 5KWVA 1T9GR 2Q3CA 3AY0A 1L7NA 2BL4A 3LP5A 3NHYA 5CB4A 2UYYA 1NYRA 1N2CB 3ND7A 3ID6C 1KARA 1UPAA 4IH4A 2IF2A 2W6PA 1C2TA 1HDZA 1RD4A 3GGGA 4H7EA 3TB4A 3IALA 3CNEA 4E03A 1E1DA 2JATA 5DCUA 3QLEA 3AEXA 4M9CA 2MR6A 3Q2IA 5E3HA 3KALA 2HV8A 4B34A 3L7KA 1DQNA 4JOSA 4M87A 3VH3A 4DLRA 4KXXA 1AKQA 1O58A 1WOMA 5A71A 3VA7A 4S24A 1N8TA 3V8VA 4BB5A 1E9AA 1CNEA 4KYTA 4EVRA 2PMEA 4J3NA 1W19A 1ZINA 2HA7A 1OTYA 2YRFA 3HY4A 3P0FA 4M1SA 2PR7A 2DFNA 5K0CA 1JXOA 5LZ2A 1FK8A 2HK6A 1LQTA 1G20E 5DI9A 4IRXA 3VTFA 3ZZMA 1BE1A 3LWZA 5K3CA 4OGKA 5CDUA 3D6AA 1OFUA 3EXFB 4CE6A 3AZPA 3JCZA 3K2EA 3X1YA 3FSGD 3H9GA 3NMUF 1IDN1 5FPTA 3H3FA 1U7PA 3G59A 4BO1A 4EHAA 5DLPA 4EELA 3NRJA 3P19A 4Q9HA 3MJVA 1TM7E 2H9AA 4Y9UA 2XRYA 2FFAA 2L18A 4H6PA 1HE8B 4TWRA 3L0YA 4G65A 3WJ1A 2HB6A 4BVLA 2RGCA 4IP0A 1AUVA 3HI4A 4G0VA 1TM2A 1DKMA 1C7RA 1ZGAA 2RFLA 3FKQA 4JV5B 4IIJF 4ZVVA 3BMCB 2HRDA 4DS3A 1GL6A 1X9IA 1H4VB 4CT0A 1Y7TA 2ZJZA 3DAYA 3FPLA 3KKLA 3C3KA 4P98A 1OI4A 1NQWA 3WLMA 3O8LA 4F06A 2O2CA 1ICIA 4WK4B 1M2FA 3SSOA 1EH5A 3URMA 2O54A 3MWYW 2JAQA 4BNDB 3IUMA 5DP1A 3DQZA 1QPZA 4RACA 2Q41A 1TDJA 3UHFA 4IFIA 5FUQA 2MT9A 3LHIA 3F3SA 3ZS8A 3KSAC 1ZU4A 2ECFA 4GKAA 2VUSA 1Z3IX 4RENA 1EBUA 2WHPB 4XR4A 1DQYA 3H17A 4O08A 1YMVA 2I34A 4BFVA 2RI6A 3NEAA 1AURA 5AHXA 4UMFA 2DB3A 1J25A 1KEWA 3R1IA 3QXJA 1IUKA 4ZK2A 2IXFA 4MA0A 3EISA 4QFMA 5BQ3A 4WOJA 1TNDA 2BT4A 4OREX 3PHIA 4TMKA 4QBIA 5T3YA 1SMKA 3STUA 1ESCA 1JDBB 4D9IA 3JY6A 2G82A 4DOMA 1QIDA 3H1AA 1SNYA 1JFRA 2Z1DA 1KI4A 1MTZA 3ZI4A 4EPRA 4JBNA 1BHSA 3LLVA 3D43A 4ES6A 2E55A 3DTVA 2H08A 2VJQA 1JFFB 2II6A 1R00A 2WFLA 3GFTA 3RASA 4LCBA 4ZQGA 4JDPA 5JARA 1ZJZA 1JHDA 2IE0A 4O29A 2VNJA 2FZ4A 3R7BA 3P9PA 3WVNA 1J2EA 2JD2A 3R44A 4BU1A 4G5FA 3R7AA 1GPAA 1QGUA 4GMXA 2CLMB 1CVRA 1PZEA 2E37A 3CCBA 3VR3A 1OXUA 1XN4A 3C8HA 3MOSA 5SZHB 2YS7A 4MVYA 4YHHB 3A9RA 2BHSA 1GOTA 3D8NA 3IEUA 4UBIA 1G5HA 2GILA 4ESEA 1M7GA 4PZAA 4KN9S 1TECE 3LX5A 4UBLA 1KWGA 2X7JA 1RYDA 3ZZUA 3AO0B 3M4ZA 3IA7A 1SQ0A 2ZIGA 2C4KA 2IZ1A 1HC7A 1DMRA 1UMBA 4HJRA 3WQQA 1XRQA 2J1LA 2HQOA 2ODQA 1TYEB 5I9SA 3AI7A 2EYQA 2J6HA 1A4UA 4Y6QA 1IB0A 1N8NA 1X7WA 3ML1A 2QJTA 4C08A 3WYNA 1U98A 2G25A 3Q7TA 4TV8B 1JGTA 1FY2A 2A59A 3O75A 3W8NA 4AY4A 3ZDAA 4EFDA 4MQFA 1DRVA 2ZBPA 1HTTA 2ACVA 5ICGA 5LLDA 1TA4A 2W6MA 2BMDA 3T1TA 5ED0A 3U9SA 4R69A 3DVLA 4AYTA 2GD6A 1XELA 4L6IA 4FW8A 4PC1A 1ZUD1 3I01M 2PU7A 1KKMA 3L8YA 4GM1A 4MO9A 4M0CA 4OU4A 4QL3A 4X7BA 2CL0X 2OCLA 1F8YA 3JQ6A 4DUGD 3WWZA 4D79A 1KJNA 1CY2A 4NICA 1JSCA 3EA4A 3NASA 2Q1XA 4GXRA 3TAXA 4YRGA 4I3FA 1LY1A 3KVYA 5G53C 4J16C 2IX3A 4KPEC 2CXQA 1H8HA 1SUEA 3SSNA 3GCXA 3BB1A 3AJDA 2IF0A 1JDSA 2JFNA 1E2KA 2JH8A 3GRPA 5ECWA 5L7YA 1N2GA 1WD5A 4BNJA 5TPZA 2VF2A 4FNOA 2W2VA 3V8RA 2B5OA 2GQ0A 2NO1A 1P9WA 3R5JA 4ON9A 3IOBA 4UDNA 2ATIA 5GJVC 3T7IA 3GT7A 3TDKA 5H81A 1WOYA 3W6ZA 1CQWA 3IB3A 1P6QA 2VIIA 3O8QA 4Z9BA 4C29A 3SEZA 2XSZD 1E1RA 4D57A 1DAIA 4MYRA 5KYXA 1GIAA 3MRVA 5IT4A 4CQNA 3ICQB 2FFRA 2Q5FA 4B48A 1DOHA 1RRKA 2WYHA 3AV3A 3PXBA 2O2SA 3PGJA 1WXXA 5K2MA 3SC4A 3W7BA 4XUEA 5TGTA 4TWZA 1RQNA 2H07A 1P72A 4IHQA 4QAQA 5ABPA 4PZPA 2GKGA 3PWZA 4QAJA 1JHRA 2EKDA 2R65A 3CJTA 3IURA 1JAIA 4QWMA 3ILVA 4WZZA 1GLGA 5FF9A 1F9AA 4UEOA 4U9IS 3GH3A 1OF1A 2VP9A 1FFBA 4LNUA 3M3PA 2OT3B 2I5PO 3CS3A 2J9ZB 3N0WA 5T4FA 4AJ4A 1SBIA 5JMPA 3V55A 4JSTA 2V59A 1HYHA 5J4VA 3GPLA 2PIAA 5EQJB 4QYXA 1CPYA 3LWDA 3UXEA 5DK4A 4CV1A 3RAPR 2IYVA 4KVGA 2HM7A 4KEAA 3TRJA 2IHVA 3GA0A 4PSKA 4ZHQA 4JUCA 1A7UA 1PAUA 3NG1A 5T41A 3WQHA 4AIIA 1G7RA 1JSZA 4MUFA 3S1SA 5IKXA 3GLFE 3ZE6A 5KOHA 1DIOB 3E9YA 2ID8A 2CXNA 2XDQB 1D5WA 1GFWA 4CDMA 1BHO1 3DMRA 2ZGVA 1DADA 4KI0A 3PDJA 5T4EA 3CVUA 1PK8A 1F20A 2XNJA 3WIDA 4G1CA 3NORA 4D9NA 1G6KA 2I6QA 4FHEA 4JVOA 4Y2PA 2JGDA 2Q49A 2CVOA 5EA2A 4KRFA 1E59A 2QRGA 4P54A 2DKNA 4HATA 4ALLA 3KSBC 4G1VA 2EAUA 3KQVA 5LP6F 4II7A 1YHNA 3AG6A 4GE3A 1RBZA 4G5QA 4MR9B 5EJ2A 2ZIZA 3OZSA 5TQ2B 1G9SA 2WKPA 3SLGA 2D3WA 4ISBA 5AW4A 1K8RA 4LXYA 4CMAA 5L3SA 1X1AA 2PM8A 3RVPA 1EVQA 4RVUA 2ZI9A 1LDBA 1Q44A 2WIGA 2R8EA 5JI3E 3U16A 1DL5A 1DOAA 3LO8A 1M6HA 3OY7A 3SJZA 1B76A 4KO1S 1JAYA 3L49A 2PLFA 1E2FA 4PZ9A 5DYGA 3ZTTA 5BUSA 3U09A 3BGWA 1PJBA 4H7JA 4FGWA 2A9JA 4ER6A 2APJA 2FZGA 4C4PA 4F3CA 5C7OO 1LWOA 4IFBA 1G5PA 1UBRS 1P4RA 4C0JA 1WQ1R 5F5LA 3GUHA 5CCEA 1OAKA 1GZ3A 3MIZA 4UOZA 5KINB 3SWWA 4HEHA 1W7AA 1QLHA 1XTSA 1YQWA 3AY6A 2XF2A 3G68A 4JYCA 4HUJA 4WBNA 5E9WA 2HRQA 1O0CA 4X1IA 1D2RA 1KY4A 4L75A 4EF5A 1P81A 2ZSAA 1T3TA 1SKYB 4DMFA 1CUGA 2JGFA 3CX8A 3HR4A 4G8BA 3JPYA 2ZWOA 1T10A 3I2YX 3ZU3A 4EK9A 4V0SA 4M99A 2ZTLA 2G8LA 1V95A 2C83A 3C5WP 4IF6A 2HXSA 4ALIA 1C29B 1Z34A 5JNSA 3EEYA 4ALNA 3ESBA 4QXMA 4PNZA 3TIGA 1F8XA 4CM6A 5IUJC 4WSOA 5TB5A 2H9IA 3N5CA 4Q1EA 5FV7A 1X39A 3EOZA 4DIMA 1IJBA 4DRYA 2WD7B 4R2WA 1OC2A 5FIUA 1M8GA 3FUUA 1CR6A 1UQUA 5DBOA 5FBLB 2X42A 5KCMA 4BV2A 5AW1A 2V0GA 1VLQA 2HHHB 4LJKA 3TN7A 5EJ5A 1EUCA 1V11B 1RACA 3B3AA 4XOIA 4LFAB 5ADWA 3QI2A 1W52X 3DMTC 3PUHA 4ESOA 1JR4A 3LVQE 2SICE 5BSWA 5MN5A 2I4TA 3ZY6A 4Q7MB 3RRYA 3D4IA 2P4HX 2PEYA 4PG6A 4F2HA 5I7EA 4IXDA 2JKZA 4E0BA 2IEAA 5KCZA 4KBFA 3RC7A 1IG3A 1ADYA 4PIMA 3ICCA 1BJRE 1N3LA 5A3QA 2ZRFA 1L4UA 4JSRA 2PBRA 3FCUB 2I9KA 1Z9BA 3S2UA 2GHIA 1IXRC 2NTJA 1QYDA 1LB1B 1VJ1A 2GEJA 5CH5A 1O8CA 4A92A 3A70A 4NZNA 4MMZB 1PR2A 2XJ4A 3RYCB 2D6FA 1UBUS 5B36A 5KVVA 1R0YA 2XTZA 3USCS 3QKRA 4YXWA 4QYSA 1PYOA 2YVKA 4F5WA 5CDGA 1AX9A 3NIBA 1VXOA 2P62A 5GV7A 2I3ZA 3ENQA 4KO2S 1O3YA 2JH3A 4YNBA 3BAFA 1CJBA 3GLSA 1Y6QA 1JDNA 3ZHRA 2ZBQA 3C70A 3GN1A 1FFEA 3A58B 3PNSA 1KYZA 3GGCA 1IHXA 2WNSA 4YBZA 2AJTA 2NZJA 16PKA 3RS8A 1NBHA 3CG4A 3DPIA 3ILSA 1Q1GA 1FYFA 3NHBA 3UGKA 3BMXA 2ZSKA 4HSEA 1GGMA 4QD3A 4DHWA 5FYQA 4A6PA 1L4GA 3PG5A 3ZYZA 3R40A 4KI7A 3RYTC 4B33A 3L7LA 3INGA 4OK5A 4PSVA 3KQMA 1P18A 2J3MA 1ENYA 2WHRA 2Y1FA 2YX1A 3AGPA 3OBIA 3OJFA 3EXAA 2BFMA 2XRMA 4DCGA 3U4QB 1NRIA 3NJRA 4EMBA 4C0HA 1QQBA 4ECEA 2JCYA 1VZ2A 4PQRA 3SHTA 1IK4A 3LI2A 1Q77A 1KJ8A 1QFJA 2OQIA 4IBOA 4QQ8A 3M82A 3G0BA 1MNAA 1JIQA 1UIMA 1JIKA 4RK7A 5FL7A 4KQEA 3OHMA 3H05A 5T6BA 5CB4F 1R4NA 1AS3A 1Z13A 2TMDA 3E6AA 3IYLW 4MGYR 3KWFA 4DMMA 3EF0A 4AIRA 3EPHA 3DQPA 5JWHA 1FFWA 5LBUA 2CLSA 4J7XA 3VYRB 1K98A 2W00A 4QNNA 1GPUA 3A31A 3PFKA 3TINA 5DK6A 5J2UA 4KX3A 5SZKB 4C7VA 5HK8A 1OTXA 4HMOA 4BNUA 3H9QA 3OQBA 4A0QA 4RM2A 2F6RA 4GXNA 1TL7C 2A2ZA 4K88A 4QSHA 5FO1A 3L82B 2PX0A 1OLUB 1XL1A 1E3EA 2QY9A 3FYUA 3GFFA 3SJBA 5J4LA 2J9FB 5TVGA 3ZLBA 2IOQA 1JLSA 4EF4A 1YRYE 1EBBA 3AERB 4BO3A 5L7TA 1NG9A 2W2XA 2OCXA 2X3YA 4G8DA 1MFZA 4URWR 121PA 4JLVA 4WOBA 1V3QE 4J7CA 3F6SA 4RHEA 1E2UA 5H70A 1WXQA 3S29A 2NWQA 2QAIA 2B8EA 1QAMA 4AUMA 5BWMA 4ROSA 1GYQA 3ISJA 4JGBA 1L5HB 4YR7A 4NZZA 3ZHTA 5FNZA 1KI9A 1NQVA 3TI7A 4CMBA 3RV3A 4ZT3A 4QUHA 3LE8A 3AEZA 4LHYA 4N39A 3T7KA 4EGSA 1ST2A 1E1RD 3SYNA 2PUWA 2F43B 1Z63A 1ZQ9A 4MIKA 1FUUA 3VYTB 3SDBA 1IZ7A 3LKBA 5A7GA 1FX0B 1Y9JA 4RUKA 5AVTA 5FTLA 1HYBA 3ROFA 4JC0A 1N8KA 3PQCA 4ADSG 4QDZA 1Z0AA 3W5IA 5KYUB 2PUFA 1OI2A 4BV3A 2G04A 3FTNA 3IEIA 2ZRQA 3L1UA 1IM5A 2XUGA 5BRNA 2CNLA 1SZCA 1NF2A 2PMDA 3O2SB 1KTIA 2FG7C 4IV0A 1SVNA 1D2EA 1RAAA 2O2XA 4LHZA 1CK4A 5INTA 2RHLA 3AOEC 4CUKA 2IKQA 3WL7A 1IJEA 1C4KA 1U3VA 4PANA 3QE2A 1W49A 4X3OA 1FSZA 3LQ2A 3EAGA 1NXPA 4NZPA 5HKBA 1QF6A 2KLHA 5CIYA 5JO9A 3N87A 4RTRA 2Q46A 2C7PA 3INNA 1OYOA 1S4QA 1F0KA 4PGGA 1T8PA 3OPNA 4QUIA 2ZSEA 3WSTA 3FIUA 4FFOA 1B3RA 4QYWA 2YMMA 1XYVA 1VPTA 1Z6AA 3G0IA 5DTQA 3RH0A 1AUQA 4BKMA 5IDXA 5HYVA 1Y1LA 1BFUA 2FWMX 1YL6A 3Q41A 3O92A 4NMXB 2P0AA 4BDTA 4Y9SA 3PA8A 5AVQA 4UVIA 4WZBE 5BYBA 5JNVA 1NUPA 1O03A 4KITB 3SZGA 1A8QA 1W4LA 1XZEA 3U60B 1TMKA 2GTHA 5AHRA 3PYXA 5EJ6A 3MQ4A 8AT1A 3EOAI 3SX2A 5JUWA 2ODWA 2XMDA 3W3AA 1U7DA 2WSLA 2YOGA 5KDOA 3T9AA 4B8YA 3TLGA 1QU2A 1HKHA 4RM3A 3B12A 4IWYA 4BZPA 1LV8A 4AY6A 4PICA 1HDXA 3DMNA 1J56A 1JJVA 1K2VN 1HQCA 5AW9A 3NNSA 1CUEA 3DULA 4IWXA 4C4OA 4LV6A 4EUHA 3K09C 4WEOA 4DG8A 2XYGA 4PNPA 4WOCA 2Y6UA 4JEUA 1QZXA 5A5FA 4FEAA 3X44A 4L50A 3TQOA 5EHXA 4W8GA 3JWJA 4C4AA 1UANA 4EQ6B 4BNDA 3A9UA 1DJQA 5DHSA 2YXLA 4HZUB 1Z8NA 5IDVA 4TTAA 3DAGA 3Q5EA 3D7RA 3BCRA 3NDJA 2PZAA 2V7XA 3RVKA 2CL5A 1KXJA 3FGOA 3ECCA 3MB5A 3L6BA 1F0NA 4AJLA 2ZYIA 4YFYA 3ZXUB 1NU6A 4UTZA 4DCPA 1LKZA 2XMCA 2J9XB 3DF9A 1Y1PA 1EHYA 1Y0BA 5BO5A 1ZH8A 1O0SA 2Q0HA 2QPOA 1ZMBA 2XVYA 3IAS1 4FCTA 3M1AA 4RIHA 1ESMA 2PD6A 4NU8X 5T4HA 2NNWB 3UT5B 4ECAA 1FW6A 1ZCBA 3K30A 1M5UA 2WPNA 3N75A 3WLEA 2QTTA 3NHUA 2YHIA 5LKAA 4ZCSA 2CJFA 1CUCA 4A91A 2GAIA 4AMUA 1OYYA 4EENA 3LWBA 1AOXA 5F7OA 3CUEF 2PAFA 3HV0A 4UEJA 5AT1A 3E48A 4W1PA 2DC1A 2X3FA 1V8PA 4BKOA 1HFWA 1HT2E 3ZQ4A 4FDTA 3VPAA 4EJSC 1C9JA 4MGZR 1XRSB 1Z12A 1GU1A 3FTQA 4Y30A 1NXQA 3INYA 3L0BA 5LL6P 4TVKA 2DERA 4LGMA 3FBGA 2UUPA 3GA7A 4GPTA 1G17A 1NN0A 2FF5A 2A5FA 4HUQB 1CVIA 3QLVC 3TL2A 3NV7A 2V5VA 3KUUA 3PGXA 4OK3A 1BXRB 3Q3IA 4PHHA 2QSZA 3LUHA 2O4CA 4M86A 4RH0A 3D6UA 1IWBB 1E32A 3DQQA 1PZFA 2QR2A 4O4JF 1FCJA 1HM5A 1U2TA 2K2WA 1DKLA 3CZ5A 1E6UA 3I9FA 4MJLA 1W1IA 4L78A 3SEFA 4FM9A 4PPYA 1CUYA 4B6RA 1H9BA 3FYDA 1U8UA 3GLTA 4RMNA 4EYEA 3OE1A 4GZ3A 2YJ4A 1RZ3A 5AXDA 1KFJB 3HLYA 4RD2A 4QDJA 3HXTA 4YS6A 4CG1A 3HBJA 2GK7A 4NU6A 1AA9A 3FD8A 1AK1A 2FUG6 4ITVA 1R6BX 1UKBA 1X92A 3OKPA 3T0IA 1NYQA 3CNOA 3ZHQA 1NULA 2IL1A 1WXGA 2FWPA 2EQAA 3JQGA 1SKAA 2QSJA 5BUZA 1FDWA 4OU5A 1WS6A 1UZUA 2IH2A 5HA5A 5HZGA 1RW4A 4X60A 1E7SA 2WMDA 3CVVA 1UM9A 1C0EA 5DYYA 4LQCA 2XZTA 6LDHA 3RSCA 1PLKA 3QKRB 2P0EA 3LT4A 4X71A 3GNSA 5GOZA 4IL5A 4BO8A 3LBAA 3LF2A 4E2WA 1D2CA 1VSVA 4WERA 5K6AC 1U2GC 3C3AA 3FPCA 1NN1A 2VUHB 5KX5F 2EKBA 1UL1X 3GB9A 1ESNA 3IQHX 3PEFA 4BNHA 3CUUA 4F3KA 4W5HA 2WWIA 1G8MA 4IM7A 4UFOA 4EUNA 1YDFA 4I4TA 2RARA 3PJEA 3LC0A 4KE6A 2OSVA 2OZLB 2VWGA 5IW8A 4HNQA 4BMYA 4U7DA 4YAGA 1I6LA 4H7IA 1YRHA 4M8LA 1YJAA 2R66A 4XB2A 4DR1B 3MXOA 4A10A 3NC1C 2RGXA 1KDPA 3EDCA 4B40A 2HTEA 4I4IA 1THTA 3NVAA 1QH8A 2H2HA 4N12A 5IARA 1ABEA 3C6MA 4O0MA 4RYDA 3O1IC 1RWOA 2X58A 1R0XA 1GUZA 1JU9A 2FPGA 2O2EA 3SYTA 2R87A 4Q16A 1DFHA 5HFNA 5D1NA 1Y6GA 2JFFA 3LX8A 3AF3A 1VHJA 3OO1A 4KACA 5LZ9A 2NU9A 4IJWA 1RXCA 3EGDB 3LQKA 4C21A 4PTLA 1KQ3A 4S2EA 2PJRA 4GIBA 1V5GA 1ORIA 3W5UA 1QIFA 3GLIB 2PVCA 3S40A 1HL3A 1G8KA 2BSXA 3TG2A 3Q5DA 4OHYA 1ORRA 4JN6B 3RC9A 4D4JA 3BH0A 5MGBA 2C31A 2XDQA 1P0QA 2XE8A 3IEKA 3EVCA 4HAZA 3H0EA 1ZJ5A 1YCDA 2C2KA 3SJ7A 3TDMA 5FLXA 1W2HA 4LDPA 3VZQA 4S05A 4YUZA 3B20A 1W5FA 2GM9A 1Y7IA 5JEEA 1X9GA 2I80A 2JGLA 4TS1A 3TOVA 3I9JA 3ZD6A 4W8HA 2G36A 4F6RA 2BGMA 2V9ZA 1KMHA 3KX2A 3ZEAA 1VPWA 4KZKA 2J3DA 3DCYA 5U9CA 1J5PA 1NXTA 1Q7BA 1JF8A 1FRVA 1T5BA 3OCWA 4YY3B 2VRNA 4DLYA 1PUIA 3JYPA 5FBQB 5B4UA 3MJTA 4EP1A 2H6EA 2YCLA 4QUBA 1L7OA 4MV9A 4YV0A 3RSLA 1QMPA 1SUIA 3KQYA 4XGQA 1UPUA 4YQZA 3I5YA 3NAMA 2IEGA 3KZXA 4URZR 5JMTA 4ARZB 3PVSA 4TV9F 2ZXFA 5FTWA 2P9ZA 2W7TA 4YRLA 5I3CA 3IQWA 3QI7A 2CFIA 4Q9IA 4I8XA 4DA7A 5IDYA 3L8CA 2D62A 3F74A 3IOEA 1PT6A 4JUDX 4L5YA 3TPFA 1JDVA 1A8PA 2CLKB 2YRXA 1WHSA 2EFDB 4JX8A 3BDVA 2GPAA 1Z18A 4E14A 1FLNA 2NYRA 1NBME 3PUXA 3MWDA 3DZJA 4JLSA 4XQGA 3VZSA 1BWRA 4BEWA 3VKHA 3FZQA 5CA1F 2XEXA 1LVHA 3FYTA 2IBMA 2QK4A 1R0SA 2N42A 2HIGA 1GKIA 2UZ1A 2ZIXB 4UM5A 1LFDB 2ABWA 4E5VA 3GEPA 4DSAA 2F8SA 5LQCA 3WL5A 8OHMA 2XTNA 1FPQA 2HSJA 1C0PA 2L69A 3E53A 1E5DA 2W2PA 5A4IS 1K08A 1WUJS 1Z28A 2OK8A 3MAJA 3GP3A 5ALIA 2GPBA 3K3PA 5F35A 1N4AA 1CG6A 1NFQA 3N2GB 1ZHFA 4Q4DA 2J9RA 2JL1A 4D9BA 4TV9A 3DE2X 4M0DA 1Z45A 2IYTA 3CLVA 1GL9B 1JUDA 1Y6RA 4U6SA 3S70A 1WA5A 1SH7A 1EA7A 4MWZA 3EY4A 4UPDA 4V0MA 4QOEA 1HORA 3DDCA 1I3CA 1NQOA 2GJKA 4LSZA 3OMLA 1FJXA 3H4TA 1JG6A 4CMKA 4X7MA 1BEUB 1ZVJA 2QPAA 3WWYA 5BUQA 4EECA 2CXSA 4DCCA 2IYOA 2QYSA 5JDCA 2HPZA 4LHVA 3NALA 5JAPA 5HZHA 1AKRA 4QPPA 2PLRA 2A5GA 3AHGA 3RS2A 4OQPA 1M83A 1G6OA 4B75A 5KQRA 2GN4A 4DN6A 1FJHA 4ALMA 3RJ9A 4XM2A 1H9AA 3RHTA 3DLTA 4I5IA 3ZHOA 4CKWB 4JLUA 4PNHA 1CC1S 4LOIA 4EHJA 2D54A 2OKGA 4NZ9A 1FLVA 3WNQA 1PX2A 2OE2A 4QHSA 4U2BA 2CCGA 3Q4GA 5IKMA 1M5TA 4DM4A 5CDSA 4A0HA 4OXYA 3TZ6A 2D1QA 2VQ3A 4L3WA 2IY8A 2F8MA 2X5NA 3QTBA 4QXRA 4ND8B 4BX2A 2P7HA 4GW3A 5KQPA 2BM9A 2IPLA 3NGMA 5C8VA 5IJ0B 3CLTD 1N8SA 4BV9A 1Z7GA 3QV2A 1QHXA 4GECA 5HUQA 4JP2A 4Q34A 5TSDA 2J4DA 2Q3BA 5A4KA 5IXSA 4DCNA 1UC4B 5IZCC 5K0ZA 4NONA 2ZRKA 4G5RA 1PNTA 3I9MA 3RJZA 2V5UA 3CGWA 4NFHA 2JARA 5K6AA 2ZYGA 4CEJB 2QTMA 1E1CB 2F9MA 2IYNA 2LZ0A 5A4FS 2CE2X 5JISA 2BHRA 1I8TA 4DIBA 2F1OA 1TTPB 3VZPA 4YDQA 1TW2A 1EJ2A 2YJGA 1IVSA 1TD9A 3IKLA 2HMAA 3JD3A 1Y98A 5NLLA 4MS3A 3AVVA 4CM4A 1J0EA 1H0HA 1LUAA 2CF6A 3D3NA 3F4BA 3IO3A 1OXBB 2N46A 2ZRIA 5BV7A 2GF2A 2BKUA 1XZKA 5AK3A 1N2JA 3FDFA 4FHZA 2H57A 1O4WA 2KHZA 2VYQA 1SXGA 1E92A 4LWQA 3VPHA 4MDFA 2YWXA 3AEQB 4LOHA 4CXMA 3HVKA 4CQJA 4Z4EA 3YASA 4O3MA 3TQHA 2VSFA 4S2UA 1A7JA 2EKZA 4P3XA 3W9SA 1I7DA 1IHPA 1U0JA 1DEHA 2LCIA 4C2TA 4CCYA 3HM2A 4YV2A 4YIHA 4PYNA 3QG5A 3CZAA 2WI8A 4UTXA 3SFTA 2OXEA 4DR4B 4FT4A 4JLAA 4QATA 3V8BA 5ENZA 4DA9A 1NW3A 1DLIA 3DO6A 3GEEA 1SC6A 5K3SA 1MORA 3BAZA 5TJ9A 4JX9A 1BMDA 5LMCA 3DEZA 3FW1A 2BMVA 4TTIA 5DLYA 4JVLA 1JEJA 1KYTA 3KSDO 4ARIA 1ZSYA 2OO3A 3ZZ0A 2WSSD 2J30A 5BR8B 4HUQA 4INAA 5I48A 2CYBA 4IEFB 3I04A 4I9NA 1G3UA 3UT5A 1RAIA 3EW7A 4LQ4A 2AI2A 3JTEA 5BQ5A 3VV3A 3WX0A 4TLMB 3HUDA 1TO2E 4FS8A 5DBHX 4MLPA 5H9WA 1BN6A 1SK8A 2O3TA 1C3EA 4LJ8A 5HCIA 4FFLA 1UKVY 2ZTHA 5CNKA 3T5DA 2ZTVA 2NU6B 4PRKA 3ZOKA 2XAAA 4GLFA 1NUQA 1YVUA 2FSUA 1JG1A 3FGPA 1DARA 2WY2D 3ST7A 3V7UA 4CIBA 4W5NA 1UP7A 3BRCA 1WX1A 1Z17A 4R1UA 3KP1A 1P9LA 3V33A 2BGRA 2GH1A 5KOIA 5LP6A 3EVEA 2HJGA 1Z6PA 3GBPA 3EXHC 4IMIB 4WWHA 4PXSA 2PGNA 2C92A 2IU6A 2EP7A 2JBAB 1FDTA 1Q22A 4FWBA 3O8NA 3B1YA 5JY6A 2JIPA 1XDZA 1Q92A 3O4RA 1QWOA 3CZ4A 3TFOA 3I4FA 3A1SA 1RKUA 1CS0A 1MB0A 2FN7A 4Z3OA 1YB2A 1H5UA 1F17A 1QG0A 4NENB 4TSFD 1O97C 1VKJA 2JFBA 2MSNA 2OGTA 2VXOA 5MN6A 3ESDA 3FRHA 1KSFX 4HKTA 4KH0A 4L8FA 4MUEA 3DB1A 3Q1KA 3KLMX 3R7NA 1NASA 1V0JA 1XPUA 2FQYA 4NPAA 1N2OA 2AMVA 3PDIB 5KAPA 1K89A 4I5EA 3U7EB 4FFPA 2WJPA 1RQGA 1TX4B 3DFZA 3UC5A 4NYMR 4R41A 1H6CA 4TQGA 3ZDXB 5JV5A 3U5TA 3QELA 2IP2A 1T4BA 4G5XA 2GM4A 1ZOPA 4HDOB 4GUAA 1PZGA 3CXUA 1L1RA 3L8ZA 3KDPA 4IV8A 1B7GO 5ICEA 1UFVA 2O5CA 3R7DA 1V43A 2DWCA 4RTOA 2DH6A 3QHPA 4CLHA 2OC4A 3CRNA 2QOEA 3WXMA 1T1JA 3JARA 2QPLA 3Q3CA 4KAAA 1R9JA 1MC4A 2BMAA 2ZG6A 3W0LB 4HTAA 3T0FA 1Q84A 3PWTA 3G2PA 2IXAA 3VAZA 1I9GA 2FSIA 2VAXA 4IDHA 3ZWNA 3W5SA 3HY3A 4HDNA 4NE9A 1PZHA 2V98A 2NU9B 2W90A 4YPVA 4P8RA 4NI5A 4V38A 1DQPA 1KO7A 3M5PA 3UAOA 2IUSA 1VSBA 2VWHA 4R8MA 1X7GA 2A9QA 1O6CA 5JXIA 1MUUA 1DC7A 3L6OO 3GJQA 2VYCA 3MTEA 4DDUA 1S5PA 3E8SA 1SWVA 1R0WA 3KBOA 2G9ZA 5TGZA 3ETHA 5KYTA 1K3FA 3WMEA 3EMVA 4Z7NB 3FY4A 5ES3A 3BDIA 4I6EA 3FVWA 4OQFA 3SQXA 2REBA 3D0QA 4RPHA 1L8QA 1GPYA 1WP9A 1YVDA 3E7WA 1I7LA 2PUVA 4NBSA 3OMXA 4EZEA 4XH9B 1F6WA 5K4HA 3Q8LA 4GRIA 4M8SA 4PQFA 4REMA 1NW5A 3T1NA 3TQCA 1E2HA 4GEKA 1M1NB 1FXSA 1T1RA 2IW1A 2FZEA 2GN8A 3SY8A 4IIFA 2O8FB 2EGHA 2FSVA 2M2IA 2OVFA 1NTRA 2ZKLA 2YH2A 1ZW6A 3ZXSA 4BO9A 3RJTA 2QN2A 2CJWA 4BLUA 4EYQA 1YJXA 2BKVA 3E05A 2I2XB 1GAWA 1KC1A 1V96A 4D42A 3NW9A 1G8FA 2PGIA 4XGRA 1GGJA 4U39A 3QOWA 3OX4A 2FUEA 1UXKA 4GSYA 4KQ6A 4MP6A 4ZTBA 1SKYE 1J99A 1TT5B 1WULS 3EZFA 4IY1A 3C5CA 3MJEA 4RSGA 4WLEA 5KTPA 1ZBDA 3Q7SA 4M1EA 1VSTA 3KELA 4BX9A 3SE7A 1FLDA 1Y7PA 3Q15C 4RZXA 2IU0A 4AXXA 2NXWA 4CDNA 4GFDA 3WIBA 1M6EX 4HC4A 2E3JA 2P2NA 3UKOA 2NG1A 3B9QA 3B9BA 4MHTA 2O0KA 4LBYA 4JT4A 1I4TD 1KDOA 2AHOA 2XNCA 4ZO4A 3DE0X 1F51E 2GO7A 3F4KA 3RAJA 3O4HA 4QDXA 2WQ7A 1NBOA 4TZ6A 4BWVA 2GJSA 3MM4A 1V25A 4ZYXA 1H4QA 4YMVA 2PFSA 4D99A 1CJSA 2H29A 4X6YA 3RANA 2B7CA 3AESA 3MGKA 1BXRA 2R1TB 4NF2A 5C80A 4G0XA 4D6PA 2XMRA 4WLFA 1XIVA 2BHLA 2HT1A 2YIVX 1E79D 3NUGA 3K9NA 1VBFA 5TGDA 2DR2A 1QCDA 4BRWA 4N3AA 3DE5X 3MSXA 1LGYA 4GOLD 1UAGA 3L7BA 3QYAA 1UT8A 1ISFA 3SNHA 3HK2A 3PGLA 4EG7A 1V4VA 2G17A 1D6JA 4EL0A 2P2CA 4ENPA 4M1ZA 5IBPA 1NLYA 2X8JA 3IQZA 1AD2A 3TXYA 1YZNA 4CRWB 1RYNA 13PKA 1DJMA 1E2IA 5DU2A 2CYCA 4XI9A 4BO2A 1BDBA 1NFRA 4KR7A 5CRIA 1LK5A 5F7ZA 3N59A 1L4EA 1RQXA 3L7JA 2BZ0A 3GROA 3BCUA 1T5SA 3MCVA 3PI6A 4ND5A 4YO7A 2X4GA 4JI1B 2ZKIA 2O8DA 1BIFA 3GCWA 2YQZA 2K7FA 1NDHA 4RHTA 4FOOA 3A4TA 1K6XA 4GC5A 2AOWA 5CW1A 2H1OA 2VKQA 1OPRA 2PYDA 3ZHXA 1X70A 1DO0A 2WWTA 2H00A 2QW1A 2X2FA 2VPPA 3D2AA 1UWCA 2GRJA 3FJ1A 3FLMA 5LPNA 3IUYA 4KHPB 1I3MA 1YBAA 2IPNA 2VLIA 3U9LA 2BYTA 2QN6A 4ARBA 1ORHA 1HFKA 1TT7A 5EE9A 4ZARA 1TAHA 2D7JA 2CNDA 3ZDYB 4LOLA 3E18A 4TXLA 3TEJA 4LF5B 4I66A 5JNLA 2DE0X 3MT8A 4KXNA 4H4DA 6AT1A 2JLVA 1UZMA 3K92A 1D6NA 1H2BA 2NACA 1N9GB 1UADA 4FNMA 4RQTA 2ZREA 4DHEA 1A9QA 2IHTA 1U4SA 1ZGZA 5JS2A 1NMZA 3VI4B 4URVR 5KSOA 2WQ6A 3WFIA 4DA4A 4QYIB 3K1YA 3BIXA 3ZCVA 1KMCA 4KVAA 5F21A 2LE0A 1MTOA 4LEIA 1I3LA 1R6UA 4PYMA 2CLCX 4JY7A 1L1FA 1U2PA 3QU9A 4ER0A 2OFPA 2FPGB 2WVGA 4LPKA 5DJ5A 5DWVA 4XKJA 5HGXA 4H7PA 2HO5A 4TYYA 3HP4A 4W1QA 5EUQB 5GPBA 5TRTA 1MQ9A 3PEEA 1C5KA 4B2LA 4UHCA 4CM8A 5FA8A 5A3VA 3NDBB 1M1ZA 3DOUA 2BKLA 4LV5B 5K8IA 1ONSA 3RVDA 1LLCA 3QBJA 1MNQA 3DYVA 1T43A 4MS1A 2DPXA 3FAKA 2A6PA 1L7XA 4KW7A 1WUKS 5BSVA 3LRXA 2V7QD 3TQRA 5K20A 3BZBA 3SYRA 3IT3A 3CEAA 2V7GA 4UW9A 1XLWA 4PQEA 3WGIA 1JFLA 2WHPA 3WBFA 4FINA 1E66A 2IZ0A 5JD6A 3FX2A 3ENWA 2XJ9A 5EZYF 4HDMB 5CT4A 5F51A 5E6RA 5EHQA 1SXJA 4GKJB 4W9NC 3P0JA 1RXEA 1UOQA 4E70A 5HTOA 1KAQA 3DGEC 4KV9A 1GPBA 2P2LA 1X42A 1EM8B 1A5ZA 5F33A 4JBYA 1GZ5A 2EF0A 2ZJ7A 4PSUA 2HRRA 5JSZB 4NV0A 3CNHA 3HQ4O 3INTA 3AP3A 4EH1A 3ZD7A 3E61A 4FGZA 2D2IA 1JW9B 3MS7A 1FU4A 2FQWA 5F4BA 2GN6A 1V9LA 3W6UA 1QS0A 1I3KA 1WP4A 2IEDA 4I46A 4DWVA 4F1KA 5A5VA 3Q88A 3AWIA 2Z58A 1X7ZB 4J7AA 1Z4NA 3HB0A 1BS1A 1KMQA 4M3NA 4RKRA 5DH9A 4CEIA 1XDBA 2JBAA 1TPZA 3U3MA 3WWPA 4GQIA 2R96A 3K4QA 3O84A 1XCGB 3KV3O 5ETJA 3ZKAA 5C32A 3F7MA 2BKEA 2A0XA 4AQDA 4D2IA 5EHGA 1Y6ZA 4QEDA 3K70C 4YX9A 3KKPA 4NJMB 4F5EA 3DV9A 4MVJD 5AI6A 1ATIA 2G1UA 3V6MA 1M2KA 4YDSA 1TZ2A 1Z5ZA 1Y33E 3OY2A 2GAOA 5EGNA 5FWYB 1GD1O 2GTPA 2VTKA 2AC2A 3B8HA 2P11A 3L93A 2PRJA 3MWDB 4KGVA 3OZFA 2QIOA 4JZYA 3LBYA 5BSFA 1EP2B 2G7ZA 2BTQA 1LBTA 3T4PA 2COEA 1Z68A 3I92A 1Z0FA 3WA7A 3D9QX 1U3UA 2ZT6A 4KAFA 4TUYB 4UBKA 4G0PA 2P4EA 3MJDA 1L1EA 1FTSA 2DM6A 3DV0B 4G4JA 3WL4A 1Q11A 1SXHA 5EZYB 1DBVO 1JB1A 3GJ8A 4RV5A 1E4YA 2FU5C 3COYA 1C3OB 1JSXA 4ZEXA 3GGJA 2ECQA 2PT7A 4HQKA 1M54A 1QZTA 3GMTA 1S3GA 4BLWA 4RVSA 4GZLA 3LUFA 3OETA 3UG6A 3IBTA 6Q21A 2C78A 3M7IA 2WUDA 3NETA 3R24A 1H0RA 3LC2O 4HBZA 3B6MA 3SP1A 2X0IA 1H5NA 2B1IA 3B7WA 3ZWBA 3UC9A 4R1LA 1BHJA 3OQ6A 3GXBA 3A3NA 5AP9A 3CWCA 3RBZA 2GNOA 2JI6A 2JCXA 5E7IA 2XOKA 2ZEJA 3EVZA 1VLHA 3IIEA 1IPFA 3ETLA 4UMDA 2X8AA 2QN7A 2VP0A 3I12A 1B3BA 3CN7A 4RX1A 4GEGA 1UPXA 2NUAB 1QG2A 4PYQA 5DGIA 3THRA 2AFHB 2R00C 3PHLA 2HFKA 3I3OA 1E1MA 1V45E 4HADA 4IGAA 4DLNA 2RI1A 4FOSA 2FMXA 2Q50A 3D3WB 1ZK1A 1SUBA 2DUJA 3MMPA 4AK9A 3H5TA 2D2XA 1P61B 5I8ZA 2EHDA 5HP4A 4IIEA 1CY6A 1YI8A 3N6RA 4EFLA 3IOMA 4Q37A 1MW9X 4TV8F 2JRCA 2NO7A 3FVVA 1NN3A 3P0IA 2OQ2A 2WNHA 3JARB 3UNXA 2IRWA 3TTYA 5T5QA 2BM8A 3AF2A 3O8DA 3EHEA 1PG5A 4R6XA 4S1PA 4LSWA 1E94E 3NKLA 5CFQA 2WFAA 2UUBB 1NXOA 3PZBA 4F7DA 3MWFA 1E20A 3VMFA 4KWHA 1NVXQ 2UYGA 3TRKA 3IAM1 4AF7A 3U39A 1I2CA 1JKXA 3W4JA 3WGJA 5KOJB 1A95A 3HBMA 2ACWA 3ETGA 3KAJA 3TBFA 1I4DD 4YN3A 5TF4A 3VTZA 1IN1A 2G9VA 2QZ9A 3OJOA 2EJTA 3F1KA 3BD8A 3EGEA 4JCCA 4X3PA 5C1BA 4ZQFA 4ER5A 3C7DB 5E8JA 2O20A 1IM8A 4HQLA 3OQ1A 3T3HA 2IKSA 4KGXA 3TPZA 4QECA 5AESA 3LS2A 5K09A 2Z3VA 5ER6A 5TXGA 4B6FA 1DU4A 5DTMA 4CKXA 3A1CA 3AJ9A 2P91A 2R6CA 2YWBA 4N0DA 3WL6A 3NYWA 3WLTA 3ZLVA 3RK4A 2PS9A 3O8BA 1XKQA 4N8SA 4RPKA 1XQWA 3TVDA 3MCZA 2VPQA 3VQTA 4N0MA 4E21A 4JLPA 4WFJA 5H83A 1OWOA 2OUKA 2I2WA 3OM1A 4YAIA 4ZCIA 1YULA 3VJMA 2E4YA 1SBTA 1PR5A 2Y8EA 4R0NA 1DFIA 3W5BA 1LPNA 1DIRA 3G3EA 4LG1A 1JT2A 1KMHB 1KYWA 2I99A 5EINA 4BQPA 5CFZA 1ZD8A 2C07A 4TTVA 5IJWA 2YL2A 2QMEA 4JJ7A 2PGXA 3QE4A 4HNSA 3X1XA 4DLBA 3M33A 4WXYB 1EFLA 2PL3A 3DMGA 3HPQA 1M6VA 3B13B 3GGSA 1CU1A 5FOVA 1J1ZA 1QHYA 2GXAA 1OY1A 4FMDF 4MWDA 2YASA 4ZVOA 4B74A 1CUZA 4CM7A 3AIOA 3OCUA 3P2OA 4G26A 4LHSA 3DHYA 1RLUA 3PQ2A 5EUCA 2XB8A 1DX4A 3AU8A 1CP2A 1OCEA 3VPXA 3NGLA 4NEGA 3NH9A 1ZM3A 3L0SA 4V39A 4IJUA 2PO7A 1XXHB 5B7NA 1K3UB 3HGMA 3UMMA 4AP5A 1C30B 1DO8A 3O2JA 1TMYA 3AUTA 4GD3Q 1CF4A 4J0QA 1NVTA 2QP4A 1KNXA 2XDWA 4NECA 1QLJA 3PNBA 5JTUA 3F5SA 4RD3A 5D3ZA 3WGHA 1QHSA 3UWDA 3B38A 1EP9A 2RJOA 1Z4IA 1G64A 3K6RA 3A1WA 2GWHA 4FFMA 3AX6A 4DY4A 5ADVA 4JXXA 4GE0A 2J07A 5TS2A 4HYEA 4MUBA 1RVDA 1YAJA 2ZRBA 4Q3OA 4K2AA 3P26A 4QYTA 4R5HA 2V8BA 1XK7A 1V71A 4BX8A 3B9RA 3GT0A 5B58T 4ONEA 3H84A 4JVMA 1SB9A 2G63A 2HI0A 2V7VA 1O7JA 1W29A 3LBNA 4Z0PA 2CB0A 1JPVA 3OZVA 2ZRLA 2O8CA 1P74A 1JL3A 3CN9A 3S3TA 1S2NA 3S81A 4WCVA 1QV6A 4P7KA 1FYXA 4KQWA 1M1UA 1FP2A 5J2TA 3BMOA 3C8DA 3ITDA 4YJ3B 4FUQA 2A4KA 4FYVA 4R1TA 4YCCA 4UUOA 4P81A 4II3A 3DZKA 3VHLB 5HCUA 3WLIA 1F6BA 1N2HA 2YZNA 4C1NA 4Q3AA 4UHEA 4ZN6A 4UE2A 1QP0A 3KOUA 2BLLA 1E8NA 1ZI8A 1YFLA 5HM8A 5B7QA 2ETXA 3AETA 1KORA 4ZI7A 3E9QA 3IIMA 4KQCA 1PK7A 1ACMA 3JSAA 4N5LA 4HDQB 4Y2GA 3HN7A 2GMWA 3U48A 5LP1A 4CKBA 3QBEA 1K0UA 3FOCA 1R9GA 3GBSA 4ID3A 2X86A 2ZQZA 4CGYA 1JN0A 3EZGA 4HPWA 3L4SO 3R4CA 2I8AA 3TW0A 1N7IA 1RWWA 3PDUA 3FFXA 2CFRA 1Y8QA 4RJTA 2YIDA 4RU1A 2JK1A 3AVPA 1QDLB 2ZUWA 2BAGA 5BQXA 3FMIA 3PB3A 3K2QA 4GL2A 4JC4A 2Z2IA 1FVHA 3P0HA 1YKGA 3KFLA 4OJMX 4RF3A 2PX6A 1KDYA 2YYAA 1W1UA 2J5BA 2Q45A 2UKDA 4IX9A 1X7YA 4QYIA 4RMGA 1TM1E 1U9CA 1ZGCA 3VJRA 2PEZA 3NOXA 1DQZA 2CHVA 1WUTA 1TTHA 1SA0B 2AJ8A 5AIAA 2IP1A 1H6DA 3NAZA 4EMUA 1C80A 3AF1A 2NN3C 2PLNA 2JLZA 1XNQB 2E2WA 3OEHA 1P29A 2GEBA 4L2IB 2ZITA 1BRTA 4RELA 3S1AB 1I2AA 1W36D 2JI4A 2HGZA 2WD9A 2OXRA 3JR7A 3GGOA 2BBOA 2CK3D 1L8OA 2C8LA 1OLSA 2HJ9A 3HCWA 4H0CA 4XWGA 3HO6A 1E96A 1URPA 4IMPA 1T24A 1L8LA 4Y2TA 5DOZA 5LYYA 1ZOLA 4UU7A 4I36A 2HQ1A 2CMHA 3EDQA 4MV6A 5KPDA 3NBYC 3P9CA 5K8JB 1XMQB 3OZTA 3S44A 1NTOA 3WNVA 3M6FA 2XQIA 4PONA 2R97A 4J75A 4PIVA 1KZHA 7MDHA 4EVQA 4K6HA 4BLPA 1AXRA 1W5SA 4OI4A 3ZGNA 4B3IA 4JVNA 4MYCA 5AMXA 1UKYA 2QXTA 1C8LA 3D31A 3GXOA 3AH8A 4FVTA 2XNDD 5CH3A 1W35A 1ZN2A 2ZPUA 4NJMA 3QPCA 3WGLA 4G0QA 4M0MA 1FDOA 5MFPA 4CG0A 1IY9A 5DHPA 1P7ZA 1Y1KE 3JAKB 3MWEB 4KQIA 3L8GA 3UANA 4KLNA 5K03A 3DTYA 2PZBA 4TM7A 4NMWA 4GMKA 2ATVA 1RM4A 2E6UX 4F56A 3KQOA 2W6QA 5F2KA 1ELOA 1P75A 4UPEA 1XWFA 1YS2X 1WHTA 4KGDA 3A6FA 3AL3A 2BFDB 2GCOA 2QR3A 3LHDA 4R8KA 2XMZA 1P8JA 1UMBB 3O38A 1GZSA 2X1LA 3PQ5A 4XQ0A 3V4LA 4CIWA 3I01A 3TRIA 4F1WA 4LC0A 2RB4A 1GNPA 4MUKA 3PNQA 5B2FA 4HEJA 1T3LA 5LP6B 1R12A 4RD6A 3FDJA 2AEFA 4MJ3A 3V42A 5JNWA 2O5EA 4LYGA 3O31A 2EWWA 1V3VA 3VPDA 2BP7B 4BWYA 3P0EA 1JS1X 1E1LA 3TAHA 2PLAA 3I04M 4C01A 2CJXA 4QREA 1LFAA 5KYWB 4AUNA 3ZK9A 1IOLA 4P35A 4QQNA 4DBVO 1MG5A 1UT6A 2Q3HA 3QVLA 4QXQA 2HAEA 5EMJA 5ITZA 1W44A 3LPCA 4B3MB 1GGVA 4FGJA 1XD9A 5B4VA 4DJDC 1NR7A 4QOIA 1G7TA 2NUAA 1NXSA 3VX3A 3PUYA 2V0NA 1HQKA 1AGNA 1JMYA 3O1HB 1DWOA 4NE2A 4X6LA 3M9XA 3USZA 4AMGA 3BB3A 4BMCA 1VE1A 4CM3A 4BRZA 2XCRB 4GPBA 2ERXA 1CZHA 3BA1A 5DRYA 3QEKA 4ZI7F 5CVUA 3E1GA 3LCRA 2QM7A 3G89A 1ZM2A 1UH5A 1UJNA 3UWKA 4WKOA 2O8NA 1EQ2A 1QF7A 4KDFA 4F60A 4MYSA 5AJVB 1XDUA 3HCFA 3W6NA 4BWFB 3G2OA 3W90A 1KO5A 1TO1E 3NVKI 2DWQA 3I32A 1KP2A 5AKEA 4C6SA 1TA0A 4TKLA 2IHKA 4INOA 2AMLA 1TLLA 4J49A 1KJ9A 3E2IA 3FPAA 2BKAA 4XJVA 4Y0VA 4B81A 4HFNA 5JSFA 3N58A 4Q1VA 3UMGA 2WV9A 3E58A 5EIOA 3UAVA 3T99A 4RE5A 3OEED 5GVRA 1TLTA 3HP1A 1WY5A 4MHOA 3SKYA 5EIXA 1FBTA 1YZTA 1J2UA 3GBVA 4BZQA 6ADHA 5P8WA 3AKYA 4TQUS 4A73A 5IVIA 4JIMA 4OLHA 1ZIOA 1NQUA 2OENG 4LF4B 3EUEA 4HN2A 2QRVB 3RVSA 2KX7A 3O47A 3M6LA 4V0QA 4IPTA 5SZIA 1L5VA 2JLRA 3ABIA 5TX7A 2O07A 4KK4A 1IG0A 2JIZD 1OI7A 4PFKA 3Q3GE 3L7YA 2XOXA 1T4CB 3QW4B 2G9UA <