4KE9A

Crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with an 1-stearyol glycerol analogue
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
EQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke9A00
3JYHA 3H2KA 1VOTA 2B20A 5KBYA 1ETHA 2EDAA 2YXPX 3WYDA 2IX9A 3ESAA 1YAJA 2JIDA 5ALVA 5IVHA 4H77A 3A70A 3AIMA 4B81A 2OGTA 3IURA 1QGED 1XROA 3N0TA 3I6YA 3OOSA 3C6XA 5DYTA 4MEAA 4BDSA 3G8YA 2C5GA 1TKRA 4CG3A 2CUTA 1QTRA 4HXEB 5CURA 1QIIA 3H2GA 2BCEA 1UK6A 1TK3A 4QNNA 5FRDA 5A7GA 1G5FA 4UBKA 3STTA 1UK9A 1MT3A 1PFQA 3V1MA 1CLEA 3PICA 3T52A 2C58A 5FOQA 5ALRA 2H7CA 4ETWA 3R3YA 3U0VA 4G1FA 4Q34A 1JI3A 5ALZA 1ZD4A 3PFBA 2WFMA 2DHCA 3H1BA 3W04A 4F60A 5AKHA 4Y2VA 5AKIA 3V1KA 3N2ZB 5F4ZA 4KAJA 3C87A 4N8SA 4FOLA 1CV2A 5BV7A 4A16A 4WDRA 5BWCA 4KE7A 1EK2A 1XZFA 3PUHA 2HADA 4B83A 3GUUA 2BGNA 3I6MA 3WYNA 1BS9A 1J1IA 3R3XA 4UBJA 1W76A 4RPCA 3YASA 1QFMA 4UFPA 5AP9A 5ESRA 3I2KA 2PSHA 3FVTA 3PF8A 1AZWA 4OU4A 3AFIA 1JJIA 2ROQA 3MUOA 3B12A 2XUIA 3C6BA 4ZGBA 3ZI7A 1LGYA 4QWMA 5ALLA 5AKGA 5LP1A 5C8ZA 2QS9A 2QR5A 3ANSA 1YR2A 1XRMA 4U2CA 5FPQA 4GBGA 4HRXA 5HK8A 4Y9SA 3QPAA 4GXNA 2WUGA 5C8VA 1VE7A 1XZLA 3R3UA 2BKLA 1BCSA 3X3HA 3STYA 3ESDA 1ZIYA 4X93A 2XMBA 5ALMA 4ARBA 4CCYB 4MYDA 3LCRA 5JALA 1QONA 2VJCA 5E2IA 5FV4A 3ICWA 5ALJA 5HKBA 3BDVA 3WWOA 4MWSA 4FTWA 1QIKA 1XRQA 3HC7A 4B0OA 1FJ2A 1AC5A 1XZEA 2PSDA 3FLEA 2WG1A 1VLQA 4UHFA 4OU5A 4DMCA 5JADA 4P9NA 4QDZA 3JW8A 3QM1A 4KAAA 4RNCA 1MAHA 3F98A 5DYWA 2RI6A 2WU3A 3KOOA 4JYPA 1DQZA 4GW3A 2VQ6A 1VA4A 4DMFA 2XMZA 2XQJA 3EQ9A 1H2XA 2XE4A 2B9VA 4O08A 4MYSA 5FXMA 3KWFA 5AK4A 1UXOA 2BUBA 1P0MA 5JARA 3IIIA 3WKEA 4J0IA 2J4FA 1THTA 3TJMA 3O9VA 2J4CA 3R41A 1RP1A 2XQFA 3FSGD 3HLKA 4TGLA 3HYSA 2QOEA 1CUEA 4NVRA 5CMLA 3CXUA 4HVTA 4B84A 1MPXA 5EHXA 3CCBA 4B9EA 1EA5A 2XUKA 4BAUA 3RM3A 1ORVA 1S8OA 4EA6A 3NOXA 6YASA 5JAPA 1JFRA 2GBCA 2NW6A 4BTLA 4BBZA 3D2CA 4MJ3A 3H1AA 4PNZA 4EUSA 4H7JA 2ZYRA 3U1TA 3FYUB 3NGMA 1LPBB 4C87A 1CPYA 1EK1A 2RHWA 3DJYA 2ZJFA 4OUKX 4BYMA 1QIDA 3CN7A 5FKJA 1HKHA 4B82A 4E14A 2WUEA 5FDFA 1R3DA 3GROA 4DM7A 1SCIA 4HXFB 3VXKA 4ZREA 4U2BA 2O2IA 1QZ3A 2Y2VA 3QMMA 4G4JA 1XZAA 3PFCA 1C7JA 3FYUC 1QE3A 2ZSHA 1G4HA 4NZZA 3C5WP 4F0JA 1MTZA 1CUWA 5KREA 2HFKA 3WIBA 3LIPA 2PKYX 4KRXA 3EQ7A 3R0VA 3I2FA 2OCIA 3HEAA 4UFNA 3EQ8A 3V1LA 4J0JA 2R8BA 1YB7A 2CJPA 4L72A 5K3FB 4GI1A 1JKMA 2OXEA 4H7FA 3OM8A 1EDBA 4G4IA 1ZI6A 3ICVA 2XUJA 1Y37A 5HCUA 4Y2QA 4LYDA 1KU6A 3IB3A 1IUOA 1WB6A 3VKFA 3H2IA 5AM5A 5IKXA 3PF9A 1LBTA 2ES4A 3BF8A 4GHWA 1H23A 2X76A 1PJAA 2Y6VA 4J3JA 3LLCA 5YASA 2HDWA 1ZOIA 3AZOA 4OD0A 3RLIA 2RIPA 2O2GA 2QUBA 2PUJA 1SOMA 2VAXA 5IVIA 5JANA 4BVLA 5A2GA 3K2IA 3WA7A 2OG1A 1RYYA 1ZGCA 4V2IA 2VA9A 1F0PA 1HDEA 4AO6A 3DOHA 4BATA 1XZKA 5FPPA 4ZWNA 1QIJA 5FP0A 3DLTA 4N8DA 4P92A 4N8EA 2G5TA 1DX6A 1G66A 1XFDA 4D9JA 4L3WA 3FCXA 4UUQA 5D3ZA 5E4TA 1GQRA 4BAGA 1P0PA 4KACA 1DINA 1K5PA 3VISA 1UOPA 1CQWA 3FOBA 4J0HA 1CVLA 4DTCA 5I8PA 2WFLB 4ZXFA 4W9RA 2Q0XA 3F96A 5DJ5A 3BF7A 1ZJ4A 5A7HA 2PVSA 1E5TA 5FLKA 2HRQA 3WJ1A 4AZ0A 1XZMA 1NU6A 3QBJA 4DIUA 1VE6A 2WJ4A 1BCRA 3FAKA 3O9MA 1MNAA 2Z8ZA 4FWBA 3WL6A 4W1PA 5JZ9A 5DTJA 7YASA 5AK5A 1LPOA 3R3VA 3ZLVA 5I9IA 1XQYA 3KDAA 1A8QA 2ZYIA 1QOZA 4XWGA 2QT9A 2XB6A 5EIAA 4CG2A 3M81A 4U2GA 2HA4A 1BEZA 2BUAA 5AKZA 2XUDA 1SCKA 2ZSIA 2OQIA 5ALQA 1CUDA 4H0CA 1H2YA 1GT6A 5AIAA 1TCCA 3AILA 4X00A 4K6HA 1BE0A 5AKJA 3O4IA 4INZA 3MUNA 1EXWA 4AN1A 4BVJA 3CCCA 3BL8A 4BRSA 2XLBA 5JAUA 1LZKA 1XZGA 3GA7A 4IH1A 3UUEA 4Q3KA 2HA2A 4UHEA 5ALDA 2JEYA 3QVMA 4X85A 3WKDA 3G02A 2W6CX 1WPRA 2HM7A 4K2AA 4X3CA 1ISPA 1VA5A 2WHQA 1E8DA 4CIBA 2C4HA 4XIIA 3I2GA 1DWPA 4Q1VA 1UKAA 3FCYA 2RAUA 1BN7A 2DHDA 3W05A 4UBMA 5JZSA 1QO9A 5T4EA 2FJ0A 3O0DA 4OB6A 1Y7HA 1GGVA 1JT2A 2X5XA 2DR0A 1ZD2P 3EF3A 4U2DA 3VDXA 3CN9A 1Q0ZA 5T4HA 1J2EA 1GQSA 4DSAA 3L1JA 1XZIA 3F97A 2XUQA 2PSFA 2WJ6A 1ODCA 2HL6A 1ZGBA 3ANTA 3FYTA 4OSEA 4BRZA 4QDTA 4FFVA 5ALXA 2WJ3A 1VZ3A 4X94A 4AMYA 4UHHA 3H0CA 1YASA 1ZI8A 2C7BA 1USWA 3G0GA 4JUIA 4OYYA 5CH5A 1XRLA 1XKLA 2UZ0A 5K3BA 4W63A 5ALHA 3WL5A 3SC2A 1C7IA 3QZUA 1NU8A 1YSCA 5ALWA 2G5PA 3C8DA 5JD5A 2VEOA 4DNPA 2HA3A 1TRHA 4X90A 2XMCA 1K63A 2FX5A 3V48A 2OLEA 2OCLA 1ACJA 1XQVA 4C4YA 1AMNA 4X92A 1DX4A 2XDWA 4FDMA 4MEBA 3HSSA 2OAEA 2D5LA 2Y6UA 4ZRDA 2BFNA 1G42A 3JWEA 3IUNA 3ZLTA 2QTBA 3RKSA 5BWBA 2DCMA 2WSLA 4FHZA 5LZ8A 2XUHA 2XMRA 3HZOA 3WL7A 4YASA 4BAZA 4W1SA 4G8BA 4IQ4A 1CEXA 2AXEA 1JMKC 3S8YA 1U4NA 3STUA 3DCNA 1SCQA 4X95A 5EIHA 1LLFA 2AJBA 3HXKA 2WU4A 2XMDA 4HS9A 5DNWA 4KYVA 1X70A 1LPMA 2XT0A 1THGA 4W1QA 5T4FA 1XQXA 1UFOA 4J7AA 1LPPA 4JEIA 1RWQA 4E46A 4EY4A 2CEKA 2VJAA 4BC1A 1F8UA 3UUFA 1HBJA 4QLAA 1K4YA 1E8NA 1MX9A 2LIPA 3BJMA 2VT7A 4YPVA 4C4XA 1P0IA 2OCKA 2JGEA 4FBLA 2RONA 5AKYA 3PE6A 2XLCA 2EEPA 5CXUA 2XUGA 4AQDA 1CUUA 3DYIA 4IH9A 5H3HA 1HLGA 4PF1A 2PU5A 3BIWA 3G0DA 5ALTA 4H7HA 1QJ4A 3WWPA 1MX5A 1ZD5A 2AJCA 4QE3A 4CG1A 3OTQA 4RE5A 3QMVA 4AZ3A 3ILSA 5IVDA 2XUPA 1BROA 1DQYA 1N1MA 3ZV7A 2E3JA 4DGQA 4Y7DA 3RK4A 1QIHA 4Q05A 4K5QA 2JF0A 2Y1KA 1JU3A 1QO7A 5EFZA 1YA8A 1J06A 4M0MA 3C6YA 3OURA 2XUAA 4WJLA 2JGMA 4BP8A 3L1IA 1QFSA 1GPKA 1R50A 1JJBA 5ALNA 3AZPA 1GPLA 3T4UA 4C89A 3K6KA 4L0CA 2XUOA 3D7RA 3AIOA 3FVRA 4PQEA 4E11A 2PSJA 1B6GA 1CIJA 4F5ZA 4FFWA 5AM3A 3STWA 5CT6A 3STVA 4U2FA 4NMWA 4X91A 3PDCA 3FLBA 4J0DA 4Y2RA 1XRRA 3DQZA 1R1DA 1VXRA 3DNMA 3WI7A 1W75A 1IVYA 3I2HA 1UT6A 1YA4A 2DHEA 2OAGA 4AMZA 2WKWA 1ODSA 2JBWA 1XZBA 3WJ2A 3Q8WA 4YK7A 3DKKA 4KEAA 3LIIA 1W4LA 5LZ7A 4H7DA 5C8XA 3VJLA 2VJBA 5AO9A 1CUHA 4G9GA 5D6OA 2VT6A 2WFZA 3ZLUA 5EHZA 2CKMA 2WLSA 5D7BA 2PU7A 4F21A 3E4DA 4KRYA 5A7FA 3DDUA 4J0CA 3BXPA 2VAVA 2XMQA 3QYJA 3KXPA 2GBGA 5AI5A 2YYSA 1W6RA 2CBGA 3ESBA 2OPHA 4PV7A 3WWCA 1UKCA 1X2BA 4HXGA 1UZAA 4DLNA 1WOMA 1Y7IA 3WMRA 4OCZA 3D3NA 2HA5A 1L7AA 5FUMA 1UOQA 3I2JA 1U65A 5A71A 3A2MA 3LP5A 5K3AA 1M33A 5AKXA 2WTNA 5KWIA 1DU4A 4Y2YA 2Z8XA 3F8SA 5HFAA 2WIDA 3H17A 4B9AA 3DKRA 3GELA 1LPAB 1B41A 1OCEA 5EIEA 5CH8A 3FBWA 5K3EA 5LZ4A 2AJDA 1L7RA 5LIPA 1IZ7A 1W1IA 4K6KA 2WM2A 4P08A 5ALPA 3WKCA 2QXTA 4B80A 3MGAA 5DNVA 4B85A 2GYUA 4C4ZA 3V1NA 3QH4A 2Y2UA 1ZD3A 3A2LA 5ALSA 1UKBA 3IULA 4TVKA 5ALYA 1D07A 1QTIA 1XLUA 3WK7A 4LHEA 2HRRA 4EY6A 4EB0A 2QRUA 4LKOA 2I3DA 4CCWA 4X71A 4M0EA 4KE8A 1QIMA 2O7VA 1I6WA 2JGJA 1LBSA 4BP9A 1VZ2A 1YS1X 2GZSA 3E3AA 5AOBA 1EB9A 3WA6A 2H9YA 1JU4A 4LYEA 3AJAA 3WZLA 4X97A 4H35A 2G4LA 1MJ5A 2BUCA 3EIOA 4S0XA 2JGFA 4CFSA 1YB6A 4OPMA 2WHRA 4LIPD 4AN0A 2EDCA 4UPDA 3G9ZA 3AUKA 4C01A 2QM0A 4Q3OA 3DEAA 1TCBA 3ZPXA 3C6ZA 5CH3A 1YS2X 1H2ZA 5BOVA 5IH7A 1X2EA 5AM2A 4CI9A 3IA2A 4LXGA 2QUAA 2C0PA 5CT5A 4BZWA 4PSUA 3G9XA 3BE8A 2BGRA 5SYNA 1KEZA 1U8EA 1UK7A 4WCVA 3WQHA 3M3DA 3A6ZA 1FFAA 1OILA 1WPXA 4G4GA 1Q83A 1VJ5A 3LS2A 1EH5A 3HACA 4QDXA 1XKTA 4H7IA 2XUFA 3BIXA 1O6FA 1ACLA 2PL5A 1QLWA 4I3FA 3C70A 3FNBA 3H18A 1GZ7A 1EX9A 4FNMA 1CUAA 4Z49A 5CBKA 2QXUA 5AKKA 3VJMA 4N5IX 2VATA 3O4GA 5DWDA 5EGNA 4DSZA 4W1RA 2VSQA 4X6XA 2WIKA 3P2MA 5JIBA 1IUPA 1CUCA 4NS4A 1AQLA 1HQDA 4GDMA 3TGLA 4WY5A 4JYMA 2PUHA 2XQGA 4UBIA 2XQIA 4X7BA 4HAIA 2I78A 1R9MA 4DNFA 3I6ZA 3QITA 5CW2A 4M0FA 5JYCA 2Z3ZA 3L1HA 1L7QA 2OCGA 1YCDA 3D2AA 3O4HA 5DLPA 2IIVA 4BVKA 4RGYA 3W9BA 1UWCA 3NUZA 3G9UA 1TIBA 1CUXA 3IUQA 1CUGA 1R88A 1LNSA 1CUSA 1XZJA 4G9EA 4LXIA 3D4LA 4BCDA 1MN6A 1Q84A 3KSRA 3AIKA 1CUYA 4UBNA 5HF8A 1MU0A 2QMQA 1JJFA 2K2QB 3G0BA 4I4CA 2ZYHA 1TQHA 3NWOA 1F0NA 3IBTA 3V9AA 4KE9A 1P0QA 4J0KA 5LZ2A 4EY5A 5AI4A 3WK9A 2HHAA 2HU8A 2OGSA 2I3ZA 3C5VA 1HL7A 2ECFA 5JD4A 2YH2A 4UFOA 3WLAA 4ARAA 4MQMA 1WB4A 1CUZA 3B3QA 1GPNA 4EY8A 1UK8A 1EDEA 4BCCA 4MXDA 5JASA 3QPDA 1QIFA 4DNOA 5AH0A 4PSDA 1WHSA 1UOOA 2WUDA 5AKEA 4CCYA 5AKLA 3KWJA 3G0CA 1VKHA 3WK5A 3DOIA 5AI0A 4P93A 4GLBA 2WIJA 2JGIA 4HRYA 1CFJA 1BEEA 3SX4A 1R9NA 3IDAA 4WFJA 1CQZA 4FMPA 4B0PA 4BZZA 3W06A 4AO8A 5SYMA 4MWTA 2HFJA 3ED1A 1AUOA 1O6GA 3B5EA 4UHDA 3KD2A 3OPMA 4OYLA 3VJKA 5CT9A 1CUFA 1XZHA 1EDDA 5ISMA 1MAAA 5AOCA 4WFIA 2XI4A 2B61A 1OXMA 1N5RA 1EHYA 4KJXA 1XZDA 3EBLA 3PUIA 1DT5A 1IZ8A 2H7YA 4IO0A 5J3JA 1IMJA 4X6UA 2PM8A 1CUBA 2FJPA 3WIOA 1WHTA 3I2IA 3W9UA 4UBLA 5A62A 2OQVA 1MNQA 5AK3A 1BN6A 1IUNA 1W52X 4G5XA 5CRIA 4AX4A 1EVEA 1XLVA 1F6WA 2Z5GA 3WK6A 4KR0A 4UHCA 4JNCA 5E4JA 2BAGA 3DYVA 5HF5A 4EY7A 3FLAA 2WHPB 1ORWA 5JZBA 1FFEA 1SC9A 3SWWA 4H18A 2ORYA 1FFBA 2DQZA 4DMHA 4Y2UA 5EHNA 5K3CA 3MVEA 5JD6A 4YX9A 4G8CA 1A8SA 4A5SA 3IUJA 4BB0A 1C4XA 3WK4A 1CUVA 2HA6A 1ZI9A 5DTIA 1T2NA 5IVKA 3D5EA 1LPNA 1LPSA 1FFDA 1QIEA 4KE6A 1K8QA 5C81A 5CT8A 5AI8A 3R3ZA 3WK8A 5ALOA 3I28A 3O95A 5EI5A 5E4YA 5EHQA 5HK9A 3IVMA 3G9TA 2I03A 2AJ8A 5CT4A 3C43A 3G0IA 4ROTA 5ALEA 2D0DA 4GEGA 1DTEA 1WCYA 2AJLI 3D0KA 4RE6A 4Y2JA 4BE4A 4ITVA 2JEZA 2ONCA 1E89A 1QIGA 1TAHA 2O2HA 4N5HX 1R4ZA 4BDTA 5JAOA 4DYHA 2WILA 3HABA 1KU0A 2P8SA 5LZ9A 2ZVDA 3H2HA 2XMGA 3D2BA 2V9ZA 5A6VA 5HQ3B 5HZGA 1E66A 2R11A 5ALIA 3QMWA 2HIHA 1XLWA 4QLOA 2JGKA 3BDIA 1AURA 3E0XA 2RGUA 2C5FA 5AM0A 4J03A 1EI9A 1MX1A 1GXSA 1ZJ5A 2WIGA 4IH4A 3M82A 1E3QA 4KAFA 4B6GA 2QKYA 1HPLA 2QJWA 3AZQA 2WHPA 5DNUA 4CIAA 4BE9A 2O7RA 3H04A 4QZVA 1H22A 1XRNA 2GBFA 2GZRA 3D59A 1N5MA 2OGZA 3IUMA 4BC0A 2WG2A 1XQWA 4ZV7A 2B4KA 3GZJA 4WY8A 2PSEA 3C8HA 4Y2XA 3W2TA 3FYUA 3I1YA 3G7NA 2HA7A 5CTAA 3WKBA 3DD5A 1GKLA 5C7YA 1AGYA 2QVBA 2PPLA 5LZ5A 2IITA 3WWEA 1LZLA 1ZICA 4OB7A 4E15A 4XJVA 2WIFA 5LKAA 5DYYA 1ODTC 2ZJ6A 2H7XA 5I7UA 4QA9A 1YAHA 4FLFA 5JAHA 4C6HA 3R40A 5HKAA 5T4BA 2VF2A 4GWLA 1FSSA 4QEKA 5CXXA 1WB5A 3QPCA 2W22A 5HQ3A 2PBLA 1DT3A 5D3KA 4Y2SA 5AM1A 3ZWQA 1Q0RA 4LXHA 4QDUA 1DWQA 4MQLA 4Y2TA 2C0QA 2ACKA 4XX1A 4EBBA 1A88A 4PSCA 2QJRA 5AICA 2WQZA 2Z3WA 4OB8A 1DWOA 4JH0A 4BTVA 2VJDA 3FSGA 3I1IA 3PI6A 3Q0TA 5ALUA 4U2EA 4Y2PA 2CB9A 4FLMA 1XRPA 4EZIA 3WL8A 4I19A 2ZYSA 4K6GA 1J07A 2BJHA 3FWHA 1SFRA 1XZCA 4QWWA 3VVMA 4UHBA 3WWDA 3WKAA 4GECA 4DNQA 2J3DA 2WTMA 4G8DA 3R3WA 1BU8A 5LYYA 5LLSA 2X8BA 5ALGA 2V98A 5K5EA 1NX9A 2WUFA 4H7KA 1EB8A 5KWJA 2GYVA 3M83A 5LKRA 1EINA 3GBSA 2HU5A 5JATA 1CRLA 3E1GA 3AINA 5AK6A 3DL7A 3BJRA 2PX6A 1TCAA 2ZJ7A 1AKNA 3F67A 2XQKA 1H2WA 2CMFA 2VTVA 5AJHA 3STXA 4WDQA 4PO3X 3HJUA 4EHBA 4AB1A 3OG9A 3A2NA 4ZV9A 3TRDA 1E8MA 4H7EA 4A23A 1PV1A 5AI6A 2J3QA 4Q3LA 4BCBA 1WM1A 3TEJA 3UMJA 5HF9A 1FFCA 4J0GA 2JGLA 3SK0A 1K6EA 4HTAA 3H19A 3DL4A 2ACEA 3F9CA 5AI9A 4FLEA 1CUIA 2V96A 2RHTA 3HI4A 2YASA 3BWXA 1ZIXA 2HA0A 5ALKA 2WG0A 4AXBA 1EVQA 4FKBA 3DS8A 2GYWA 1VXOA 3OC0A 5K3DA 5HFNA 4B7ZA 2H1IA 1CR6A 4WFKA 2WFLA 3RARA 1T4MA 4UBOA 5AIBA 5K3FA 4AO7A 2DFPA 4QDOA 5AM4A 5AOAA 4ZI5A 2G63A 1A8UA 1GKKA 1BRTA 2CZQA 1Z68A 3GFFA 3H2JA 3C45A 3HRHA 2GBIA 1MO2A 4TPKA 3WZMA 4DMKA 5AHXA 2XMSA 4PW0A 1N8SA 4L9AA 4IHAA 4Q82A 1CUJA 3O4JA 4HZGA 3S2ZA 1JMYA 1AX9A 2HU7A 2DSNA 2DQYA 4X6YA 5ALFA 3K9BA 4C88A 4FNGA 1U2EA 3ESCA 4XVCA 1A7UA 2FUKA 4FBMA 5HF6A 2QZPA 2V97A 3VVLA
chains in the Genus database with same CATH superfamily
3BGOS 3VDRA 3H2KA 1H1TA 1PV4A 2B20A 2Q46A 1AGXA 4ZVPA 3KTAB 1JUDA 1RLIA 5KI6A 3PHLA 4YT2A 2YXPX 5JJIA 4URVR 4JI8B 1Z4OA 3MJDA 5FD8A 3C97A 3I6IA 4S2UA 4U7HA 3PFIA 2RHHA 3EE6A 3JQ6A 1SRQA 1YDHA 1ZD8A 2D06A 2XIJA 3PI7A 4JROA 5ALVA 5J59A 3D64A 3GCWA 5IAKA 2QZ4A 2NZYA 3RVBA 4H77A 2WVGA 4HBZA 2PMCA 1NURA 3A6EA 2DB3A 4GX5A 3RK0A 4U0JA 2FZGA 2G9QA 2PSSA 3C1AA 4YQEA 1HNWB 5JWRA 3A26A 1YVRA 1J2UA 1EJ2A 3FGPA 4RAQA 4XLZA 4YUWA 4NJOA 4M86A 5KC8A 1GKIA 2HHLA 2JLAA 4O4JA 2QSYA 1DRUA 3TRIA 4OMUA 5IYZF 4MKRA 2CMKA 2NV0A 1WS6A 4KGDA 5FJJA 1ISSA 2EP8A 2BSXA 4OJYA 2W48A 1BJKA 3AP3A 4IMIB 1QKIA 5EXTA 1NYLA 1ZPDA 1MD9A 3ETJA 3QNWA 1WSDA 4URZR 1TKRA 3AF1A 1KO5A 1XD9A 3EHEA 3UT5A 5AK0A 2BF4A 2PH7A 1UXKA 2PRSA 4KSYA 1V7QA 1RI4A 2XVAA 5TJ9A 3FI9A 5CURA 1R8XA 4O3MA 4FMCF 4P7KA 2FPIA 1DC8A 1OVGA 2N3ZA 3CISA 4QQ8A 1CKEA 3PPWA 2PX4A 1Q7TA 2BCEA 2E0IA 2WTAA 3PNOA 4QYWA 1TK3A 2JI9A 4INPA 1XF1A 3JD3A 1AGNA 3KFXA 4FSHA 4QYMA 1YDWA 1L4EA 1T9ZA 2GSDA 4IGAA 1RKUA 3WYCA 1BRMA 1P4AA 1OHHD 2IOYA 3WXBA 5SY4A 5E0OA 1IBRA 3DXYA 3FKSA 1BDHA 3V1MA 1OH5A 1CLEA 5JCJD 1U28C 2B7BA 4EJMA 2FPPB 4E08A 4R54A 3A36A 3BWYA 4Z7OB 2HEIA 3BGWA 3D7NA 5GVSA 3F7NA 2DYKA 2XY4A 3EEFA 3QYPA 3R3YA 3GGDA 3KT0A 4NCKA 4BNWA 3L46A 1I2BA 2GJ9A 5CA0F 4KITB 1YS4A 3F74A 3TNDA 3ADPA 3QBVA 1X7XA 1R9JA 1XC7A 3A1FA 3X1MA 5ALZA 1J90A 3CF2A 5LC1A 4HQRA 2UZ4A 1G19A 1Z35A 2F1HA 1P77A 3GEDA 2I7VA 5EJ2A 3GT4A 3SDSA 2AS0A 5E1DA 1L7VC 1UT5A 5DM60 5G3YA 4KXQA 1OFUX 1L1RA 2WFMA 3TMKA 1IQPA 2TECE 3NC1C 4PTYA 1JYSA 1XEFA 1NATA 2GR9A 5AKHA 1UBEA 2A9FA 2M1XA 4Y2VA 2JJMA 3NHPA 5IUKC 3F6CA 3K2QA 5F4ZA 3NKVA 1U1EA 2VK8A 2Y4NA 3AGQA 1M2NA 4NRDA 2QN6A 4EG8A 1OJ7A 3BBPA 4FWTA 4UMFA 4KNYA 3VPDA 4G37A 3EXG1 2IZ0A 1RMTA 1NJ8A 1H2EA 2EERA 3NHKA 4WOPA 5JO9A 3TKLA 2B1IA 5BWCA 2JANA 3FMFA 3N1UA 3U81A 1AQJA 2X42A 4AJPA 4R2IA 3VC1A 1LTHR 4CMKA 3GUUA 1HMYA 2P8JA 3G2PA 2BGNA 5KVCA 4JZYA 1CQJA 4L08A 5FCDA 3VOSA 2NO5A 5LMNB 1T9HA 1M8PA 2I2XB 4FX5A 4UBJA 3IAEA 1OH6A 1JB9A 1W76A 3MILA 4RPCA 3ZX5A 1E7YA 1PGQA 3E70C 3OUTA 3VMMA 4WCFC 4OM7A 3CNOA 5DGTA 4HDOB 3PF8A 3O94A 3PDIA 4G25A 1PX2A 3WISA 3CV3A 3ZDFA 4DLRA 5HX7A 5J40A 1HRDA 1JJIA 2ROQA 2QK4A 3UFXB 5A9SA 4Z0TA 4ZO6A 1RPTA 1W581 4CETA 5TF0A 2PS1A 2E89A 2REOA 2E5FA 2G28A 3ZS8A 1LGYA 2JLRA 2YN4A 3FOWA 1G21E 3C1OA 3KWLA 4QWMA 4YP0A 3RUHA 3HI6A 1PYDA 2IL1A 4E13A 1RYDA 2WKPA 1XN1A 4E5PA 2OZLB 5IXJA 4CEIA 4K6OA 1XRMA 2AX4A 3P2OA 1WNTA 4UHJA 2OL4A 1B0PA 2ZTSA 1KEPA 3CPEA 5IMBA 4EJFA 3TG2A 5CK4A 4ITUA 1CR0A 2VSOA 3GR6A 3NAMA 2IE8A 4YFYA 5H16A 3UJ9A 1SURA 3ANYB 1WO8A 2BM0A 3PZBA 4P31A 5ITSA 5JCPA 3LL4A 1ZESA 1VE7A 4PHGA 4P36A 3IP9A 1FMTA 4C21A 1USKA 3GO4A 3ZU4A 1I4LD 4QOHA 3X3HA 1J2JA 1RWWA 5L3SB 4B6EA 4NOLA 3ZY4A 2R6JA 3KQUA 2XB8A 3LXMA 4X93A 1II9A 2C8JA 2FQQA 1EZZA 3GFBA 3VYTB 4ARBA 3HXLA 1N57A 3C0KA 3BUSA 5FUXA 4BN4A 4CCYB 5CVVA 1RCTE 1W36B 1YMQA 1WZNA 4YRNA 3GAZA 4MI1A 4S1NA 4ARVA 1ULBA 3LCRA 2DUNA 1ZEJA 2FW1A 2L42A 1SXJD 4DR6B 4P2BA 5FO1A 2RHDA 5M7EA 1ADBA 2V7BA 3ICWA 3AI2A 3IXMA 1BKYA 3FVQA 4WGFA 4DR7B 4JVOA 1T35A 2EJUA 4FTWA 3V00A 1TFUA 2PFKA 4CR6A 4GP9A 4JQOA 3UF0A 2IYTA 4CHGA 4HUQB 3WG9A 1IZZA 3HC7A 4O4LB 4GS5A 4DY6A 2YTZA 3NGLA 5IWCA 1DAKA 1B0ZA 4DQVA 5HPYB 3MQFA 3MCAA 5MN4A 3OZTA 4JIMA 4ENQA 1Y6FA 1FYEA 2ODTX 4H16A 1TM2A 3SR3A 3BSSA 3FZGA 2ZIAA 4HLUC 3UCEA 3FLEA 4RGBA 5J23A 2WG1A 4JIGA 4RS3A 1Z0JA 1CXZA 4UHFA 1JG6A 4P0QB 3NNSA 5EUMA 2VUHB 2ZQ5A 1KDVA 2YOFA 5K8TA 3P4YA 5L95A 2GPWA 4E1AA 2O2YA 3BCSA 3GUHA 2J9ZB 1OYVA 3JW8A 3F90A 5KIAA 1W85B 3N6VA 1HFJA 3K0EA 4QPCA 3A6LA 3I6QA 1QYCA 2RI6A 2WU3A 3OIVA 3Q7IA 3QI7A 4HWSA 2VCEA 4BMDA 1DQZA 4CLXA 4ER0A 4I36A 3X2EA 4YQFA 2GBLC 2VQ6A 3QOWA 1O6ZA 4E5KA 5U9CA 2H08A 3WYBA 3HUDA 2X1VA 4TX1A 1XDWA 1Z16A 2ZIXB 3MT9A 3ZZ1A 2XMZA 2XQJA 4BEWA 4XOUA 4EA7A 2PJDA 3I01M 3F3SA 1ULUA 4PNPA 1DIGA 1QF9A 1X0VA 4HKTA 5IKOA 1EX6A 5F12A 1Y89A 2RGAA 3DT8A 3KYJB 4X20B 4C7VA 3GOHA 4LBYA 4Z51A 1F2VA 5FXMA 3ESZA 3O4VA 1CSEE 3AUYA 3NPAA 1Z4NA 3P4XA 4IJUA 3L4JA 4YAIA 3KX2A 2GJKA 5AK4A 3A7EA 1UXOA 3ZIUA 4RVCA 5JARA 4ETMA 2IYZA 3GG9A 1Y81A 2X6TA 5IUNC 3WKEA 1AE1A 2JFFA 3UMRA 1YJAA 3D7LA 1LRLA 4HVAA 1Z13A 2JIZA 1I0IA 3I92A 4LOHA 1N32B 1NT4A 3NYIA 4ZVKA 1RLMA 1EHCA 3CH6A 3FW1A 3IP7A 5KUTA 2VDMB 3K72B 2PUVA 3Q4GA 4TS1A 4EQ6B 2P2SA 1QQAA 2O2ZA 1D6MA 4X1KB 5FL3A 5B30A 2O14A 1VL6A 3HDHA 4IJ6A 4L3VA 4QFDA 3WLLA 3AVUA 1LV8A 1DL5A 1FMJA 5TQJA 1T3HA 1Q5PA 3HLKA 3ZWOA 4TGLA 4LYYA 3RASA 1NF8A 5A4FS 3CE6A 4Q9NA 4GKVA 3SX0A 1DUIA 3NTRA 2VF5X 4LWQA 3BFPA 3CXUA 1DO2A 4B74A 4TMTA 2QN8A 4KDFA 5JTUA 2EWMA 3U3XA 2YFHA 4MP6A 2BGLA 3M6LA 1QH9A 4L0MA 5EHXA 2XT6A 1T3GA 3CLTC 4LZJA 3LYLA 1NE2A 4NX2A 3UJCA 2P91A 4B9EA 4N65A 1NUUA 3TTTA 1XPOA 3SHWA 4FCCA 1SK8A 3OM9A 4WKCA 3TI9A 2RAFA 1JL3A 1RBQA 3Q9NA 1Y82A 2IU0A 2C8VA 2P4UA 5KPDA 1TEZA 3RYFA 1K8XB 2DJ5A 4BV3A 1WWKA 4FYHA 5HJ7A 2IBTA 2YRFA 4P4TA 3OCVA 4UM9D 4CV1A 2Q5JA 1G2QA 2GBCA 3F49S 4JVMA 1PWYE 2E5WA 3Q9UA 3ZZ0A 2O8VA 2Y1DA 4OQNA 1XZ8A 2F9LA 4YCBA 3B1XA 2QHXA 1QH8A 3GLFE 1T9AA 1VSBA 1JPNA 3I0MA 2ZYRA 1XTSA 1VIMA 3WLPA 5ICMA 1UBHS 1Y9DA 3NGMA 1Y3HA 2QG9A 3VVBA 1LPBB 1XDBA 2F3UA 3L01A 2ADOA 5AVKA 4RAOA 4C87A 1PT5A 4D4IA 1A1VA 3ZWNA 2OD2A 1ZIPA 2RKWA 1OXBB 5J5CA 5K0LA 3SQNA 3TBHA 1GZSA 2RGBA 5LYJA 8GPBA 4HSGA 1EK1A 4US1R 2AEMA 1EFCA 4IRUB 4C5AA 2RHWA 3DJYA 1KQFA 2C2OA 2I2WA 4HNGA 1GUBA 4J1TA 4Q39A 4BU1A 5HKKD 1RHRA 2B8JA 1E2DA 1D4OA 2JFHA 2PZEA 2ZB8A 4G5RA 4F9GA 4F6RB 2CFSA 4F5WA 4GVXA 2HK6A 2MU1A 2XYQA 4I4TA 3T9CA 4G6ZA 3GN1A 4E03A 3TZHA 1YUNA 3OFVA 1U1IA 1UBFA 4MDFA 1V96A 4JC0A 3GJ0A 4RZUA 3S2GA 3V8EA 2BVNA 2WUEA 2C20A 3PLAE 1UM9A 3E05A 2H29A 4L8WB 5EKUA 4NFYA 3M6MD 4ESHA 2B1RA 3PG5A 4MS1A 4PGMA 1OLUB 1LK7A 1QK3A 3UJBA 2WWRA 4LZWA 2IYOA 4FILA 3WNVA 4TMZA 3GFTA 4PFJA 5JSYA 2FVXA 3A4YA 4C0KA 4DM7A 1YR3A 2B1GA 1DTWA 2FK7A 3Q3IA 4HXFB 4BBAA 3A4IA 4Q4AA 3RV4A 3MN1A 4XRRA 4ZREA 1G8AA 1OLXB 5KYVA 5FAXA 3R5TA 1GCOA 5B7QA 5EJGA 4BFZA 3UUWA 2DGDA 2X41A 3LPMA 4JJIA 5A4MS 1QZ3A 5KYYB 1XA3A 5H7XA 3UKDA 2HWYA 2XITA 3QUSA 4REMA 3VZRA 5IAAA 1J5EB 1XZAA 2YY6A 3PFCA 3GFPA 5K20A 1LQTA 3FYCA 2F8TA 1SZCA 1O54A 3KAPA 4Q1CA 2H0QA 3VH4A 1CIPA 4WZAE 3HJFA 2VPXA 3K9GA 3NWEA 4URHA 1JLRA 1H65A 2R96A 2EOAA 2EP5A 5ELXA 1GTRA 3O5AA 3HGTA 3HJGA 5JQGA 5KREA 1IEWA 4EB3A 1V5IA 1FFWA 5LL6P 3TGPA 3KOUA 1THZA 4FR2A 4TL6A 2YY7A 4I9GA 1BMFA 4MEJA 3ZKWB 3LOUA 1TQ2A 2X3YA 5BRNA 3A2KA 1I80A 3KL2A 3HB1A 3W78A 2SECE 2R8BA 4RV4A 5BW8A 3N8HA 4L75A 2CYCA 2FP4A 1EFRD 3UEOA 2JZOA 2QW8A 4L72A 3WB0A 3DF9A 4QJ3A 4ZGWA 4LC9A 2IOFK 1T9CA 1QG6A 1VPVA 3RKUA 3VH2A 4Z7NB 2ZEJA 5KYWB 1RMQA 3L92A 5K8VA 1L8XA 1WCIB 2KSQA 1QHYA 4Q1DA 1NGSA 3I8XA 2Y9PB 1PUJA 4B48A 4Y2QA 1KK3A 1KU6A 2H1LA 3IJPA 4URXR 3IB3A 4TVOA 2HZBA 5FQOA 1L5NA 1WB6A 4EO4A 2QYTA 2FEXA 3VMFA 2ZBQA 1KZYC 4L4YA 5TT0A 4BMSA 2PR7A 1LBTA 3N7UA 1VLZA 1ZKDA 1K75A 1U6KA 2IP2A 1ISIA 2EWVA 1H23A 2VYVA 1NNSA 2X76A 3BF8A 4UXHA 2Z5LA 1BX1A 2CCJA 3AHDA 2E21A 2QTNA 3BSWA 4UDXX 4DCUA 2C00A 3OQBA 5JSHA 3DT9A 3QG5A 1RQRA 2HT6A 4DUGD 7MDHA 2O2GA 1Q95A 4MVWA 5CGZA 2MOKA 1ZA1A 5FUQA 2HMAA 1VRVA 3I5XA 2GPAA 3Q8KA 4WZAB 1SOMA 1W5EA 5TB5A 3TVYA 4B3TB 2VAXA 5IVIA 5JANA 4RDCA 4EG4A 2W2NA 1UC4B 4GEKA 2I67A 4DLZA 4CRWB 2OG1A 3A3PA 2INGX 2X0RA 3X44A 3I5YA 1PDVA 3I39X 2DUWA 3AKEA 1DIAA 1MJGM 1I1NA 1ZRSA 3BORA 1O2DA 4RY0A 4MUGA 2DUMA 1J5PA 3LY5A 3O3OB 2WICA 3LPAA 1JG3A 4EGCB 5I48A 1U0FA 4PXYA 1FTQA 1BW9A 2R8RA 3KHTA 4NP6A 3ZWAA 1RABA 4ID3A 5F4BA 4DSOA 4DB4A 2PUFA 3H8SA 3VU3A 3V7UA 3NHUA 2VYFA 4ZEVA 2WQ7A 1AKEA 1EFLA 4GOLD 4V0LA 1SOUA 2FN3A 1F0PA 4WZBA 4JJ8A 4J43A 1Q7BA 4GR5A 2NO9A 4TTQA 4LJ5A 3L8ZA 4LZLA 2A0FA 3DOHA 4K9RA 2QX7A 3IMEA 1A7AA 4BATA 4ENSA 1ABBA 2CBXA 2E2WA 4TYMA 4ZWNA 1P39A 1QIJA 2I65A 2ZRIA 4URUR 4XD7A 4C1NA 3CUTA 2FEPA 3STHA 3N2KA 4P92A 3JZMA 2OV3A 2XRMA 5LQRA 1DX6A 1O0CA 4V0NA 2AN3A 4OIFA 3KAJA 1GGEA 1KNQA 3RNLA 5LD2C 2C2KA 3RS3A 5IN5A 4PAGA 1SPBS 3BQNB 4Y7CA 1F5NA 4UUQA 2B92A 3N28A 5CAEB 3TVDA 1T9KA 1ZDMA 2K2WA 4EGFA 5AW3A 1P0PA 3RH0A 4LDZA 5L6MB 3CEJA 4R1LA 2IBMA 3CX7A 4JK3A 1RRGA 3WQRA 1LK0A 5A6SB 1K5PA 3RRNA 3UK1A 4CF6A 4F8YA 2HMWA 1Z6XA 3SQDA 4IGEA 4ZQEA 1HDXA 1ILWA 1H6DA 1GRNA 1BH2A 2FKNA 3JASB 1QYRA 4KODA 1ZISA 3RREA 3VSDA 4CGYA 3KAQA 5U1PA 2A14A 1XNJA 3KB6A 2ZROA 1ZM7A 1N77A 2P1DA 4G0UA 2Q4TA 4QTUB 3GL9A 2IIBA 4IIBA 3ZI4A 3EIQA 1KJ8A 4RZSA 4DLYA 2KS6A 5CG1A 2I80A 3AG5A 3DZJA 2Q0XA 3EA5A 1R8SA 3MCVA 4W9RA 1JEQA 1HEYA 2AH5A 5EHGA 1ZJ4A 4YUYA 1NC1A 2JAWA 1XMXA 2HCRA 4D5EA 2DWUA 3OF2A 1MH1A 1OHHA 3QUQA 4IKPA 3UXYA 1EFPB 4OGLA 1E3WA 4FHEA 4F8EA 2R84A 5JCJA 4JASB 5JBNA 1S3SA 1P1BA 1KEWA 2DR2A 2XZLA 5JJKA 3O7MA 4HOYA 4MIOA 3P0RA 3H9QA 3QBJA 3PPXA 2QTZA 4IP0A 3TL2A 4DIUA 1O08A 2WJ4A 4RFLA 4L5IA 5JJBA 1BCRA 1MENA 3FAKA 4QKQA 5AFSA 2I6TA 1IZ0A 4PX5A 1J8FA 1BO6A 2IHJA 2VH1A 4O4JB 1OAKA 2I6QA 1JI0A 2JH9A 2NPOA 2Q3FA 1IN6A 1KVQA 4I4LA 5EE5B 3KSBC 1J4AA 5EJEA 3SFTA 5CB8A 2EHDA 4HMOA 3CSSA 4X61A 3R3VA 3MMPA 3ZLVA 2I6GA 4XB1A 3KDAA 4WOJA 5H5JA 1UBJS 3UK0A 5I9IA 3W6OA 1WABA 1US8B 2VCYA 1SJ9A 2R7KA 4WL0A 4YJ3B 5JHGB 4LF5B 3A6HA 3JQ8B 2XYVA 4I50A 2A5YB 4MW5A 3W5HA 4BUCA 1AQNA 1UBOS 3M81A 3S2YA 4O2AA 1C30A 2ZQZA 4U2GA 5IAGA 1MJFA 2PL1A 3VHLB 5FX2A 4OTZA 3AKDA 1L4FA 2PL9A 4L8GA 1BMQA 1QHNA 3VO2A 1I7LA 4UATA 2KHZA 5AKZA 1RWXA 5JVDB 3HDQA 2OQIA 2XIQA 3LBIA 2JPDA 4AP5A 1ZGGA 2HSDA 1Z22A 3X1ZA 4FQ5A 4ZVNA 1CUDA 1KDPA 1VG1A 3E5MA 3KZVA 4FFOA 3TMYA 3WHPA 5E3HA 1VKZA 2XRYA 1H2YA 3EZ6A 3GP5A 1EFVB 3V2UA 4U9UA 2P0YA 5TMPA 2VN8A 2QZZA 5EESA 2PCLA 1V8DA 5I7VA 4DEVA 1TLLA 4YRJA 4P4UA 3HNOA 3UFBA 1A27A 1DBRA 1KKLA 2VIIA 3DUFB 4FC6A 4JXJA 3WNZA 5C9ZA 2QTAA 2C9OA 1CZHA 3AR2A 3OQJA 3UHFA 2VHUA 2GZHA 2GHIA 4KDCA 3TNJA 4INOA 3ZWPA 1QHXA 3ZHQA 4BVJA 1L8AA 3WMFA 4KQHA 4YAKA 1Q17A 3V7NA 3EVBA 3I30X 1Q91A 1ZK1A 1LZKA 4LY6A 1FUIA 3VVCA 2HK7A 3AHGA 3V9PA 5E7JA 4MHTA 4I1RA 4LSMA 5BMVA 1NPTO 5JNUA 4BXOB 4J8PA 5GJCA 2OM2A 1R0KA 1KZ6A 3WX0A 4Q3KA 5GGYA 2FQXA 3QIAA 2R60A 4JGBA 2PH3A 5A4IS 3U13A 2FUCA 4MPDA 3GLIA 4E32A 2O9JA 4J1TC 2MT9A 4PLVA 1HO3A 1IM8A 2JEYA 1XCJA 3DDCA 3EF1A 3LK6A 2AIRA 4IY1A 3A0RB 3F8WA 4JYBA 2FUEA 5B1SA 3WKDA 4CUJA 4DVJA 3TUIC 6GPBA 3UATA 3PGKA 4GOND 3TNYA 2W6JA 3HPQA 1KI4A 3JRWA 3QENA 3G5AA 4RD0A 5IULC 4X3CA 3UQZA 2ZIVB 2WW8A 3NV9A 1JPVA 2VNSA 1VHLA 2B8EA 2IGBA 4IFEA 4FT4A 4GKKB 1VIVA 4TV8A 5CFOA 3GBPA 2N9UA 3OTGA 2BP7A 2G80A 2EX4A 3EGIA 3F3KA 3OLZA 1DWPA 2R7MA 3LCMA 4MR9B 4Q1VA 2QMZA 1K8ZB 4E51A 5ADWA 3K32A 1DKOA 3ELYA 2WKRA 1V1JA 4LRYA 3TPFA 4OFBA 5LPNA 1T2CA 2RAUA 2YJ6A 5AJYA 4IOJA 4FFSA 2AC4A 5JZMA 1FYVA 1M1UA 3MWDB 1QAMA 4GKJB 5F52A 2XZOA 3HU2A 1C7FA 3B1FA 3LY8A 5J4VA 2ZI5A 3CUKA 1PFUA 3V97A 4YY3B 3HCNA 5KX5B 1XL0A 4KFSA 3ZU3A 2HZ7A 1JPJA 1Y7HA 4FNOA 1V3VA 1OZFA 4E5UA 2PG3A 2C4WA 1DAGA 2X5XA 2DR0A 4ND8B 4PIPA 1K2WA 4RK0A 5FB3A 2I4IA 5FUBA 3GJQA 3V2HA 1A5AB 2BEUA 4ATNA 4FB5A 2FLVA 3QFHA 4OP2A 2NUTA 1DFHA 4U2DA 3PYLA 3TNLA 3S6JA 1CNFA 3I5AA 1LBQA 1SIBE 3HA7A 1H42A 4N18A 1T0UA 4UJ3A 5JS8A 2AEFA 3WWYA 5F3DA 4GIBA 4JBLA 2EJCA 3B52X 1CF9A 4EARA 2FP3A 2V4MA 3CEAA 1H0SA 3C3MA 5TLSA 2A3RA 1Z37A 4RVDA 5BNFA 1Q0ZA 1SKYE 2XJ9A 1K1EA 4Y6LA 2X58A 3C3EA 1ID1A 4DSAA 3Q8MA 3ENWA 1DIBA 1I5EA 4V03A 2PMWB 1T36B 3HL0A 3W1VA 5FBWB 2I91A 1P91A 2BDTA 3K92A 2ID4A 3VZQA 1ECLA 3OY2A 5FR1A 3UCFA 4GX0A 1TJ3A 4LGYA 3WLFA 2VQEB 4CKEA 1YIOA 1XVLA 4DA6A 2PSFA 1A9PA 2WWGA 1XBTA 5L45A 3KQKA 4RA9B 3CLRC 1X19A 3L93A 3LT2A 3FYTA 4BRZA 1CF4A 1RXVA 2YRXA 3KZMA 5HRUA 1B74A 1LF5A 1ECPA 2BLNA 1Q3KA 1LSOA 2AMLA 2KWIA 3PGLA 3U2QA 3HE3A 4ZI7B 2NO1A 3EAQA 3IDOA 3ADCA 2B5VA 4UARA 4OQLA 4FIDA 4MA4A 3NIDB 3ISJA 1PJLA 1A4IA 4ML3A 4B3IA 4KHPB 1XKLA 2RGNA 4P80A 4XFJA 1LC3A 2EZ4A 2L69A 3L7DA 5JJ5A 4W63A 1QQTA 3HPRA 1Y4SA 4K7JA 2A67A 4R9NA 5CBPB 3RAGA 1WU7A 2DTDA 1RYMA 1ODJA 4XYBA 2OBNA 5BSHA 1NUQA 3A4NA 2NSLA 1PEYA 3HYNA 4R8RA 2ZTUA 4ES6A 1KH3A 1CDDA 2A1TS 4HH0A 4HZUB 4NU6A 4C43A 4GSKA 1YSCA 1PS0A 2G0TA 2AC7A 3I52A 3L7YA 3OH8A 1UF9A 1XEXA 2UYQA 2Y77A 3NBZC 5IUJC 2P78A 2J32A 2PPVA 2PLRA 2R44A 2X3FA 2FXVA 3ENNA 4B3CA 1FOEB 1JEJA 1N0UA 3BGSA 2J1LA 2VNIA 3WLRA 1OPRA 1Z6AA 2VSXA 1U2ZA 2FX5A 1OIXA 2ZBFA 1CQXA 3IOCA 2W6ID 2XX3A 2YV5A 3K0AB 1I30A 2QR2A 3ET4A 4JBHA 4DCTA 4F4CA 3V48A 2OLEA 3EGOA 3ILVA 1YCGA 1QS0B 4C14A 1GAQA 3R5KA 1ACJA 3I76A 5FQNA 4A6EA 4MV3A 3C8ZA 4FJ2A 5IAJA 1XQVA 4C4YA 1E64A 4LBVA 2O48X 2C2WA 4AJLA 3G7UA 3D4BA 4YAOA 1ZU4A 3GRYA 1O95A 3DAPA 1PL7A 1P2BA 1K8YB 4X92A 5J2TA 3FOFC 1X0XA 4WNCA 2OAEA 2WJPA 2A8YA 3BMNA 2D5LA 5FA8A 4KMMA 4OK3A 4GQAA 5MFPA 1GPAA 1ECJA 2Y6UA 2IP1A 1E1DA 2TMKA 4FDVA 4ZRDA 1Y4AE 3FLMA 1T6XA 1G42A 3P96A 5T8KA 3GH1A 1N6OA 2GJAA 4B2IA 3F1LA 1NJ6A 3UWKA 5ILOA 5AW5A 2GPBA 4YNBA 1TPZA 3LX6A 3DPIA 3TYXA 1E2HA 1WIWA 4LX0A 4MCJA 2V6BA 2GCOA 4KKVA 1NUTA 1YI1A 3PRHA 1EFRA 1CNMA 1E3EA 1DJNA 3OZCA 4NMHA 3RKSA 1REQA 4BVAA 621PA 2ZM5A 5FFFA 1VL5A 1L4YA 3N07A 1FDVA 1QE5A 4DXDA 4NBUA 2XUHA 5LZ8A 4AMUA 2XMRA 3O8OA 3D3QA 3C7CB 5IJXA 1RAGA 3UN1A 1ILEA 2YN0A 1OWPA 3DLCA 3V5NA 1S01A 3O1HB 4G8BA 1DZIA 1MB3A 1CEXA 1CNEA 2X8JB 1AQ6A 1RAEA 2JFXA 3K8OE 4ABTA 4GMXA 3KYDB 3WDKA 1XJ5A 2AJTA 2ZWIA 4I9HA 2DWOA 2UZ1B 3O8NA 3JPYA 4DMRA 5B7PA 3S8YA 4I8IA 3ESXA 2CL0X 1SVSA 4REQA 2B7CA 2SCUA 4TV8F 3H42B 4X95A 4YT5A 4C0SA 1GV0A 3SPXA 3IQDB 5F1OA 1G17A 3IPXA 4A8JB 4YPOA 1NL3A 5DWQA 5B53A 1IPHA 1UDBA 1A76A 2ETVA 3DMGA 4LOIA 3LTNC 2O5EA 3A6JA 1EP3B 1USGA 2OMKA 5DTMA 4KN5A 2RG1A 3ANXA 2I3BA 2REXB 4NNOA 2XMDA 2W2TA 1YDGA 3G49A 2EBFX 2EGHA 4HS9A 1U11A 2CDAA 3JVDA 3EXEA 2F62A 1F14A 1EE1A 4OQDA 5DNWA 1X7ZB 3UM9A 1I1QB 4D3XA 4ZZ1A 4P6VF 1NBAA 4IOLA 4MV9A 1T6ZA 3KOXA 4W1QA 1S1MA 5DHPA 1SQ0A 3W5JA 4F86A 3DHYA 2D1SA 2W7TA 2NUPB 3KQQA 4TMVA 1Q0PA 3AY7A 1LPPA 5K8UA 3AUSA 4HCJA 4M1ZA 5NLLA 4WEQA 1X74A 4H4CA 4E94A 1EBUA 4TSFA 4DQLA 5JH7B 1C7ZA 1J56A 2XGJA 1DRWA 1OI4A 3CZAA 4RHXA 1WVIA 1BDMA 3N2GB 4X1KA 2WJZB 1ZOSA 1W49A 4X6LA 5LDHA 5GONB 3KKKA 4BPBA 2ZUVA 1ABEA 4XM0A 3ZN2A 3S1SA 1NVWQ 1PG5A 1GY8A 1G3UA 5DCUA 1C0LA 3J7TA 5F2OA 4R1PA 2Z6UA 1O95D 3VM6A 3ILYA 4A03A 2HHHB 3UUFA 4DARA 2F1RA 1UQTA 2AVDA 3GHYA 3NHRA 4QLAA 1DX9A 4XH9B 1E8NA 4FZJA 5DH9A 1E7QA 2UUOA 1AUQA 2F9FA 4M22A 3KQWA 2VT7A 4FP9A 4WTOA 3DAOA 1T5SA 4GPZA 2OA0A 3RIEA 1NJGA 1ZBQA 1MGOA 3DL2A 4P33A 2MTBA 1W73A 5IS2A 1KAGA 3R8XA 1DTWB 3T3GA 2PIAA 2IPOA 4FE7A 5CBPA 3FXAA 2HHJA 1G7SA 4IDOA 1CETA 2OCKA 2VDWA 4UUMA 1T24A 4EH1A 3O92A 2JGEA 1E7MA 1PL8A 4NZOA 1M5RA 4FBLA 3P0IA 4OI0A 3DYBA 5AKYA 2FSUA 1VKRA 1QGYA 2B6HA 2C9BA 4BO3A 2UZIR 4YCNA 3PCRB 4H1UA 4R3WA 3RYTC 5J4LA 2I29A 1EG2A 5CXUA 1A9TA 3KSZO 3TRHA 1E0AA 1SG0A 3IVXA 3O1LA 2GTIA 5LUBA 3RRJA 1K06A 4X0EA 1JS1X 2ISQA 2BRUA 4IH9A 2VTEA 1E3TA 2BEVB 3IIKA 4H0FA 4CM1A 5BVHA 1QF7A 2I4TA 4EEZA 1N4DA 2JIPA 3OZAA 1YQDA 1ZH0A 2X6RA 3RADC 3BIWA 4C22A 3SZMA 5TGTA 4BNDA 2B4QA 3QVSA 4YRMA 2O06A 4JDUA 5FIUA 5DMHA 1RFLA 1X8JA 3M6UA 2X86A 1JDSA 1PLJA 1Q6YA 1VBKA 4EYSA 3OD1A 3OTQA 3IAUA 1KZ7B 3NOVA 4PZEA 3ZY2A 4CWAA 2FWRA 1XI2A 2QSJA 5F1YA 1K8RA 3I64A 4PTLA 3RIGA 4FGKA 2VRCD 1GZ4A 4W9NC 1BROA 1DQYA 2PBFA 3ZV7A 3CKMA 4EF6A 4NFSA 3FYSA 1HDCA 3EBOA 5AD1A 2V9PA 3EDQA 4TMKA 4DGQA 2PYZA 5E8JA 1EM8B 3R76A 1IRXA 2HSWA 1E94E 4K5QA 1HM5A 1VG0B 2FMKA 2Y1KA 3LQKA 4GYYA 1WXGA 4L8LA 4OQFA 1QO7A 1MJNA 2HMSA 3LX8A 1JEYA 1VCOA 4PAOA 3FCEA 3R9XB 3PGVA 2WR8A 2QAGB 1QC5A 2XUAA 1G4UR 3EGDB 4CLDA 4WJLA 1J0BA 1WTCA 4UNSA 3UTCA 4CQMD 2JGMA 4TZ6A 5CLHA 1D1QA 3L8GA 4A7PA 1W87A 1G0NA 1QFSA 1GPKA 4F4FA 1LSJA 1RC1A 5ALNA 5J63A 3AZPA 4NPAA 4V02A 3ID6C 4RGVA 2CLOB 4AP6A 3MTAA 4H1VA 1AIPA 1UUFA 2SKEA 3VH1A 1QQ6A 2OUKA 4XW2A 2LR0A 3RTAA 2HC9A 4HQ6A 4XIJA 4AJ9A 3DNPA 5FNVF 2WUVA 4CM4A 3B7GA 4L5BA 4WK6A 4ER7A 1JNXX 5FBHA 3RBXA 2IS6A 2PSJA 2C0CA 2IYRA 3AHHA 4IMRA 4QODA 2ENWA 3SSNA 4H6PA 3TD2A 1OA0A 9ABPA 2AZTA 1N6RA 2D5AA 5A3JA 1T3TA 4OM8A 5CT6A 2JLUA 3R7LA 2IC5A 4CM8B 5JOQA 1RQGA 1K9SA 1VPEA 3KKEA 4YJHA 3FLBA 3HBNA 3QU4A 3TAXA 1TZMA 3GPCA 2P6UA 2AG0A 3BB3A 4Y2RA 3USES 2VHWA 1XYGA 2FETA 3BWEA 5IABA 3D3WA 3IBGA 5EZYA 221PA 1U9IA 3OE1A 1W75A 3DP7A 4NZPA 1RRPA 4BKOA 1I33A 5M3BA 4X66B 5KTMA 2GK3A 4AMZA 4LK2A 3LA6A 4BPRA 4FSDA 4KU4A 3PC3A 1U9CA 2QGFA 3LHIA 3P9PA 2QQEA 3ZOZA 2NM0A 4HH4A 1Y8RA 4FW9A 4QM6A 2QGZA 1ISJA 4YMUA 2NUPA 3GLIE 3FWYA 3DKKA 3BGVA 2HQSA 3BH0A 1E6KA 2QSZA 1IPEA 3TFOA 2P9JA 4KNVA 2WOOA 3EYWA 2DF8A 1I4WA 4M9CA 2BKUA 1OH7A 2B37A 2I6FA 3MFQA 4Z99A 2WWHA 3COZA 4HTFB 3BXZA 4BO2A 2BFEA 2VR1A 1F7VA 4JJ4A 5AO9A 5L3ZA 2Y92A 3ITDA 1QVWA 1CUHA 4RY9A 3HVRA 2ZXUA 2Z4SA 2SNIE 3L41A 1MBZA 5IW8A 3OECA 3CJQA 4JB2A 3ZE6A 5PNTA 2CKMA 2RGGA 1ZQ1A 3KE8A 3ZLUA 5C18A 3W6PA 2Z08A 5D7BA 5E8RA 3E9NA 4J75A 4P3PA 1ODKA 3C39A 1RBYA 3ICEA 5LMZA 4LHZA 1F6DA 2SCUB 4UEWA 1M1NB 3GD5A 4CM5A 5A7FA 3DDUA 4MKZA 1G9XA 5FPHA 4J0CA 5HILA 5AVUA 1T4GA 2XMQA 1T6NA 2UZ1A 4KSBA 5LMUB 3CS3A 3GEHA 1JMVA 2YUTA 3AOGA 5HRCA 5B58T 2NV2B 3T12A 1DKNA 4KPYA 1NKVA 2J08A 3PIDA 2N75A 4TMFA 2OPHA 4BVFA 3FNGA 4GPD1 3PEUA 4R2LA 3L8CA 1NVXQ 3PFNA 3RVOA 3S5JA 2Q6TA 2C4TA 5KVAA 4GOOD 1UKCA 1SVLA 3IALA 2PEZA 1KR2A 1YJ5A 4XDGA 2HREA 1I3KA 2R3SA 3IPAA 3ND6A 3QVVA 2A9JA 2UKDA 4QDJA 5JZVA 3RSSA 2PXCA 5B4VA 2AX3A 4DLNA 1XSEA 1Y0BA 3BB4A 3CW8X 1L5WA 2VI5A 4TMXA 2D1YA 4RIEA 1ZG3A 2P9QA 4BNTA 5CA0B 3VDQA 5ENDA 1SBTA 5AUPB 5CFQA 2HMYB 3U6KA 1L7AA 3W7BA 2CNBA 2PLWA 5HUJA 4R7TA 1GOTA 2VUUA 1U65A 3AUTA 3A2MA 1QK5A 1E5XA 3CGGA 1M33A 1ZWKA 5K3AA 5A71A 4LF7B 4CMEA 2J0SA 4FYVA 2EJVA 2QRHA 1WCV1 1GWNA 5AXBA 2VKQA 4ALIA 1DU4A 4IDHA 3ON5A 4IINA 3V4VB 2X8LA 3ACBA 5C4IA 3DQPA 3EEQA 4R40A 2F59A 2MSWA 4Z1MD 5H9WA 1A9XA 5BQFA 2WAOA 1WPQA 2WIDA 3B3JA 3DKRA 3H17A 4HAVA 5LB2A 5A02A 3LQ1A 4JKOA 5EIEA 5JU6A 4TS9A 1QORA 1S5PA 1QO0A 1W94A 5TV2A 5CLJA 4WW0A 2J31A 4RPGA 3BWDD 3VR6H 1EUYA 4FGZA 3K1YA 1W1IA 4WXRA 1V47A 2WM2A 1C30B 2PBRA 3R5JA 3UMBA 4DAOA 3JASA 4P08A 3HMQA 4XSHA 3MD0A 3PGJA 5C37A 3O8RA 1PN3A 1YUBA 1M2VB 1CJKC 2GKSA 2YVQA 1PV2A 3TTXA 4H0NA 4B85A 1YRHA 4NBRA 3Q3HA 4WX2B 1NMZA 2OV6A 4L28A 4TTTS 3V1NA 5MN5A 1U0RA 2Y2UA 1ZD3A 3A2LA 5ALSA 1QR6A 2QTVA 2F3SA 4YMGA 2PRYA 1A95A 3IULA 4HBGA 4TVKA 3SIWA 1QRUA 2WJWA 4N4AA 5IHPA 1QTIA 1XLUA 2OESA 4IS3A 1HYGA 3PHBE 3IRUA 2HLNA 1HOXA 4OAQA 4PXAA 4R16A 5CVEA 4EY6A 5E0KB 5T64A 2PKQP 3DLAA 3BCUA 1UXIA 2I3DA 4X7RA 1UAGA 2FYTA 3G2KA 4TZTA 5EJ8A 4X71A 3RTEA 2AOXA 3X43A 4F3KA 3IT0A 4GMKA 3VYVA 4IFTA 3BKXA 3QLTA 4NV1A 4ZANA 2ADFA 2JAHA 4BFTA 3NJRA 1ZEMA 1YCHA 2JFVA 3FNHA 4CT0A 1Z17A 1Z29A 3IIMA 2NTNA 3PQ6A 4OLJA 4E30A 3P0FA 3ZK7A 3MAAC 3VNRA 5KTYA 1B4DA 5AOBA 1EB9A 1BFUA 1GT91 4QGBA 3UENA 4NE9A 5JLJA 2Q07A 5F1KA 4HWGA 1DXYA 3HO1A 5FEUA 5ITZA 3F2VA 4YI5A 3U4HA 4I9UA 2FPSA 4H35A 2G4LA 1XZNA 3D2LA 3W5DA 2ZUSA 2ZI4A 1KMHA 3ROQA 3F73A 2EKPA 2PZFA 1LVUA 2WHRA 3R5HA 4AN0A 4ON9A 3UT6A 5BO5A 4IMPA 3AUKA 1RLTA 4LI3X 3N7TA 5A05A 3JQPA 2YDYA 4ZRMA 3T7JA 3TD9A 3K1TA 1JSXA 3ED5A 3DEAA 3PNLA 3TR5A 3WLNA 4AURA 2JIRA 4RMIA 3L5KA 2YBDA 5G3ZA 2XXAB 3C6ZA 2JIQA 2AI2A 2Z2XA 4WLOA 3ICOA 5IAEA 3RIHA 1H2ZA 4G1VA 2GKOA 4YMWA 3URKA 3DAFA 4V1CB 3HDTA 5KHOC 1YNSA 1P7VA 5JHHB 1X2EA 3HKCA 4EG1A 1KRWA 1JH8A 1I14A 1KMIY 4IZOA 4HMPA 2O3TA 2AN5A 2BGJA 3WGHA 2DOKA 5A4AA 5ES4B 2VDNB 3K0CC 5DMXA 4L6AA 2C0PA 4UUOA 5K0FA 1AS3A 1KFJB 4DGSA 4DPLA 4PSAA 1DCFA 4QUEA 4BZWA 3IMGA 3BQ9A 1LJ8A 4PSUA 1JLKA 2YBEA 1UPFA 5EMMA 5A1TA 3DOJA 3DONA 2O0KA 1O1YA 3MF4A 4MVJD 4WZBB 5A1JA 5FA5A 1YQXA 4L8YA 4E5NA 4KQWA 4UZSA 4C05A 1PZGA 2OY0A 3TTVA 3ZDEA 3PNQA 3E15A 1U8EA 3TDKA 2GEUA 3GLVA 1EP2B 4GSLA 2WZQA 5A5GA 4RANA 1VBMA 2AOUB 4F2PA 4D7AA 1NV9A 2OCBA 2QRLA 3W79A 2XA2A 2CV2A 2UXDB 4FS3A 3C3PA 2RKOA 5B1EA 3QW4B 1N4AA 3Q7EA 4QDKA 3GP3A 3CWCA 4D97A 2CN1A 2QUHA 3ZVKA 2HJSA 2OHOA 2ZUCA 3GJRA 4H7IA 5FTWA 1P1CA 2BE9A 3IAAA 5IDXA 2J9YB 4DCVA 1H3NA 1NWHA 3HDYA 4MQEA 3BEDA 3BIXA 4RMGA 5DHFA 1GLGA 1HE2A 3ESRA 3EY9A 1O77A 2H9AA 4I3FA 3H18A 4O8CA 3GAFA 2JFPA 4KK4A 1O8BA 1TL7C 4QTYA 3V8NA 2XKKA 3RUAA 1HFEL 3GQVA 1CUAA 4FEEA 1KJNA 4U9IS 5EG5A 4LY9A 3AVQA 3TBFA 2HJGA 1E4OA 2VATA 1OXVA 3O4GA 3O3CA 2TRSB 3VOBA 2CVFA 4D26A 3TR0A 3O73A 4CU5A 3BOSA 3W1WA 4PGHA 1JSZA 2C4VA 2J3IA 3RIMA 1E2JA 2JW5A 1TUGA 1XWWA 4F1WA 4OX9Y 1SA0A 4YJ2F 3CLRD 3M3HA 1FJXA 3KU1A 4HPJB 5M04A 3OEED 4GGPA 1GGJA 1G3MA 2FF5A 1OAOC 4N01A 2O54A 4Y1EA 1BHJA 5DPMA 3RYCB 4K26A 1W25A 5BVGB 2C9DA 4JYMA 5KYXA 1HH4A 4FYIA 1TM4E 1RWBA 4N5NA 5KTTA 2P9CA 2PUHA 4DKXA 3M0EA 5DK6A 2KMLA 2JGDB 2Q5QA 2XQGA 3RSFA 5MHTA 2CLIB 1J8YF 3ZJYA 1A7KA 1B0AA 4YRQA 3E3OA 1U8UA 4R71A 1R9MA 3DGFC 4J90A 5ELLA 3S29A 1HLFA 4EY3A 4G9BA 2B8TA 2Q5HA 2AMFA 4N0EA 4Z86A 2FW9A 2DH5A 4M88A 4M0FA 2IBSA 1E0DA 3R7SA 1XPUA 1N2EA 3D7SA 3DSRA 2QZ9A 3NAQA 1YCDA 1G4AE 3D2AA 1NMSA 2IIVA 5JQGF 1KAMA 3GYGA 4LX8A 5EEGA 3VTAA 4FE3A 1DKMA 4BVKA 4BKQA 3U61B 4CDRA 2GEKA 3H1PA 1FX0B 5CX4A 1FDIA 1QCCA 3FCUB 2BHSA 3SYLA 4B3HA 1AUXA 4RTLA 1UWCA 4FFNA 1A5ZA 4GSYA 1P7WA 3QVKA 4M46A 1VC2A 3PNVA 4MUMA 2NZ8A 3IRVA 4QYIB 3MEQA 2NXJA 4X24A 1YIDA 4BNFA 2W2KA 1AO0A 5TGDA 1D6NA 1I2MA 2QAIA 3F5DA 1G18A 1RQNA 1POWA 1CUXA 1RLOA 2IW3A 3TIIA 2ODBA 2CXUA 1OZHA 1R6VA 3FHCB 1DG1G 1SM4A 3QFRA 2WE7A 3OX1A 2Q4EA 1S6YA 1GTVA 1V16A 4UPVA 2K5UA 1JSRA 3U44A 1NNUA 5I7RA 1RXUA 1RYZA 2AZ4A 4C2BA 3BL5A 1EXNA 3IO3A 4JA2A 1H85A 1MT0A 2EFJA 2G09A 3AIKA 2OR3A 4AUNA 2PUAA 1CUYA 4HNQA 1H93A 1GVHA 5DTEA 5FOXA 5HF8A 5HGXA 1R4AA 2NUAA 3MK31 5EZQA 2RK3A 2IT1A 3W7VA 2HWXA 2QXYA 1BU5A 3NWOA 3V9AA 1V8FA 3IV6A 2NX2A 2CFCA 4KE9A 1P0QA 4C5BA 3RNOA 4Z4IA 5LZ2A 3K31A 4EY5A 5ESXA 1PEAA 2N46A 3RQSA 2OTCA 1N2ZA 4UULA 3RC8A 2D2IA 4YHBA 3H4TA 1IOWA 1Q0SA 3UKJA 3WK9A 2IWRA 4D8YA 3X1YA 1N8KA 7AT1A 3OTIA 3L77A 4DWWA 3AJ9A 2BLLA 721PA 4AS3A 3ZDDA 3H9UA 4K9OA 3SQLA 4K0RA 5G0TA 1ENPA 1HL7A 3DMNA 4BX9A 2OLKA 3HWWA 2H5LA 4W9MC 4GX1A 1Z9BA 1O94C 5GM2A 2DLDA 2BI7A 2FN4A 1OV6A 2H17A 2QLLA 1TW2A 2XDYA 3B89A 3ORSA 4RMHA 4FHFA 4ABYA 4ARAA 4IJ5A 5COBA 5M2QA 2O2JA 3JWJA 2AOUA 2C54A 3S0JA 2AG8A 3ESQA 1PJQA 2MR6A 3I4FA 3TLMA 1LI5A 1Q44A 1N2CA 1V1MB 2VKTA 2V74B 1CRPA 1XDUA 2AL7A 1RJ9A 1UK8A 1RXYA 2BKEA 3PWTA 3WRXC 1J9GA 3ILHA 3WRYC 5A3VA 2IS4A 3HO6A 3QPDA 3B6ZA 1X8KA 4HQOA 5KSZA 1ZOPA 3CF4G 2EFEB 1J0CA 4G86A 4BVHA 4E21A 2I1LA 1FP4A 2EL7A 3DZCA 4PSDA 3EUFA 3C3WA 2WUDA 4XASA 2E49A 1OXKB 4EMSA 1NNEA 4NOKA 1NJ2A 1VKHA 3VV2A 2Y05A 1Q1QA 4OHFA 3R7FA 3RJZA 5AI0A 4EFLA 3S81A 4F38A 2FMHA 1Z5VA 3NV7A 2JGIA 3HN7A 4G0MA 4HRYA 3LWNA 1CJTC 1BEEA 1C4OA 1E58A 1RZVA 1M8GA 1NBEA 2JBAB 3WFJA 2IYQA 3TFQA 4ZU6X 1IWOA 4V1CA 2Y1GA 2CZCA 1D4AA 3RU3A 3EC7A 3EDOA 4BEJA 4AO8A 2QPLA 1QKKA 1WMDA 2XVMA 2YXNA 4FPXA 5SYMA 3TLBA 2OV1A 2FV8A 2V8BA 3LYHA 3OX2A 3VR4H 2QR3A 1BDIA 1O6GA 4IV0A 1ZM3A 2CF5A 2GZAA 2QIOA 2FW6A 3KD2A 3O75A 1ZUWA 4PYQA 4ZOAA 3FI0A 3VYRB 3ZD8A 4F5EA 2JFQA 3BGIA 3LKBA 3U80A 1JHZA 3R23A 2RH9B 3CRRA 3CVVA 1SB9A 3NNNA 1EDDA 1M10A 3WLEA 4D3YA 5ISMA 2V6GA 4W7IA 1P4JA 3HCAA 4WFIA 1HE5A 2B61A 3ODGA 4N3NA 4YUVA 2BRUC 3HFJA 2GHRA 4DHWA 1MGPA 1EHYA 1U04A 4XKJA 3SF8A 2X5NA 3EBLA 1T4BA 1TA0A 4IIYA 3EVZA 4FR5A 4HLCA 2D6FA 2A33A 5BVHB 2LRHA 2FSGA 3MMSA 3E5RA 1LWOA 1WL8A 2JFGA 3OJWA 4RO0A 3RR2A 4CM4B 2GN4A 2H7YA 1YQTA 3EDMA 3OU7A 4XQ0A 1XXHB 2QD2A 3FPEA 4TXHA 1X38A 3Q12A 1X9IA 3IAM6 3K2EA 4OA5A 4EATA 4P1ZA 4AY5A 1QG4A 3JQAA 1UBCA 1RHUA 3A4VA 4F9FA 1TAGA 4H60A 5FPSA 4NHEA 1NVTA 4XJTA 5EMLA 2XZTA 2I22A 1WHTA 3IUSA 4I3GA 3Q6IA 1O87A 3VGPA 1V4VA 3BZWA 1VP9A 3V6MA 2VLIA 4JI1B 5EJIA 1KQOA 1C1XB 2FPMA 2OLJA 1SZDA 2WHYA 1RT9A 3A1CA 1NN1A 4GI5A 3W9UA 2R1UA 1MNQA 3KZKA 3LG2A 1LW6E 3RSGA 1CZLA 1BN6A 2QVYX 3NR2A 3OY7A 5AK3A 4G5XA 4ZDJA 2QBYA 1M8JA 3MINA 1QZTA 1LK5A 2JJ1A 3HO8A 1KIMA 4WXEA 3NATA 1N7IA 3IHTA 1T8PA 2G9NA 3OO0A 4L5CA 4P8RA 3T54A 1ZHFA 3U4MA 4JWTA 3U37A 2MINB 3IOYA 2FCAA 2W2MA 2P9GA 4MKHA 5HF5A 5FAKA 4B2PA 1WDMA 1DCKA 3EVGA 1GYQA 4YAJA 4M4SA 4LC1A 1ORWA 4C4TA 3PDUA 4B73A 4C4AA 1U0TA 2Y0CA 3KEGA 3OQIA 3UUGA 3NKFA 1VCIA 3KKZA 4NZYA 4Q4HA 1ZVKA 4H18A 1SC1A 4KRGA 4WK2B 3MSXA 4B40A 2ZPUA 3NNDA 4X1IB 3RBAA 5BWLA 1YOVB 1CZUA 3H0KA 3FF1A 3VHXA 5DVZA 4DSTA 5JNTA 4MUKA 4TN5A 1IU9A 2APJA 4R2XA 4DDMA 2FOXA 3H9JA 2R1TA 2WMYA 4PVCA 4IW3B 4D9HA 5LWHA 4QPJC 1IMOA 2V1UA 3G5MA 4LY0A 1TJ5A 4PXSA 4UZEA 4EOGA 5C80A 3F5FA 5KJ6A 1AOXA 1QQBA 3R3HA 2CWDA 3LKZA 3Q87B 3B70A 5C52B 3ZBPA 1EJBA 1R6TA 1BDJA 5DIFA 1UJNA 4LRUA 4BB0A 2XOKA 1E1YA 1PFVA 3HUFA 4H3SA 5EVCA 4O8ZA 2G77B 2ZPTX 3IEXA 4MJXA 3D5QA 4FT2A 2A1TR 4GZ6A 3JALA 4M37A 4ICIA 1LNQA 1HL3A 5CAEA 5D5PA 1NVVQ 5IVKA 1SXJA 3D5EA 3RD5A 3ICPA 1PS8A 2DZDA 3CJRA 3EA0A 3N8KA 1JQBA 3PKZA 5BN4A 1U63A 4TROA 3B1JA 1AO3A 4HHEA 2VT3A 3KYDA 1D09A 1JG7A 1NZFA 1RD4A 2WYOA 3D8UA 5C81A 5EQTA 4GC9A 1L5FA 5AI8A 3R3ZA 3RVNA 5ALOA 1L6IA 3P9KA 4N3GA 3W5UA 1P44A 2FNAA 3O95A 5C51B 4G5GA 4JR1A 3THXA 3LQ4A 4KN8A 3WADA 1LFAA 3VRHA 3DE6X 2WI8A 1T6YA 2RH4A 2G1JA 4D4HA 5BSEA 2BH9A 1XU7A 5CT4A 1GSHA 1E92A 5TQ0B 1WY7A 4FKZA 3S99A 3GN2A 1JXQA 1W44A 2P90A 2ZYTX 5DYNA 3C43A 2WRZA 1SUAA 2ZIFA 3WQSB 1GUFA 3G0IA 4DV2B 1DKQA 4ROTA 1OYOA 2D0DA 5KOYA 2I7DA 1DTEA 1WCYA 5F7OA 2QYHA 1ZUIA 2RBEA 2IZ7A 1PR1A 2G5GX 2AJLI 2C3YA 3K0BA 3NHFA 3QEOA 4KGVA 4OUDB 2O3SA 3D43A 2VHYA 2D74A 4BE4A 4BLQA 2JEZA 3NAGA 5TDHA 1DELA 4G3XA 2QLTA 4JITA 4R8VA 5FOWA 1YJ8A 1E63A 3W0LB 1C9EA 2B4AA 2O2HA 2P41A 3O83A 4BX0A 1S96A 4BMYA 3FGNA 4Q4HB 2C96A 3W2EA 3FHOA 5LXTB 2F3RA 3IT3A 2PKWA 3IEUA 1RXIA 3FHLA 2VNAA 2YICA 2J5BA 1R2QA 4PG6A 1THMA 3UG6A 3USZA 3MXOA 1QDLB 1BXKA 4G0OA 4ZFNA 4QOIA 3MGGA 3TTUA 4Z2AA 1OX4A 4C29A 3ZVMA 3DWEX 1ODFA 2VS1A 3GG2A 1JFSA 1JJAA 2ZVDA 2C82A 1UDXA 1DAIA 3JXEA 3SQWA 5JISA 1M73E 1SG6A 2XMGA 1RQLA 2ZRNA 1FTYA 4TRMA 4AKSA 4RF2A 3T1OA 2V9ZA 4Y1RB 3CRZA 1J0DA 2IPNA 4KJZA 3TH5A 5EIOA 2IV2X 5JJLA 1E66A 3KHKA 1TYAE 4KPGA 1G8HA 4LMBA 3WLSA 5DO9A 3SBOA 4D25A 3HR7A 4RPJA 2FZ5A 1XLWA 5CDUA 3QGMA 1V3QE 3BXGA 2JZCA 4CV0A 2BFBB 2ZR8A 5I3CA 1ZN9A 3BDIA 1A9OA 1AURA 1VBFA 3EXAA 3SHQA 4EHFA 1UEJA 3BX1A 3IPCA 4DR4B 2RGUA 4D9FA 4DV3B 3NHLA 1NF2A 3NJ8A 5AM0A 5I9SA 4BNKA 2V7QA 4KPUB 1EI9A 4W82A 1ICEA 1KP9A 1QHHB 1ZJ5A 4PLFA 5HCNA 1XZQA 1GR1A 1NOIA 4Y8VA 4IFBA 2OC9A 4L78A 5JD3A 4IH4A 1SIUA 2FRDA 2X0NA 1T25A 1E3QA 5DRTA 3QBDA 4RWEA 4B6GA 4F85A 1E6LA 3LP8A 4JJ6A 5DM4A 2Q0HA 4KQ9A 1M2HA 3RRFA 4BQIA 3A06A 3NBUA 2YY5A 2VVTA 4O1IA 5TE9A 3ZW7A 5DNUA 1ZRMA 5BSMA 4CIAA 1NA5A 3BB1A 1YOBA 2J0EA 2O7RA 2FK8A 3FDIA 3T6KA 1P0FA 4BE9A 3F6YA 4TV9A 3WIEA 1XCMA 1H22A 1PDOA 3RC1A 5DM2A 2GZRA 2HCFA 3LHSA 2UZAA 3D59A 1N5MA 1T5DX 1QUEA 1I3LA 4BC0A 4HFRA 2WG2A 4PPYA 4P5EA 2J9FA 2NTJA 5IDYA 3SY8A 4ZV7A 1PQWA 1Z4PX 2GN8A 4IRMA 2A9QA 2Q6KA 4KKXB 3WYGA 4DBZA 3BCRA 4R31A 4HVLA 4N54A 4HUQA 4FN5A 4RXUA 1A4XA 4GUDA 3FYUA 1MW9X 4NENA 2F3QA 4E5DA 3D4NA 5DX8A 3R9WA 4Q9KA 3BD7A 2G0NA 3HWSA 2C61A 2HA7A 4Z5XA 5CTAA 2B98A 4TTRA 3RTBA 4YRBA 1JZTA 1MRNA 1G2IA 4NY1A 5KNBA 3LFTA 1SVOA 2QN3A 3UGQA 2KX7A 2XA1A 3O74A 1V7CA 1SXIA 3B85A 4OBWA 4OXIA 4CKBB 1Y8ZA 5ECWA 1YB5A 3K6JA 5LZ5A 2AFHE 4LCJA 2IITA 4UVEA 2C3MA 4V0SA 3BHJA 4F2WA 1LBEA 3RFFA 1X39A 1Y6RA 4MVJA 4XJVA 1B8NA 1LLCA 5FOSA 4S1TA 5LKAA 5EP4A 3QVTA 2QT1A 3SQMA 2H7XA 3DKIA 1UZNA 5IYZB 3IQIX 4QA9A 1YAHA 4FLFA 4DVGA 5JAHA 1AKMA 1JU9A 3O8BA 4FONA 4B71A 5HKAA 3GLIB 1ZX1A 4DCGA 3AWIA 4M0CA 1LBHA 2CJYA 3IQZA 4QUJA 1JKJA 3FZYA 1PJSA 3MWYW 4LRSB 3RVKA 5D3KA 2X8JA 3RS0A 2YC4C 1N5OX 3WLHA 3CLVA 2H8KA 4P7JA 5EXXA 3TFWA 1I0ZA 3WGJA 4EVIA 3THSA 3GGPA 1B2LA 1DDOA 3O8CA 2GXAA 3DFMA 2C0QA 4Y9TA 2VK1A 5SY6A 2G08A 1QU2A 3IP3A 5DW0A 4AUEA 1P7YA 1A88A 1CLUA 4PO1A 2QD3A 4JCOA 3TMAA 1TZJA 1XX6A 2Z3WA 1RWNA 2O8DB 2GNOA 2VJDA 5HIIA 5DP2A 1QHHA 1U2DC 2QORA 1Y3CE 2H2IA 3Q0TA 4LQDA 4U2EA 2WYWA 4MYTA 4TKLA 4Y2PA 3ORQA 3OFKA 4FLMA 5DISB 3E58A 2OP0A 2Q5CA 3N8DA 2Q99A 3QTTA 4OL0A 2AFHA 2W2VA 3RAEC 2HNAA 3D0OA 1FNCA 4K05A 3WL8A 3AWDA 1DBPA 3RWBA 4IDQA 1UEXC 2XWSA 2IU3A 1RVV1 1RQ7A 3DUFA 1WD7A 4K6GA 3F7TA 1EDZA 1VHDA 1AN0A 3HZZA 1UP6A 4AJKA 2Q3JA 4YBZA 1NLFA 4EPTA 2G70A 4MUAA 2JLCA 4AD8A 3HTXA 4DCOA 3Q5EA 1JLLA 3LRXA 1G8GA 1KZ1A 4XFDA 2VXOA 3UXEA 3IEMA 2BH2A 3OESA 3CUYA 1C7EA 1XZCA 4JLKA 4UMDA 3TQRA 2ZFUA 3W4IA 3WZ2A 2BDUA 4KYIB 3OICA 3DC2A 3F9RA 4FFBB 4J7CA 5HCIA 3NU1A 5SYAA 5CVTA 3ZTYA 5K2OA 4DNQA 1WB9A 2XWJI 4RL6A 2ZJOA 1OWNA 4WPGA 4C76A 5KMGB 1BWPA 2KJQA 2WTMA 2EWWA 3AR9A 3S68A 4CM7A 3IPYA 5LDDC 5LD2B 1Q1AA 4RTRA 3Q5DA 3VOTA 4NTZA 2VPWA 2HGZA 3M2PA 1VIDA 3ZDQA 1RRVA 2JFNA 2OT3B 2PMBA 1XEXB 1HETA 5CP8A 5F7JA 1JVBA 4DEXA 1AS2A 1DNPA 6AT1A 5AXCA 1RP7A 3C6QA 3LDHA 5K5EA 1WJGA 1NX9A 3I12A 2CJXA 3P2YA 4JSRA 4A0GA 4O4IB 1FDWA 5ICCA 2NYUA 2Q4RA 4ZU1X 1EINA 3GBSA 1EU1A 2JAPA 3LYAA 3FMPB 4NE7A 3A7DA 5G0WA 2QV0A 2WA1A 3GC6A 4KVAA 1GITA 3GVCA 5C8YB 3PJRA 3AINA 3VU0A 2GN6A 1UCFA 4KN9S 3MS7A 1OBFO 3H99A 3VR5A 3M4JA 5JY6A 1NSTA 3BM5A 2V6FA 5ED0A 4CKWB 5EAIA 3VYWA 1N0VC 5B4UA 1E3MA 1TCAA 2EL9A 3CNQS 1Q57A 3RIYA 4ZALA 2ONKA 4YRRA 3ZCPA 3RS9A 1GNPA 1GU0A 2WWTA 4YROA 3F67A 4FCTA 4JUFA 3E1SA 2CMFA 2VTVA 1ZH4A 5C5CA 2BISA 5KHLB 4N6GA 3STXA 3QWIA 2FR0A 1LLQA 1KK1A 4Q1AA 4UZFA 2W83A 5FFMA 5DN6D 3QXHA 3KIPA 1UDWA 2AUMA 4GH5A 4LXYA 4RV9A 3ZJTA 3T5PA 2YC2C 3ZIAD 1RHQA 3T1NA 3AC0A 1AXEA 3EAGA 2C2BA 4XX0B 4QGSA 1CY4A 2BM9A 2WD7A 4J3FA 1E8MA 4ZV9A 4Q03A 3PC4A 3SC6A 4FUQA 4O63O 1KJYA 2R8EA 3FOEC 1I24A 4MDHA 1ZK4A 1GNRA 1SQ6A 4MVXA 4XZ3A 1RPZA 4BCBA 4EDFA 5JCZA 1JDPA 1RJFA 1PGJA 1WM1A 4Z53A 3EUWA 4Z4EA 1ZK0A 5HF9A 4MLDA 4YS6A 1M34E 2JB9A 1YE5A 4J0GA 2JGLA 5DB4A 1U1GA 4KGZA 4OVKA 5KSOA 2ZUBA 1K6EA 1M2GA 2AW5A 2C94A 4FWIB 2NZVG 3WHLA 3DL4A 4HJXA 2ZK7A 3OWHA 1EJ0A 1HDRA 4NECA 4LYAA 2QL9A 5BR1A 1TRKA 4DMMA 4NYJQ 3HI4A 2GH1A 2XODA 1GQ2A 2F3PA 3LC0A 4BFCA 3BWXA 4P58A 2G1AA 1M2KA 3S8EA 4EB6A 4AXBA 1L3IA 1P7CA 1IPFA 1EVQA 1I3CA 1HZJA 1CF2O 2Z30A 3NBQA 4QXAA 4LV6A 2OHFA 2JJYA 3PFHA 1PZNA 5KYXB 3DTVA 4PPGA 3QEKA 4ZD6A 4AM8A 1D2EA 5HFNA 3ZVLA 2DCUA 1RTKA 4B7ZA 1TUBA 2ATVA 4A3SA 3CGWA 3M7IA 1SHUX 1NOJA 3RARA 1C4KA <