4KFRA

Structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with sulfate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
207
structure length
204
Chain Sequence
NPDDIVVLVGRKKSGKSYLIKHYFIPVLKAHKISYIIDDHNLGSEYSKFGYNATSLSDIVSKQYVVVYDRAKNDDFFEKLWQASKLHSKKYGTTVLIIDEAYYHFKYKQKVTPAIDEALHANRHAGLGLILSTQRVYDLMPIVYKQADLIIMFYTREPNELRWISKYISAEAAEKVKTLKQYHFLIYDVNSQTIKIHKPILEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome packaging NTPase B204
publication title The Structure of the NTPase That Powers DNA Packaging into Sulfolobus Turreted Icosahedral Virus 2.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus 2
molecule tags Hydrolase
total genus 63
structure length 204
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 3.-.-.-:
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kfrA00
2Z4SA 2ZI4A 4TLEA 4XD7A 3W90A 2F55A 1LB1B 3WBJA 4QHTA 2B8WA 4XTRA 3VR4A 3LFUA 2AK3A 4EQ6B 1CR1A 2ZUCA 5KSYA 4LJ9A 3K0FB 4A8JC 4NCIA 3ICQB 4MRSA 2J0UA 3P27A 4HZUB 2KE5A 3MWKA 2ZTSA 3R9XA 1XCPA 2WWGA 2BKEA 4Q18A 1Z8FA 1G3MA 2QMUA 2OLJA 4NYMQ 2TMKA 3V00A 4MDEA 4AC9A 3KDSE 2P6RA 3BH7A 1OT3A 1FUUA 3MWLA 4CEIB 1QVAA 1M6NA 2OZEA 1W0JD 4FXPA 3UMFA 5BN5A 1AN0A 1EFHA 2H57A 1ZMXA 2ZAOA 4B2IA 2G1KA 3W8NA 1OFTA 2J7PA 3EWAA 4RZ2A 3F5FA 3L8ZA 1SXJD 5SZHB 2JLWA 1KY2A 1GRQA 3T12A 2H18A 1US8B 1VCMA 2IHYA 3TRFA 1GM5A 1U98A 1G8PA 1FMJA 1QHYA 1YE8A 2CHGA 2YOFA 3R20A 4BFXA 4ESVA 1G7SA 1N2CE 2PL3A 4XVRA 3PEUA 4F4JA 1GNQA 5FOVA 5K8IA 4R71A 3PEVA 5EP3A 3ADBA 3VHLB 2PJZA 2XTZA 3D3QA 3U6BA 2RHDA 3WXMA 4JYCA 4P4SB 2VPPA 5E7JA 1JR3D 1M2OB 3K0EA 4S2EA 1MH1A 5JBQA 5JSZA 3GLGB 1JXMA 2EFHB 3CX8A 3NEJA 3B6EA 2WV9A 3RRZA 2QBYA 1UBFA 1JEEA 4V0OA 2W2XA 2PJRA 3TSWA 1X8LA 4HUTA 1G7RA 1D2EA 5H70A 1UBCA 5JHGB 5C18A 5JI3E 1RE0A 2G6BA 4TYQA 4EPWA 1GUAA 2ZEJA 3P32A 2PBRA 3GD7A 4I1OA 2RB4A 3KB1A 3QQ5A 1E9FA 3Q72A 3O8BA 3U2QA 2ZE8A 3HYTA 4IKEA 4DSOA 3EAQA 3UMRA 5J4YA 2ZRFA 4US2R 3NG1A 5FOXA 3U6KA 4EJSB 1G16A 2QMEA 1MRSA 4FN5A 5IDVA 1TF7A 1E0JA 4B73A 1NL3A 4A6PA 1NVVQ 3I5XA 1WBBA 3AEZA 4D25A 1N5KA 2OO7A 2D74A 3CRW1 2DCUA 1Q0UA 2ZAMA 2WPDD 4F91B 3PV0A 4NHOA 1GWNA 4A0HA 3ZVRA 4PO8A 2PZFA 1NN5A 4PSVA 5AJYA 2OXCA 1BS1A 3B5JA 2GZAA 4MYCA 2ZJ2A 1LF5A 1P6XA 2OG2A 2W58A 4L9WA 1NLYA 2J59A 5G41A 4QHSA 4G5SA 2F6RA 3J81k 1N6OA 2A5GA 2GXUA 3VFDA 4D0GA 2GXAA 4JLDA 4R9UC 1BYIA 5EXTA 2FX3A 1KHTA 2ZVPX 2J0UB 5SZIA 4NDZA 1SXJE 3R7WB 3SFVA 5HE9A 1Z06A 3CRQA 3A37A 1YJ5A 1QVRA 3SBEA 4DBLC 1WQ1R 1MRNA 3MJRA 4BEJA 4RD4A 4LPSA 2W0MA 2O8FA 3EG5A 5TARA 3MLEA 5H68A 5IRCD 4CGZA 3SI7A 4JL5A 2CL7X 4YXWA 1KI6A 1W4BA 1W0KD 3JZAA 3LNCA 1F2TA 1JR3E 3DEFA 2PLRA 4BFZA 4XJXA 1LFDB 2OBLA 2PX3A 3BH0A 1M7GA 4PHFA 4QJ5A 5KHOC 4PZYA 2ZRKA 2ZETA 1AQUA 3QPWA 4RD2A 621PA 5JLJA 3W34A 3RSOA 4LC1A 1TQDA 4KSBA 1KOFA 1SKYE 3B85A 2EW1A 5L3RA 4PZZA 4DDWA 2A9KA 2GXSA 5M04A 1GRRA 4PQRA 5DIFA 2IWHA 2GF9A 4DEXA 3WHKA 3LQQA 2FWRA 2NIPA 2AL7A 1G20E 2XITA 1KO1A 3H86A 4LCBA 5C4GB 4MRRA 4P32A 2O8CA 1ZC3A 2BMJA 3QENA 1ESMA 2BEJA 4LHZA 4LV8B 1XEXA 2EQBA 1KMHA 3LW7A 3SNHA 3TW4A 1XEWX 1AS0A 4YMWA 3UXMA 3GJXC 5IT5A 1YQTA 1GIAA 1YHNA 2IYVA 2V9PA 4D4LA 2B7BA 2IS6A 1KTVA 3ZZTA 1KSGA 4TSFA 1KK0A 4M1OA 3ADKA 4D4KA 4CEJA 2QAGC 2QMOA 1CJMA 1GP2A 3BBPA 3EIEA 4ASUA 2ORVA 1G3IA 1N5IA 2O5VA 4MQBA 3CUEF 2PLFA 1GL9B 1D9ZA 4C2UA 3UWKA 2EVWX 2VQSA 4WXPA 3FMOB 3WRYC 3SN6A 2FZ4A 1UDWA 2FDCA 5L8VA 2B92A 3RS3A 3RS2A 3LXRA 4TQUS 3UK6A 3N70A 4V03A 2VRWA 2AXPA 1FL9A 2QT0A 3KX2A 3EWSA 2JASA 4DEYA 3SJAA 3ZH9B 1NMXA 2YKGA 3RRYA 3EPJA 1E1QA 4ZDIA 4B76A 1IJEA 2Z5FA 2J87A 1TQ4A 3AP1A 3B9PA 5TDHA 3A58B 1JR3A 2XNDA 4IFBA 4U7DA 2KSQA 1DOAA 4J0QA 4MRVA 1GKIA 1JECA 1FFHA 2GKSA 2PEZA 2FSFA 1BIFA 3FHCB 2IS1A 2J0QA 3W3ZB 4F7WA 5JS7A 1KO8A 5AWFC 4DLRA 4NTZA 1G21E 3D31A 1FOEB 4BPBA 5IK2A 3ETLA 3PQCA 1G17A 4MITA 2H7VA 1N6HA 4PPQA 1JEDA 4B71A 3NBYC 3IIMA 2ORWA 2ZSEA 5HZHA 4BFUA 1KNQA 4LX0A 3ND9A 2WMNB 2HXSA 4GNKA 3KQKA 3K8YA 3GP8A 2XJ9A 3FDIA 3X1XA 1ZNXA 5EE5B 2QE7A 4IDPA 4DDVA 1Z0JA 1XTJA 4K81B 1OFUX 3GEIA 4MYUA 1KJYA 5TB5A 1PUIA 1N6KA 3C4JA 2OCBA 1XCMA 3RYTC 1LS6A 2QSYA 5BW8A 1RRCA 3OZXA 1XMIA 1SULA 2A2ZA 4HAZA 3PVSA 2XXAB 4NKRA 3Q3JB 4HYYA 1BO6A 3NH9A 3X1YA 4OK3A 4TQ9A 2IUUA 4DCNA 2AK2A 1WRBA 2ZQ5A 1Y63A 1OIWA 2OHFA 1EK0A 3OEHA 1SVSA 2XTNA 4RVCA 2HJVA 2ANCA 1X8JA 1E2NA 4DLVA 4LJ7A 4LK2A 1Z63A 3KKOA 3HDTA 2F7SA 3NBZC 1SXJC 4M0LA 5A5GA 2QP3A 3TIFA 4G5RA 5HKKD 2C96A 3BAFA 1IQPA 4WIAA 4C0LA 1W47A 4JVLA 4OI0A 2CK3D 1CF4A 2EYQA 1G5RA 2WJGA 3HU3A 3O47A 1YR6A 4KFTA 5TY0A 3WYFA 3ZZ0A 1UKZA 4NYIQ 1HEIA 1R10A 3D7MA 3LA6A 4TYNA 1T0JB 3QBTA 1P2TA 2AWOA 5LD2B 5E3HA 3RSLA 1KZGB 3AV0B 5AJXA 4QJ3A 1D6JA 1VCIA 4DLWA 1Z2AA 3NBXX 4QBIA 1OFIA 1HTWA 4BECA 2IBMA 8OHMA 5AJVB 2HDNB 1T0HB 4B48A 1R5NA 3A36A 1N0UA 5DHAA 2QNRA 3W8RA 1A7JA 1XXHB 4OJQA 4EFNA 4QBFA 2D7DA 4FWIB 2W83A 4QXAA 2WSSA 3X1WA 3RRMA 1C4OA 1KO5A 4LYFA 5BXQC 4ESHA 4D26A 2X77A 3K0AB 4QC2A 5FBQB 2VSXA 4GZLA 3KQNA 4Q4JB 4PHHA 3ZIAA 1XPRA 5EJEA 4NE2A 1R5OA 2NZ8A 1XCGB 5AK0A 5FFMA 3NHBA 1ZU5A 4TZ6A 2WOOA 4LV5B 3KQUA 2CBZA 4LBYA 2A3RA 5CM9C 2DHRA 4TL6A 2ZI7A 1LV7A 3L8YA 2QQ0A 2EWWA 2QORA 4WW0A 4IVQA 1AM4D 3C41J 4L8GA 1I2DA 1KI1A 2BMEA 1B0UA 5L3QA 2LKCA 2ZRPA 3CH5A 3TUJC 3IPYA 4CIDA 2JJ1D 3VNUA 1Q1ZA 5CM8B 1JBKA 2CE2X 3H1TA 4LHVA 1XTRA 1XJCA 1DE0A 3IO5A 5FR1A 4M9XA 3M6AA 3GFPA 2WWWA 4PC7A 3TKLA 1UEIA 3MFYA 4PPFA 2EFGA 3NDPA 4TQAA 4G0NA 1XU4A 3T5GA 3PUZA 3THXA 2XZLA 2HF8A 2WHXA 3TJZA 4BWYA 4M53A 3SYNA 4BZXA 5DI9A 4CYMA 3E2IA 2F3TA 4DDTA 1R2QA 5K8TA 4MH0R 3ZLJA 2IYTA 3FMFA 3GEHA 2VHJA 1DG3A 3C16C 1W49A 5CYOA 2H17A 3TNFA 1DS6A 3LX5A 2VSOA 4BEBA 4IW3B 2XOKA 3B82A 1VTKA 3U4QA 2W6ID 4EUNA 2XZPA 1ETUA 1JJVA 3GMTA 4MKGA 4P31A 5FL7A 3THYA 4Q7MB 3CZPA 5EE0A 5FPYA 1P73A 4GI7A 4DCVA 1XRJA 2HT6A 1XMVA 4XSHA 4Q21A 2Z43A 5J4HA 3Q7PA 4E03A 3LQRA 3U7EB 1A1VA 1PLLA 2KBFA 2FMXA 1BKDR 2B7CA 4OQXA 2OFWA 4XVQA 2ZR0A 1XTQA 2ATVA 4FIDA 3A4MA 5E7MA 4M1YA 3DM5A 3EC2A 2VTKA 2FSGA 4P4UA 5ANRB 3GCGA 1VG0B 3QVUA 4IFEA 3CNNA 4DT1B 1G18A 1IXSB 2GCOB 1Z07A 2J3EA 2JCSA 4B3BA 3NC0C 2QRNA 3OEEA 5LDDC 1J90A 3AQ4A 4C4PA 2YINC 4X8MA 2ZJYA 1Z6AA 5KPJA 3T34A 2FNAA 5EQTA 5KPDA 1FQJA 2YYZA 5JHHB 5G3YA 3MGCA 1TAGA 2BEKA 2CVHA 2VL7A 3GLIE 1S96A 3E70C 3RS5A 1S1CA 1VCOA 1IBRA 2FN4A 4M1SA 5AJWA 1XMSA 3EPLA 3AUYA 2RMKA 2ZSDA 3U61B 2CK3A 4M8NE 4V0KA 1E0KA 1OPXA 2FV8A 1A2KC 4QGFA 3QNUA 1I4DD 4EPVA 4DSNA 4DKXA 1B23P 3BERA 4H9GA 1E9CA 4BLQA 4Q47A 5FOUA 2OV2A 1G3UA 1TTTA 5L3QB 1IY0A 5H8WA 5GJWC 4IDOA 1DELA 3HYRA 3WBKA 1HQYE 2NQ2C 2IXFA 4MKFA 2VIIA 1RRFA 3JVVA 4R7ZA 4B44A 3AH8A 4UQOA 3OE7A 1FQKA 4XTCS 5CYPA 2Q9BA 1G8YA 4W5WA 1E96A 1P2VA 2IYLD 1E2IA 1VG1A 2O52A 3CPEA 4MGYR 2J1LA 3IKJA 4PAOA 4IVRA 2PCLA 1T91A 2IF2A 1W2GA 4RFVA 1J70A 2VP9A 1MR3F 5B57C 4N0EA 3K9LA 2OCAA 1YZGA 2QAJA 4AWXA 4KXFB 1OYYA 5C1BA 1GDDA 1L8QA 3KXLA 1KY3A 3WMGA 1IXRC 1Z0FA 5KYKA 1L2TA 1Q1BA 3SU8A 2JLXA 1DTSA 3KTAA 4WAUA 1SVIA 1ZP6A 4TL9A 1U0JA 1IJFA 3U4QB 3PUYA 2ORIA 3RRNA 2I4IA 3R8FA 3THYB 3THWA 4GFDA 4NYJQ 4Z8XA 1E79D 1FNMA 2C9OA 3I1FA 3ZVNA 2WWIA 3FKSA 2HEIA 2VHCA 4UNSA 3A1VA 2BJVA 5GVSA 2G0TA 2OAQ1 3TVDA 3MWYW 2F1JA 2GCNA 1H8HD 3CPHA 5JJIA 4Q7KA 2QTHA 4P33A 5FUWA 1EFRD 2E9SA 1EX7A 3PEYA 3LLUA 4URZR 4TTQA 3GLHE 3PG5A 1S0UA 5A0FA 1OJLA 1AJEA 1KJZA 2W6JD 1KJWA 4LYJA 2NO6A 3PUVA 4A8JA 4KLZA 2GJAA 2WJHA 821PA 2JLRA 2R6AA 3CIOA 2CJWA 1CEEA 3DOFA 3TK1A 3FHOA 1Q3HA 5FPSA 1DAKA 1QHIA 3ZGXA 2AKYA 1XFAA 2IYUA 4C0JA 3ZVLA 5K8LA 1CKEA 2ZU0C 2O8DB 1E9SA 4G5GA 1GOTA 5FI0B 5B64A 1W36D 4PC6A 3K70B 2O8BA 3SC3A 2FGKA 1U9IC 2LKDA 1OXXK 1ZD1A 2G9NA 1G291 4AIIA 2F9LA 3SOPA 4Q4AB 4IEEA 2ZM5A 4IEIA 2PEYA 1QF9A 4YDHB 3VHXA 3LD9A 5LBIA 4QGGA 2ZI6A 4DCSA 2IYXA 4JLPA 4OI2A 2VYFA 3EC1A 4B47A 1DBSA 1RZ3A 3HR7A 2ONKA 4R2IA 1CRQA 2GJ8A 1R6BX 3DHWC 3DPUA 3VR1A 3GEEA 1C1YA 3C15C 3LBNA 4G5QA 4GMXA 3ZS8A 2REBA 4BASA 4PZLA 4A36A 5JRZA 4FMDB 3PUXA 3TE6A 1V43A 3QIAA 1D8TA 2VHTA 1XNJA 2ZREA 1WXQA 3QPVA 4JJKA 3EW9A 3LX8A 1FX0A 3B1XA 1P72A 2DB3A 3CF0A 4K8OA 2MMCA 2NG1A 1HT1E 2X2EA 2BMFA 3ZVMA 3FB4A 4LGMA 4TLBA 1KK1A 1OLOA 1OE0A 3NXSA 2JLUA 2ZS7A 3KTAB 4H1UA 3A8TA 1OXSC 3UG7A 2ODBA 4HAWA 5JI2E 2CLDX 1Z0KA 3DMDA 4CVNA 5JMTA 2G0NA 4QHYA 5DN6D 4TYWA 4BRUA 3THWB 3BS4A 4GMDA 1P60A 2KI5A 3QVVA 4BLSA 3IILA 1GKUB 1VIAA 3IQXA 2JIZD 4NYIR 4KFRA 4PQYA 3WRXC 1QHSA 4DLTA 2JLVA 4Z1MD 2O0HA 5UKDA 4HB2A 1RFLA 4JL6A 1Q44A 3B1VA 4HAUA 2QT1A 1ZAKA 1KMQA 3BB1A 3ZD7A 4CW7A 3X1DA 3QEJA 4WZ6A 2REXB 1X3SA 3RHFA 3A1WA 4DIEA 2OAP1 4PC2A 1U94A 4A8JB 5FPKA 3VKGA 5KSZA 1ZM7A 3KKQA 3NVAA 2ZR7A 721PA 3QXJA 2CJWB 2ECKA 1ANKA 2FFBA 2BWJA 1X1SA 3BFVA 4ZV4A 4JBXA 5JZVA 1E0AA 4RJLA 4ZDJA 3O8CA 3BC1A 3QG5A 5DGXA 1U8YA 1BMFD 3EZ6A 1VYVA 1Q3TA 2JGNA 3CPJB 4B35A 5CB6A 1TMKA 1KKMA 4BFTA 3AKDA 3ASYA 1ZRHA 2HLDD 3ZJYA 3B78A 2FU5C 3BORA 3PR1A 2O8BB 1E79A 1G3QA 1P61B 5TXGA 4ARZB 1M8PA 4KCGA 1D9XA 4FMCB 3LV8A 1GNRA 2NPIA 3NKVA 1H8HA 1WE2A 4TT3A 1ZD8A 3TR5A 2W00A 1AZTA 1CULC 1Z5ZA 4FMDF 1CJTC 1GAJA 3NBFA 1XPOA 3U7GA 1W4CA 2PT7A 3BE4A 2PH1A 5EXXA 1G8HA 3GJ5A 2C99A 3VX4A 5CB8A 2N42A 3PEWA 2AHOA 2L0XA 4PXAA 4L5BA 1K8RA 1VIYA 4Q9JA 3TW8B 1S3GA 5JFGA 4V0ME 5B58C 4W9MC 1IN5A 1VHLA 2ZI5A 4DLZA 3CW2A 2XTMA 1WA5A 2QAGA 4DDUA 3ONWA 1FX0B 1XD2B 4V0NA 5DE3A 3QEOA 3KUDA 2AR7A 2QROA 2Q9AA 3L82B 3SJZA 1G64A 2OT3B 1R7RA 4GP6A 1E9AA 2F43A 3EX7C 4BQSA 3A1UA 3SFZA 3GLFE 4RKFA 3WNBA 1UJ2A 4A9AA 3K9HA 1KO4A 1OB2A 1SHZA 1JALA 1YRAA 1U0LA 3C5CA 1E98A 2WWHA 4URYR 4A0FA 2ZRCA 3U7FB 2WIBA 3GJ6A 1KI8A 5BQ5A 4Q01A 1SQ5A 4GPTA 2GBLC 5FTJA 1P62B 4HLUC 4KVGA 3ZYCA 4YC7A 1HA3A 2ZSBA 2ZRAA 2J41A 2GJSA 5KSOA 1DG1G 2AFHE 5CIQA 3I62A 4URXR 3AKCA 4JYBA 1YZUA 2FSHA 2ATXA 1Z3IX 4KYIB 4MA4A 1XTIA 2WKQA 2JEOA 3CLVA 4RD1A 3OFND 4Q4LA 1CR0A 1K5DA 2P6NA 1XWIA 4TMKA 4PHTA 3PCRB 4GL2A 1N25A 3K0CC 3TQCA 4NCJA 3C14C 3FGNA 3OIWA 4O2RA 4OI1A 3E1SA 5L3VA 3FFBA 3K53A 1XDBA 1Z28A 4LOAA 3UKDA 1K5GA 4EPYA 5HKKA 2Q3FA 2IXGA 4V0MA 4KODA 3QE0A 3TLXA 4D4JA 4OQFA 1E0SA 2ZUBA 4A0GA 1IHUA 2QM8A 3P26A 4HLQB 1VMAA 2ASEA 2OESA 4O2LA 5DI3A 5BYJA 3PITA 3DL0A 1E2DA 2ZRLA 4WOPA 1S9DA 5JSZB 1AK2A 1VDZA 2IW3A 3E5HA 2QBYB 2QL6A 5EE3A 2CDNA 2GWHA 2NTYC 3SE0A 1TU3A 2Z0MA 3DKPA 1G6OA 1G8FA 4X8OA 4Z1MA 4NP6A 3FHTA 1UF9A 1OXTA 1R8QA 4KBFA 3EIQA 4CZ2A 1Z0AA 4IHQA 4M1TA 3GLFA 1W0JA 2NO9A 2QTFA 1BYUA 1RYFA 3QKRA 4TMTA 4MRNA 1W36C 4GOKA 2Z4RA 521PA 2FGJA 2CMKA 5B2ZA 2C78A 2GJ9A 2JJ2D 2A5YB 1ZIPA 5JWRA 1EG7A 1G6HA 1SXJA 2CLSA 2F1HA 3MAAC 5FUYA 5KU1A 1UAAA 1DO2A 1NLFA 2V1UA 3G5UA 5K8UA 1UKEA 1EFCA 2XSZD 4Q5IA 2HJGA 1DAIA 2IUSA 3AVQA 4Z8YA 3AVWA 1XZQA 1C9KA 3BB3A 2C03A 5FOSA 2C04A 4RFSA 1R4AA 2QAGB 2WVJA 1NBMD 2OILA 5EXSA 4B32A 3PUWA 1RJ9A 4U02A 1SGWA 4O0MA 2GCPA 4HEJA 2WJVA 3VR3A 4B34A 3AGPA 3IEUA 1RRPA 3WP1B 3KJHA 2P5TB 4RY2A 1YR8A 1YZLA 2ZSFA 1NMZA 2WTUA 1FNNA 2CCKA 1J99A 4HI0E 1TPZA 4OBEA 1AQYA 1LW7A 1Z29A 1VPLA 3I4LA 5EP2A 2F43B 4ZO4A 1XEWY 4JZKA 4ABYA 3ZQJA 3WHLA 5L3SA 2GESA 1HT2E 3SYLA 4KBGA 3VMFA 4NYJR 4UJ3A 2NO0A 3RS4A 4AY2A 4NCKA 3SJBA 2VEDA 2FG5A 3QY0A 3BJIC 2FA9A 3UMSA 2EYUA 3KJEA 1NIPA 5JECA 4F92B 1TEXA 2GXQA 3LVQE 3I5YA 2O8FB 2WICA 1ZNWA 5JJLA 1W1WA 4DC9A 5KSPA 4ZI2A 3FTQA 3KXIA 2R9VA 4OI4A 1ZUHA 2XZOA 2ZXUA 4UNRA 1QHHA 1RVDA 2ZE6A 3IPXA 4DWJA 1KI6B 5GJVC 3U3MA 3NTUA 3K09A 1F2TB 3RWMB 5FL3A 2Z83A 4M4SA 1NLZA 2V4ZA 2WPDA 3AM1A 4ZKDA 5TMPA 1DARA 1L4YA 3BIFA 2NMVA 4B33A 4M1KA 4II7A 1N6IA 3CONA 3G0HA 3MUFA 5SZJA 1UBEA 4HLDA 1GKYA 4LYHA 4JMPA 4MRPA 1G7TA 4N0DA 4WZBE 1HYQA 3CR7A 1JAHA 1CR4A 4GBMA 1UM8A 2O8CB 4MGIR 4TYPA 1XEXB 1KMHB 2Q3HA 1M7HA 4H1VA 3QUSA 4PR0A 1ZIOA 3MJHA 2WIAA 4B6EA 3WNDA 2IYRA 3L0OA 2IYSA 3Q5EA 4A4DA 4B2LA 5A4JA 2XB4A 4PTLA 4CT4B 4CEJB 2IS4A 4ZCLA 4KI0A 2FEMA 1CR2A 1NBME 1W44A 3GJ4A 1OV4A 1P2UA 4OQLA 2P65A 4US1R 1W0KA 2ZE7A 3K9GA 4RD0A 4BGDA 1RKBA 4JSTA 2RAPA 4MGZR 4IDNA 2VH5R 5GADl 1U8ZA 1SXJB 1JAIA 1VKJA 1ZCBA 4YMTA 4XOIA 1T5IA 3M1IA 4BE7B 4Q9HA 3SBDA 1PLJA 4TLAA 3RVBA 2ZRGA 2W2TA 4URWR 5GJBA 4GOJA 3EXAA 4PANA 4A15A 2I3BA 1AIPA 3I61A 2VP4A 1T3LA 3BXZA 1RJ9B 1FP7A 3AKYA 3CRVA 1E4VA 1TEVA 4A2WA 1JQLB 1X1RA 4QBGB 1WB9A 1NN1A 4OHXA 1ZD9A 2UKDA 5AJZA 2CVFA 4DUGD 1SVOA 3AVXA 4BRWA 4PX9A 2QA5A 5FTNA 1EGAA 2FF7A 5HE8A 2A78A 3KJGA 1SZPA 3KL4A 1SKYB 4OHVA 5HPYB 3K09C 1BH2A 1R0YA 1IONA 3AVUA 3CB4A 2XB2A 4FD2A 1NN0A 2GILA 4NYMR 5FBVB 2HXYA 4L4UA 5HR5A 2RHMA 1F2UA 4AI6A 3KKNA 4B3CA 3AVPA 1I4LD 2JJ2A 2DWPA 4YMSA 2IWRA 2WAXA 1YVDA 1A82A 3QF4A 3BFKA 3EZFA 3HU2A 1WDTA 2XSZA 1QHHB 1MABA 3QKSA 4C0HA 4B3DA 4JVSB 4P0TA 4X8LA 1AS2A 1T8TA 3TR0A 3VU9A 2YOHA 4TL8A 1CU1A 5CK5A 3CO5A 4HDCA 4L9SA 4U00A 3BH6A 1E9RA 1OYWA 2X8AA 2WWFA 2D3WA 5F98A 2ZYWX 1X8KA 3A6PC 3NH6A 3TSOA 4LI0A 2RGDA 4Y0VA 3SZRA 2J5XA 4DJTA 2IXEA 2D4HA 4LHYA 4WZAE 4CT5A 4EIWA 3TH5A 5HCIA 4HLCA 4HDOB 2C9CA 2CHQA 1R0WA 3T06B 3PENA 1UADA 1LNZA 1ZUNB 2OBNA 1G1MA 3UG6A 4JS0A 1KSFX 3U5ZB 3I32A 5BYKA 2OXRA 5JJKA 2ANBA 5AUQA 3BB4A 2BOVA 2HV8A 1S1MA 3ND8A 1S8FA 3BD9A 2REOA 4HATA 4UNQA 3CBQA 2QENA 1P9RA 3MG9A 2PZEA 2GVZC 2ODNA 1IN6A 1M74A 3BWDD 2FJUA 1F5NA 5JS8A 4GP7A 4RZXA 1E9EA 1NVVR 1DPFA 4ZKEA 3TVTA 4IOKA 2R6DA 4LSGA 4QNMA 4JJZA 2FSIA 1FUKA 2DFLA 3U7HB 1E1RD 1VCNA 2J0VA 3SJCA 1TF5A 3TAHA 2WKRA 1W46A 2BC9A 2DFKB 2JLSA 4E5UA 2RCNA 2ZRDA 5FPTA 4BFYA 1OIXA 3O8DA 2VP6A 1DVRA 3IGFA 5DHFA 1NF3A 3SS8A 1H8ED 1II8A 1N6RA 1RYHA 1U99A 4LZZA 4V02A 1AS3A 5DYGA 4AYXA 4Y0AA 4XWAA 3RC3A 4I99A 4JLKA 2ZIAA 4PFSA 4ZPXA 3WYAA 4Z51A 4Q19A 2J7KA 2MSEB 5CLQA 2FFQA 2EU8A 1NJFA 2C9YA 3CX6A 1ZYUA 5E7IA 1QHNA 4KU4A 1ZNYA 2FFAA 1F3OA 1LS1A 3I3SR 4MYTA 4D80A 2YWEA 4EDHA 3I73A 2XEXA 4XD7D 1P9NA 2HCJB 1U9IA 2YWHA 3IUYA 4HAYA 2GVDC 1Q12A 3FFAA 3OESA 4DLUA 3I8XA 3B13B 3PFIA 1KI7A 2J46A 3QF4B 4YQFA 2JA1A 4A82A 3QKSB 3W3AA 5D3MA 2PZGA 2BM0A 2WMOB 3OIUA 3WP0A 3THXB 5C46F 4M9ZA 2YJTD 5JEDA 3W9YA 3GJ8A 4QOSA 1OHHD 3MMPA 3SR0A 4DCTA 3HR8A 3ASZA 1EXMA 1E94E 1YR9A 2VF7A 5FTMA 4GZMA 2B8TA 2ZJOA 4JLNA 4Q1CA 4FWTA 5AR1A 5EUQB 2GK7A 5EP4A 1XTKA 4NMMA 3VKHA 1LTQA 2A5DA 2YC4C 2J7PD 5HCNA 3GLGE 3DZ8A 1P2SA 4CDGA 1E2GA 5KNBA 1N5JA 1R8SA 2WAYA 2JJ1A 3REGA 1S4QA 5JRJA 2B6HA 3TSZA 2GZHA 4WXRA 1BOFA 3AVYA 4AYTA 1XEFA 3GLIA 2CL6X 4A2PA 3TMKA 4TYYA 5FBLB 2OCYC 1NMYA 4EQ6A 1QDEA 2CE7A 4KJZA 1DAGA 1U2RA 4TLCA 1Z6TA 4S35A 4NL4H 3SHFA 1X86B 5J4KA 1NVWQ 1ZNZA 2HYDA 3LH5A 4PPNA 3AVOA 5EUMA 3S1AA 2G88A 3EIHA 4DB4A 2WJIA 1RW4A 1XF9A 2ZS8A 4TL7A 2NOAA 2HF9A 4TMZA 1VYTA 3RAPR 2ZPTX 4YLGA 3GFOA 1UDXA 4Q1DA 2N1BA 2VLIA 1WP9A 3EPHA 3Q9LA 1XJQA 1DAMA 1P5ZB 2QP9X 2W6IA 1Y3AA 4C0KA 3VR6A 2FPKA 2RKOA 4EKDA 1OIVA 3LBIA 2H16A 3WNCA 1ZC4A 3T5DA 1US8A 3CNOA 1T9HA 3Q85A 4GRAA 2F1IA 1E2FA 3HPRA 4I1SA 4Q1FA 4BZPA 3VR2A 4LPKA 4ACBA 2WJJA 3OIVA 4QNRA 2C2HA 2AX4A 5CLLA 3AF0A 4DSUA 1IAQA 3OHMA 4JT4A 1MO6A 1E69A 1E2PA 4XVUA 2JLYA 1J7KA 4D4MA 2YZ2A 2C95A 2NPFA 3VAAA 4HAXA 3BFXA 1T3SA 2EWVA 3CM0A 4PC1A 3QJYA 2HUPA 4MUBA 5J40A 3GLGA 1G7CA 1GTVA 3AF2A 4LJAA 1NI3A 3TGPA 1E4YA 3U44A 1HURA 1UEJA 1J8MF 3B7GA 5SZKB 3RS7A 4HB3A 1E3MA 2BCJQ 1E6CA 1E1RA 2IHBA 4KFUA 2GAAA 1Z0DA 4KV9A 5ELXA 1SVMA 3RNLA 3NEYA 3GLHA 1AKEA 1FPMA 3L0IB 2KWIA 3QKTA 3CZQA 4HB0A 1KI2A 4MKHA 1TADA 4EJSA 4QJ4A 1N0WA 1NN3A 3K1JA 1UFQA 2MSDB 4FW9A 4X8HA 4MUAA 2IEZA 4A1FA 2JLZA 2VF8A 1NG1A 4IOJA 4RD6A 3EPKA 3C7KA 1AGRA 1E99A 2IL1A 5LB2A 1G4AE 2BCGY 3VQTA 1IN8A 1E2LA 3NWJA 4B75A 1XTSA 1NKSA 1G8GA 4Q9LA 4LC0A 1SHKA 4B3FX 2JLQA 1JR6A 2PMKA 1DAEA 1Z6YA 3GLIB 3TUZC 2QEQA 3THOA 3FPAA 3D8BA 4LHXA 1JJ7A 2QMHA 2VP0A 1UKVY 4BLTA 1NNEA 4KITB 1W4AA 3F0TA 3R7WA 3DO6A 4IVPA 4JLAA 3S1AB 4C0BA 1GL7A 2GBLA 1OHHA 4HLUA 3X2SA 4TSFD 5TV2A 4D6PA 4ITRC 4DIDA 2C77A 2AN9A 4TLDA 1GNPA 1XX6A 4RCZA 2QSZA 4KYUA 4UNNA 2FPMA 3DKVA 4UNPA 5DYIA 2DPXA 4ASUD 1F6BA 4QL3A 1VECA 2ODWA 4AK9A 4UJ5A 4PQFA 4EPXA 4HDQB 3PJRA 1GSIA 3BK7A 1IY1A 4B2PA 1ZM2A 2HYIC 1CJUC 1GITA 3K0CA 3KKMA 2RGCA 1D2MA 1ZW6A 2O0JA 4W7SA 2IYZA 5FTLA 4CRWB 4KLNA 3TAUA 4I4LA 3CX7A 4YMVA 1TU4A 3A1TA 5GVRA 3N5CA 2BDTA 4LDJA 1F48A 1ZCAA 1RPZA 1EFRA 1TL7C 2WSMA 1II0A 2NO1A 4EFMA 1E1QD 1GILA 2EFCB 3WYGA 1R0ZA 1KDTA 2W6JA 4UXHA 2ZRJA 1KGDA 1P9WA 2OUKA 3LVRE 5EZ6B 5HTKA 2XNDD 5C2JB 1FP6A 3KUCA 2MSCB 4EJSC 2ZR9A 1MO3A 4Q00A 4TWZA 4UXJA 5G53C 2QTVB 4AKIA 4IDHA 2V55B 3U3RA 3U44B 2E1RA 3CNLA 5F9HA 4XH9B 2A5JA 4AG6A 1GL6A 4US0R 1KIMA 1UKYA 1YRBA 3GJ7A 3DDCA 2ZI9A 5EE9A 5IK2D 3SYKA 1VG8A 1E9BA 2BBSA 5AUOB 1Q57A 221PA 3GLHB 4JL8A 4LV6A 2X1VA 4A92A 3A1SA 3T15A 1S2MA 2CNWD 1N6PA 4LJYA 1QHGA 4C9BA 4POAA 3LO5A 2RGAA 2FZLA 6Q21A 3SQXA 2QE7D 1R0XA 1MV5A 3QPUA 1IOZA 4IXMA 4LBVA 4D81A 4U5XA 1TNDA 4G1UC 1Z83A 4HAVA 3T35A 1RC8A 2K5UA 2IUTA 2ZYUX 2LWIA 1W5TA 1HV8A 3G82C 1M7BA 1UBGA 4G3XA 5HZKA 1CJVC 3KKPA 4BLPA 2FE4A 3EASA 1X6VA 1PLKA 1JPNA 2VBCA 2ZRBA 3ECCA 4BFVA 4QGAA 4GDFA 1IN7A 2V3CC 2ZJZA 1Z6GA 1QG4A 3IO3A 2IEYA 3M4YA 2QPOA 3P4YA 4KFSA 4L16A 5FOTA 3QG1A 4D0NA 5G3ZA 2N46A 2MMGA 1PZNA 2GNOA 2Q0HA 1VG9B 5EXPA 2JJ8A 3OEHD 3LBHA 3IBGA 4I81A 4AG5A 1LF0A 3IHWA 1G41A 1TQ6A 1CLUA 2RGEA 4AURA 1U90A 1AGPA 3D6TB 4ZDKA 4DLXA 1YU9A 3H2YA 2DFNA 1XXHE 3T1TA 2BM1A 1E2EA 3LRPA 2OFOA 2P3SA 3O8RA 1OH5A 1S3SA 1N5LA 4M9SA 4QM6A 3AB3A 1KK3A 1T5LA 4PC3A 2W0SA 3N2EA 4EPRA 4FMCF 3RWOA 3DM9B 5JCZA 1WBDA 2I1VB 4IJMA 1COWD 2R6FA 1QZXA 4GSYA 2FH5B 2QQEA 3QI2A 5KNCA 1MOZA 1ZM9A 4DVGA 1NSTA 5DN6A 1NIJA 2DWOA 4JLJA 4DB2A 1W5SA 2H92A 5J4VA 1NVUQ 1L7VC 3LWNA 2JIZA 4WBSA 3T1OA 1P3JA 2XXAA 1WMSA 4GT1A 4M21A 1M34E 2WSSD 2PT5A 3AKEA 5B30A 1ZJ6A 2YC2C 2FPLA 2IK8A 4O25A 2ZS9A 4FCTA 5J5CA 2WBLC 2Q6TA 1HUQA 1KO7A 2QPAA 3TUIC 2ZRMA 5AUNB 1SKQA 1N0VC 1Z08A 3QXCA 3ZIAD 1YZNA 2IYWA 1KDPA 1KI9A 4C0SA 3UANA 4FCWA 3EZ2A 4OYHA 1XD9A 1KZ7B 1XMJA 2Q3MA 2RGBA 1L4UA 1LY1A 1RIFA 2GHIA 3B2EA 2ODEA 3PIRA 5FPHA 3ZZUA 2KBEA 3AP3A 5IF9A 4BFSA 2RGGA 1T3HA 3BOSA 2GRJA 4LBWA 4PO9A 2D06A 1JPJA 3VNVA 2A5FA 2YWFA 1QHXA 3Q7QA 4XWKA 2KJQA 1BMFA 1TUIA 4IXNA 1KNXA 2V1XA 2O8EA 3TQFA 2BBWA 4PPGA 3HWSA 1EFTA 3RC8A 2ZRHA 2HLDA 5KDLA 1W36B 4PHGA 1JB1A 4F93B 1VHTA 4JBWA 3CH4B 4FINA 3ZDQA 3VR5A 5BN4A 2VP2A 4Q66C 1XXHA 2F3RA 1I4TD 3B8HA 2WZQA 3H84A 4A6XA 4B3XA 3EA5A 4JLVA 4JSYA 4KVAA 4DCUA 2Z6VA 3L43A 4ZI3A 1OH8A 3U60B 1XPUA 2P5SA 5EE1A 1CIPA 2QU8A 2QY9A 3T1QA 3K0AA 1U8AA 5D3QA 3IBYA 5F2EA 2GA8A 2GTPA 1J8YF 4ILEA 3CWQA 4Q4JA 2AKAB 4UXIA 4C2TA 1IN4A 1KSHA 4RZ3A 2AXNA 5DSZA 1T8UA 1CTQA 3U3OA 3I8SA 4ZDWA 1IM2A 4NBSA 4JBYA 1ZUIA 1E2HA 4JVNA 4LJ6A 2P67A 2EFDB 2XOKD 1J2JA 3HU1A 5FTKA 2G3YA 2ZJ8A 2YNMA 5FL7D 1W4RA 1E2MA 1G5TA 3VTKA 1M1YE 3RANA 2B21A 2WM9B 5EP1A 4OKSA 2ERYA 2QPTA 4IDQA 4P3YA 4B74A 2P2LA 3CKLA 3X1ZA 4JKIA 2CNWA 4OL0A 4RCYA 3MCAA 4IRUB 2GEUA 2O0KA 4G01B 3Q8XB 4EPTA 3LY5A 2X19A 4CEHA 4BLRA 5KO2A 1SVLA 2BBOA 1VYUA 2QGZA 3CRMA 1E9DA 1A5TA 2ZI3A 5FR2A 3TBKA 3QF7A 3OIYA 1DEKA 1MO4A 5DI3B 1G5PA 2CEAA 2ZRNA 3W5IA 4PAMA 2VP5A 4RSGA 1EWQA 3IHLA 3V9PA 1V5WA 1T6NA 5P21A 1FMLA 3OAAD 3LW8A 3CF6R 1OFHA 1Q1EA 2OE2A 2OBMA 3MRSA 3OEED 2YWGA 4HSEA 4K46A 2XAUA 4TTRA 5LD2C 2BMDA 4DLSA 3C8UA 3JZMA 3M0EA 4Q1EA 2BJWA 3GLFB 2NO7A 3OF5A 5H1YA 3K70D 3OFNA 2JDID 5CJPA 3QKRB 4LJ8A 4DLYA 4QRHA 4LHWA 4M1WA 1ONBA 2ZJ5A 5E4FA 3AF3A 3C5HA 2CLCX 4NCNA 3V4RA 4BLOA 1CS4C 2R6GA 2VHUA 2OCPA 1KI3A 2IYYA 2ZYTX 2PMDA 1ELOA 4OHYA 2IA5A 4KHZA 1EESA 2I1QA 4Q1BA 4ZCMA 3QXSA 4MGKR 3SDZA 2RGXA 3UATA 4KO8A 1Q1QA 3W6NA 4TMVA 4RFSB 5BWMA 1COWA 5FH9A 3LAWA 2Q9CA 121PA 2O8EB 1U81A 1P7CA 4O3MA 2D2FA 3BRWD 4AKHA 2RGNA 2BV3A 1AKYA 1OKKD 4G5OA 5DLQC 3OE7D 4DT1A 4TZ0A 2GCOA 2V6JA 4Q9IA 3B9QA 1D5CA 3FVQA 1FTSA 2QM7A 2HCBA 2VSFA 4QBHA 1RRGA 4MYHA 4M1MA 4W5JA 3KQLA 1G9XA 3I92A 4Q03A 5L3SB 4LUCA 4URUR 1FZQA 1CXZA 2C98A 1O3YA 4C30A 2ZRIA 1PUJA 4DZZA 5KTYA 3AF1A 4AKGA 2IF0A 1ZM3A 3FE2A 4Z54A 1IXZA 4JVMA 4QFMA 2G1JA 4OK6A 3AP2A 4YMUA 2J9RA 3Q5DA 3U3KA 4DRZA 1A2BA 4Q48A 4UKDA 1Q22A 4C3ZA 3DMNA 2C8VA 3I72A 1QBKC 5FBRB 4LY6A 3ADCA 2R6CA 3R9WA 4HUQA 4JT2A 4B6FA 2D2EA 1PJRA 2VO1A 3T61A 4ERNA 2V7QD 4QGHA 1NSFA 5DNYB 3L0PA 4N1AA 3H0KA 4QM7A 3N2IA 4DXAA 2QUZA 2CCJA 1DO0A 1NBMA 3FKSD 3HJNA 4BUJA 1EX6A 1JNYA 1OW3B 1OH6A 2ZUDA 3B60A 4HZIA 1XBTA 2AWNA 4TMXA 2J45A 4YDSA 5C4MA 3KJIA 4OK5A 1GG2A 2DBYA 1E2KA 1Z0IA 2OLKA 3UIEA 4IOMA 2JAQA 4NPHA 3FMPB 3IIKA 1GRNA 4CEHB 1ZINA 4AKEA 2ERXA 3QBVA 3QSYA 1P4SA 4FMBB 2PCJA 3IDQA 4AYWA 5E95A 5FUXA 4PAQA 4PSAA 4Q02A 3AVVA 3B1ZA 1PV4A 2DWQA 1W48A 2ZSAA 1Q20A 5F3WB 4R98A 5CK4A 5J47A 4I1UA 2FEOA 1ZVQA 4NH0A 3PXGA 3UPUA 1KK2A 3RLFA 1IY2A 2OEPA 4M9QA 2R44A 421PA 4B43A 1DADA 3EARA 5CJ2A 1XD8A 1E32A 4E07A 2IX3A 1F60A 1W2HA 3FMIA 2WKPA 1ZM4A 4YONB 3IIJA 1KDRA 2ZYVX 2RGNC 2V54A 1Z6XA 4JLOA 1CRPA 5JWHA 4C7OA 1HY3A 1KAGA 4P4TA 3SQWA 2OFXA 3QOFA 2BIFA 5F9FA 1N6LA 1XP8A 3DZDA 2GJKA 2W2VA 4M22A 3R9IA 5DO9A 4JKYA 3QKUA 4OQMA 3SHWA 1CBUA 2DR3A 3KQHA 5FI1B 4Q4HA 2QP4A 4LJ4A 4D82A 2YHSA 3W5JA 3RABA 2WOJA 1PVOA 2FOLA 2GAOA 3KFXA 1KKLA 1JQJC 1WCV1 1EWRA 3AUXA 1NP6A 2X2FA 3U3JA 4QKQA 3B1WA 3MD0A 4IOLA 3CR8A 4R2HA 3SEAA 2XNSA 2NGRA 1QRAA 4EFLA 3OAAA 3ZD6A 1OXUA 2P0EA 1O87A 2O8DA 1ZU4A 3NC1C 5GJCA 1NVXQ 4TMWA 2IS2A 1NY6A 1MO5A 1W7AA 2CXXA 1TQ2A 1NJGA 2AD1A 4NONA 1WF3A 1G19A 2SHKA 3W6PA 3AGQA 2JDIA 3ADDA 2ZANA 4RKEA 4D2IA 2AFIE 5CDFE 1NRJB 4JLMA 1F2UB 5KOYA 3ICEA 2F9MA 2R8RA 4ZIRA 3GFTA 2IT1A 4Q4AA 5CIWA 5AUPB 4OJKA 2QRZA 3DOEA 3EZ9A 3NIBA 4HUQB 1NY5A 1TX4B 4F38A 1ODFA 1KI4A 2PX0A 1H65A 2R65A 1XZPA 1MABB 2QG6A 4TN1A 2H8KA 4JLBA 5G40A 3A4LA 3VU9B 5IHPA 1YZTA 5BN3A 4OHZA 2CHVA 3K0SA 2OM2A 5JEEA 3FOZA 2RH5A 4DHEA 1FW6A 2GEVA 3HPQA 1OKKA 1NKTA 5EZ5A 2QZ4A 5LPNA 2HT1A 4LWZA 1OSNA 3F8TA 4D0LB 1G3RA 4DUGA 4I1VA 1QG2A 4MKIA 2QI9C 1Q21A 5FBWB 1YZQA 3AVTA 5TVKA 1DAFA 3NHAA 1GVNB 4XSGA 4RD3A 2DY1A 3JVUA 2ZITA 2GZDA 2GEDA 2A30A 4ON9A 1SVWA 5FOWA 5KDDA 2ZE5A 3CF2A 4LBZA 3FYHA 4A2QA 4KSCA 3KXKA 2E87A 4KAXA 4E09A 3LXXA 1NG9A 2CCGA 4CF7A 2JATA 1YKSA 3GQBA 5KNDA 4Q1AA 2UZ3A 2OSBA 4NZYA 3KZ1E 2ZVQX 5KDOA 4LRWA 1R5BA 4NU0A 2XGJA 4A0RA 3EZ7A 3A4NA 1OXVA 1E2QA 1HH4A 4PO1A 3K0FA 2V7QA 2ZJBA 2R62A 5DH9A 3LLMA 2D62A 5JCPA 4PSKA 4HZUA 2GETA 3T1VA 4TTPA 4AD8A 1DAHA 1YZKA 4HB4A 4ZCIA 4URVR 2Q21A 4C7OB 1E2JA 1A4RA 1ESNA 5LB4A 3GPLA 5CDFA 1GFIA 4TT3D 2BVNA 4WVFA 4CEIA 4Q9KA 1ZBDA 3MSXA 3P1JA 2A7QA 2R2AA 4W5HA 4BFWA 3HP1A 4Q4HB 4L15A 4NCHA 4V0LA 3WMEA 3P4XA 5JWOA 2BBTA 2IC5A 3MWJA 4B3GA 3K70C 2DFTA 3L0SA 1AZSC 3W6OA 2GDJA 4JIMA 3WY9A 2BKUA 3VKWA 1OB5A 4F4IA 3FKQA 4M2LA 4LYAA 3IEVA 2WWXA 3UWOA 2CL0X 2BHRA 4FI3C 1XJ0A 5FUVA 3VX3A 4OHWA 2F1RA 2YV5A 4E22A 5CITA 3KB2A 2DYKA 4LJ5A 1JXOA 2D7CA 1Z22A 1Z2CA 1K6MA 1II8B 1T4GA 4C0AC 2KB0A 1SVKA 1LVGA 4Q7LA 2QGNA 1OH7A 3LDAA 1UPTA 2ZROA 4XWOA 3V4FA 1II9A 1JI0A 2ZJAA 3DVLA 2Y8EA 4GOXA 3QXHA 4P4SA 1GZSA 1N6NA 5DISB 2UZIR 2UVQA 3CWZA 2WJYA 4Q7JB 4MDFA 2VHQA 1I2MA 2IYQA 3H4MA 2XJ4A 1HE8B 3IQWA 4ARZA 1AA9A 2C5LA 3GJ0A 4ZIRB 2YOGA 3RS0A 4ACAA 5J4LA 4XIGS 1S9HA 3P20A 1CP2A 3ZS9A 3QXXA 2LCFA 3KFVA 1FTNA 3ZQ6A 2NZJA 3FWYA 3L2OB 2ONJA 2V8OA 2H1LA 5D3MB 2ZU6A 4DSTA 1XB2A 2H5EA 2YVUA 2EFEB 2GF0A 4BZQA 3NDBB 1G4UR 1KSJA 1EFUA 3REFA 2WWYA 1TF2A 1D2NA 2G77B 2J0SA 1KDOA 3CRRA 1HE1C 3AF4A 1KYIA 3F3YA 3RDPA 1P75A 1N3BA 4FCVA 1H8EA 2VA8A 3R8CA 4YXWD 4QG7A 5KUTA 2G83A 4N3NA 1HQCA 3GJ3A 1KAOA 1YR7A 1XD2A 3EA0A 2V6IA 4EAQA 1U0HC 4RZUA 2QN6A 3BGWA 2AD5A 1TUEA 2FFHA 4WA7A 3K9NA 1CJKC 1OF1A 4OQNA 4C0QC 2XX3A 1MT0A 1Z47A 2GK6A 1MKYA 3WMFA 4F4CA 2P6UA 3B1YA
chains in the Genus database with same CATH superfamily
4RIFA 4TLEA 4XD7A 3IMEA 4YMIA 4I55A 3QEMA 4Y2SA 2AG0A 1QAOA 4YRIA 5B6PA 1T10A 4EQ6B 3R75A 4M60A 4HDKB 4B6JA 2GMWA 2ZUCA 3O94A 1LLCA 2QDKA 1XQWA 3C2QA 5KSYA 3K0FB 1R4NA 5JNSA 3ICQB 3PNPA 4Q6WA 4YBRA 3MWKA 4N40A 5F33A 2RK6A 2WWGA 4P6VF 5GZ3A 2BH2A 3R9XA 4MI9A 4DXHA 3TZCA 2AX3A 3RS9A 1G3MA 2BFCA 4KK4A 1GG5A 2HF2A 4JJGA 4MR8A 1CY4A 5FWXA 1AO0A 3URKA 1Z82A 2P6RA 3BH7A 4BQRA 1YHYA 4L5CA 1FUUA 4RHTA 3E9EA 2WU8A 3W2FA 1QANA 5IJWA 1QVAA 2OZEA 3CINA 3KTOA 4FXPA 1AN0A 1EFHA 2W6OA 5C1DA 5F7OA 3DEAA 4M8KA 2H57A 1ZMXA 2V58A 3AQIA 2VN8A 2J6IA 1Q7CA 2BFNA 3H8WA 4NESA 5GONB 3VNRA 4ZTBA 3EWAA 2EIHA 1AK9A 5GQSA 4M7WA 4HMOA 5SZHB 2JLWA 5IN5A 4L95C 4TYYA 1GM5A 1L4KA 1SOUA 1TK2A 2I7VA 1FMJA 2CHGA 3WL3A 3VPBA 1SVNA 3T7SA 3AK4A 4X3PA 3WLQA 1G7SA 1QYCA 2DETA 2WG0A 4XVRA 4EJMA 1GNQA 4WJKB 2NN3C 3L6DA 4R71A 4IDGA 2DVMA 2D54A 3NTVA 3ADBA 1SVUA 3DWIA 5JAUA 3OQJA 5KC8A 1A4XA 3H4IA 3MELA 2WB2A 3DQPA 5E7JA 3MUNA 3VISA 5AVYA 5I4IA 5K5EA 1M2OB 4S2EA 4J91A 3TXYA 3DTVD 3NEJA 1W76A 3CMMA 4ETNA 1A4IA 3BYZA 5JJBA 1UBFA 3DMRA 4V0OA 2CFIA 4GMGA 3E7WA 2O5EA 1G7RA 1M9NA 1VJDA 5JHGB 1J8FA 4UEKA 1K8YB 3N0TA 1DC6A 5JI3E 1RE0A 4HGOA 3F1KA 5IKEA 1FFDA 1GUAA 4B4OA 1JAZA 1LC0A 2RB4A 1U0GA 3TI9A 3HP7A 1ZN7A 5K0SA 3F9RA 1FDWA 3Q72A 3WJ2A 2UZ1A 1E5LA 4AM8A 2AI1A 2UVPA 1M8KA 2PD4A 3CT4A 3QOYA 4Y3UA 1FYDA 5FBHA 5JSKA 5BURA 2WUVA 4P34A 3TZ6A 2ZRFA 3PTAA 1DUVG 3FB1A 5FOXA 5KYNA 4F96A 1NRXA 2QMEA 3HN2A 4H7JA 3L79A 4R3UC 1MRSA 2B20A 3OZBA 4FEEA 1TF7A 1E0JA 4MRMB 4MW6A 2EJBA 4YQZA 4B73A 3SFTA 4OXIA 1R12A 2VUSA 1OFGA 1N5KA 1PFGA 1SUSA 2M2IA 2X40A 2WU1A 1B6TA 3N8DA 1HFWA 1QC5B 2IELA 3GZ4A 2RHLA 2WA2A 5HRUA 2ZAMA 1B7GO 4YUVA 3KPJA 2H7CA 1Y5NA 2FP4B 1GWNA 3PV0A 1N92A 2PZFA 1NN5A 1CUGA 1AHIA 3SIXA 3B5JA 2GH1A 2GZAA 3QU7A 4R6WA 4ME6A 4UVHA 5ECWA 4FYYA 4WJZA 2VHZA 5DWQA 1N75A 3TXXA 3WMRA 2OG2A 1FUYB 4IIJA 3N3AC 1NLYA 1IIBA 1TFUA 4QHSA 3WGHA 1EVEA 4G5SA 3NTRA 2J9FB 2QZSA 1VPDA 1N6OA 2GXUA 4I5EA 4IP0A 4PLHA 3J81k 4CMJA 3LO8A 5K4AA 2GBPA 3JVEA 1IXYA 5SZIA 4EB8A 2ZIUB 4NDZA 5GONF 2G5CA 5TSDA 4FXOA 2BGIA 5AW5A 4TMFA 4X20A 1KEVA 2C2YA 5ALVA 5ADWA 1QVRA 1ESEA 2P7HA 2HO5A 1XZFA 4LPSA 4IIDA 1RNLA 2H1HA 1A72A 2X8BA 3G85A 3V80A 4BFLA 3WQBA 3H42B 1WSAA 2O0LA 4U5QA 2OFFA 5KZMB 1E9VA 5DOVA 3FIJA 2RHJA 4YPOA 1QIDA 3N76A 5ALJA 1ADBA 2HDWA 4YT2A 3ICOA 2XMRA 2Q28A 3TOXA 1PFKA 1BU5A 2JFBA 5AK5A 2CD9A 4QXPA 3UAXA 2HA5A 3DT8A 2FZKA 1NAHA 3SSOA 1JR3E 3GOQA 4KQJA 4N39A 5T7BA 4XJXA 1QU2A 1M7GA 3CHYA 4BP3A 1ZR2A 1H69A 2ZRKA 2NT3A 4AW9A 2A6PA 4G37A 621PA 5JLJA 4BO4A 3ZWPA 1DIOB 1R6UA 2XV1A 1JDBC 4D3ZA 4KSBA 4RA6A 4EYSA 3BQNB 3FTCA 3PFGA 4CM7A 3HMKA 2XTJA 5BW5A 1NVAA 5M04A 5DIFA 1NAIA 6PFKA 4F5ZA 1BEEA 3WHKA 3LQQA 4AJPA 3WLKX 3G8CA 2O48X 3E8MA 4MRRA 4B2YA 2X8WA 4MYHA 4LV8B 4JC5A 4WOBA 2Q4BA 1XEWX 1ZZEA 3G89A 3QLUC 1ZBQA 4WEQA 4YFVA 3UXMA 3ZWXA 1G5FA 1GUZA 1ODCA 1GIAA 1YQTA 2IYVA 3H2HA 3OURA 4LXQA 5DEIA 3WIOA 3CA8A 2ZM6B 3O90A 3OHSX 3ORHA 3ZZTA 3VDRA 4DQ0A 3O4HA 3U81A 2P41A 3A6FA 3LT2A 1C30A 3NGMA 4EP1A 4R8LA 3PNVA 4CEJA 3UM9A 1JKMA 2DT5A 2QMOA 4I6JA 4ASUA 2G1UA 3QU9A 4HDMB 2ORVA 5IX8A 1BNCA 1KRHA 2BISA 2Z9DA 3D64A 4QOGA 3UJ7A 1WKVA 4DDMA 1K1EA 1YB6A 3A2MA 3LQ2A 4DQLA 4NS4A 2PL9A 2FZ4A 1EH5A 3UICA 1V2GA 2H29A 1MX9A 2B92A 2O06A 2R86A 3RS3A 4MUJA 3RS2A 3WGUA 4OX9B 2EERA 1IRXA 3HXMA 4KH1A 2VRWA 3A4IA 1WPXA 4GLBA 5JFOA 1QZUA 2GDZA 2QT0A 3O9MA 2G1AA 4O4HB 2HA0A 4WECA 2AT1A 3RBZA 2GBGA 1FP4A 1M6WA 2Z1DA 4PZCA 3SJAA 3AY6A 4AP6A 4LTDA 1NMXA 1T2DA 4UAGA 2PDAA 3M6FA 4O0LA 3EPJA 1IJEA 2O4CA 2PJUA 4IRMA 2J87A 2PSHA 3B9PA 3IPAA 3D8NA 4I3FA 1ESCA 1JTVA 1USVA 2WMYA 3A58B 5CXSA 1V9SA 4YRFA 5JH7B 4BV9A 3WGIA 3ZVKA 1DOAA 4J0QA 1C14A 4MRVA 1WEKA 1PT6A 2GKSA 2C3MA 4HCJA 4UE2A 4BQOA 4WGFA 1B1CA 2W2LD 1N32B 3W3ZB 1PQ4A 2RI0A 2IS1A 3L40A 3DEYX 5EXDA 1U63A 1QQ5A 4UHFA 3VVBA 4WX2B 3D31A 1FOEB 3WR5A 3L7DA 2GN8A 5IK2A 1KJQA 3ETLA 3PQCA 4KGXA 4MITA 4PPQA 2XF8A 3NBYC 2ATCA 4DARA 5I4CA 4IGAA 1M0EA 1V2HE 1GA6A 4NEGA 4R1LA 5CGZA 3PXEA 4BJ1A 3R4VA 2HXSA 1C1HA 3B3FA 3EN0A 4KE7A 4NJMA 5F2OA 3W78A 2OUIA 4IINA 5JS1A 2H54A 3GRFA 4QYIA 2WHPB 4CIVA 4FOLA 4CM8B 1V45E 3GIDA 3SD7A 5C0OE 1HC7A 1A5BB 1NNLA 1ZCJA 1KJYA 5EIWA 3M33A 1Z39A 5DLEA 1PUIA 4X6LA 2PUDA 2G28A 3COPA 4MUKA 1I9GA 1BFUA 4HDRB 4ETIA 1M8FA 3MIZA 4L73A 2C7BA 3VPSA 3REQB 3UAYA 4C88A 5JJCA 1WLYA 1NPYA 4HYYA 5MN6A 1WUJS 2GZMA 1KARA 4GRIA 5DCLA 5JS2A 1CEQA 2QD2A 3K6JA 1U80A 3H7IA 4HDSA 3F90A 3SEZA 3MGAA 4N18A 3TTWA 1WPQA 1OIWA 2OHFA 4YT5A 4CL3A 1UFRA 3V5NA 3L6UA 3D2CA 2N9UA 4LJ7A 1OXBB 1Z63A 5B4VA 3JAKB 4ZN6A 4DYDA 4KQFA 1U2EA 2EGUA 2X22A 2C96A 3BXEA 3N53A 4EG6A 5IAJA 3TNDA 1U2DC 1SZJG 1FXSA 4G6ZA 4JVLA 2XVYA 3LOUA 3M1AA 2IUYA 3HU3A 3GN2A 3ITDA 1PJLA 2MU1A 4NYIQ 1C8KA 5I7WA 4MUGA 2XUDA 4UHKA 3OCUA 2BGGA 2GHRA 3ZGYA 1LPSA 3VC1A 3A2KA 2BGNA 3ZLVA 1VE3A 1WABA 2NW6A 1J5EB 4F21A 1S5PA 4U1RA 3G2HA 1OFIA 1JFFA 1OLSB 4K1XA 1L1RA 1JA1A 1L4BA 3DOOA 5AJVB 2HDNB 1T0HB 2R5FA 5KOJB 1CR6A 1XJWA 2BZGA 3JPWA 3WFIA 4C08A 3A36A 1N0UA 5BN4B 5JW6A 5IDWA 2FZ5A 1T2UA 2DKOA 3WI7A 2ZUSA 1A7JA 2CNLA 1EX9A 5JH7F 2Q1WA 3KQTA 4FWIB 3UJNA 3QE4A 3KQYA 2A0XA 5K3CA 1FFYA 3TL3A 3PXCX 3HN6A 4FR0A 3IP3A 4XFDA 2XYPA 3B6KA 2QN2A 3H99A 2O3RA 2DE0X 3AJ8A 4CUKA 4ESHA 2HU2A 1G6KA 1Z75A 1CRWG 1F8GA 5FBQB 4HD8A 1E4EA 3DEZA 2R11A 4PHHA 5B3AA 4DLAA 5T67A 5EJEA 1R5OA 2FK8A 4RJ2A 1Y7IA 3OI7A 1N3YA 1C9EA 4RHXA 1AXEA 2A0KA 3AX6A 5TMBA 3P5BA 4NCAA 3DBIA 1AG9A 3ZE6A 5SY9A 5COAA 2OHIA 2PYIA 1LV7A 1B14A 3HGTA 2IY8A 2I7CA 3L8YA 5MHTA 1M34B 5BUCA 3P9YA 1EP3B 2JIQA 4WW0A 4TS4A 1PFQA 5H82A 4ADSG 2BMEA 1B0UA 1PN3A 3MMSA 3V1NA 2Y2VA 3ORSA 2JFOA 2ZRPA 3CH5A 3TUJC 5KNBD 2FLWA 4XWWA 3VNUA 1Q1ZA 5CM8B 2CE2X 1FXUA 3DG9A 2O7VA 1XTRA 4ZGGA 5FR1A 5K09A 5K3OA 1V6SA 3EFEA 1KPGA 3M6AA 3CEPB 1SCIA 3AIIA 1CPYA 1A50B 2JFGA 4RF2A 5KVQA 1JLRA 4F3KA 2PR2A 1E7WA 4R41A 4AN1A 1JG1A 3VI4B 3NNDA 2LGJA 3M5CA 2JJQA 4I1IA 3CEAA 1ZMBA 5LQUA 1DHTA 1KZYC 1XU4A 4FKMA 1YKGA 3PRHA 5CXQA 3P0RA 3H2ZA 6REQB 3TJZA 5AW0A 4ZVQA 3NORA 1I9CA 3NEPX 4X7RA 5EJMA 5DP1A 3R4CA 2GLTA 3E2IA 1GPLA 3KZOA 3COVA 3OCVA 4CMHA 1R2QA 2RJNA 5K8TA 3ZLJA 1MB9A 1G9TA 4KWHA 1S2NA 2NO4A 2CVPA 3AY3A 2JGMA 5K8VA 4YCAA 4X5OA 3UAZA 1JSCA 2KHZA 2E49A 3MJDA 2H0AA 1F9EA 1KZ9A 3FI9A 4EUNA 3HDJA 1JJVA 3AINA 1QE0A 4FSHA 4KVZA 3THYA 4OIMA 2XQVA 3DEHA 5EE0A 2COKA 1Q7BA 3CSDA 3FPKA 2ZJ0A 2XUGA 1YS6A 4AKSA 4H7PA 3PTLA 2SBTA 4G2NA 1ADYA 4KL8S 2PE5A 4X1YB 4XSHA 2Z43A 5E6RB 3DKRA 5EMJA 3LVFO 2C5HA 4DMKA 1VI5A 1LPBB 3CLTD 2PUEA 2WAAA 4MWCA 4YI3A 2D13A 4EHIA 1L8OA 4Z53A 1UMBA 3O0DA 2FMXA 2KBFA 1JHAA 1QKKA 2OFWA 3CVJA 4Y2VA 4Y7CA 3N9IA 3E03A 3V1TC 4BNLA 5JAPA 4K2HA 1KZ6A 3V4SA 3LCVB 3AEUB 3DM5A 1M1YB 2LVBA 2H06A 3IT0A 2FSGA 2MINA 3N8HA 3C24A 4LXYA 5ANRB 4MROA 4KAJA 2ZIFA 1JX6A 4DBZA 1JXQA 3MWEA 1V11B 1IXSB 2FEAA 2EG9A 2GCOB 2IU4A 2FKAA 3IMKA 2JCSA 2XA2A 3DYIA 3NC0C 1I1NA 3TNLA 4B3BA 3LTNC 2CW5A 5LDDC 5BMVB 3K2BA 3AQ4A 3A1DA 3BK1A 1NJ6A 3V2GA 4X8MA 1A04A 4KGZA 4P3NA 4XX0B 2FNAA 3M5WA 4H4DA 2YYZA 4MV6A 1TFRA 2QS9A 1CZKA 3ID6C 4D57A 3BFJA 3MGCA 5G3YA 3TZEA 2X4GA 2VL7A 2K2QB 3EEQA 3HB4X 3HZHA 3QHAA 4K9RA 3E70C 3RS5A 1Y4UA 1B4DA 1VCOA 2OP1A 1ACJA 2IZ5A 2QK4A 3EPLA 1Z0ZA 3LA8A 3U48A 2ZSDA 2I34A 2DTDA 2HY7A 1E0DA 2QN9A 4GPD1 4FLMA 3ZGLA 1OPXA 3F6BX 3K6SB 2PMWB 3O3OB 4Z9FA 4QGFA 5BWCA 4ETMA 1E60A 2VEOA 3BERA 1E9CA 3EJ6A 3Q7SA 1G3UA 5L3QB 5H8WA 1DOZA 2IW1A 3IVCA 4KYTA 4Q7QA 4IDOA 3OBBA 5CDTA 3HYRA 4CNQA 3WYEA 1A5SB 3OECA 1ACMA 1EE9A 1N2EA 2IXFA 2VIIA 3T38A 1RRFA 3D3WA 4OH1A 1O6BA 1ORWA 2PFSA 3KYDA 3OE7A 4MS4A 4UQOA 3WOVA 1LK5A 2Q9BA 1MB3A 4M1QA 3DTYA 1FEZA 4IR7A 3ZE0B 4E2WA 1E96A 4P1ZA 1LXCA 1Q95A 3HJBA 2HZ7A 3U17A 2J1LA 4XR4A 4ZYYA 1P2BA 1C50A 4TWJA 5B1EA 2ZT5A 2NSLA 4LWPA 2PCLA 3LYAA 4PPYA 4RFVA 1W2GA 3AY0A 4KXQA 1REQB 1MPXA 2C29D 4AF8A 4N0EA 3K9LA 4JB2A 4MO2A 3TRIA 1YZGA 2QAJA 5AXDA 3WKAA 4ER5A 4NF2A 1D1SA 4TTSA 2X4LA 3ZYZA 3BTUA 1L8QA 1XDDA 2GRUA 3B89A 1QIMA 4N5MA 1DBQA 3RFUA 1L2TA 1UP6A 2C97A 2JLXA 1XZIA 1FDIA 4Y6LA 3JYOA 4NQZA 1SVIA 3CKMA 3DNMA 1PFUA 2ZVDA 1H5UA 2GZSA 2VHXA 4TL9A 3O73A 5K2OA 4KZKA 1PS9A 3PUYA 3DFIA 4KXFB 2JIPA 3O91A 1IEQA 3QX3A 2QPLA 1FVHA 3THWA 4GFDA 3LL4A 4FC7A 1IE3A 1FNMA 3D1LA 1RWMA 1XZKA 2XCUA 4GC9A 2WWIA 3NJ4A 4MLCA 4MWEA 2NLOA 2QW0X 3OFJA 5GVSA 2YWRA 2ZBUA 2AFIA 4HGQA 1Z7YA 4I50A 3QIVA 2H31A 4BVLA 2QTHA 5K0NA 4P33A 3GDOA 4MS1B 3GR6A 3LT5A 1CQPA 3GFSA 3DBOB 1QYIA 3MINA 5HZGA 4Z3OA 3L8CA 3NBKA 4RADA 1IOWA 1L5VA 2WIGA 3BKWA 3EDRA 4BOYA 3VDXA 5BMVF 5K6RA 2A0YA 3S2GA 1U9JA 4RVDA 2HA2A 3DO8A 3CEJA 3M1LA 1EUZA 3AHCA 1Z5UA 2UUOA 1VL6A 1ZL0A 3D2LA 4UREA 2WIKA 5T41A 1FLDA 1YS4A 2HRQA 2P5UA 4D96A 1DAKA 4WCDA 2VWHA 1VFNA 3KWFA 3ZGXA 4YP5A 5EZQA 2GN4A 5J59A 3ZBQA 5J43A 4P2BA 4C0JA 4M0KA 3DBRA 2ZU0C 4ML3A 3FETA 3ODPA 5EY5B 3VPHA 3HDYA 3W3AH 1G98A 4K5QA 5EMLA 3ZR4B 2HQSA 4L85A 1JG4A 3UMGA 2JKZA 3MTQA 3CUUA 4FFWA 3S2ZA 5JU6A 1IUKA 3GFQA 3IT2A 3MLBA 3SC3A 1NNI1 4TRNA 5KTOA 4AB1A 4G0XA 2LKDA 1N9KA 2G9NA 4AIIA 2I2WA 3DA8A 4BX0A 4G9GA 1RACA 2AB0A 1C0LA 1LVHA 5FCDA 2I62A 3IKLA 1K6IA 2W2MA 3PPXA 5TQJA 3ETHA 1QF9A 3R6LA 2JFWA 4EGAA 5C8YA 2Q1TA 4EG8A 2BFWA 4OI2A 4DC0A 4GS5A 3TDNA 1DBSA 2Y27A 1BGXT 3CJQA 3Q3CA 2PRYA 1RZ3A 1GO2A 1T1EA 4DMGA 5H9VA 3UXYA 5HTOA 1CRQA 1NVMB 1UBUS 2GJ8A 3DPUA 2IGBA 3GEEA 2QVLA 1C1YA 2ZYHA 3LBNA 3GMIA 4PNPA 5BWBA 4GMXA 3LZDA 4MB6A 4BASA 4XQ9A 4PZLA 1X3LA 4L22A 2NXJA 3PUXA 3KKKA 3TE6A 2H2AA 3DBLB 1LQ2A 1U3UA 5JAHA 2PSEA 5J9FA 2X3YA 3T7AA 1Z8HA 5FTJA 2ZREA 1YF3A 1CVLA 3BA1A 1HLDA 1MQ9A 1PJSA 4JJKA 4DMRA 5AW2A 2N47A 1FK8A 1RWXA 3LX8A 3P9RA 4ZXFA 4BVAA 4CQMD 2Y92A 2WR8A 1VGVA 5EPUA 2N1MA 4RQBA 2Q49A 1K63A 4B4DA 1Z4LA 3KPWA 1E5QA 2P75A 1L4NA 3FDFA 1TMYA 1JDPA 1NUAA 2XD9A 1QIHA 1WPRA 4LJRA 1OU0A 2XCIA 2X2EA 4ZVMA 3VSBA 2BMFA 1X1BA 3ZVMA 4LGMA 4TLBA 3MS4A 3NR2A 1FTWA 1OE0A 3ACBA 3DE7X 3NXSA 3Q2KA 3VKVA 2JLUA 1ZLXA 4HS9A 5ALDA 3KTAB 4HGYA 9ATCA 5KTMA 4H1UA 3MTBA 3A8TA 4X24A 1OXSC 1N5OX 2ODBA 1XEAA 4HAWA 1HDEA 4GLFA 4CVNA 5JMTA 1H9BA 4TKLA 3KQPA 1BD3A 2YIJA 4Z2AA 1WU8A 1MOQA 4QHYA 4S1VA 3S40A 4F6RB 4DJJA 1NOKA 3BS4A 1TC1A 4GMDA 4Y9RA 4NDNE 1GKUB 1P8JA 4KFRA 4C4YA 1VE5A 3A25A 3G0CA 3CVWA 2J08A 2QJFA 3LK6A 5CT4A 5ALUA 3VKFA 5UKDA 2OV1A 2FXIA 4YJGA 3GJQA 1Q44A 5JXHA 3B1VA 4HAUA 3T7RA 1X1QA 1KMQA 1GY8A 4UPEA 1QF6A 3B1FA 2VJPA 3D7KA 4LDAA 3ROMA 1BXGA 2BAGA 1KS9A 1CWUA 3F1LA 3TRKA 1X3SA 2E82A 2QVYX 4A91A 2PTHA 3DV0B 4HHEA 1PEAA 4AZ0B 4WESA 2Q46A 3H8JA 2JNWA 1PEDA 2ODTX 4L6AA 2HNBA 1YJBA 5CCBA 1GNLA 1ZM7A 3QU2A 4UD2A 3WGOA 1GUFA 2ZR7A 3F46A 4NABA 3DLHA 3WICA 2CJWB 2DJIA 3LUHA 3Q88A 1ISMA 4P53A 1C3JA 1RP7A 2FSSA 2PKYX 4EUFA 3W5VA 4JQSA 1X1SA 3ANTA 3G88A 3WG9A 3O2JA 4JBXA 1DQSA 1FDTA 1Z17A 4FP9A 1E0AA 2L82A 2WSLA 4H0NA 4E2XA 3EMBA 2WILA 4W6ZA 1E3QA 3RGGA 3QG5A 4RKRA 5DGXA 1EJBA 1U8YA 3V9AA 4D3FA 1JGTA 1BVUA 2ZB3A 1BQ3A 2ZB4A 3EZ6A 5CX1A 3W9SA 3KS9A 4TXJA 4B35A 1TMKA 4RABA 1DAOA 3EQZA 4BFTA 2H4HA 2ZIVB 1SXIA 1ZRHA 1YB4A 3ZJYA 3B78A 1C0KA 1QH8A 3C3AA 3LGXA 3FDJA 4HR7A 3MHTA 1NYQA 1E79A 1G3QA 1L7NA 5TT0A 5TXGA 4ARZB 1Q50A 2E4UA 3GRZA 4UDOA 3ZBTA 1D9XA 4EUEA 4MIKA 2LZ0A 1U28C 1Y8CA 4R5MA 3LT1A 4OLFA 1VRWA 1D3AA 3TR5A 4C03A 4DTIA 1GLNA 2ECPA 1RTKA 5AI6A 3W77A 3NBFA 4NDAA 2PKQO 3U7GA 4GOLD 1QYRA 4KQ1A 1USGA 3IEPA 3OCZA 1C9DB 1GZ4A 5EXXA 2QGFA 1C9MA 4GNRA 2RAUA 4EX6A 5IMBA 5AICA 3FRHA 5LDHA 2O5CA 1NX6A 3B1YA 5IC5A 2CC2A 1T5SA 1HG1A 2XIQA 2ZB7A 1M5UA 1L7PA 3HJGA 2YV3A 4OV6B 4CHGA 6CHYA 1NA5A 5B58C 3Q9NA 4UULA 3WGKA 2UYYA 3OOEA 3TEMA 2R47A 4W9MC 2YNMD 1PR4A 2ZI5A 4G89A 2X9NA 5KYYB 1TDJA 2CXTA 3I9OA 4JR0A 4H7FA 1I3LA 4H16A 4OQPA 2JG3A 4F06A 4WPGA 1L5GB 4C5AA 1BTOA 4ZAZA 3SX0A 1FX0B 1Y4AE 2ZZKA 1XD2B 4V0NA 2QE6A 3QEOA 4FDTA 2AR7A 1NYLA 3I12A 3GYBA 4OFWA 4XIYA 1Y7PA 2QX4A 2V5UA 1G64A 4JASB 2Z98A 3SC4A 2DPLA 5BRJA 3MMZA 3PEFA 3ZE1B 4ZGWA 3PRYA 1SQ0A 1N2GA 3OQ1A 4QJBA 2F43A 2PZMA 3R6DA 3A1UA 2E55A 3DHEA 3RBAA 2BTQA 3RUFA 2I91A 1UJ2A 1JBEA 4IO0A 1KO4A 2Q2WA 5DJ5A 1OB2A 3O1HB 1JALA 5EHXA 2Q9UA 4A0FA 2WWHA 3U7FB 3GB9A 2WIBA 3D0OA 1AHPA 3T54A 4ZHQB 1B8VA 5BQ5A 2K7FA 3K71B 4Q01A 3J80A 3KL2A 3F78A 4GZ5A 2BM9A 3ZGVA 1U2ZA 1WM1A 3I1JA 1GPMA 3IEKA 1PWZA 5FNZA 4KV7A 4YC7A 4EMUA 5AOBA 1HA3A 2ZRAA 5E6UB 3KLMX 4EX7A 2ETXA 3DJFA 4NV3A 3G13A 5FLYA 4XYMA 2CZQA 2CMFA 3V6LA 5DX0A 1U3DA 4D3YA 4ZJPA 2ATXA 3ZDBA 4MA4A 1XTIA 2G06A 5AHXA 1B8PA 3PHHA 2AOUB 3CLVA 4EG5A 1KQFA 1BX1A 4RQAA 1AUQA 4IV0A 1XC7A 2XYGA 3P0JA 2XWSA 3CNEA 1WSWA 4Q4LA 1CR0A 2P6NA 3ZU6A 1XWIA 3COJA 4PSUA 5AVZA 2CZGA 3PCRB 1N25A 2AEFA 8ABPA 2VPYA 3DZCA 2Z3WA 3WSTA 3P71T 1PJ8A 3C14C 3FGNA 5DNAA 4OI1A 3IA2A 1NFQA 3IUMA 4OUDA 3DEJA 3H11B 1IHPA 1YH3A 3UA3A 3UKDA 4GF5A 2WZCA 4RTRA 1UMCB 2P78A 3KP1A 1THGA 4X1IA 5U1PA 1YQUA 4V0MA 2LD4A 4KODA 1CEXA 1O6FA 3QE0A 3LBFA 4OQFA 2ZUBA 4AO6A 4WY8A 2XADA 1YZFA 4GI3A 7GPBA 1IHUA 2PGOA 2WT9A 3AB8A 1VMAA 3JASA 4HLQB 5HG0A 5LP6B 3FVVA 1ZUD1 3GT0A 3PGMA 4O2LA 4S1WA 4Q12A 5HRCA 3DH0A 4QDZA 2EC5A 3I9LA 2ZRLA 4WOPA 4L28A 3I2GA 1X1TA 3SX4A 4Z1OA 4B3RB 1XKXA 1Z74A 3DKPA 1G8FA 3OUZA 4OF4A 1QOQB 4R1NA 3NWPA 4Z1MA 1OXTA 4H60A 1QQAA 1N5RA 1QLJA 1Z0AA 3HI4A 4C1NA 3GLFA 2LW7A 3BFPA 3MMNA 1JQBA 1R6AA 1RYFA 4TMTA 4CCWA 1W36C 3U09A 2D0IA 2FMTA 2NT4A 2QRPA 4N5HX 2IDMA 5B2ZA 3SIPA 2AZMA 3B3QA 4PZUA 5JWRA 4RC9A 3WIVA 2X0NA 1NXOA 5FUYA 1OU4A 4FGSA 4IMPA 3DDSA 2R8OA 2YHIB 3LLSA 3AG5A 2V1UA 2I80A 3U4IA 4MTCA 1FU4A 3F4BA 2JIMA 2X1MA 3VSAA 4DW8A 2IUSA 2AFHA 2IZ6A 4HNRA 1C9KA 4IPTA 3W2EA 2C03A 1W73A 1KP9A 2C04A 2QUKA 3KYJB 2QAGB 2WVJA 3EG9B 4RFSA 3EEIA 2XCQA 4O0MA 2FW1A 4NFLA 2WM8A 2WJVA 4MUYA 2HSEA 4ZHQF 2AH5A 1RRPA 2G09A 3KJHA 1JIXA 4K6GA 4MVCA 5JH7A 1JPUA 5C5CA 2ZSFA 2WTUA 1O58A 3DTVA 1ODJA 2OENG 3EVNA 3QKWA 1O0SA 1PSDA 1RAIA 2EJWA 1Z29A 1VPLA 2BLNA 3GV0A 4TROA 4ZO4A 2NXEA 3WHLA 4I9NA 2VQFB 4C4TA 2G63A 4LMRA 5BYAA 3MWDA 4RK6A 4AY2A 1T1SA 4H7EA 4KAAA 1NATA 4RVFA 3EXEA 4ZT7A 5FPQA 2VEDA 3SJBA 3DKKA 5CUQA 3ILHA 4BNGA 4F3RA 3SMQA 5CVTA 1U2SA 2VZ9A 5JECA 2IPXA 3Q3IA 1TVCA 4U3JA 1QR2A 1TEXA 3MOIA 4EZIA 4Z4FA 2WP0A 1CY2A 3PCTA 5K0BA 1C0PA 2BE9A 5HW0A 3LVQE 1PGJA 5TS3A 3I5YA 1BDHA 5KSPA 1J97A 3LBYA 1WV0A 5B55A 1NXQA 1I2CA 4QTYA 5JANA 5H16A 4UNRA 1RADA 4L57A 1S3IA 3DWFA 2VF2A 3IPXA 1FUEA 3Q9UA 4HRXA 4V0SA 4QTZA 5F64A 5GJVC 4RHEA 1JG3A 4A26A 4DWJA 3NTUA 2H1CA 3HJAA 3K09A 4LJSA 1OLXB 1LTHR 2VNJA 4J1TA 3KG2A 2Z83A 4R8SA 1NLZA 2O0MA 1NW5A 4GI2A 4F4HA 5LP6F 1DARA 1DDIA 1L4YA 1RQ7A 2QKYA 4M1KA 3KSMA 3OKCA 5ENDA 3G0HA 3CLKA 5SZJA 1Q83A 2ZQYA 3MRXA 2HJ9A 3S81A 4JMPA 1MAHA 1KWKA 1E58A 1G7TA 4HMPA 4PYIA 1ARZA 1NC3A 3GNLA 3PUIA 5AYVA 4JXXA 5A0TA 4RTLA 1PK7A 2FEXA 4CKBB 4PCUA 4DV2B 4FBLA 5EMHA 3HZRA 3ONVA 4OU5A 5K3SA 1DJLA 1BEUB 3MEQA 2AKEA 1Z6QA 3EH2A 2NUPB 1XEXB 1H1LA 2IOFA 1DIGA 4B3HA 2AC4A 2TS1A 1USKA 5JAQA 3H2BA 4MV5A 2WIAA 2JKYA 4YJKA 5F73A 4B6EA 2QWXA 3FJYA 4MW4A 3EGXA 4QFDA 2CFCA 4B2LA 2PU7A 1RYZA 5A4JA 1GADO 2V03A 1NMSA 4CU2A 3FSGD 2RH9B 4H08A 4INAA 4PFJA 2IS4A 1BXKA 2FEMA 3EXIB 1G0OA 1ZOOA 1W44A 2AN1A 2BM8A 3HCPA 4C6RA 3V34A 4OQLA 3K5HA 5G0TA 3WTCA 1G21A 1ZI6A 3T6KA 1AKUA 3K9GA 2EX1A 3O21A 4RD0A 3ROTA 3WKCA 5ALHA 4CM3A 4FFRA 4IDNA 5GADl 2Q8QA 4EWLA 3L49A 4XI9A 2Q6VA 4MULA 3F9IA 1VKJA 1ZCBA 2QW8A 4L0MA 4YMTA 1AMUA 4BE7B 1GGMA 2ADOA 1O94C 4FR2A 4Q9HA 5B6JA 1TKBA 2O6LA 2ZRGA 5BNZA 5LOVA 2YY7A 3V1UA 2OQRA 3DW1X 4ZXPA 1GZ5A 1JYSA 4IZIA 1AIPA 3T0FA 3PNQA 1T36B 3HNRA 2HI0A 2Q5EA 5CX4A 4AZWA 3R76A 2Y2UA 3ENKA 4PWYA 3ZV5A 2Q29A 3R74A 5DSTA 3CRZA 1E4VA 3GRPA 5K01A 1TEVA 1XVAA 1L7QA 2P5YA 2LV8A 4C2BA 3NIWA 4M1ZA 2Z5LA 1WB9A 1ZD9A 1OWMA 4FWBA 2CVFA 1W59A 2HOQA 3ORRA 1SVOA 4IS2A 4E5NA 3CCCA 2HV9A 4KE9A 4YACA 3VDQA 4Q1VA 4BRWA 3Q2OA 4C0AC 3KIPA 1EGAA 1C5KA 3GRCA 1JJAA 1SZPA 1M6VA 3K09C 5FO0A 5I47A 1BMQA 1QGAA 4J1TC 4KQXA 4OCZA 1LTKA 4EUHA 3CB4A 2TMYA 4O4IA 2CGEA 4NYMR 5ECDA 2QU7A 2HXYA 2ZB2A 4FE4A 2AV6A 1KEZA 4IQFA 4KWTA 2J3JA 4L4UA 1F2UA 4EITA 4YB8A 5HR5A 1J56A 4B3CA 4E08A 2B83A 3IIIA 4YAGA 1BCSB 3WWZA 1C1DB 1HYBA 3DHYA 3E53A 3GRUA 3H4VA 4XVHA 2DWPA 3OZSA 4YMSA 4BO9A 4MJLA 4IMRA 2WWTA 5JVDB 4YRNA 4IH1A 3DNPA 5AKJA 2SCUA 1ZLYA 2IHJA 4QIHA 5BWLA 3OMLA 1JWBB 4YV2A 2V9ZA 2IU0A 1T8YA 2V6BA 1U7WA 2DF8A 1LX7A 4CLRB 4B3GA 3BK2A 5IS2A 3EVBA 5EWMB 1LSOA 3HKBB 3KWJA 4ND7A 3TD9A 1K75A 5LMNB 4GECA 3AHIA 4F3CA 1YJXA 3HRKA 4BNTA 4EHLA 5ADVA 1ZGJA 2AQKA 4PXSA 4ZO7A 2KLHA 2C3UA 3RVKA 3RJZA 4P7FA 1E3SA 4QLAA 3AM5A 4UTRA 3BH6A 2R6R1 3KKZA 5FQNA 1QGYA 3Q0EA 3PLRA 1DT3A 3A6PC 3IJRA 5M2QA 1V1JA 2GPJA 3ZCXA 3IVGA 1QNFA 5KHAA 2FYTA 4Y0VA 2J5XA 5J5AA 4DJTA 3N3BC 5D2CA 5B1DA 4RTQA 2I78A 1NQXA 1ONOA 2PD3A 2XRYA 3U7IA 4FK8A 3V32A 4AULA 3QEAZ 4I1RA 4Z9YA 3HCCA 3ICPA 5HCIA 3T4PA 1Y1RA 4HLCA 2Q1SA 2JJYA 2CHQA 2IXDA 4B81A 4JC0A 2DPYA 4E11A 1DV1A 4OAQA 1DNPA 1ZUNB 1LNZA 2XUAA 4YUXA 5CDYA 2OBNA 3C3CA 1KFEB 1KSFX 3RK1A 3U5ZB 4P38A 1KMIY 1ZQ1A 2VJQA 3HCAA 3IC5A 3BRQA 4OA5A 4UCQA 2C4KA 4WLOA 5AUQA 3ZC3A 5A06A 2BOVA 2HV8A 1U3WA 5JMPA 1M5RA 1C4KA 1TIPA 2BEWB 2FMUA 2XQJA 3ACDA 5DTQA 1S8FA 4U9IS 5A9RA 1ID8A 2GPSA 2KQUA 1UIRA 2REOA 3CBQA 4HATA 3MG9A 4UNQA 5F5LA 3Q8KA 1HNWB 1D1PA 3BWDD 4LXXA 2F90A 5TMDA 1C41A 3AHHA 4K9LA 4QYSA 3ET5A 1A9RA 5FLKA 3RTAA 5G1PA 1EEXB 3TLMA 4V1CB 2HWYA 4YXFA 2KMLA 4BIMA 4OTZA 4QOHA 5JDIA 4PM4A 1CQZA 2P1RA 2H2IA 2QTTA 3WWOA 3SJCA 3SJ7A 2PUWA 2E4YA 4MDHA 4X93A 2X9QA 3G9UA 3KYCB 1DRKA 1EDDA 1TE2A 3ONFA 2EZ8A 4DADA 4RESA 4WT7A 2ZRDA 1XCBA 1U1GA 2O54A 1DVRA 2XMSA 3IGFA 4XVCA 1O9HA 1FLAA 1NF3A 2GK4A 4H4EA 3S55A 2Q1UA 3OCJA 1TZ2A 1DC7A 4QPPA 4OMDA 1H8ED 1II8A 1N6RA 1RYHA 4AYXA 4YAIA 3QYAA 4MINA 2F1KA 1WXGA 2ZBGA 3DL7A 3Q1LA 4ZEXA 2Y05A 1K2VN 1M1UA 4G65A 4XRRA 4GUAA 5K4HA 3GG9A 3ZNNA 5JVDF 4Z51A 7ADHA 2MSEB 4C7JA 5C7LO 1KDZA 1NJFA 2HMUA 3IESA 1JQEA 4RXUA 2NYAA 4UM8B 8ATCA 2C9YA 4DR6B 2AEEA 5E7IA 3AI2A 1QHNA 1FA9A 3OG9A 2CN1A 2I03A 2M6RA 4S24A 4WHMA 1HE4A 4LZOA 2R751 4HDNB 4MKRA 3I73A 4JX8A 4MWSA 4MYTA 4D80A 1WXXA 1QORA 1U9IA 2MR6A 3IUYA 5HWSA 3GGCA</