4KFRA

Structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with sulfate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
207
structure length
204
Chain Sequence
NPDDIVVLVGRKKSGKSYLIKHYFIPVLKAHKISYIIDDHNLGSEYSKFGYNATSLSDIVSKQYVVVYDRAKNDDFFEKLWQASKLHSKKYGTTVLIIDEAYYHFKYKQKVTPAIDEALHANRHAGLGLILSTQRVYDLMPIVYKQADLIIMFYTREPNELRWISKYISAEAAEKVKTLKQYHFLIYDVNSQTIKIHKPILEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome packaging NTPase B204
publication title The Structure of the NTPase That Powers DNA Packaging into Sulfolobus Turreted Icosahedral Virus 2.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus 2
molecule tags Hydrolase
total genus 63
structure length 204
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 3.-.-.-:
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kfrA00
3W6PA 1U8AA 3QXSA 3P1JA 4P33A 4GI7A 4AURA 3FE2A 2GAOA 2IL1A 1XD2A 2ZRMA 5DI9A 3VNUA 4AKHA 3Q7QA 3MJHA 1P73A 1IY2A 2QT0A 4KSBA 1G8HA 4QNMA 5JJIA 1G18A 3EPLA 4LJ7A 1TU3A 4MQBA 5AJYA 1A82A 1VCOA 1W7AA 2V4ZA 2VRWA 1CJUC 2WAXA 4KU4A 5FTLA 1Z0FA 4XIGS 1E79A 3QKSA 3LQQA 3I92A 3K09C 1XTIA 1IY0A 2HDNB 1XTQA 1JJVA 2R6AA 1Z0AA 4KSCA 1Z28A 3T34A 4QKQA 1Z6GA 4ARZA 5FH9A 3KKNA 1FZQA 2RGNC 2OLJA 4LV8B 1NBMA 3LD9A 3NXSA 4HLDA 1D8TA 2VHTA 1DG1G 1JEEA 4RSGA 5JS7A 5B30A 3QKSB 4BASA 1EWRA 3QIAA 4DLSA 2W2XA 3REFA 1KKMA 2YYZA 3RRNA 4YMSA 4D4KA 1BIFA 1IXSB 2Q3HA 1JR3E 4ARZB 1E2KA 3GFTA 4JYBA 2WTUA 4JKIA 1T3LA 4BGDA 4HZUA 5CB8A 1DELA 2R6FA 3B5JA 2WSSA 1WA5A 3QVVA 1VIAA 3C4JA 4IOLA 3CLVA 2BMDA 1S9DA 1VKJA 3T1TA 3RC8A 5DH9A 1IN8A 5L8VA 3FTQA 1ZD9A 2AFHE 2C99A 3LLMA 4R71A 3FVQA 1DADA 3I8SA 4PO8A 4Q9LA 1VTKA 1KI4A 3QKRA 2DFKB 3BAFA 3HJNA 2CL6X 2ZANA 4HDOB 2YINC 4K8OA 4M53A 2ODWA 3PG5A 4DEYA 3IQXA 4PC2A 2W6IA 4L9SA 3B1XA 4G5QA 2DFNA 4ZV4A 3X1YA 3KTAB 2GCNA 1NL3A 1XMJA 1CEEA 2ZI6A 4M1TA 1DAKA 1UBCA 4ZCMA 1I4DD 2QMUA 5IK2D 4LK2A 4NYMR 3WYAA 2B7BA 5CM9C 5J4HA 3A4MA 3AVTA 1CULC 2P5TB 2ZRNA 3K0SA 2AN9A 1FX0A 3EASA 1ZINA 3GMTA 4A4DA 4IDPA 1RRCA 1BYIA 3O8RA 3QEJA 3K0FB 4DCSA 3QKTA 4HUTA 4ILEA 1ZIPA 3WNDA 1G5RA 2YZ2A 4LX0A 1KMHA 4M8NE 4PO1A 1Z3IX 1G4UR 1KO1A 1KSFX 2NIPA 5C4MA 3R8FA 2ZETA 1MV5A 1GKUB 2OAP1 3LO5A 3QEOA 4TLCA 4YDSA 1R7RA 2CL7X 3AGPA 4DLVA 4M9SA 1I2MA 4MRRA 1II8B 2K5UA 2ZJOA 4PX9A 5E7JA 2HXYA 1D9XA 4IFBA 2ZSAA 4PAQA 2CXXA 2OAQ1 1XEWY 1KSHA 3CR7A 4I1UA 1AKEA 2H17A 5E4FA 2H57A 1WQ1R 5DI3B 4TT3D 1OH6A 5DISB 2PLRA 4JBWA 3K9HA 2ZRDA 5E7IA 3U44B 1FQKA 1UEJA 4TLAA 4IOKA 4D0LB 4EFNA 1WRBA 2QA5A 2RGGA 3L8YA 4A0FA 2P5SA 2WM9B 4H1UA 3IILA 4D82A 2IBMA 4LOAA 4XVRA 2V1UA 4LJ5A 1RIFA 4E5UA 3OAAD 2B6HA 1KDRA 1FMLA 3K0EA 3FWYA 1R0WA 3GJ0A 2ZJ8A 3ZIAA 3CUEF 4GP6A 1YZQA 2RGBA 2IW3A 3E5HA 4MGZR 4PFSA 2YHSA 1NNEA 3CH4B 2Q9BA 2Q3FA 5LD2C 3KKPA 2QUZA 3RVBA 1NJGA 1FMJA 2PEYA 4A8JA 2RMKA 3Q8XB 1PLJA 2E9SA 4AYTA 1EXMA 4TZ0A 3T06B 4UXIA 1OPXA 2GAAA 5KNCA 2FGJA 3CRQA 1P61B 3CNOA 4PQYA 1Z5ZA 2OXRA 3LBHA 4TT3A 3VX3A 2FFQA 4DEXA 4UNQA 1U98A 2EFCB 4Q03A 4LBYA 4BLOA 4F4CA 5EE1A 2FMXA 3GPLA 1GUAA 4DWJA 4C0KA 2DFLA 4R7ZA 1GOTA 2WJGA 2YNMA 2C2HA 4JLDA 3HU2A 2PBRA 4Q7KA 3DM5A 1G7CA 2FH5B 4AKGA 2Z83A 4PQFA 3QENA 3W3ZB 3G82C 2FU5C 1CJKC 1G4AE 3LY5A 3OAAA 2ORWA 3IO3A 4O25A 1DAEA 4MKFA 5FFMA 3QPUA 2O8BA 4Q21A 2IXEA 4NMMA 1W0KD 4LPKA 2VEDA 1HT1E 2ZRAA 4PTLA 4DDVA 3UWKA 3VHLB 1J8MF 1OH8A 1T5LA 3GLHA 2R9VA 3PITA 4NKRA 4PC3A 2ZQ5A 5H70A 2ZVPX 4YC7A 3VR5A 3CWQA 4HLCA 3OEHA 3WYFA 4B2LA 2O8BB 3EZ6A 2CMKA 5FOSA 2QM8A 1XXHA 5EP4A 4G5SA 1R8SA 4TQAA 2REOA 2AXNA 4GP7A 4ON9A 3U3KA 2PT5A 5FTNA 3KXLA 3ZQ6A 3D8BA 1H65A 4JBYA 4DUGD 4PANA 2R62A 3LQRA 2E1RA 2C95A 4Q9HA 5FPYA 1OFTA 2HJGA 3L82B 1AS2A 1CTQA 3T5GA 2FNAA 4BZXA 2KBFA 2NO1A 3AF0A 2DFTA 4E22A 1W44A 4WXPA 4NYIQ 1P7CA 3TQFA 2QTFA 4PXAA 5K8TA 2W00A 4EIWA 1UPTA 4HAZA 3THXA 1T0HB 1C1YA 1G8YA 4NYJR 2CCGA 3W8NA 1PUJA 2YOGA 1HY3A 3AKDA 5K8IA 3IHWA 2DR3A 2B8TA 3ZVRA 2QAJA 2GEVA 2QG6A 3CF0A 2IUTA 2ZS9A 4ACAA 3MRSA 2DB3A 2BVNA 3NKVA 2AD5A 2GVDC 3BB1A 1UBFA 1UBGA 2HLDA 1BKDR 1KI2A 1CF4A 3L43A 2ZJ5A 4GT1A 3H0KA 2G6BA 1L4UA 3H84A 4MRPA 1MH1A 1YR6A 4PAOA 2G83A 4RD0A 2BV3A 1JAIA 1EX6A 1OKKA 2GK6A 2P6RA 3BOSA 5AJVB 5EQTA 4U00A 2OCBA 4GMDA 3BD9A 1MKYA 5G3YA 3WXMA 4LHXA 1E0AA 3IPYA 1P5ZB 3RC3A 1L8QA 4BRWA 1NVVR 2FEOA 2CJWA 4BQSA 3NBXX 5A4JA 1WB9A 3NVAA 4FMDF 4AYWA 2G3YA 3CIOA 2DYKA 1E1QD 4JLAA 3DO6A 5GJCA 4RD4A 1M7HA 2D2FA 5AJZA 3VFDA 1NY6A 2BM1A 4QOSA 3GLFA 1UJ2A 2NO9A 4B75A 4HB0A 1AS3A 2WMNB 1KZGB 4DZZA 3QPVA 2VO1A 1MO3A 2VSXA 2ZAOA 1QZXA 2BKUA 3FKSD 721PA 1P9RA 4PO9A 4URYR 1SVWA 1ZIOA 4RJLA 1GTVA 3BERA 1NY5A 4LHYA 2OM2A 2YWFA 3I4LA 3WP1B 4ZDKA 3A6PC 3THYB 1Q22A 2ZROA 1EFUA 2J7PD 3BH0A 4P4SB 2MSCB 3QJYA 4G01B 4KI0A 2JIZD 1MT0A 1OV4A 5JRJA 2XNSA 1A7JA 2VP4A 4GNKA 1XEXB 2J5XA 2PMKA 2ANBA 2C8VA 2X8AA 2A5FA 2FFBA 3N2EA 3OF5A 5LPNA 2CVFA 2MSEB 4BEJA 1YZKA 3QNUA 4NCNA 2JJ2D 1WDTA 3U2QA 5D3MA 4OQNA 1F60A 2Z4RA 1LNZA 2NO6A 1WF3A 3NIBA 1KSGA 3R9XA 4NCHA 3KXIA 4P4UA 5HE9A 5EJEA 3C5CA 1QDEA 2JJ1A 1NLFA 3T1VA 4D25A 4MGYR 4JYCA 5B2ZA 2GZAA 4Q9IA 1HEIA 3RABA 4I1SA 1SXJA 3U6KA 5AWFC 1T8TA 1X8KA 1G41A 1GIAA 3TLXA 4EFMA 2EQBA 1XNJA 4D0GA 1V5WA 2FOLA 1MRSA 3LVRE 1S1MA 1UDWA 4TYYA 4D0NA 3PFIA 5JJLA 4Q5IA 1E0JA 1RE0A 1DEKA 2O0HA 2KE5A 3B13B 2ZI3A 2CK3D 1KI6B 3A1UA 1D9ZA 2W2VA 4GPTA 4KBFA 2JIZA 2BMJA 3V00A 2W6JA 2H7VA 4GMXA 3GEEA 1XTJA 5L3RA 4N0EA 3B85A 3TH5A 1Z47A 1XPUA 2IF0A 2JJ2A 1AN0A 3SYNA 5JWOA 2GF9A 3KX2A 4TZ6A 1XD8A 1ZNZA 2G0TA 3AUXA 1CU1A 1RYFA 1G6HA 2XX3A 1IHUA 4LPSA 5L3QA 3UATA 1GKYA 4JJZA 2JLQA 5IF9A 1N5KA 2CVHA 1ZC3A 2QTHA 2WIAA 3IIKA 4FI3C 4TSFD 4XTRA 2GXAA 2PX0A 4WZ6A 2ZUBA 3X1ZA 4LY6A 3DHWC 2X2EA 2CHQA 2V9PA 1YZLA 2HXSA 4WVFA 4PC1A 3WHKA 1S4QA 1QHNA 2BM0A 3K0AA 4RCZA 3U60B 5JS8A 4JMPA 3OIVA 1ZUIA 4O3MA 5EE9A 5JJKA 1CBUA 2CK3A 1EGAA 1KI1A 2EWWA 3EWAA 4V0ME 4PSKA 2XB4A 4PC6A 3GLIA 1E9AA 4HATA 1EK0A 1N6NA 3F3YA 3K0AB 2WWGA 4E07A 2DWOA 2ZSEA 1E9CA 4CT5A 1XRJA 1DAMA 1SVKA 4LJ9A 4FIDA 1BYUA 4TN1A 2OFOA 4N0DA 3OEED 4TSFA 5EP2A 4FCVA 3B78A 4PHTA 1G3QA 1P62B 2BHRA 1E2FA 1JJ7A 1LVGA 1U0LA 4TLDA 5FUVA 3B1WA 4B6EA 3KB2A 2XOKD 3BBPA 3AH8A 3NC0C 4JBXA 4LYAA 1DO0A 3A4LA 3P4YA 2VF8A 3ETLA 3GJXC 1X1RA 5JFGA 4S35A 2Z0MA 5JCZA 5F98A 4AI6A 3D7MA 2ZSDA 4QHTA 2C9CA 2JLRA 3UMSA 2RGXA 1KNQA 3AVPA 3LWNA 3R7WB 3IDQA 1P3JA 4WBSA 4WOPA 1SHZA 4C0HA 1QHHB 1YZTA 2KJQA 4N3NA 1AIPA 4O0MA 4TWZA 4JL6A 4V0KA 5K8UA 3U7FB 2NMVA 1ONBA 4M9XA 5FI0B 4DCUA 2IXFA 1PJRA 2OCYC 2AWNA 2JLWA 2ERXA 4IFEA 3Q85A 1CS4C 2ZYWX 3OEEA 3ADKA 1GRQA 1W0JD 2R6CA 1E2NA 4TYNA 2F43A 2PX3A 2F9LA 2N42A 1TMKA 3B1ZA 5BYKA 5HKKA 2A5JA 3SS8A 4IEIA 1AZTA 4A6XA 3E70C 4B33A 3GEIA 4LSGA 4RCYA 2ZJYA 3O8BA 4FD2A 5DN6A 2AWOA 4DLYA 3AF2A 4OBEA 2WJHA 4JIMA 5JRZA 4HLUA 2QU8A 3QF4A 1OW3B 3GLGB 3HYRA 4OQMA 1PZNA 1VG8A 1CJMA 3M0EA 2D2EA 3V4FA 2WWHA 2F1RA 2Z5FA 4RKFA 5CYPA 3AF1A 4BLRA 3JVUA 2OILA 2QMHA 5H1YA 2QTVB 4QJ5A 1KKLA 2A5YB 1IONA 1XTRA 3KUDA 3IPXA 3MUFA 4NPHA 1G64A 2LWIA 2OBNA 4QGGA 4YQFA 4OYHA 4QM6A 1EFRA 2VF7A 1LY1A 2AKYA 3AQ4A 2GEUA 3B6EA 4B44A 1W0JA 1GNQA 2QGNA 3WHLA 2D62A 3MG9A 4ACBA 4AD8A 5J4YA 4FMCF 4WW0A 5FOUA 5G53C 2VH5R 5H8WA 1FW6A 5FL3A 1AZSC 1ETUA 2GJ8A 4POAA 4FWIB 3THWB 3EPKA 1ZD8A 2QMEA 3IGFA 4Q01A 2ZE6A 1DS6A 2ZXUA 4B34A 1XCGB 4QGHA 2WJJA 3FFAA 4S2EA 3ZLJA 2JA1A 3FMPB 3ZVNA 1FPMA 1N2CE 1KAGA 2Q21A 2ODNA 4ZPXA 3IIJA 1GNPA 4G5GA 2R6DA 1G5TA 1DE0A 5BN5A 4HEJA 1ZYUA 1U8ZA 5KPJA 4TL9A 5DIFA 1N6OA 4Z8YA 4YMUA 1II0A 1E2LA 4NZYA 3W8RA 4JL8A 1XPOA 1SVIA 1VG1A 1OFUX 1G3MA 4I4LA 5B57C 3W5JA 1TADA 5BN4A 1KI9A 4RVCA 4LJYA 5BQ5A 3Q9LA 3LX5A 1J70A 2ZEJA 3KJIA 2NPIA 5FTMA 3P27A 3NBFA 4H1VA 5J4KA 3CZPA 1DVRA 3VNVA 3EIEA 4XVQA 2WMOB 1TUEA 4V03A 2A5DA 1HURA 3RHFA 2IUSA 4M22A 1Q1QA 1VG0B 3VMFA 3K8YA 3SNHA 1VCNA 4CRWB 4B2IA 1TF2A 3PCRB 1RVDA 3EIHA 3K09A 4Z51A 4D80A 1TPZA 2D06A 4FCTA 3CX8A 5KDLA 4YLGA 4M1WA 1GL7A 3CRRA 3TVTA 2KSQA 2RGNA 4MDEA 4GZLA 1Z2AA 1NKTA 1P6XA 3AKEA 3EC2A 3QXXA 3TGPA 4BZQA 1FNNA 1OXTA 5FUYA 1XMIA 5FR2A 4Q9JA 1MO4A 4YDHB 3KL4A 4OHZA 4HB3A 2FX3A 4JT2A 4DSOA 4ABYA 2DPXA 2PZFA 2QN6A 2Q9AA 3PJRA 1Z29A 4A1FA 3PIRA 1XF9A 1E0SA 1P75A 2DBYA 2O8DB 1C9KA 1E9EA 2WKQA 1M8PA 4MA4A 4DLXA 4F38A 4MRNA 1DAFA 3AKCA 4RKEA 4DDWA 1GNRA 5FBVB 2ATVA 4XVUA 5DNYB 3W9YA 2OXCA 2RGDA 3QI2A 3PEVA 3DM9B 4P0TA 1M34E 4M1MA 4UJ3A 3T5DA 3NBZC 4I81A 1SVOA 1B0UA 4LBZA 5IRCD 3GLHE 3NC1C 1NG9A 1LS6A 4TMVA 4BFSA 2YC2C 3LXXA 3MLEA 4EUNA 4HZIA 2V7QA 5GJWC 1MO6A 1E9RA 1M2OB 3SYKA 4B48A 1NMXA 1OB5A 1E2DA 1NRJB 3PV0A 2GJ9A 3CM0A 1GP2A 1N25A 4QBHA 2GA8A 2AK2A 1D2NA 1XXHE 4PAMA 4OI1A 2QP9X 3U3OA 4F91B 5GJBA 4RD2A 2IHYA 4C7OA 5HZKA 2H1LA 2FF7A 2JASA 1G9XA 4LGMA 3T12A 2QZ4A 1W5TA 1J7KA 1ZM7A 4EPRA 1P2VA 1HQCA 1Z0KA 1GILA 4JVMA 4Q18A 3ZJYA 2BBSA 4KXFB 3KTAA 4CEHB 1AM4D 5J40A 5FOVA 1ZUNB 1A4RA 4BRUA 4DT1A 3MWKA 3W34A 1NIJA 3RWOA 4DKXA 4FXPA 1FUUA 1GVNB 2BBWA 3CZQA 5EXTA 1G8PA 1KI3A 5CK5A 5FTJA 1I4TD 2OCAA 3K0FA 4B3CA 3CH5A 2XB2A 1KYIA 1YQTA 1QRAA 3EX7C 4DT1B 1XEWX 1WE2A 2OUKA 1IQPA 2R8RA 4HB4A 4PQRA 2JLXA 2CCKA 2ZYTX 1UADA 4KODA 4MH0R 4Q7MB 2XZPA 1P2SA 4HYYA 5HCNA 1OT3A 4CVNA 1OB2A 4EPWA 4OJQA 1Z2CA 1Q3TA 2EFEB 2QL6A 1ZC4A 1G3UA 5CJPA 1II8A 1JEDA 1G3RA 5AR1A 4NE2A 3A36A 5FPSA 4E09A 1N0VC 2XSZD 2PEZA 5C18A 2IYTA 1TQDA 2IA5A 4R98A 5KSPA 1OXSC 4NCKA 5DI3A 3LNCA 3I61A 1O3YA 3U44A 4MRVA 3H2YA 4LRWA 1SKYB 3EWSA 1KY3A 1KJYA 4QRHA 1MABB 2IYWA 3IO5A 4AYXA 4R2IA 3TQCA 1KMQA 221PA 1MO5A 1GDDA 4NYIR 3X1WA 1KI8A 4EDHA 3X1XA 5DSZA 1TQ4A 2JCSA 4OQLA 3MGCA 1CR4A 5IK2A 1QHGA 2XZLA 3TUIC 4GRAA 3GLFE 3SJAA 4XOIA 2ZE8A 5JI2E 3FYHA 1F6BA 1VMAA 4XWAA 3SDZA 3VKWA 5BXQC 1Q3HA 2X1VA 4CEIA 3HU1A 3LLUA 2ZITA 4F92B 2QBYB 3I62A 1T3SA 4NHOA 3TW8B 1Z07A 5LB4A 1VYVA 3UIEA 2HYDA 1NP6A 2F1IA 2XTMA 1YRBA 2JLYA 2IYVA 1QG4A 2P0EA 2MSDB 3GD7A 4FMBB 4IEEA 3REGA 3AVXA 1E96A 3OFND 3TKLA 1N3BA 1Z6YA 4CEIB 1L4YA 2GWHA 4TQ9A 3ICEA 4QBFA 4Q1CA 1KZ7B 5DHFA 3UK6A 1W4RA 4OK3A 4K81B 4A6PA 3RSLA 2IYSA 2JGNA 2GHIA 3K1JA 1ZU5A 4LBVA 1NSTA 2BCGY 4A9AA 1GG2A 1SXJE 3THOA 2BJVA 3R8CA 3CR8A 5K8LA 2ATXA 2AR7A 4AKEA 3A8TA 3SEAA 4JLKA 1U8YA 3EXAA 2EYUA 1VIYA 5E7MA 3U3MA 4DHEA 1G8FA 3ADDA 1U0JA 4EAQA 2ERYA 4Q4JB 4TMKA 4X8MA 5SZIA 2GILA 3EPHA 4MUAA 2NO7A 2X2FA 4DIDA 3MFYA 5BWMA 1JR3D 1DAIA 4GL2A 3SFVA 4D81A 3MJRA 4QXAA 2B7CA 5JLJA 3CRMA 2P65A 3PVSA 1AKYA 4F4IA 1EFCA 3AF3A 3PENA 2O8EA 3ZDQA 4W5JA 1G17A 1HE1C 5JZVA 3CB4A 1LTQA 1YZNA 2WJYA 4C0LA 4NYMQ 2VP5A 4L4UA 4P4TA 2Z6VA 1JPNA 2ZS8A 2UVQA 1E98A 1LV7A 4G0NA 4UKDA 1XTSA 2VSOA 1M7GA 5DYIA 2O8EB 3LAWA 4L8GA 5FUXA 2GVZC 3DPUA 3CPHA 3EZ9A 3N2IA 2QPTA 4IDNA 4NBSA 4TMWA 2ZYVX 5EZ6B 5EE5B 3U3RA 1KJWA 1W0KA 1JR3A 4XSGA 3O8CA 5SZKB 3GJ4A 5M04A 3GLIE 4YXWD 1SVLA 3BJIC 2PJRA 4YMTA 3ASZA 3IKJA 3TRFA 3NEJA 1F5NA 2ORIA 2WAYA 3X1DA 2UZ3A 5AJWA 3SBEA 4PSAA 3D31A 2GJSA 2VHUA 3AVQA 4BLTA 1U9IC 1Z6AA 2ZU0C 2J41A 4OI4A 5CYOA 3SHWA 1IY1A 3RRZA 4PHGA 1R5NA 2CHGA 1X8JA 3HPRA 3TSWA 1AK2A 1JXMA 2YC4C 4E03A 4ZO4A 3CPJB 4OL0A 1G7TA 3PR1A 1R6BX 4M1SA 2F3RA 5LBIA 4Y0AA 4DUGA 1JR6A 5HCIA 4DJTA 1X1SA 3IBYA 2A30A 1GFIA 2IXGA 4MRSA 2LCFA 2C77A 2ZSBA 3AP2A 4KO8A 1JQLB 1OE0A 1T5IA 4TQUS 3VAAA 2FSGA 4LDJA 4MGIR 1WP9A 1E99A 4V0LA 2HJVA 1NN5A 4OJKA 4BECA 4V0NA 4DB4A 4HSEA 3QE0A 3B1VA 2ZM5A 3H1TA 2EWVA 2CNWD 3Q5EA 4DB2A 4YXWA 3TUZC 1DPFA 2QEQA 1DTSA 2J0UA 3HYTA 4EKDA 3EG5A 3DKVA 2P2LA 2QY9A 2GXUA 2A3RA 4P3YA 4QNRA 1PLKA 4Q1EA 3U6BA 1XP8A 5GADl 2V54A 2PT7A 4EQ6B 2VHCA 1Z0IA 4PPGA 3THYA 4P4SA 4WZAE 4WXRA 3AVYA 3OIYA 1Q21A 5JI3E 2DHRA 2ZRFA 3VHXA 2J0UB 1CIPA 2GCOB 4IOMA 1JECA 1XEXA 1KDOA 2HCBA 1NVXQ 1J99A 3WBJA 1AQYA 2GZHA 5KTYA 4W7SA 5FBWB 3RS3A 2VP0A 2CLSA 4LUCA 3LW8A 4KBGA 1UEIA 4Q00A 2BIFA 3FMFA 3ONWA 4M1YA 2OHFA 3OIUA 1XMSA 4TMXA 3SI7A 1EG7A 4EFLA 4CGZA 5C4GB 2A5GA 5CJ2A 4P32A 421PA 1KHTA 4ERNA 1ZU4A 4A0HA 2DCUA 2CNWA 4LHWA 4KYUA 1E2JA 1E2PA 1E1QA 1ZW6A 3OIWA 1IN7A 4LCBA 4BLPA 1CLUA 2FEMA 1KO5A 5KHOC 2W0SA 1XZPA 4NH0A 4DRZA 4LC0A 3C15C 5JSZB 3WP0A 2PJZA 4MDFA 5DO9A 3TE6A 4JVNA 1KI6A 3LA6A 4RFSB 1N0UA 4A2PA 5KDOA 1R5OA 2O8CB 1VDZA 1ZMXA 4G3XA 3C14C 5B58C 1F2UB 1UKYA 4XWKA 2IS2A 3FKSA 2BC9A 3FB4A 2ZRBA 4L15A 4Q1DA 2FFAA 4HAUA 3LFUA 3OZXA 3FOZA 4TL8A 1EESA 2ZR0A 2PL3A 5FOXA 1R4AA 2J7PA 2REBA 3B2EA 3KFXA 1E9DA 4KFSA 4DSNA 5TDHA 4HDCA 1LW7A 2FPMA 4ASUD 3DZ8A 2FFHA 4QC2A 3DEFA 1AQUA 3DKPA 4DCNA 1HV8A 3B60A 4L9WA 2GXQA 3KQUA 4LYJA 2LKCA 1TF7A 3KQHA 1QHYA 2GJKA 1T8UA 1IXZA 1E4VA 4NYJQ 2WBLC 4BLQA 1YRAA 1KJZA 2WSMA 1S3SA 2HT6A 2ZRHA 4D2IA 5F2EA 2FN4A 2IYUA 2PZEA 1NJFA 4QG7A 1Z22A 4ZCLA 3F5FA 3HR8A 4URWR 4LI0A 1E2GA 4TL6A 4V0OA 3W6NA 2OO7A 1D2EA 2KBEA 4PZLA 2PCJA 4IVPA 4EPYA 3ZD7A 4ZKEA 2WOOA 5E95A 1H8ED 3HP1A 3KXKA 4H9GA 2HF9A 3ZGXA 1B23P 2FPLA 4C9BA 1Y3AA 2RGAA 2WWFA 3QBVA 4MYHA 4C4PA 3NDPA 3TUJC 3GJ7A 3T1QA 3UPUA 2YWHA 5JHHB 2V6JA 2IEZA 2B8WA 2CHVA 4AIIA 2F6RA 1Q44A 4IVQA 2OCPA 1UKZA 1KIMA 4OQFA 2J87A 1C4OA 3T1OA 5C1BA 1YR8A 3L0OA 4R9UC 3BFKA 2GNOA 1TUIA 1NVVQ 3B9QA 4QL3A 5EXXA 3K0CA 4IDOA 1OLOA 1ZVQA 2RHMA 3QG1A 2VP9A 2ZE5A 2XEXA 2P6UA 2FV8A 2AK3A 1U94A 4P31A 1W5SA 3U7HB 4B47A 2BMFA 2HV8A 1W49A 4D4LA 1N6IA 3DL0A 2QM7A 3CONA 4X8LA 3A58B 5JECA 2ZPTX 1T91A 2JAQA 5FOTA 4URUR 3BWDD 3R7WA 2HF8A 4TMTA 2ZRCA 1OHHD 2H92A 2RCNA 1XWIA 1GZSA 1QHHA 1E2QA 3GP8A 3RWMB 1XJQA 2SHKA 3MWLA 2H18A 1DAGA 2QP4A 1E69A 1KDPA 2I1VB 4EPXA 3A4NA 3K0CC 3W5IA 4A92A 4DBLC 1G7RA 3ZS9A 4EPTA 2CEAA 4X8OA 1JALA 1WBDA 2QQ0A 1NBME 1ZJ6A 3BB3A 3HU3A 2BBTA 3B8HA 1E9FA 1JXOA 4QHYA 1E4YA 3DMDA 4JKYA 1IJEA 2QQEA 3BORA 3VR3A 1TX4B 2CDNA 4MITA 2I3BA 4HAYA 2FGKA 2YKGA 4Q7LA 4KFTA 3I3SR 2GESA 1KK2A 4GOKA 2Q9CA 4US2R 3LV8A 2HEIA 3OHMA 1I4LD 1OXUA 1M7BA 1SVMA 4QBIA 5G41A 3GLGA 2NQ2C 2ORVA 1NN3A 1N6LA 2H8KA 4C0AC 4Q4HB 1A5TA 3RS2A 2XOKA 2HUPA 4JLJA 3EC1A 4WIAA 4Z8XA 1KSJA 2V1XA 1OHHA 1X6VA 2W0MA 1RJ9A 3IBGA 1K8RA 1BMFD 3IUYA 1U99A 4AWXA 2ODEA 2CE2X 3A37A 2IHBA 1OFIA 2Q3MA 3HWSA 4ZKDA 3EA0A 2FZ4A 1RPZA 1UKEA 1ZNXA 4DLUA 4A2QA 1EFHA 2F3TA 4RD6A 1RJ9B 3SYLA 3C8UA 3CF2A 1TQ6A 2QRNA 5EP3A 1D6JA 3NHAA 1I2DA 4NU0A 1GKIA 1NKSA 3AVOA 3CRVA 3QPWA 2G88A 4KITB 4Q48A 1COWD 3ZD6A 3THWA 3ASYA 1ZUHA 1IN4A 1J90A 2VL7A 4BFWA 1T9HA 3AVVA 2WWXA 3PUXA 621PA 4XTCS 1OH5A 121PA 1U0HC 1G291 2FJUA 3A1VA 1OF1A 2BMEA 4HUQB 4Q4AA 1SKQA 1FP6A 2ODBA 3CW2A 1ZM9A 3Q5DA 4B32A 4B76A 4MYCA 3MWYW 1AS0A 3NEYA 4PZYA 1CKEA 2BWJA 3TNFA 2ANCA 4YONB 5A5GA 2ZR9A 5DGXA 3C16C 2WWWA 3BXZA 3TK1A 4PSVA 5A0FA 5FPKA 2VTKA 4JLMA 2JDID 2IK8A 4Q4AB 3FFBA 1KO4A 4LV5B 5JCPA 3N70A 4ITRC 3SJBA 1SVSA 1RFLA 2IYYA 2ZJZA 2CLDX 2REXB 3MAAC 1XX6A 2QGZA 3AUYA 3SFZA 3LX8A 3CF6R 2WKPA 3C41J 4IRUB 4U7DA 2KB0A 4PPNA 2NTYC 3KKOA 4Q19A 1E9SA 2ZUDA 2ZAMA 1HT2E 4UNRA 1AGRA 5F3WB 3GQBA 4J0QA 4KVAA 1K5DA 1G5PA 1ESNA 4CZ2A 4EJSB 821PA 3OE7D 4M9QA 2EU8A 4UXHA 1A1VA 2QE7D 1KDTA 3LBIA 3FHCB 1MOZA 2IYZA 4LJ6A 1IN6A 3SHFA 4V02A 5CDFA 5KU1A 2GXSA 1K6MA 2CLCX 2I4IA 3IEUA 3LBNA 2UZIR 5CLLA 4FINA 5CM8B 5FI1B 4EJSC 4TYQA 1UKVY 3CKLA 2D7CA 5KNDA 1HE8B 2DWQA 2G1JA 2JDIA 3P32A 3WMEA 2NPFA 2OSBA 5FPTA 2I1QA 2KI5A 5AUQA 3KJEA 1E32A 2A2ZA 1E2EA 2QORA 1KNXA 4LZZA 4ESHA 5ANRB 3UKDA 3X2SA 2ZVQX 3I72A 1E79D 2C78A 1R0XA 2O0KA 2O8DA 1CRQA 2OZEA 1OH7A 3M6AA 4OK6A 1S9HA 1W4BA 4M2LA 2BEKA 4HDQB 3EPJA 3WMGA 5FBQB 2EW1A 4O2RA 1VHLA 2IF2A 1IN5A 4C2TA 2IX3A 1F2TA 3OE7A 1X86B 4U5XA 1VCMA 2NG1A 2Q6TA 5IT5A 4HI0E 4CIDA 4DIEA 3UWOA 1QF9A 1G20E 2QT1A 4BPBA 3SJCA 2XJ4A 1IXRC 5J4VA 3CPEA 4KLNA 5FR1A 3T15A 3UMFA 3KJGA 1CR0A 4MYUA 3RDPA 4JVLA 1XZQA 4DCTA 1YR7A 1F2TB 2WSSD 3FMOB 4JT4A 5H68A 3Q3JB 4G5RA 4JZKA 4MUBA 3QUSA 2RGCA 3I1FA 4W5HA 1A2BA 4C7OB 3KUCA 5TV2A 4CEHA 1W2GA 2IS6A 3AGQA 4URVR 3QKUA 3NG1A 4LV6A 4MKIA 1XD2B 3D6TB 3CNNA 3SC3A 3JVVA 1GWNA 5DLQC 5EUMA 5AUNB 2W6ID 5GJVC 2N46A 3UANA 2NZJA 1P4SA 1OIXA 2NOAA 3B1YA 3FHOA 3GFPA 2ZI9A 4LJ4A 3LXRA 1VHTA 1YHNA 1VYTA 1D2MA 4ESVA 1ZNYA 4F7WA 2ONKA 4D4JA 4D26A 3RAPR 3RS7A 3HR7A 1LFDB 2ZSFA 3BRWD 4TLBA 2FA9A 3WNCA 2GF0A 3R9WA 1ZRHA 1YR9A 2J0QA 3ZH9B 5JHGB 4DSUA 1Y63A 2JLVA 2X19A 4A36A 4WZBE 2G9NA 2BOVA 2IYRA 3QF7A 3QXJA 4MYTA 3U3JA 2GK7A 4JLBA 3OESA 2V8OA 3AF4A 4II7A 1XPRA 2D7DA 4AC9A 1RYHA 2QI9C 2FPKA 3PUYA 1Z08A 2JLSA 1HYQA 4QFMA 3QG5A 4C0SA 1PLLA 3V9PA 1Z63A 5J5CA 1XEFA 3NH6A 4GZMA 4DVGA 2XXAA 3CX6A 4I99A 4HZUB 3IEVA 2AXPA 3ND8A 3AB3A 4RZUA 3BB4A 2IT1A 2J0VA 3W90A 2RGEA 2J45A 3EA5A 5AK0A 1ZM3A 1MABA 1YE8A 1NIPA 1XDBA 3ZVMA 1N5IA 3I5YA 2EVWX 2YOFA 5KDDA 1O87A 3QKRB 5KSZA 2XXAB 4BFXA 5EE3A 4IXMA 4AY2A 4IW3B 1P9NA 2GRJA 2NGRA 5FOWA 5TVKA 4TMZA 1NN0A 4DDTA 2XNDD 3DMNA 2O0JA 4Q47A 4BFYA 2RAPA 4JSYA 3VKHA 2GDJA 2C96A 1OIWA 2R2AA 2WJIA 4B35A 1S96A 1CR1A 3UG6A 3K53A 2D3WA 1AJEA 5CK4A 5TARA 1P72A 3ZIAD 3EW9A 1KO7A 1QHIA 4CF7A 2F55A 4M9ZA 2QBYA 4BEBA 1FX0B 3S1AA 2GJAA 2XAUA 2RH5A 4JL5A 1ZAKA 3BIFA 3KJHA 5CIQA 5EUQB 2C98A 3BK7A 5EXPA 3U7EB 4AK9A 3L0SA 2XGJA 1KI7A 1KMHB 3I32A 4DSTA 2XSZA 1KK3A 4JVSB 3LW7A 5JWRA 3EIQA 3NH9A 3NHBA 4FWTA 3K9NA 3K9GA 3MMPA 3MWJA 3S1AB 2IYXA 1E9BA 3BGWA 5ELXA 5AUOB 2ZR7A 3FDIA 2Z43A 1XBTA 5FBRB 2NO0A 3E1SA 3QBTA 2IC5A 1M6NA 3VR1A 3RS4A 2XNDA 4GSYA 3ADBA 4GFDA 1ZCBA 3BC1A 1P2UA 1E94E 1BOFA 1ODFA 5LD2B 5DHAA 1R5BA 2QRZA 3V4RA 1NSFA 4OK5A 5FL7D 4RZXA 2WKRA 3QY0A 1Q1BA 3SOPA 3IHLA 4ZIRA 1DG3A 1DOAA 4DLZA 1VPLA 4Q4JA 4F4JA 5L3SA 1R0YA 4BWYA 2VBCA 4C3ZA 4BE7B 3G0HA 1Z0JA 2J9RA 3P4XA 5JMTA 8OHMA 4PR0A 1KK1A 2J3EA 4W5WA 3SE0A 4PHHA 3W3AA 3VX4A 5KO2A 5IHPA 1NVWQ 2ZRJA 4Q1FA 4ZIRB 5J4LA 4LYFA 3OEHD 3B9PA 3L0IB 5L3SB 2BJWA 1P60A 1SGWA 4XD7D 5CIWA 2O5VA 2ONJA 4HAXA 4ZI3A 2AX4A 1VG9B 3OFNA 2KWIA 1GRRA 4X8HA 4A8JB 3KZ1E 5F9FA 3PUZA 1QG2A 4PPQA 4B3XA 2YJTD 2P3SA 4JSTA 2CCJA 3GJ8A 1R0ZA 2IYLD 1HQYE 3MSXA 3AVUA 2YWEA 3I73A 4Q9KA 3IIMA 4UXJA 4M1KA 3GEHA 5JEDA 1FFHA 4C2UA 1RRPA 1N6PA 1XMVA 5FL7A 1ESMA 4OHYA 2OBMA 1CXZA 2C5LA 4A8JC 4A2WA 2WZQA 2W58A 2OESA 3UG7A 4BFZA 4W9MC 2GBLA 3TR5A 1V43A 3TAHA 1YVDA 2OFXA 3RNLA 1Q57A 2EFDB 3L2OB 3PEUA 1OFHA 4C0JA 1U9IA 1BO6A 2C9YA 2RB4A 5KPDA 2O52A 2VP2A 4BFTA 3A1WA 5GVSA 3ICQB 4NDZA 1QVAA 3TVDA 3VKGA 3LDAA 1KOFA 1OYYA 3WMFA 2LKDA 5KYKA 3SJZA 1AGPA 2ZE7A 3GJ5A 2GCPA 4JLOA 3BFVA 2QMOA 3FGNA 2QSYA 2B21A 2L0XA 3FKQA 4M0LA 4OQXA 4TLEA 2PCLA 3ECCA 4HLQB 4BUJA 4DLRA 5HZHA 4XD7A 1E2IA 2HLDD 2A9KA 1L7VC 3CNLA 4C30A 4IJMA 1W48A 1VCIA 1H8HD 1NI3A 4BZPA 4RD1A 1NN1A 4G5OA 6Q21A 2IS4A 5BYJA 3GLHB 2W83A 1U90A 5AUPB 4D6PA 3AVWA 4JLVA 3FPAA 2GBLC 3AM1A 4IKEA 1ZM4A 3VTKA 3LVQE 3SR0A 1OKKD 1WCV1 2MMGA 2CL0X 4QHSA 3KFVA 4I1VA 2FG5A 4IXNA 4EPVA 1XXHB 2YV5A 3QQ5A 3AV0B 3CX7A 1NLZA 1BH2A 3AP1A 1G7SA 4IHQA 3MCAA 2WV9A 1W36D 1JQJC 4MGKR 1HTWA 2F1HA 3IQWA 3GFOA 1R8QA 2QENA 4DCVA 1FL9A 5JBQA 4DLWA 2RHDA 2IYQA 4LJAA 2BKEA 2BEJA 3FMIA 4MKHA 1S1CA 5CLQA 2CBZA 4Q1AA 3O8DA 2IS1A 2BDTA 4EQ6A 4Z1MD 2QP3A 5B64A 4QM7A 3THXB 2WVJA 4OHVA 1HUQA 2HT1A 4FMDB 2P67A 4NTZA 2VHQA 1H8HA 1T0JB 2ZIAA 4HAVA 4C0BA 3LRPA 3M1IA 2YWGA 1S3GA 2R6GA 1MRNA 3TMKA 2H16A 2IEYA 1RRGA 5E3HA 2GCOA 1Z06A 3KQNA 2JEOA 5F9HA 1SULA 1G6OA 2FZLA 2PLFA 3Q72A 1JI0A 1E1RD 1IOZA 1YU9A 1DARA 2TMKA 2ZRPA 4HAWA 4IDHA 3G5UA 4RZ2A 5LDDC 3N5CA 1L2TA 1K5GA 1N6KA 1ZBDA 3GJ6A 2ZI7A 4HB2A 1VYUA 1TF5A 3M4YA 1CJVC 3QVUA 2VA8A 3GLGE 1PVOA 3EZ7A 4UQOA 4CW7A 2VQSA 1ELOA 2RKOA 3EZ2A 2V55B 1XJ0A 3AEZA 4IOJA 1QBKC 4LYHA 2GEDA 1IM2A 4Q66C 4RFVA 1G16A 4UNSA 1QHXA 1TEVA 3WBKA 4Q02A 4KFUA 2JJ1D 3CO5A 3DZDA 4KLZA 5TY0A 3LH5A 1W36B 4Z1MA 2ZI4A 2EFGA 1P2TA 4CDGA 2CJWB 1SXJD 2MMCA 4I1OA 5JSZA 4JS0A 1IAQA 1OXXK 2O8CA 1TEXA 4RFSA 2G77B 3RRYA 5J47A 1GITA 1CR2A 1JPJA 1F2UA 3JZMA 3PUVA 1U81A 5KUTA 5G40A 5HTKA 1EWQA 3K9LA 2D4HA 1P9WA 3P26A 3SN6A 4ZDIA 1W36C 4DC9A 1N0WA 3WRXC 1E1RA 1UM8A 3GLFB 2ZS7A 3CBQA 3RRMA 1E2HA 5FUWA 4AKIA 2W6JD 4KFRA 3U4QA 2YVUA 3KKQA 4OKSA 5KOYA 1DBSA 3DDCA 1OXVA 2WOJA 4LC1A 1NMYA 1LF5A 2WHXA 1ANKA 3WNBA 2F1JA 4O2LA 4XJXA 1XB2A 3W6OA 2VIIA 2DWPA 1N5JA 3KDSE 3R9IA 5P21A 521PA 1TU4A 4XWOA 5TXGA 2BBOA 3U4QB 1JB1A 2P6NA 3T61A 1CJTC 3WY9A 3QXHA 5C2JB 4TYWA 1UF9A 4BFVA 3WRYC 1NG1A 3B7GA 4A15A 5HPYB 1OIVA 5D3MB 4QJ4A 1QHSA 1AA9A 1T4GA 2V6IA 1SHKA 2ZJBA 1Z6TA 1ZNWA 2OFWA 2J7KA 4PC7A 1LF0A 1RKBA 1W1WA 3HPQA 2ZUCA 4TTPA 5FBLB 4A0RA 1FOEB 2G1KA 3ZVLA 2ZREA 4M4SA 4Q4LA 1EFTA 5EE0A 2C9OA 4G1UC 1SXJB 4FCWA 2AD1A 3EZFA 4L16A 2ZJ2A 3BS4A 4B43A 5HE8A 4AG5A 2PH1A 4RD3A 3ZZ0A 1S2MA 1U2RA 2FSHA 1TL7C 1W4AA 2Z4SA 4OHWA 3EAQA 4RY2A 3RYTC 4GOJA 1W4CA 1Q12A 1SXJC 4TYPA 3L8ZA 4CYMA 3RS5A 1F3OA 2Q0HA 3Q7PA 2ZYUX 1Q20A 1OSNA 4B3BA 3NBYC 1UBEA 4ASUA 5CDFE 1RC8A 1OYWA 2H5EA 2IWRA 2EFHB 1Z6XA 4KV9A 5KNBA 1Z83A 3KQLA 1RZ3A 1N6HA 1KK0A 2B92A 4OHXA 4TTQA 2ZTSA 3K70D 1F48A 2VHJA 2ZU6A 3EARA 2XTZA 4NL4H 1E2MA 1SQ5A 5EP1A 2VLIA 5L3QB 2WWIA 2OV2A 5G3ZA 2OT3B 2VSFA 3ZS8A 5FTKA 4KAXA 4PHFA 2QPOA 1UDXA 4B3DA 3TSOA 4A0GA 3GJ3A 4Q1BA 3DVLA 1T3HA 5D3QA 5L3VA 1M74A 1Z8FA 1H8EA 2E87A 3PQCA 1YZUA 2WIBA 4Z54A 2ZJAA 4M21A 1XCPA 4B73A 1X8LA 4MKGA 2ZRKA 3UMRA 1ZP6A 4CEJA 4TTRA 1CRPA 1FP7A 4Y0VA 3GCGA 2F7SA 4KCGA 4N1AA 1TTTA 1S0UA 1KAOA 2WICA 2A7QA 3E2IA 2XTNA 3ZZUA 4B2PA 1NF3A 4B6FA 4GDFA 1PUIA 3PEWA 4URXR 1T6NA 2JLUA 2JLZA 3A1SA 3VR2A 3RS0A 1R2QA 3GLIB 3SZRA 2AL7A 3BH6A 4CEJB 5BW8A 2IUUA 5HKKD 3H4MA 1LS1A 1J2JA 2X77A 3BFXA 2AKAB 1YZGA 1OJLA 2F9MA 4NP6A 2WWYA 4Q4HA 2GZDA 1Q1ZA 4JLPA 3WYGA 5DN6D 3T35A 1G21E 4PZZA 2R65A 5HR5A 1GL9B 1FTSA 4WAUA 3U5ZB 4NONA 3PUWA 4PPFA 1HH4A 1R10A 4NCIA 4L5BA 4FW9A 4LHVA 1G19A 3QSYA 1US8A 1KO8A 3K70B 4R2HA 4B3GA 2XITA 4AG6A 4XH9B 3ADCA 4IDQA 2NZ8A 1Q1EA 2PMDA 5UKDA 1XTKA 1JNYA 1NLYA 1IJFA 4GBMA 5KSYA 2QSZA 4NCJA 1YJ5A 2C04A 2R44A 5TB5A 2ECKA 2HCJB 5C46F 4UNNA 3J81k 4RZ3A 1EFRD 1G3IA 3K70C 1US8B 4QGFA 1WBBA 4U02A 1RW4A 4JJKA 4K46A 2QAGA 2CE7A 2V3CC 2BCJQ 2ZRGA 5LB2A 3TJZA 1XCMA 5BN3A 1RRFA 1CP2A 3FHTA 2FDCA 4BLSA 1J8YF 4HUQA 2GKSA 1Z0DA 1GAJA 2XJ9A 1GRNA 1N6RA 5TMPA 1HA3A 2DY1A 4JLNA 4KYIB 3VR4A 3SBDA 1GSIA 1A2KC 4C0QC 3MD0A 2QAGB 4Q7JB 3RLFA 4LHZA 4ZI2A 2F43B 4FMCB 1G1MA 4US1R 5DYGA 3DOEA 1GM5A 3ZQJA 1NMZA 3L0PA 1SKYE 1M1YE 3QOFA 3KQKA 4OI0A 1DAHA 1KTVA 1FUKA 1UFQA 1NVUQ 5AJXA 3B82A 4URZR 4CT4B 2O8FA 1BMFA 4WA7A 4LBWA 4OI2A 2QAGC 4XSHA 4IVRA 4DLTA 3A1TA 3SQXA 3PXGA 3D3QA 3QF4B 1TNDA 1KGDA 4ZDWA 3TIFA 5JWHA 4DXAA 1TAGA 1PV4A 4TL7A 1QVRA 2IWHA 1E3MA 4A82A 1MR3F 4UJ5A 5SZJA 2ZRIA 1ZM2A 5JEEA 1LB1B 3I8XA 3F8TA 2EYQA 1FNMA 3I5XA 4FN5A 2O8FB 1DO2A 1Q0UA 2C03A 2HYIC 3H86A 3ZYCA 4HLUC 4EJSA 3O47A 3BE4A 3P20A 2QROA 1FTNA 2A78A 1G8GA 3CRW1 1S8FA 1COWA 2QNRA 4DDUA 4BFUA 4QGAA 4YMWA 3UXMA 1JBKA 3VQTA 3AP3A 1GL6A 3ZZTA 3U61B 2UKDA 5SZHB 2AFIE 1UAAA 3NDBB 2AHOA 3R20A 4D4MA 1W2HA 3RSOA 3U7GA 2VYFA 2FWRA 4QJ3A 3PEYA 2J46A 3CWZA 1XD9A 3VR6A 1ZCAA 2GTPA 5CITA 1N5LA 2WPDD 3RANA 4LJ8A 5KSOA 5GVRA 1D5CA 3QXCA 2XZOA 2QPAA 4F93B 2FSIA 3NTUA 1YKSA 3TW4A 4YMVA 2ASEA 1XFAA 1XJCA 2FE4A 1ZD1A 2FSFA 1WMSA 4B71A 2PZGA 1KY2A 3SU8A 3TSZA 2G0NA 5EZ5A 3KKMA 1VECA 3TR0A 2VPPA 2GETA 3VU9A 2VP6A 3C5HA 2ZI5A 5EXSA 1E6CA 4ZCIA 3DOFA 2Y8EA 1IBRA 2J1LA 3AKYA 2OBLA 4UNPA 1FQJA 2J0SA 4GOXA 4KHZA 1TQ2A 2YOHA 4B74A 1SZPA 2ZRLA 1XU4A 4B3FX 1JAHA 1W47A 2N1BA 1WXQA 5CB6A 4KJZA 4V0MA 2OE2A 3KB1A 2OLKA 3SQWA 2JJ8A 4QBGB 1W46A 5IDVA 1EX7A 1X3SA 2OEPA 4LWZA 3VU9B 3NWJA 5DE3A 3TAUA 1NBMD 3ND9A 3BH7A 3TBKA 2JATA 2V7QD 3HDTA 1E0KA 2QE7A 2WPDA 2WJVA 1BS1A 3F0TA 4KVGA 2OG2A 4US0R 2D74A 2J59A 3JZAA 3C7KA 5FPHA 4ZDJA 2W2TA 1II9A 4M1OA
chains in the Genus database with same CATH superfamily
4V0SA 3QXSA 2K6GA 1FNCA 5A0VA 1S2NA 2P91A 2QSJA 4GI7A 2I6GA 1CQJB 2ACKA 3V4VB 2OVBA 5JAUA 2EF0A 4I50B 3OT1B 2C5GA 1C5KA 5DI9A 4W5RA 3FN4A 4OOEA 3GLQA 2W2KA 2P9ZA 4M60A 1IY2A 4F8YA 1BGWA 5EOVA 5AW5A 1N5OX 2HQOA 1PNRA 4LE1A 1G8HA 5FDFA 5JJIA 4X0EA 5JDCC 2BFOA 4PYRA 3RG2A 4MQBA 4D74A 4EYGA 4MINA 3UH0A 5AJYA 1A82A 1VCOA 1I30A 1W7AA 5KYYA 2VRWA 5EAIA 3LFHA 4KW7A 4ZVLA 2GRAA 5ECGC 4DDMA 5ELMA 3E7FA 4IWYA 4J2HA 3QKSA 3I92A 1XTIA 4Q24A 3PC8C 1DNPA 4O5AA 1FXSA 1R8YA 1T5DX 2DEUA 2TSYB 4KSCA 1Z28A 2OAGA 4YJGA 5AKKA 5FQNA 3RC7A 3T34A 4ZEWA 3LQ4A 1ADBA 4ARZA 2DERA 1H1LB 1MJNA 2R00A 1CY1A 2PWAA 4LV8B 1NBMA 3PDJA 3PX3A 3N75A 3NTQA 3NXSA 1EA5A 4TYMA 3UUEA 3JZDA 1D8TA 1EZ1A 3U81A 1PWHA 5B30A 4BASA 2H2GA 1TEHA 3RFTA 3QIAA 4ZYVA 2JIPA 1WNFA 3DDUA 2W2XA 2P5YA 3FSRA 4S0ZA 4D4KA 1BQ4A 3L4KA 1BIFA 3GUYA 1OROA 3NHJA 2W6OA 1TJ4A 3WYNA 1WD7A 2XRMA 2AHRA 4JYBA 2CNDA 2A9VA 2D5LA 4JKIA 1KFEB 4BGDA 1ECCA 3EBOA 1HDXA 2PT6A 4MW4A 2X1MA 3DMRA 3FUCA 4IOLA 3CLVA 1YKFA 6LDHA 1MRZA 4X93A 3PXAA 3ADPA 3W1EA 1Y82A 1JAZA 2QQGA 4L5CA 2A33A 1ZD9A 1C3LA 3LQYA 1CJSA 1GXSB 2C99A 3R5SA 4R71A 4FZRA 6ADHA 1DBQA 1DADA 1TA9A 4ND8B 2QVGA 3W9SA 2DPGA 4C7OB 2CVQA 2DFKB 3BAFA 4K8OA 3N2NA 2YINC 1C7EA 5AVOA 2IY9A 2C5AA 2E4VA 3T4UA 4WSOA 2O2DA 4KXMA 5AQ1A 1OI7A 2PYZA 3C6YA 1TUBB 3SBOA 2GPNA 5L6LB 2DQZA 2MINA 4G5QA 1LQ2A 1OTYA 4NBTA 3X1YA 1KDZA 3KTAB 1ENYA 4CDMA 1NL3A 5BWOA 1XMJA 4NZ9A 5ICCA 4S12A 3RTBA 1DAKA 1UBCA 2YASA 4RIHA 5DXAA 3PFKA 5HOEA 2P4SA 1V45E 4FFDA 4LK2A 4HFJA 4Q3LA 3JWEA 4TS9A 2XLCA 3O9MA 2BH2A 4ZC1A 1O08A 3NRBA 4ENWA 1YVPA 1BWSA 2JFQA 1DRUA 2ZRNA 3L4BA 3O4GA 1U0RA 3D6FA 3N86A 4DS3A 1VJDA 1ZINA 2WJZB 3GEBA 3GMTA 4QRIA 5TMDA 3NGLA 1VL5A 4OGGA 3MILA 1BYIA 4JBNA 4XYLA 5HM6A 3M2TA 3QKTA 2H00A 2QLBA 5DW3A 3TOCA 3JR7A 3LDHA 3WNDA 2FK7A 4M8NE 2F64A 2P2YA 4MKXA 4LVNA 2Q5LA 4MR7A 1PT5A 4PO1A 5B37A 3UTCA 3VPFA 2VAMA 2X22A 3CUUA 3ETDA 3GCZA 4FK8A 3MGAA 3FPKA 2AMVA 1BX3A 2NIPA 2HBZA 3U7RA 2YWRA 4HNAA 3K5IA 3LO5A 4YDSA 4GW3A 4BNMA 1WB4A 3AGPA 3TX2A 1XRSB 2VI5A 3LLVA 1L4LA 3WLPA 4BMPB 1I2MA 2Q1TA 2K5UA 5AI5A 1NNUA 1SXHA 4H1WA 1P4GA 4S2UA 4K9SA 4UMVA 5E7JA 3JYPA 1NQ5A 4IZIA 3TQTA 3UJCA 1G0NA 3BHNA 3I6IA 2ZSAA 4IFBA 2CXXA 2NXNA 4PWYA 3KPJA 3L4BC 2W11A 3VC2A 4AN4A 2PRSA 3CR7A 1U2DA 2XWBF 1KQPA 2BSXA 3BRQA 3RU2A 1U2QA 1EE2A 1FCJA 4FNOA 4G26A 3P9QA 4FEGA 4R84A 3TXAA 5BWLA 1OH6A 3VMMA 4UBMA 3G1WA 3GLKA 3FTDA 1MIOB 5E7IA 3GIWA 2H7YA 1H4QA 4EFNA 4D0LB 1JJFA 1WRBA 5H4GA 1N2IA 2QA5A 5KYGA 4WCDA 3E9DA 1MCZA 2X9GA 4K6HA 1JDJA 1U1IA 2LR0A 1QFSA 1I7PA 2YY7A 4P9NA 2B35A 3OCYA 1P0CA 4GKBA 1T8SA 3WQBA 2QNIA 4JJIA 1QO9A 4TV9B 4E5UA 3II6X 4C0XA 1DI0A 5GMOA 4NAUA 1ZSYA 3IPAA 3K0EA 4JEMA 4C01A 2ZJ8A 2WF8A 3CUEF 5LP1A 2RGBA 3CUWA 1HGXA 2XYRA 3M4JA 4X44A 1Y7LA 1WV1A 4U6NA 3P0RA 1Y6QA 4ZT6A 2ZUEA 3L3BA 3KJXA 2BFMA 3ZHUA 2NYUA 2QUZA 3KKPA 1U9ZA 3RVBA 5HUQA 4G23A 1MVOA 2CLKB 2X4LA 1RXYA 4ZU3A 1PQ4A 1VE7A 4N18A 7ABPA 4DUZB 4MQ6A 4UMDA 4MO2A 1JHUA 4KR9A 4GPZA 2VSYA 5JISA 3AM4A 3SYRA 3BHMA 3WWEA 4AYTA 4EO4A 2VZ9A 2GD2A 4GMFA 4IYRA 3INNA 2ZDHA 1SBQA 3CRQA 1P61B 3CNOA 2H52A 4PQYA 3VX3A 3BIXA 4MLCA 4JP1A 2FFQA 1ENOA 3D3EA 4BNTA 4DEXA 3VDRA 4N7JA 4Q03A 5K0NA 3V2HA 1GPYA 5AOVA 4BLOA 4JXXA 1Y1RA 2QW1A 5MN6A 3TG8A 1G9TA 5JAHA 3HJHA 2BHNA 2RI1A 1P77A 4Z9FA 2F1KA 4OGLA 2HHAA 2XXBA 4JLDA 4PVCA 3HU2A 4TVOA 4CM4A 5AM5A 2Y99A 4DQDA 1C14A 1CSEE 3GHHA 1QH1A 4YRDA 3QENA 5KNLA 3G82C 3PI7A 1ZH6A 3AU8A 3PNMA 1CJKC 2W9XA 3H2IA 3NGXA 3BD7A 4JR0A 1Z6PA 4OJMX 2ORWA 1JLLA 4G1CA 3I0MA 4Q21A 3UA3A 4EL0A 1Z5PA 1P4HA 3D4BA 1ZJ5A 2IXEA 3GRKA 2Z9CA 4LPKA 1SBHA 2ZJ7A 3K6RA 5ICEA 4Z2YA 4B40A 3OQOA 3UWKA 5GINE 1ATIA 2ABWA 3P8ZA 1YF3A 1KZYC 3KYDA 2R9VA 4EELA 2PIAA 1FEZA 1S6YA 3N2ZB 3LUKA 2ZVPX 4IUBS 3MOIA 4HLCA 3VH4A 3VR5A 3ZXSA 3EZ6A 1DFHA 2CMKA 5IXJA 5BSWA 3R3SA 4MLPA 5GOZA 3INYA 2XGOA 5DT9A 3L93A 1XNQB 5EP4A 2GCIA 3LL7A 4WK4B 4EHJA 1PL6A 3E53A 1X15A 1R8SA 2C4NA 3C1OA 4I0WB 2FWJA 2REOA 4KO2S 3U3KA 3BCSA 4RVSA 2PT5A 3U9TA 3ZQ6A 6REQA 5JXHA 4KDEA 2UYYA 2XOXA 3DKKA 4PLYA 4QNNA 4Q9HA 3M6WA 1M5TA 3C7AA 3I0ZA 1GZVA 4UULA 3RBXA 4YV2A 5JY6A 1O5OA 4E5KA 3T5GA 5AVRA 4LY0A 4QATA 3T7JA 2NO1A 4BZXA 3D1VA 3FB1A 2DFTA 3MMXA 3R5KA 3FCUB 5F1KA 4ZZ3A 3ZNNA 4I19A 4Q9DA 4EA9A 2OV4A 2QTFA 5DMHA 2IE0A 3OPMA 3AY3A 2QL9A 4PXAA 2W00A 1UPTA 1YS1X 1GPBA 5EJ9A 3IP9A 3D8TA 3B2QA 3OQMA 1SXGA 3IQHX 3WX0A 5LUBA 5LQJA 4NDAA 1F7UA 3O93A 3JYNA 3MELA 1HY3A 3QA3E 4S1VA 1U2PA 3AKDA 1TM1E 3DCIA 2XUHA 1WXDA 1FYVA 3IHWA 1QH8B 2WZBA 3ZVRA 4MHOA 2WYUA 4IR7A 1MQ9A 3GROA 2QG6A 4HKTA 2ZS9A 2OXEA 3MRSA 4MS3A 4Y2VA 3BJEA 5DHSA 3SQNA 5C5EA 4KGXA 5ALEA 4EW1A 2Y76A 3KBBA 1KI2A 1Q17A 1Q84A 2GD6A 3EQ6A 3L43A 2D5IA 3H0KA 4M0MA 3TD9A 4M99A 3BJRA 5KOHB 5LFAA 1V6AA 3ABSB 4ZZIA 2GMWA 1XZHA 3QVJA 5I4BA 5DV9A 1KAQA 1YKGA 1GU0A 1YR6A 3JR3A 2OWEA 4TRMA 1RAAA 4CTNA 1XZEA 3HCBA 4K5QA 1RRMA 1JAIA 2GBGA 2GK6A 2H8GA 5CVUA 1K06A 3C6QA 3H2JA 4MIEA 4A23A 3NJ4A 3VKUA 2OCBA 3I9KA 1ZGZA 4RCVA 4RZHA 1JDTA 1PZMA 4RA6A 1BRMA 1Y8AA 2H5JA 2WU4A 1L8QA 4AMZA 4OUDA 4DCPA 5A5FA 1NVVR 2O1EA 2HLNA 3PEEA 4L57A 2GEKA 3ZU5A 5I9LA 5A9TA 3CSDA 5DM2A 2PXXA 5HDQA 1SU6A 1QYVA 4LWOA 1MEJA 5HRUA 4NY1A 4G25A 4JLAA 2ZBRA 1U0NA 4PCAA 3HCDA 1P5FA 4X1IA 2YH2A 2IEDA 1M7HA 1HI9A 4TOIA 1S2OA 2GBPA 3FNEA 4Y0NA 2NACA 1YE5A 3G5MA 5AJZA 3AL0C 4B75A 5EXDA 4J91A 3D3WA 5E0KB 2GCGA 3K30A 3M4XA 1W25A 2XGSA 1JIJA 1ULHA 1C0PA 4LFAB 4U5QA 3ENKA 5G0SA 721PA 3TI9A 2CZGA 5K51A 4EYEA 4IUCS 5A2GA 4XYEA 4ISCA 1NY5A 3UJAA 1JIVA 5H81A 3A6PC 5HMLA 2JARA 4JGIA 1LLDA 1JPUA 1Q22A 2E4AA 1IXKA 2J7PD 2ZBFA 3LOUA 4BZZA 2NP6A 4J3FA 4B9AA 2MSCB 1NRWA 2X0JA 1EMDA 1C30B 3DH0A 1MT0A 1Z2OX 2VYND 3K5HA 3LT4A 5B1SA 2VP4A 1T29A 1J8VA 4HWPA 4L5JA 4BJ1A 1AMNA 4YRLA 2JK0A 2CKMA 1XEXB 2GFHA 2PMKA 3QMWA 2N47A 3M3PA 1U7WA 3VPCA 3IODA 2POQX 2XW6A 2M6KA 1EHYA 2MTBA 4TT8A 2Z4RA 4IGEA 3OX1A 4PINA 4BYGA 2Z3WA 3I5MA 3R3YA 3KEMA 3ANYB 3VKFA 3ZHSA 3V7UA 2RK6A 4GOOD 1TJ5A 4CG2A 4MGYR 4JYCA 4PY2A 4FLMA 5B2ZA 2GZAA 5AIBA 2VDOB 4Q9IA 1HEIA 4MW0A 4W9RA 5IULC 2IEAA 2GZ3A 4I1SA 1OLSB 1GD1O 2HEGA 2RHLA 3G2NA 1FLVA 3AWDA 1T8TA 3I2HA 5AWFC 1YS4A 4CL0A 1GIAA 4EFMA 2E6UX 2OKCA 5J63A 1L5ZA 1XNJA 4I66A 1JIKA 4G67A 4IDEA 2VTBA 1FS4A 2I76A 3L6CA 1QZZA 4TYYA 4D0NA 3PFIA 3KQVA 1E0JA 1X80B 4RJIA 5C5DA 2ST1A 3CWCA 3NTOA 4KGDA 3HM2A 4MAFA 4RC9A 1QGUA 3ITKA 1Q0LA 3QFCA 5JRDS 3DEAA 4BO6A 3QP9A 3R3HA 2CK3D 4GPTA 1RKQA 2CLEB 4IHJB 1NFQA 3K2EA 3MK31 2RHBA 1V1MB 4QU5A 4BO5A 4UVIA 1N7GA 3DLPX 3CTMA 1KEEB 1CUCA 5I45A 4KOAA 4QU9A 1ONSA 4CR7A 1GTL1 2LDBA 1W34A 4CL3A 2BTEA 3JTMA 3OZBA 4KXVA 1RXIA 3HUUA 3SYNA 4KIWA 1AN0A 1SBNE 2R1UA 3SHTA 3RJMA 4F2PA 1JEYA 5E9JA 1KY5A 3C8ZA 1MFZA 4CF6A 1ZNZA 3RK1A 3AUXA 1M6WA 1LDEA 4MV7A 2PGXA 3KBOA 1IHUA 1N9KA 5EHIA 3R8XA 3UATA 4BMYA 2JLQA 4WINA 3PSAA 5IF9A 2CVHA 1QV7A 1ZC3A 2WIAA 3HEMA 5CFPA 1SQGA 2ZM6B 2BTOA 5L4NA 2IH4A 4WZ6A 3TWOA 4FCCA 4CM1A 4HDAA 4N03A 4F38A 1CRLA 1FBTA 3QTBA 1DPGA 4Q6WA 2YTZA 4PONA 1V8OA 2V9PA 3LVBA 4K3VA 3DFKA 3AFMA 4M9UA 5GV7A 1IVNA 4WVFA 4KXQA 1LBTA 3E9CA 1IULA 1M10A 4OGKA 3GVXA 5GGYA 2BM0A 1YOBA 3K0AA 4B3JA 4RCZA 3B7WA 2ORYA 4FI3F 2B5OA 5KTNA 4O3MA 2V0GA 4DUYB 4J1SA 4YNBA 3KOMA 3TX6A 2YCLA 1EGAA 1AKMA 2FG6C 4UHCA 3TSAA 4WUTA 2EWWA 3UHJA 4ZOLB 4DWWA 3J80A 4RS3A 3R24A 3JQQA 1FNSA 1E1CA 5LZ5A 3KKZA 2G28A 2Z2JA 4ZMBA 1EK0A 3F3YA 1DFIA 4EYQA 3HB1A 1J5XA 2XNCA 2XDAA 3GJSA 2B4YA 1W2WB 3L9XA 2C5HA 2VQ6A 4BWVA 4CT5A 1YC2A 4GX1A 1PEYA 1DAMA 2LW7A 4FTWA 3QE2A 3WB9A 3HU5A 3MD9A 4D9FA 4F45A 4JP5A 4N0DA 3OEED 4GIBA 3GRVA 1TEZA 1OBHA 2P6OA 1WKVA 2DHEA 1C1XB 2HZBA 4GLJA 4MYDA 4Y6RA 1WETA 1LVGA 1A7KA 3MUNA 3HKDB 4C7XA 5L9AA 4YT4A 3B6KA 5IN5A 4B6EA 3VSDA 1JT2A 2ETXA 1GU1A 3AH8A 3NC0C 3D7NA 2X2OA 3P4YA 2HCTA 2WTBA 3FNIA 3HS3A 2Y1KA 3V8VA 3PCTA 1NOIA 3GJXC 4P54A 5KQLA 1P91A 1I14A 5E3JA 3UWSA 4A5SA 5JFGA 5JCZA 2B2CA 5F98A 3D7MA 2ZSDA 1CLEA 4QHTA 4QD3A 4WKGA 2JLRA 4ZI7B 2RGXA 2A92A 2PWBA 3JS5A 3ICVA 4HMOA 1A8SA 1Y9JA 1X1AA 1MX1A 4MVJF 1M2KA 4UCWA 3DBRB 1AH2A 1RYMA 1XP5A 1U65A 1ZO8A 1MC8A 1NNSA 4LNHA 4UBNA 4CLOB 1EUCA 1P3JA 4M8SA 1O9HA 4XGQA 3K1ZA 4Y2JA 4DQXA 4C0HA 1XSEA 2VH1A 2P77A 4QPCA 3AB8A 4NBRA 3U49A 1FQOA 4U63A 5TE9A 3U7QB 1VJGA 2C2ZA 5FI0B 3B6MA 3G23A 3TI7A 4C06A 1CHNA 2B37A 4CE6A 1I3NA 1CS4C 5A7HA 5EHQA 3NP9A 1GRQA 5FD8A 2MSNA 4DV2B 4DA4A 3UO8B 4QUHA 4XUGB 1M6HA 1E2NA 3EEIA 3IAS6 3DQPA 3O73A 1ZXXA 3SS8A 2BL4A 3KB8A 1F6WA 4I46A 1E20A 3UYLA 5AKIA 2NSYA 2YHAA 3E70C 4A6XA 5EHXA 3GEIA 5IJ0A 1GPMA 2Q1YA 4RCYA 3IOMA 2JGJA 2QR2A 1ODKA 4OTZA 1ISJA 1PX0A 4DLYA 4TKMA 4JH0A 3RRXA 3C1TA 2NZWA 1OW3B 1ZRSA 1E5QA 1YAJA 3E7WA 4F11A 5CXUA 4ARUA 2HX1A 4OQMA 3K20A 4R1QA 1VG8A 4C4AA 4NICA 4NOMA 3QVWA 5IDXA 2D2EA 2WWHA 2F1RA 2I6SA 1T5HX 2XI4A 5CYPA 4KGVA 4BLRA 1NWHA 1N2JA 2OILA 2QMHA 4NENB 3K73O 1KJQA 2IZZA 3T7DA 1KKLA 2ONYA 5CFQA 2I4NA 1IM5A 1CB0A 1XTRA 3KUDA 1KYYA 2BF7A 3MTQA 1C9DB 4UVDA 4NPHA 5CM2Z 2OBNA 5B2EA 2AFRA 4QM6A 3DJFA 1T1SA 2WAOA 4J0DA 5FRDA 1K2WA 4KR3A 2VF7A 4LG1A 2Q1XA 1LPOA 4NAHA 2FQXA 3HDHA 5IH7A 2QGNA 4NU6A 3W5UA 2D62A 5EMMA 3CVWA 4DA9A 5A4DA 1JYFA 3QEKA 3PR3A 3KZOA 5WRFA 2FR8C 4WW0A 5H8WA 4ALMA 2HTFA 2VH5R 1FW6A 2JFVA 1TO6A 1ETUA 4COOA 2CLMB 2GJ8A 2Z5GA 2BD0A 3AB7A 3THWB 5JSYA 2GTIA 1NULA 1ZD8A 3EPKA 1H6BA 4Z4EA 2FCAA 1FPQA 2QMEA 4JDUA 4Q01A 3OCJA 2JGRA 3BTSA 2P4QA 4QVGA 2P40A 4AJJA 4LZOA 2GR9A 3BXOA 2ZXUA 4RF5A 4YV1A 2GHTA 2BPOA 2A3NA 3ZVNA 2IX9A 1KAGA 1KOLA 2Q21A 1CUYA 2OKGA 4N6OA 2QVLA 1GNPA 1W96A 2FQYA 4MO9A 3OQ6A 1GN9A 4PYMA 4RWZA 2WNSA 3HYSA 1SOVA 1QVWA 4HEJA 1WHTA 3CUVA 5ILQA 4NX2A 3R0QA 4K9OA 2QLJA 1N6OA 1YJXA 1ZK3A 4OXRA 4Z8YA 4J3NA 2PAFA 4KE9A 4RBNA 4EOGA 1II0A 4YR9A 1KORA 4NZYA 1MN6A 2P8SA 3P4UA 3DGEC 1SVIA 1IUNA 2HM7A 2FAXA 3HNOA 1X19A 3ZI0A 4MDYA 2Q5HA 3FUUA 4UUOA 3O90A 1KI9A 3H87A 3AEQB 2QR5A 4G09A 2O50A 5JW6A 2ZEJA 3DVRX 3UH1A 1IZ7A 5GP1A 4D3DA 1KRWA 3P27A 3TZHA 1TE2A 1XVAA 1DVRA 3VNVA 1GHTA 2WIDA 3KAQA 1TUEA 1L8XA 2PS9A 4V03A 6PFKA 1S02A 4ND4A 3HB9A 4XR9A 5DKFA 3HFSA 5EKTA 2ADMA 1TCAA 4AMYA 1W5AA 4MROA 1Q1QA 3EULA 4CNQA 5IKEA 1AV6A 3KTOA 1RQNA 4WKOA 3I52A 3DVSX 1OA0A 1GAXA 2JFOA 3K8YA 2VYQA 4HWGA 4L5YA 3RIXA 3SNHA 2IXAA 3ESQA 1BCRB 4CRWB 4PYNA 2DPMA 1TF2A 3PCRB 1ESCA 2I6FA 2CV0A 3AESB 4MIYA 3K09A 1OI2A 3U39A 1JEOA 1XQXA 1UBHS 2D06A 3JVDA 3L04A 3Q5GA 4FCTA 3MWEA 3WMWA 1TYEB 2EP5A 2IU4A 1Q91A 1RCFA 3FTFA 4UCXA 5EIBC 4QECA 4JI5B 3TVTA 4JBLA 2PJUA 4MV1A 1P6XA 3ZGNA 3AKEA 2XMRA 4BZQA 1OXTA 4HGRA 3PQEA 4ZAGA 1EUYA 1INLA 4MWGA 1T0IA 3DDOA 1MO4A 4ZWNA 4P3OA 4OHZA 3SIXA 3JQAA 3PT9A 4TX1A 4NNPA 3MC1A 3U5TA 5AI8A 5K05A 4CKYA 4OU5A 4F9EA 3H1GA 4E13A 4R1SA 1J1UA 1RXCA 5CFOA 5IZCA 4BUCA 1XF9A 1YONA 1C9KA 1E9EA 2FPUA 5BORA 4Y7CA 2IDJA 2WKQA 1M8PA 2XCIA 3MMNA 2XQKA 3IQGX 4R51A 4HDRB 4TWIA 3V46A 1DAFA 3DZIA 2H9YA 3LQFA 4PZUA 1ULSA 3LUHA 1UM9B 1EXNA 4XVUA 1VKZA 3SQLA 3NJRA 4HNRA 4X7PA 1H4VB 4C6SA 3KCQA 3LQKA 3NBZC 4I81A 1B0UA 3GLHE 1MPTA 1ZQ1A 1PWEA 3EEFA 4U7HA 1VPEA 4WQMA 4I50F 4HX5A 3T7IA 4CR6A 1QAOA 1RI1A 2JLAA 4KLRA 1OB5A 1QONA 3K4PA 2FMIA 1JG7A 4YQEA 3PV0A 1XVVA 8MHTA 2GJ9A 5LJLA 2GT1A 3Q8WA 3VZRA 2GA8A 4OKNA 4UPDA 1JKIA 1TVKA 2VPTA 2QP9X 3U3OA 2B3TA 3NRCA 4X54A 2ZT8A 3MS4A 4FYYA 4LOIA 4RD2A 2H1LA 4UBJA 1QORA 5HZKA 5IZCC 5KS2A 2JASA 4LGMA 4U39A 4R8MA 5GTDA 1Z39A 2P1ZA 3P0FA 4RMHA 3G1TA 2XHEA 1P2VA 1PKEA 3ZWDA 2Z9BA 1GILA 1R18A 2GZMA 3BGIA 2BBSA 3R7LA 2HGSA 2M98A 1U7HA 2AJBA 1VLVA 2P68A 2C7QA 4CEHB 1AM4D 2GLUA 5J40A 3PNOA 1WDWB 5FOVA 2HMAA 5HWSA 4BVLA 6YASA 1V5GA 1VLHA 2O3QA 1UWKA 3PQ3A 4QARA 4DT1A 1Y4ZA 4Q3DA 3MWKA 4O3FA 4MWDA 1MQSA 4XIFA 2ZSJA 5CYFA 3RWOA 1XYGA 3M5WA 4FXPA 1FUUA 2QM3A 4UZSA 5JJ5A 5JSKA 3PQFA 5EXTA 3T5TA 1Y4AE 2O57A 1KI3A 4YAFA 2NU9B 2OCAA 3K0FA 5IJZA 4B8WA 4JNCA 5EZSA 2XB2A 1KYIA 4CCYB 3DD1A 1CVIA 5BNTA 1RKXA 1TLFA 3T7AA 1ZK0A 2XZPA 3DJYA 4RPGA 1OT3A 1ZHFA 3N6RA 5DBGA 4PIVA 4NG4A 5BSUA 4OJQA 3N2KA 4ZZ1A 2HDHA 2VJAA 4HSGA 3HCCA 3MIZA 1WMFA 1G3UA 4UE6A 1P7WA 1C29B 1G3RA 3A0RB 5AR1A 2GZSA 1A88A 4E09A 2PEZA 3Q8KA 3D4LA 1RHUA 4CJXA 3MGBA 3ON5A 1TQDA 2CXHA 2DZDA 2IA5A 5C18A 1V5EA 3O21A 2ES4A 3NT5A 3WZLA 5DI3A 3S2SA 4EEZA 3JATB 1U1EA 1R66A 1Z34A 3LJKA 4R1OA 3I61A 1O3YA 4QQNA 3U44A 1JFSA 2BI7A 3H2YA 2LIVA 1SC9A 2XUGA 1RACA 4LRWA 3TLJA 4BO3A 5CFRA 3R6WA 3EWSA 1KJYA 3UAYA 4QRHA 1ORHA 2WT4A 3CLHA 2IYWA 1MO2A 4R2IA 1ODSA 3A4VA 4DOMA 1JYEA 1GDDA 4YYEA 5BSHA 4EDHA 2XKAA 5CJJA 3X1XA 4DGQA 1WP4A 3CZ4A 3EIWA 1TQ4A 4KQFA 4QYIB 3MGCA 3BJMA 2ZUWA 5IK2A 1KARA 5AM0A 4D4IA 1OTHA 2ZE8A 3DD5A 3PVCA 3PXUA 3WV4A 1T8YA 1XLUA 3GT3A 4QEZA 3CZ9A 4XJVA 5KWEA 5JALA 1VMAA 1YULA 4XWAA 3VKWA 4DWVA 2O54A 1W88B 2D2VA 3UCFA 4X3OA 2B8NA 3T6KA 3VUFA 2QVZX 4CEIA 3LLUA 5HOQA 1QIFA 2D59A 5BWBA 4F92B 4TLMB 2QBYB 2PH3A 4QT4A 1T3SA 4NHOA 4DGSA 1PNOA 2HD4A 2CXQA 4CIXA 1QE5A 2NPOA 5KKCA 2F1IA 4F06A 5HCUA 1R0RE 1PNTA 1QE0A 1YRBA 1BXRB 1U8FO 2QYOA 3REGA 3VI4B 3QVGB 1PHRA 2P2GA 3JD1A 1V47A 3OFND 4RGQA 1VGRA 1J9EA 1N3BA 2IOQA 4M86A 4DV4B 1L7BA 1Z6YA 5HGJA 4O02B 2E4WA 2P9FA 5T4BA 5A3JA 4EF6A 1B6TA 4C6TB 3ICEA 1FFBA 1Z45A 4OHUA 4MARA 4Q1CA 5TPWB 2EJUA 1KZ7B 3S2FA 1MENA 2AEJA 2TS1A 3A2MA 5DHFA 5HMMA 3TOZA 3GIDA 3RR2A 4A6PA 2B83A 3RSLA 3IJRA 1YOVB 2D00A 1XRMA 3S2ZA 4BX3A 1MC4A 4TV9F 3VZSA 2BCGY 3RKUA 1JIQA 3C6XA 1X14A 2BJVA 1ZICA 4ZVVA 3QMMA 1LDBA 3AW8A 3RO7A 2ATXA 2YWDA 2AR7A 2MR6A 2IP4A 2C57A 3T0FA 4AKEA 3ZV3A 2HREA 5E4YA 4JLKA 1U8YA 2X0KA 2NUAA 3EXAA 3K15A 3AIOA 1RKVA 2WF7A 4M54A 4XIJA 4EO9A 1B8NA 1C4KA 4DHEA 2RJOA 3BKXA 4D8TA 1FZTA 3EGXA 2Q0XA 3IPLA 4IQGA 4EAQA 2C4TA 2EEZA 4FFMA 3A2KA 2O5EA 4ZA2A 5KAMA 5BUQA 4JEHA 1QJCA 1R6AA 1L3BA 1UJBA 4NEHB 3T41A 3ASUA 3VOTA 3EPHA 3L07A 2YRFA 5HS6A 2ZIUB 2ZIEA 4C4ZA 5KNDH 4R81A 5ECWA 5AXDA 4CFZA 1J24A 2CXSA 2W6MA 5EPUA 1VP3A 2V58A 4YQZA 2M1ZA 3O8QA 3MRVA 1JMYA 3DYIA 2VUTA 2RIRA 3MRTA 4G0ZA 2YYYA 4WGGA 1T6ZA 1E6KA 1EFCA 3M6XA 2P4EA 4OV6B 3VUEA 4C7BA 3PENA 3K1AA 3STYA 2FQ1A 5LP6A 4W5JA 5KOJA 1G17A 1HE1C 2AFVA 2HJSA 2OZVA 5DM4A 3W9UA 3SVTA 3CB4A 4H6VA 2HF7A 2VJMA 3KELA 2VUSA 4EKYA 1JG2A 3AOEC 4PCVA 3E5NA 2ZS8A 1JPNA 4G63A 1UC8A 3VPGA 1E98A 2ZUUA 2C2BA 1M6VA 2EJWA 5ALJA 4R1NA 1E3QA 2DC1A 4DAOA 2GSDA 4E2XA 1M7GA 3HUDA 5U9CA 2O8EB 1D5WA 2W6PA 5AJHA 4X62B 3LAWA 4DQKA 1L8AA 3HP7A 1C8KA 2GVZC 3CLSD 3OTIA 4QDKA 1DIAA 2EW2A 5ESDA 5DWVA 4RJTA 2A9RA 3EZ9A 4RIEA 3N2IA 4UTPA 3SMQA 2ZYVX 3IUNA 3E8XA 5EE5B 4MHTA 3M6MD 3PRJA 4D9GA 2JBAA 4RIFA 1V8ZA 5BRNA 4GX2A 2L19A 3O8CA 2JAOA 3JYLA 1GQFA 2IZOA 2NTNA 3H1BA 2FUNB 3QLEA 4I55B 1M54A 4UCFA 3ZI4A 1DDIA 4PW0A 2PU7A 2XUZA 3TM4A 5LVAA 5LWHA 4J0HA 2WAYA 4HBGA 2UZ3A 3F49S 1O6FA 4MRMB 3GMSA 4PSAA 1V95A 2Q6LA 4AMGA 2Q7XA 3LUPA 3D31A 1I80A 2FPSA 3AVQA 3G49A 4BLTA 2AW5A 1EFKA 1O4VA 4H35A 4PX3A 4WNIA 5JPCA 1IY1A 5BVGB 4EATA 1R5NA 3G2JA 1IEVA 2QPLA 3T4PA 1AK2A 4KQHA 2Q3DA 2YC4C 4LRYA 3HEAA 3VO1A 4BMXA 1P6QA 3CPJB 4OL0A 1B2RA 5LLDA 1XDGA 4M0UA 2G0AA 4BP9A 4ODIA 3ZG6A 4RK0A 4YMGA 2QRJA 5JS1A 2A30A 1GFIA 2NZUG 3DE5X 4CV2A 5FTMA 1C0KA 4D43A 1E4EB 1QF7A 1YV9A 2FSGA 2OHJA 1WP9A 4IS3A 2AMFA 4UEJA 2WILA 1FB5A 1PFKA 2VOEA 1HORA 1EBUA 4OJKA 4NBNA 1W85A 4V0NA 4Y2SA 4BECA 5FAKA 2C7OA 2R4UA 1PZEA 3E48A 2TECE 3LL4A 4N76A 3PQ5A 4UU0A 3QEMA 4Q82A 4MJ3A 5KQGA 1CEXA 1DPFA 2GPYA 4ALIA 3A2NA 3RJTA 3TEJA 2QY9A 2GXUA 4QNRA 1SMKA 4XCVA 4I36A 4YT8A 3WLHA 1HPLA 3NV9A 4OLBA 5GADl 2V54A 2VHCA 4GYKA 4X6YA 1ACMA 1IK4A 2EL9A 2WWTA 4YGYA 4YRJA 3T7RA 3EXIB 1W581 2OHIA 3SIPA 3V34A 2QJFA 1VE6A 2C1XA 4WZAE 1UC5B 4WH0A 3I2IA 2G07A 4RHTA 3AVYA 2Z3VA 3N3BC 5DCWA 2VK8A 3OIYA 3PHJA 3RSFA 1H85A 3UXYA 1RS0A 2QQFA 2YXNA 1CP3A 4FMDB 4I9NA 4YUVA 1PYOA 2B4RO 3DCNA 3KD2A 4N8EA 4WJKB 5JIBA 2BI4A 4MPDA 3Q1KA 1J99A 4NG5A 5L7TA 3HJAA 1HFKA 2GZHA 3FZNA 4MUKA 3T3GA 4W7SA 3O4VA 2HU5A 1XGKA 5FBWB 1G8KA 1YI1A 1Y81A 3MCZA 3JARB 4ZEXA 1QX3A 3MB5A 2BIFA 5LJIA 5HKLA 2GJ4A 2OHFA 1MD9A 3OIDA 2Q4OA 2V6MA 3H65A 1RLJA 1T24A 3OCZA 5AM1A 2J3MA 3HBNA 3I2GA 4CGZA 3I6QA 5C4GB 1KFCB 1OGYA 4P32A 3C4VA 2OA0A 1J0BA 2B4AA 2CNWA 4IFIA 4MWOA 1UMCA 1M8JA 4UE3S 4OPMA 2YHUA 3LUJA 1ORDA 1O6CA 4IIJB 3P9XA 4R7GA 1E1QA 3IJ5A 4BLPA 1OLUB 1DQNA 1Z5NA 3AUKA 7REQA 1XZPA 1X7XA 1A7UA 1IMJA 1UOPA 3QUTA 2CXPA 5CFNA 1V96A 1OAOA 5DO9A 3ANXA 4JVNA 3TE6A 2O8CB 3AUFA 5DIZA 2H06A 4XLLA 4II3A 4Y1GA 4BMNA 3L6EA 1T9GR 1EE9A 2G9UA 2ZRBA 3FB4A 4UHFA 4W63A 2CUKA 3UJNA 1OQAA 1W5EA 5ER6A 3RRJA 5AXCA 3VSAA 3N58A 4EVQA 3FOZA 2RD2A 2CSXA 4HCJA 2BE7A 2PL3A 3V1YA 2BMVA 4PEVA 5K4GA 1R4AA 1CZKA 2IE8A 2QSUA 4GLBA 2REBA 3KFXA 5H3LA 4B7XA 6AT1A 4CKZA 4AJ9A 3GEPA 2H31A 1G42A 1H2WA 3LGAA 3MJ4A 1WF6A 3M82A 1TECE 4HDCA 4RADA 2ZJ1A 3SJUA 3ZOKA 4AZ0A 1QYCA 3GARA 3LNTA 5IYZB 5KNBD 3OQIA 1B3RA 2MDTA 4BN5A 3F46A 3KQUA 1IJBA 2EP7A 2CV2A 4FGWA 4XQ9A 5C8VA 1TF7A 3HCAA 4S1TA 1QHYA 5FLEX 4IQ8A 5EWJB 1CHDA 3AHFA 1AQJA 1RYBA 1ZS9A 3KZCA 2O23A 1SFRA 2WR8A 3MINB 2QIOA 1YCFA 5FB3A 1SNYA 2WSMA 4E11A 2IYUA 4QG7A 2PZEA 2XQFA 4NR0A 2ZUVA 4RJKA 1DIHA 4XGIA 2UVDA 1YZ3A 5HUJA 1I6WA 2H51A 3B3GA 1EVYA 2HK9A 2PCJA 3NT4A 1SCAA 4IFTA 5ECDA 4ZKEA 2MCFA 3QNWA 3I0NA 5E95A 4IH9A 1EAYA 1H8ED 4ZAYA 4IHJF 5E9WA 1YUMA 2H4JA 3W3AH 1BWQA 2I0FA 1JN0A 4UTRA 3H6KA 2WVAA 2G63A 1JU4A 4ZK2A 3H16A 5ULLA 2FPLA 1FMFA 5ALGA 2RGAA 2WWFA 2CXUA 1L4HA 3QI7A 1IPFA 1B00A 2FZKA 3L49A 3KZMA 3NDPA 4LOLA 3T1QA 2YWHA 3KVYA 1WCWA 4EA6A 4X6UA 2V6JA 3NI2A 5K4AA 4EARA 5JHHB 2WQ7A 1Y3IA 3Q6MA 3HZHA 4OG2A 3W0LB 4EL5A 1Q0RA 1O03A 3EQ2A 3HV0A 1UKZA 1DO8A 3TPCA 3B3QA 2BISA 3PR2B 2W2MA 3PI6A 1CD5A 1RJWA 4DR4B 1XHEA 5C1BA 3ZLTA 1QJ4A 1AMUA 3BFKA 1PS8A 3PT5A 2GNOA 4CLXA 1EM6A 1Z26A 4MUFA 2O05A 1NVVQ 2ISQA 2VJNA 3B9QA 2ZBVA 1IJKA 4W5QA 1GSAA 1V7PC 4IDOA 1G5HA 2YVLA 3HBLA 4HQOA 3TLAA 1SVNA 4IRMA 3LS2A 2ZE5A 3ERCA 2CY0A 4W1RA 2FV8A 2AK3A 2HPHA 4WESA 5T3YA 4P31A 2RHJA 2V5AA 3WNQA 1YS7A 4H77A 2OFPA 4X8LA 3CONA 2A8YA 1BDHA 5IUJC 5FOTA 5CA1F 4ZOLF 3R7WA 1NT4A 1QWSA 1DIGA 4FU0A 3N59A 1XCLA 2NTEA 4D56A 4X24A 2SECE 4OFZA 3D2AA 4ZO9A 5LMCA 1GZSA 2DPHA 1QHHA 1E2QA</