4KFRA

Structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with sulfate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
207
structure length
204
Chain Sequence
b'NPDDIVVLVGRKKSGKSYLIKHYFIPVLKAHKISYIIDDHNLGSEYSKFGYNATSLSDIVSKQYVVVYDRAKNDDFFEKLWQASKLHSKKYGTTVLIIDEAYYHFKYKQKVTPAIDEALHANRHAGLGLILSTQRVYDLMPIVYKQADLIIMFYTREPNELRWISKYISAEAAEKVKTLKQYHFLIYDVNSQTIKIHKPILEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome packaging NTPase B204
molecule tags Hydrolase
source organism Sulfolobus turreted icosahedral virus 2
publication title The Structure of the NTPase That Powers DNA Packaging into Sulfolobus Turreted Icosahedral Virus 2.
pubmed doi rcsb
total genus 63
structure length 204
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 3.-.-.-:
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kfrA00
4MRNA 4M1MA 3OE7D 5CYPA 4C0JA 3FKSA 4EAQA 2GRJA 3D3QA 1YU9A 1ONBA 4EJSB 3EXAA 2B8TA 3KJGA 3RC8A 1R0YA 2XAUA 2A5FA 1G8GA 1XD2A 2J46A 4GPTA 4BFZA 2FOLA 4D26A 2E87A 1U99A 3WNCA 1GG2A 3ASYA 1LF0A 5C1BA 4P4SA 1HYQA 3QI2A 3HU2A 4IOLA 1E9BA 1QHHB 1YE8A 2WJJA 4XWAA 3SN6A 4JVSB 1OE0A 3IGFA 2QG6A 1OB2A 4W5HA 4OI1A 2YVUA 2VHUA 3KX2A 4AWXA 1G17A 1KI1A 4EIWA 1XCPA 3DDCA 5AUNB 2DCUA 1P62B 1GL6A 5LPNA 3A37A 5CYOA 1K8RA 4TYPA 1Z6TA 2K5UA 3L8ZA 3K9LA 1N6PA 4LJ9A 4DUGA 3KQKA 3AF3A 3AVPA 2NZ8A 4HB3A 2XXAA 2WKRA 2J0VA 5JI2E 1VTKA 4EFNA 2C9OA 4PANA 5CM8B 2BDTA 4JKIA 4HLQB 2GJKA 3QPWA 3FB4A 2G1JA 2XOKA 2QORA 4B43A 4GMXA 4U5XA 1VG1A 1YR6A 5C46F 3CKLA 1AN0A 2O52A 5JECA 2D2FA 2ZRFA 4WOPA 1DVRA 1HV8A 3P32A 3QENA 1SVOA 4PO1A 2BBWA 5HZHA 4LHWA 5EE0A 4PHFA 4OI4A 2QMEA 3OIVA 5B57C 3LFUA 2C2HA 3BIFA 4DLZA 2YKGA 3Q8XB 4TZ6A 4RD3A 3IEVA 2OE2A 3LAWA 2ZITA 2QY9A 5K8LA 3EPJA 2CNWA 2BCJQ 1E9EA 3GFOA 4CT5A 2AFIE 3T61A 4XD7D 2O0KA 1R5NA 1GP2A 3X1XA 4CVNA 2C03A 4V0NA 5D3QA 1E3MA 4Q9IA 4TT3D 3P4YA 1ZU4A 1RC8A 4AKEA 1E0AA 1DELA 3PUVA 2WPDD 4B3FX 1W7AA 5HKKA 1CU1A 2OFXA 2CDNA 3THWA 1CR0A 1E2LA 2MSCB 1IJEA 2QTFA 1E2HA 5EE1A 2AK3A 2VP2A 1G41A 3U4QA 1OKKD 3F8TA 4LK2A 5KNDA 1XJCA 2PL3A 1S3SA 3QG1A 4UNPA 1WA5A 2XSZD 4M1TA 4C7OB 2UZIR 2ZTSA 1JEEA 1FNMA 3E5HA 3CX7A 3IQXA 2GZAA 1ZM4A 1PZNA 2W2XA 4IDHA 3EZ9A 1S96A 3RS7A 3ZZUA 2PJRA 3EPHA 2ZRLA 1OJLA 4AKHA 4L16A 1NRJB 1NVUQ 1OYYA 3AUYA 3WRYC 4A8JC 4BFVA 5EUMA 3ETLA 1E2PA 2JIZA 2BKUA 1GL9B 2OCYC 4FMDB 4QXAA 4WAUA 4J0QA 3ICEA 1SXJA 2G77B 4TYYA 2WWWA 4A2QA 3T1OA 5F9FA 4HAYA 4Z1MA 3QJYA 1Z06A 2YWHA 2FF7A 5FH9A 1DOAA 3SYKA 2FN4A 2JATA 3U7FB 1ZUHA 4ABYA 3U7HB 121PA 1GWNA 1GRQA 2ZEJA 3K09A 1Q3TA 2JEOA 4WZAE 2XB4A 4DCSA 1WXQA 4DLYA 1P2UA 4PC2A 5KDDA 1RRFA 1OFHA 1ESMA 2PEZA 4YMTA 4BQSA 1BMFA 1LV7A 1RKBA 1EESA 4ZKEA 1D9XA 1AJEA 1OXTA 221PA 3B1ZA 1NMYA 2QA5A 5IK2D 2UKDA 2EWVA 2FZ4A 1KK0A 2XOKD 3GJ8A 2W0MA 3Q3JB 3FMPB 3SZRA 1BYUA 4AYWA 1DAIA 3M0EA 1A82A 2F1RA 3UPUA 5LB4A 2V55B 2GJAA 3KTAA 3F0TA 4ZDJA 4CEJA 1HEIA 4II7A 4B6EA 1AKYA 1KI3A 2BHRA 1MO5A 3W90A 3DVLA 1S1CA 3EW9A 4DLRA 1KHTA 3CRQA 1J70A 2QAGB 4DKXA 4B3BA 2ZS9A 5KHOC 4KSBA 1Q0UA 5TMPA 1ZRHA 5EE3A 1ZNXA 2BIFA 2VHQA 4PHHA 1GKUB 4HLCA 2ZUCA 4Q19A 4MQBA 1QVRA 1XD8A 2N1BA 4NYJQ 4NCKA 3MWKA 4PC3A 2D7CA 4JMPA 2F1JA 1E4YA 1GVNB 1SXJB 3F3YA 3KKNA 5JHGB 1XZPA 4PPNA 3W5JA 1AZSC 4G5SA 2IYYA 1O3YA 5FOTA 1RRPA 1Y63A 3IKJA 3DOEA 1JQLB 4HAVA 3RRNA 2DFNA 2DB3A 4DUGD 3R9XA 3AVTA 2IHYA 5J5CA 2ZE5A 5JEDA 1N5KA 3U4QB 2W2VA 4EPWA 2QE7A 4C0AC 1M6NA 1NN3A 4D4LA 4D25A 1NL3A 4HLUA 3FMIA 4LJAA 5JJLA 2CEAA 3HPRA 1JR3A 1X1RA 1J8YF 4MYTA 3K70B 5DO9A 4NHOA 4XVRA 2N42A 521PA 1QDEA 2R2AA 5TV2A 1EK0A 4EUNA 1N3BA 4LJ7A 5F3WB 3GLFB 1XMJA 2YOHA 3C8UA 3FPAA 3JVVA 3THWB 4IVRA 3SJCA 2DY1A 4BECA 1X1SA 3AF0A 1KMHB 4DLWA 4Y0AA 4AY2A 1PJRA 1II8A 1N5LA 2VHJA 1OIVA 1QHIA 4C2TA 2OEPA 2XJ9A 4IOJA 2W83A 3UXMA 2H18A 2IYQA 3EAQA 1YKSA 1N6LA 4F4CA 1CIPA 5C4MA 4U02A 2QEQA 2FGJA 1QHSA 3OIUA 2YOGA 2QP3A 2RGCA 2WMOB 2ZJAA 4XIGS 4AI6A 4OHYA 1A7JA 3U3JA 4JLJA 4Q02A 1LTQA 4AURA 1NSFA 1W44A 1CTQA 1SHZA 1ZVQA 1FQKA 2NO9A 2J1LA 4A9AA 2IWHA 2IXFA 4RKFA 3L0IB 1JXOA 2GAOA 1R2QA 2V7QD 4XVQA 1ZJ6A 1R7RA 2OUKA 1XMSA 2ZANA 1KDRA 4M4SA 2VO1A 2W6JA 1M7GA 3VR5A 3LVRE 4B2PA 2J0UA 2PH1A 4URUR 5TVKA 4M9ZA 3L0OA 4BGDA 1MRSA 4DLXA 5AK0A 1A4RA 2DR3A 2EFHB 5C2JB 1KYIA 3GFTA 4NYMR 4TMZA 2R6FA 1AS0A 1G20E 1MH1A 5JEEA 5HTKA 1CS4C 5E7MA 1W4BA 2BMFA 2VHCA 2X19A 3SE0A 4M53A 3R20A 1E2NA 4QJ4A 3TSWA 1T0HB 3Q7QA 4QHTA 2IUSA 4LJYA 1ELOA 4HUQA 3RRYA 1RZ3A 3LWNA 4YDSA 1FQJA 2R6DA 3D31A 5CB8A 3KFXA 4CYMA 4ITRC 2ZUBA 1PLKA 1ZNWA 4OI0A 1IXSB 4CEJB 5UKDA 1KSHA 2AXPA 3U3MA 3VU9A 5JI3E 1W47A 1ZW6A 2HJGA 3Q72A 3WHLA 2Z6VA 1JAHA 4GSYA 2Q0HA 1F2UA 1A5TA 3P1JA 1NF3A 1W1WA 1HT2E 3T34A 4JS0A 4ZCMA 3TE6A 2JAQA 3H2YA 4TYNA 3RS3A 2QP4A 3ZVMA 1TADA 4YXWA 2WWXA 5BXQC 2GJSA 3HP1A 2V6IA 4C7OA 1NN0A 5KUTA 3PCRB 4KXFB 3W34A 5JCPA 1M74A 3CM0A 1FUUA 4LV6A 4IKEA 2IYRA 1N2CE 4TT3A 3AP3A 4ESVA 3HR7A 4LBVA 1ZIPA 4LHVA 2JJ2A 4DEXA 2P6UA 1VCIA 3KDSE 3LY5A 4GP6A 1VDZA 4M1YA 5CITA 5FOUA 2XITA 2BJVA 2ZUDA 4RZXA 5LDDC 2AWNA 1F60A 2VF8A 2HXYA 5L3SB 2I3BA 1GUAA 2G88A 2A78A 1XRJA 2FSGA 1ODFA 2GF9A 2B8WA 4HAXA 3GLIB 4A0FA 5JFGA 1HQYE 2V1XA 3KUDA 4H9GA 5DHFA 2P5SA 4DT1A 1YVDA 3RRZA 3WMEA 3BFKA 3CF2A 3AQ4A 4IDQA 2OLJA 3LRPA 5FL3A 2ZSFA 3H86A 4HDOB 3GLHA 1LVGA 2J5XA 3MMPA 3U3RA 3B1VA 2JIZD 3UIEA 8OHMA 2IBMA 4HDQB 3KTAB 2HT1A 1BO6A 4FN5A 1CJTC 3NEYA 4IEEA 4B2LA 4ON9A 1CP2A 2IYZA 3EIEA 1TF5A 1DG1G 1NN1A 3SI7A 1LW7A 2OBLA 3OF5A 4BFWA 4TZ0A 4QHSA 4OHZA 1ZM9A 4QGHA 4A6XA 3BS4A 3FFBA 2D74A 2ZREA 3V4RA 1MR3F 2V3CC 3DM9B 4GMDA 2R9VA 3P4XA 4FIDA 4C4PA 4HZUA 1DAMA 5FTJA 4GZMA 5LB2A 3TGPA 4GT1A 5B58C 1SQ5A 1YZLA 4AD8A 3SBDA 1A1VA 4V0ME 1QHYA 3RS5A 4NCIA 2CK3D 3GEEA 3UMSA 1Q1EA 2OILA 2XTZA 4URYR 3MLEA 3G5UA 2FSHA 3FMFA 4P4SB 4HUQB 2FNAA 4NDZA 4KJZA 1T3HA 2J7KA 3HU3A 4P4TA 3KKPA 1N5IA 3VR1A 3THXB 3R7WA 2V54A 1EFTA 1X86B 2ZR7A 3H1TA 3N5CA 4DBLC 3PUYA 3TKLA 1YZQA 4RFVA 1KZ7B 2SHKA 2ZRCA 1EX7A 4URZR 5TB5A 3AVUA 3AKCA 3GLFE 1XZQA 1FMJA 4B44A 1SKYB 2GXSA 2IHBA 2PT5A 5JS7A 1P60A 2DBYA 3MGCA 3K9NA 3QBVA 3FGNA 1JAIA 2ZIAA 2ZSEA 1RE0A 3O8BA 5KSYA 2JLZA 3EG5A 2OO7A 2PBRA 1RJ9B 2ZRIA 2WJIA 3RLFA 2F55A 3JVUA 2RB4A 4BRUA 2O8CA 1G6OA 1G19A 1KKLA 2QSYA 3QVUA 2D3WA 4IDPA 4IFBA 1CLUA 3MWLA 2VRWA 2YOFA 2ZROA 5DE3A 2BKEA 3N2EA 2D4HA 1H8HA 2CE7A 2JLYA 1KY2A 1H65A 3EIQA 2EWWA 5TARA 1L7VC 4KLZA 4QBHA 1W48A 4PZZA 2D62A 1E2DA 4UNSA 3VU9B 2JLRA 1E9CA 1VKJA 3EIHA 2F1HA 5K8UA 5EE5B 1TF7A 4F93B 4O3MA 3PVSA 3TQCA 1F5NA 3KKOA 4YONB 3TVDA 4QL3A 4DSTA 1D2NA 1VCNA 3AF4A 3QG5A 5GJVC 4Q9JA 2LCFA 4PC1A 1KI9A 4K81B 4OJKA 2VA8A 5EZ5A 3NC1C 1CJMA 3K0SA 2F6RA 4MKHA 2BMEA 3IUYA 1Z0AA 1YHNA 4C30A 3GLGE 3OE7A 2C77A 3M6AA 1U0LA 3CLVA 4RKEA 3ZYCA 2GCNA 3ADBA 3U3OA 4OI2A 4A8JB 4FW9A 2PJZA 1NI3A 4A8JA 1RFLA 1Q57A 3K0CC 2EYQA 2VSXA 3S1AA 4I99A 1KO1A 1VECA 4B75A 1L4YA 2V1UA 4ZCIA 2OXCA 1UBFA 4LV8B 1X3SA 1XMVA 3B60A 3LXXA 3NH9A 3FE2A 4PAQA 1T3LA 5JSZB 1X8JA 3CONA 3GJ0A 4EPYA 1EGAA 2UVQA 4F7WA 1VHLA 1BMFD 2GK6A 2C5LA 1UBEA 3TW4A 1JB1A 2O8BB 1KJYA 4ACAA 2Z43A 1W0KD 2ZYWX 3VFDA 2W2TA 3BFXA 2Q9CA 3VMFA 2YYZA 4O25A 1NLYA 2H16A 3LW8A 4PFSA 4Q9KA 3T06B 1AA9A 4A82A 3C5CA 1VG0B 3ND8A 4DJTA 2HYDA 1T8TA 5L3SA 3BBPA 4OYHA 2NO0A 4LOAA 5A0FA 4RFSA 1UKEA 3FMOB 2ZRJA 1W36C 3SHFA 1KMHA 2A5DA 2V9PA 3X2SA 2XZOA 4RCZA 5FTKA 3W3ZB 2OM2A 4PPQA 3PEWA 4FINA 1E2GA 5B64A 1YZTA 3E2IA 3PXGA 1Q1BA 5CLLA 3GPLA 4JT4A 1NNEA 5FPHA 3U2QA 4HUTA 2AFHE 2EVWX 4AK9A 1CXZA 2FFHA 4Q4AB 4Q21A 2WSMA 4D80A 1KDOA 3SBEA 3GLHE 2CCGA 2NGRA 3CF6R 3HDTA 5EXPA 1MKYA 3OZXA 1X6VA 3OEED 3UG6A 3LX5A 1RIFA 1FOEB 1UF9A 1Z0JA 2VQSA 3PFIA 3ZD7A 4IJMA 3VX3A 4CDGA 4XTCS 2IEZA 3CWZA 4NBSA 1SKQA 4Z8XA 3UANA 1NMZA 2Y8EA 5FR2A 1GNQA 4G5GA 3E70C 2G0TA 5DISB 1VHTA 2XEXA 1SULA 2NIPA 4L5BA 1HURA 5SZHB 3Q5EA 4JLKA 1XTIA 4JVNA 1PVOA 3CZPA 4GZLA 4TL7A 3NBXX 4CEIB 4FWIB 2OHFA 3THYB 3RSOA 4GDFA 5FI1B 3GFPA 4UQOA 1N5JA 3V00A 1F48A 3NBFA 3X1DA 3FWYA 3UG7A 4BWYA 3A1UA 3GEIA 4M1KA 2ERXA 4E5UA 3I8XA 5AJYA 1GKYA 3SEAA 2J0UB 2CMKA 2H5EA 3K0FA 3CNNA 2BCGY 4AKGA 1ZM2A 2QGNA 1VYTA 3OIYA 2Z4RA 1IXRC 3HYRA 4HZIA 1Y3AA 1ZC3A 5B30A 2C95A 1R4AA 2BEKA 1E79A 4AG5A 1G3MA 2ORIA 3K0AA 2PZEA 4TWZA 2FU5C 5L3VA 1XTRA 3U61B 4NONA 2GTPA 5FPSA 5SZKB 1RYHA 2ZVPX 3FOZA 3UMRA 1VCMA 2IYVA 4LGMA 1B23P 1D9ZA 1AM4D 1JR3D 3IBGA 5H1YA 3CH5A 1P61B 4CF7A 1WE2A 3QKRB 1JJVA 4B48A 4D0LB 2EFDB 1TEXA 1D2MA 2ZI7A 1E2KA 1W0JA 2RMKA 1Q1QA 1G4AE 1P4SA 2A9KA 1TTTA 3T12A 1CR1A 4PHGA 2JGNA 3AP2A 3BGWA 1KGDA 2DFLA 3OEHA 5JWRA 1CEEA 1OF1A 1TQ2A 5KSPA 3PQCA 1IBRA 4L8GA 4NL4H 2QPTA 1H8EA 4JLNA 1N6RA 1ZUNB 2ECKA 3K1JA 1TF2A 3QKSB 4DCTA 5IT5A 2Q3FA 1KKMA 4KO8A 2QNRA 1E1RD 5AJVB 5H70A 4H1VA 4MDFA 1ZBDA 4KYUA 4QBIA 4P31A 5FOVA 1KSFX 4MA4A 3ICQB 4F92B 1XF9A 4P0TA 1JPNA 3RDPA 1U0JA 4OHXA 1Z6GA 5L3RA 3PIRA 2ZVQX 4LJ5A 1AK2A 1EFRD 1P2SA 4ZV4A 3SS8A 1COWA 2QRNA 1Z2CA 1N6NA 3MUFA 1I4LD 3P20A 4PAMA 3SJAA 1ZNYA 4FMCF 2W6JD 4MGKR 4TMVA 3V9PA 3VHXA 1GL7A 3EC1A 1R8SA 1FP7A 4LC1A 1KAGA 1ZU5A 3AP1A 2WJHA 4XWOA 3QF7A 4LDJA 1QHNA 1G7RA 5AUQA 3SQWA 3AKYA 1E1QD 2NO1A 1RRGA 1KNXA 4M1OA 2ZI4A 3K53A 2KBFA 3H84A 1G3UA 1GIAA 2ZS8A 4QOSA 2GHIA 1OH7A 3LBHA 2ZE7A 3UATA 5E3HA 3O8CA 4UKDA 4D82A 3K70D 3RC3A 5DI3B 3WXMA 1XD2B 4WXRA 3TW8B 3BRWD 5DYIA 4HYYA 4M21A 4EQ6A 5IHPA 1M7BA 4QKQA 4US1R 2RGXA 2PLFA 4A36A 5FBLB 1EWQA 4V0LA 5G3YA 2ZR9A 2ZAMA 3VAAA 1XEWX 1D6JA 3QKTA 4JLMA 1OH5A 2FPMA 2O8FB 4HLUC 2XJ4A 1Q1ZA 1KJZA 2CXXA 2FPKA 1DS6A 2BBOA 1TUIA 2ZI3A 1FX0B 4F4JA 4TLCA 3ZD6A 3KUCA 3CZQA 4HEJA 2P3SA 1G5PA 4M9SA 4PQYA 4IXNA 3QY0A 4RZUA 4OQLA 1OT3A 2GDJA 1M34E 4Q4HA 3K9GA 1KO5A 1EFCA 1SGWA 5CJPA 3ZZTA 3J81k 1ZD8A 4C2UA 3GP8A 1U90A 2AR7A 1CJUC 2NTYC 2F43B 2XXAB 2CJWA 2F43A 4DDVA 2HLDD 1JPJA 4JZKA 4B33A 3ZQJA 721PA 5KNCA 4BZXA 3LO5A 5FFMA 1VG8A 5J4LA 4EPTA 2REOA 4UXJA 2QPOA 3F5FA 4IFEA 3TUIC 2XZLA 1S8FA 3REFA 4JT2A 2VP9A 2ZJOA 3HJNA 3NHAA 4TLAA 3WBKA 3R8CA 2CVHA 4DC9A 2DFKB 3Q85A 3GJ3A 5EZ6B 1KDPA 2ZYVX 5JZVA 1ZP6A 4JL5A 1P3JA 1W4RA 1LS6A 1P72A 5HKKD 4LHZA 1N6IA 3U60B 3OFNA 1U8ZA 2MSDB 1QBKC 3GLHB 4PSVA 1NBMD 4B6FA 4BLOA 2OV2A 4RFSB 4NYIQ 2GESA 2YNMA 4G5RA 3B13B 2WBLC 1KI6B 2OFWA 3WRXC 1AGRA 3EPLA 3SR0A 4EQ6B 4Q7LA 5EUQB 4QBFA 1UKYA 1UJ2A 1NVVR 4Q18A 4TTQA 5KU1A 4XVUA 1W2HA 3ADKA 1AS2A 4MKGA 1GOTA 4ZO4A 4Q1DA 1J90A 1KI7A 3I5YA 3VKWA 4DSNA 4FCTA 2ONJA 1M7HA 3QXJA 1K5DA 1E2EA 2XTMA 3GJ7A 2QTVB 1ETUA 1E9SA 2FA9A 3UKDA 2YV5A 1RRCA 4WIAA 2WWIA 2RGAA 1OV4A 4PX9A 2QZ4A 5IK2A 3VR6A 2J59A 2YZ2A 4Z51A 4AYXA 5DN6A 1KO7A 3T5GA 5J40A 3AVVA 3PUWA 1XXHA 3CRMA 4DVGA 1UKVY 4JLVA 4V03A 1UM8A 1B0UA 2ZU0C 2C98A 1P73A 3RS4A 3LQQA 3M1IA 4YDHB 3ZLJA 5FUXA 3QXCA 2QMUA 3PEUA 4JL6A 4BLTA 1T8UA 3UK6A 5DIFA 3RYTC 3NEJA 2I1QA 3SFVA 4NMMA 3K70C 4GL2A 2ZJBA 1NLZA 4D4MA 3VR4A 3DPUA 4XSHA 3A4NA 3LXRA 3L82B 2QAGA 1G5TA 1MO6A 2WIBA 4EFMA 1N6OA 3I3SR 4Q1EA 4CEIA 5SZIA 2FZLA 3DMDA 3W8RA 4ZI2A 5DN6D 3NXSA 2B7BA 2FEOA 3IILA 4N0DA 2IS4A 5HCIA 3GLFA 4LY6A 1ZAKA 2VSOA 3KJIA 1E2IA 4AKIA 3CR7A 4LX0A 5K8IA 3GJ4A 1NG9A 3FKSD 2AXNA 3SJBA 3THOA 1COWD 2KWIA 4ARZA 5HPYB 1AQYA 2Q6TA 1S3GA 4KFUA 5BYJA 2IYUA 1CR4A 3O8RA 4MDEA 3LV8A 4WA7A 3TJZA 3DEFA 3DL0A 1FPMA 3PEVA 1FTNA 1RJ9A 4NE2A 4A0RA 1LNZA 2HXSA 2CHGA 2FMXA 5P21A 4G3XA 2BMJA 1KI8A 2IYXA 4DCVA 3T15A 3U6BA 1KNQA 2ATVA 1Q12A 1XEXA 5HE8A 1MT0A 3TSZA 4B32A 3ZIAA 4OK5A 2OAQ1 4D0NA 1FFHA 2XB2A 1MO3A 2DWQA 2J0QA 4LHYA 1ZCBA 3TR5A 5B2ZA 1XBTA 4AIIA 1GM5A 4TMKA 2KJQA 2EQBA 2PZGA 1KI6A 3GQBA 1JR3E 1U9IA 1TAGA 2GXUA 2OXRA 3MAAC 3QPVA 2BMDA 4OL0A 5HZKA 3U44A 1XP8A 1XWIA 4BFXA 2F1IA 3TK1A 2QQ0A 4UXIA 2B7CA 2JJ1A 2ZU6A 2X1VA 1WF3A 2PCJA 3NTUA 2J7PD 3IBYA 2ZI9A 4KI0A 4P3YA 5E95A 4WXPA 4OK6A 2FGKA 4W7SA 2ZJ5A 2PEYA 3T5DA 4UNRA 5AJXA 4JBXA 4C0QC 1XPUA 5BN5A 1JI0A 4WVFA 2ZR0A 2AN9A 3DMNA 3G82C 1E9FA 3H0KA 4LI0A 1X8KA 1FP6A 1KK2A 1U94A 2EW1A 1V43A 2OAP1 4KFRA 4MUAA 1GTVA 3EC2A 2ANBA 3TUJC 3A36A 3GEHA 4DSOA 5JHHB 3K0EA 4RZ2A 1SZPA 3LBNA 1T4GA 4BFSA 1G4UR 3PUZA 4ZPXA 2VSFA 2JA1A 3A4LA 3U6KA 4ZIRB 4LYHA 4DXAA 5CIQA 5EXSA 2QE7D 1E0JA 1JEDA 3AKDA 3X1ZA 5L8VA 2QSZA 4QM6A 1IHUA 1BIFA 4TLDA 1DO2A 2QRZA 2YC2C 5JMTA 3MJRA 5JWOA 2E9SA 4JBWA 2GCOA 1GNRA 1EWRA 4TTRA 2AWOA 3QKUA 4DHEA 1IQPA 4KBFA 2KI5A 3ZIAD 4JL8A 4OBEA 3QUSA 4BLSA 1KO4A 3SFZA 1VYUA 1EX6A 1V5WA 1ZMXA 2AKAB 3REGA 1GFIA 1C1YA 2P65A 2VP5A 3MD0A 4W5WA 2ZM5A 3OIWA 2Z0MA 1GAJA 3UWKA 1W36D 1E9RA 4KV9A 1HY3A 3LNCA 1Z83A 4PQRA 2ZRBA 4HAUA 2O5VA 1K6MA 1YZUA 2ZPTX 5DH9A 3EX7C 3WYGA 3I4LA 1XEWY 2WAYA 2J45A 2ZRMA 4LJ4A 3W5IA 5FPKA 4TL6A 4QGAA 3RABA 1R10A 4HZUB 3CPHA 3ZZ0A 4BUJA 2IA5A 2NOAA 2WKPA 4DDUA 5ANRB 3AF2A 2YHSA 2CLCX 4TSFD 5FTNA 1SXJE 1KIMA 3L0PA 4NCHA 2CHVA 4Q4HB 4AC9A 2F3TA 1WRBA 3KB2A 3BH0A 1D5CA 3VNUA 2QQEA 4MYUA 1XCMA 4RD2A 2Q3HA 3QE0A 4WZBE 5IRCD 1U9IC 2RKOA 4TTPA 4DB4A 1E94E 1FX0A 3SOPA 3TRFA 1E2MA 2QENA 2FFAA 1XJQA 2OCPA 2WMNB 2WSSD 1T3SA 1W2GA 3NG1A 4FMCB 1DAGA 2P6NA 4V0MA 2V8OA 3OEHD 4F4IA 3AVXA 1IM2A 3KL4A 4E09A 3QNUA 5CDFE 3T35A 1IN4A 4EPVA 3LD9A 3B78A 2G83A 5AUOB 1XTKA 4OJQA 3M4YA 3RWMB 3EZ2A 1YJ5A 4MUBA 3R7WB 4XWKA 4LWZA 2ZRDA 4U00A 4WZ6A 4EPXA 1IY1A 4R98A 1N0VC 4V02A 1D2EA 2ODEA 2WSSA 2CLSA 3EARA 4WW0A 3AGPA 4I1SA 4POAA 3ADDA 2GEVA 1OIWA 2ZJ8A 2ZYUX 1Z5ZA 5BN3A 1RVDA 1E79D 1XDBA 3B85A 2J87A 3B82A 5EP2A 4C3ZA 2C9CA 1SHKA 3L8YA 5BWMA 1G3IA 1NVXQ 1G8HA 3TSOA 5GADl 3KJHA 3AB3A 1CJKC 1TU3A 3NVAA 4IW3B 4MYCA 3DO6A 1WCV1 4MGZR 5JLJA 2G9NA 4ARZB 3LLUA 1I4DD 4QNMA 3LVQE 3VR3A 1ZINA 1TNDA 4LUCA 1Q3HA 1YZGA 2GWHA 4LV5B 5C4GB 4ZI3A 4EDHA 1Z8FA 4BFUA 1P5ZB 1JJ7A 2RGDA 1X8LA 3WY9A 1UDWA 4A0HA 2H8KA 3MCAA 1KSJA 1NLFA 1ZNZA 3K0FB 2HYIC 5GJBA 3WNBA 1UFQA 1F2TA 4CRWB 4QHYA 1T0JB 2OT3B 3QIAA 5JBQA 4KVGA 5FPYA 3CH4B 2VP0A 3O8DA 2NO6A 3QSYA 4DT1B 2NO7A 4PTLA 4RY2A 3LQRA 3BE4A 1XCGB 1R0ZA 5KSZA 3FHCB 2DFTA 3ZJYA 2HLDA 2ZRHA 1XNJA 1DPFA 1P2TA 4Q00A 1P6XA 2VIIA 2ZJYA 1ZC4A 4MGIR 2IYWA 2GJ9A 1U81A 2C8VA 2JASA 4YC7A 1XB2A 5FR1A 1W36B 4OQMA 2ZQ5A 1XPOA 1OXVA 2HV8A 1GSIA 2A2ZA 4HAWA 5KOYA 4KFTA 1G21E 3I32A 2RGNC 4JLAA 5KDOA 3ZH9B 2R65A 1R0WA 1HT1E 2EFEB 2PX0A 4B3DA 2I1VB 1KJWA 2J7PA 2ZETA 2BVNA 1OSNA 5EQTA 4FD2A 5JWHA 2EFCB 2OBNA 5CDFA 1SVMA 2A5YB 1DEKA 2G0NA 1XPRA 4QBGB 4V0OA 3BK7A 5C18A 5KPDA 1I2DA 4OHVA 2CHQA 3I92A 3W6OA 3AVYA 4L15A 2QL6A 2FV8A 3ZVRA 1Z22A 3R9WA 3RHFA 1R6BX 2X2EA 1OFUX 3DKVA 3K09C 4A2PA 1Z63A 3B6EA 2FH5B 3D6TB 4FCWA 4MITA 4TLBA 2C9YA 2OFOA 3TMKA 1QHHA 1U8AA 3RAPR 2IWRA 2FFBA 2JJ8A 3RSLA 4ZDWA 4OKSA 2CLDX 3OAAD 4S2EA 4BPBA 3SJZA 4TLEA 1E1QA 3C7KA 4KLNA 4QNRA 1GZSA 1YRBA 4BLRA 4KCGA 3I1FA 3DM5A 2X2FA 3VX4A 1AKEA 3SNHA 4TQ9A 4ZDKA 1G6HA 1II9A 2MSEB 4GNKA 1N25A 3NH6A 4D2IA 1S4QA 1N0WA 1UAAA 3BOSA 4Q66C 1VIAA 1XTSA 2GZHA 4KYIB 4TQUS 4ASUA 5J4KA 1Z07A 2ZJ2A 4IDNA 3QBTA 2FEMA 2DYKA 5JJIA 3KFVA 5AJWA 4W9MC 1ZYUA 4BZPA 4D4JA 1TPZA 4PSAA 3PJRA 4DDWA 1ZM3A 1DAHA 3CIOA 3T1QA 2BV3A 4BEJA 4IEIA 5FUVA 1Q20A 3AVQA 2IL1A 4LPKA 4YLGA 5KNBA 5DNYB 4XOIA 6Q21A 2J9RA 1QG4A 2DWOA 3R9IA 2AKYA 2GVDC 2YINC 4QJ5A 5CK5A 2QMHA 5EXXA 3CPEA 2HT6A 1TMKA 2ZXUA 2BM0A 1W4CA 3LX8A 3KQNA 5J4YA 3A8TA 2B6HA 2O8DB 3KXLA 3NBZC 3EZ7A 5J4HA 3U7EB 1VIYA 2ERYA 3HPQA 3K8YA 2GILA 2Z83A 4PQFA 1W49A 1Q44A 3QEJA 1SKYE 4Q1FA 1IOZA 4Q9HA 4I4LA 2C04A 1SVSA 1ZIOA 4PSKA 1IAQA 3AM1A 4MH0R 4NPHA 5GVSA 3NKVA 1QF9A 4PZYA 2RGNA 4Q01A 5F98A 2XZPA 3C41J 1NVVQ 5FL7A 4LHXA 4Z54A 4XH9B 4NP6A 2Z4SA 4X8HA 5TXGA 3BC1A 5D3MA 1PLLA 2WWGA 2ATXA 4L9SA 1LFDB 3CO5A 3NIBA 3W9YA 1OXXK 4NH0A 2VP6A 4ZKDA 4BRWA 2O8EB 1G291 3NDPA 3A6PC 3ZGXA 5CIWA 4ACBA 4JLBA 4LCBA 3CBQA 1WBDA 2ORWA 2JJ1D 1SVWA 2IF2A 1ZCAA 1ZD9A 4G0NA 4Q4AA 2ODNA 1E0KA 3ND9A 4C0KA 1J99A 3LH5A 3TIFA 4UXHA 3PV0A 1D8TA 4WBSA 3WP0A 1OH8A 2OZEA 1DAFA 2PLRA 3C5HA 3B8HA 5JJKA 4HATA 4UNQA 1M8PA 1TL7C 1AQUA 4G5QA 1JECA 2VL7A 4KODA 2LKDA 1P2VA 2NZJA 1G7TA 1JQJC 1SXJD 3Q7PA 3TR0A 4DLSA 5H68A 4Q4JA 2G1KA 1VCOA 2CCKA 4HAZA 2F7SA 2TMKA 3I61A 3DZDA 4JSYA 4R2HA 4B74A 1J2JA 4US0R 1CBUA 2W6ID 4DLVA 4D81A 3U3KA 3BB1A 4A92A 2O8BA 1XU4A 2HF9A 1BKDR 1TU4A 4M9XA 4BLQA 1P9WA 3OEEA 5CK4A 4F91B 2XNDD 4O0MA 3VTKA 5J47A 1SXJC 3CX8A 3B2EA 4P32A 3FHOA 1J7KA 2IS1A 2QBYB 1QRAA 2OCBA 2OESA 5DHAA 2CE2X 2Z5FA 3ZDQA 5G41A 2FSIA 1XTJA 4K8OA 2FWRA 1G18A 1KY3A 4HB2A 3B9QA 1OH6A 4RD1A 1KK3A 1NN5A 3KQLA 4Q48A 4DZZA 1LY1A 3GLGB 3WMFA 2Q3MA 4MKFA 2O8EA 1G16A 1R5OA 1YR7A 1YQTA 2H92A 2R8RA 1KDTA 2F3RA 3IQWA 2NPFA 3FFAA 3K9HA 4G1UC 2ZSBA 3NC0C 3TNFA 1GRRA 3A58B 1U8YA 4I1UA 4XD7A 2BC9A 3P26A 4TL8A 2FFQA 2FG5A 3C16C 1IONA 4C0LA 1XX6A 3CR8A 4G01B 4TSFA 3KXKA 1PV4A 2Q21A 2WAXA 1HTWA 1QZXA 1XTQA 4RVCA 5A4JA 5DGXA 3B1WA 1PUJA 3HU1A 3N70A 1P75A 2H17A 3LA6A 2RGBA 3THYA 3EA0A 1MOZA 1W0KA 5E7JA 2J3EA 4MRRA 2B92A 4HLDA 4NKRA 4LBZA 2Q9AA 2QROA 1G8FA 2HCBA 2W6IA 3T1TA 1MRNA 5L3QB 4URWR 3TAHA 3IIMA 2VHTA 3VQTA 2IS6A 3UMFA 1IJFA 4M9QA 2ZE6A 2OSBA 4A1FA 4RCYA 1F2TB 4DDTA 4L4UA 4Q4LA 3TVTA 4E03A 5JRZA 1NP6A 2XX3A 3C14C 1Z0KA 4JLDA 1KAOA 2ZRGA 2PZFA 1IN6A 1FTSA 1KI2A 2F9MA 4DEYA 4B73A 4TQAA 1E6CA 3FKQA 1XFAA 3LLMA 1FUKA 1L4UA 4B47A 3X1YA 1N6HA 2JLVA 3JZAA 3U5ZB 3CF0A 5CM9C 4C9BA 2ZRNA 4CEHB 5FTMA 1HE8B 3T1VA 1CRPA 1S0UA 5H8WA 1Z2AA 4QGGA 3BH6A 1QG2A 1NY5A 1WMSA 2C99A 4TYWA 1CR2A 2QAJA 1KI4A 4IDOA 5AUPB 2CVFA 5A5GA 2IW3A 5FBWB 2BBSA 2VF7A 2OG2A 4QRHA 1VPLA 2CL7X 3IHLA 3OESA 4M22A 2WJVA 3R8FA 2IUUA 1TUEA 2R44A 2WZQA 3MJHA 3DZ8A 4JYCA 4N3NA 5FL7D 5F2EA 1G9XA 1FZQA 2WM9B 5FTLA 2A7QA 2LWIA 4A6PA 1E98A 3IO3A 3QQ5A 1OB5A 1K5GA 3MWYW 4QGFA 2VBCA 3BWDD 4NYIR 3VKGA 4IOKA 2ODWA 3AV0B 5LD2C 3NBYC 2YWFA 4X8MA 3AUXA 3TUZC 4MKIA 3ASZA 1OPXA 5SZJA 2G6BA 2VLIA 3KQUA 2V7QA 5FOWA 4M0LA 4PXAA 1TQ4A 3X1WA 4ILEA 1C9KA 2QM7A 2VP4A 1JR6A 2QTHA 4TMXA 1CF4A 5DSZA 4QC2A 2CJWB 2JLSA 4JVLA 4A15A 3ZQ6A 4F38A 5HR5A 2LKCA 2EFGA 1E69A 2VPPA 1KSGA 2ZE8A 1EXMA 2R6CA 3UWOA 4A2WA 4U7DA 4BFYA 2G3YA 3NWJA 2DHRA 5BQ5A 3IDQA 3L43A 2REBA 1M2OB 2ZS7A 1EFHA 2KSQA 1YR8A 1KMQA 3WNDA 1GITA 3QOFA 1RW4A 4PR0A 3IO5A 4K46A 4ASUD 4NYMQ 4EJSC 4M2LA 4Z1MD 821PA 1E2JA 4LZZA 2JLQA 4X8OA 1ANKA 4KSCA 2ZI6A 2QU8A 1HQCA 1XEFA 4Q7JB 5KPJA 1PUIA 3PUXA 4BLPA 1VYVA 4GOXA 4Q7KA 4RD0A 3I72A 2CK3A 2ZI5A 4PPGA 3WHKA 2QT1A 1US8A 4FXPA 2B21A 4GI7A 3NDBB 2ZAOA 2VH5R 2RAPA 3SYNA 3KB1A 3OAAA 3PG5A 1H8ED 4N1AA 4Q1CA 3D7MA 2W0SA 4ERNA 4HB4A 3GLGA 2IUTA 5AJZA 1GDDA 1DAEA 3QXXA 3A1TA 3EA5A 4KBGA 4X8LA 3QF4A 1WP9A 1OKKA 4C0BA 4PO9A 5G3ZA 2WHXA 3CB4A 4P33A 3SQXA 3SU8A 1G64A 2ZRKA 3RNLA 4C0HA 2OLKA 4MRPA 2Q9BA 5FBQB 1CRQA 4B3GA 4YQFA 4B3XA 3S1AB 5BW8A 3CRVA 3BERA 3DOFA 1NIJA 1Z28A 3EASA 1OYWA 2KB0A 2OBMA 2VTKA 2V6JA 2WIAA 1G1MA 1OFIA 2QAGC 5CJ2A 3VNVA 4Q47A 4BASA 2X77A 3GD7A 1TEVA 3FYHA 5IF9A 2ZRAA 4A0GA 1OHHD 4GFDA 4R71A 1NKTA 1LB1B 3W3AA 5FOSA 4R7ZA 2GNOA 2A5JA 2RCNA 2NG1A 4L9WA 1IY0A 4Q4JB 5L3QA 4YMWA 2RGGA 421PA 4IXMA 4DCNA 1O87A 3FVQA 3BFVA 1G8PA 2AD5A 4RZ3A 1U98A 5FBVB 1Z0DA 4QFMA 2O8FA 1SVLA 1TX4B 1II8B 2JLUA 3AGQA 1YR9A 3IEUA 4JJKA 2ZJZA 3D8BA 4KHZA 5JS8A 2W00A 3C4JA 1EFUA 4CT4B 2FDCA 3I73A 3CNOA 2O8DA 3H4MA 4RSGA 1Z6XA 2E1RA 1SVIA 5DI3A 5GJWC 2MMGA 2ONKA 3CRRA 2VYFA 4M8NE 5KTYA 1E99A 2V4ZA 4GRAA 1AGPA 1FL9A 1OIXA 2JCSA 2CBZA 2A30A 4D4KA 4PHTA 5JSZA 1Z08A 4FI3C 2P67A 1WQ1R 2CCJA 2F9LA 1NG1A 4TMWA 621PA 1FW6A 3KJEA 1G8YA 1DG3A 2PT7A 4NYJR 1DADA 5D3MB 3GJ5A 3LW7A 4XJXA 2FPLA 4JSTA 1UBCA 3CX6A 3AF1A 4Q03A 3KQHA 1E2QA 2R6AA 3KKMA 4G5OA 3QXSA 1IN5A 2GKSA 1TQDA 2YC4C 4JIMA 3BXZA 3GJXC 5AWFC 1U0HC 4GP7A 5DYGA 3TLXA 4URVR 4PC7A 1QHXA 1UDXA 3U44B 4Y0VA 2A5GA 4CIDA 2AHOA 1F3OA 5GJCA 4C0SA 1VG9B 3B1XA 4W5JA 1W4AA 1IN8A 3B9PA 1DAKA 2AL7A 4LYJA 2EU8A 2D06A 3WYFA 2AK2A 1CULC 1XXHB 2XTNA 3BORA 4B3CA 1E0SA 4B34A 2FSFA 4DWJA 4RJLA 1OFTA 3TBKA 1RYFA 1W46A 5E7IA 4DSUA 1HE1C 4LRWA 3TH5A 4DB2A 1IXZA 5LD2B 2QMOA 1WB9A 2R62A 1XMIA 3CWQA 4NCJA 3MFYA 1Q22A 1OHHA 2GBLC 4D0GA 3QVVA 3G0HA 1OLOA 1Z3IX 5GVRA 1P9NA 1FNNA 3FDIA 2QN6A 1JALA 4KITB 2ZRPA 2GVZC 4URXR 2KBEA 2GXQA 5CB6A 3PENA 2I4IA 4Z8YA 4JLOA 2IF0A 3BJIC 2CNWD 4TMTA 1R5BA 2GBLA 2RHMA 5KSOA 2RGEA 1L8QA 4LYAA 3RRMA 4ZDIA 3A1SA 1E2FA 1EG7A 1Q21A 1G7SA 2GF0A 3C15C 3O47A 3AVOA 2XNDA 4LBYA 4UJ3A 2HJVA 2RHDA 2P5TB 1I2MA 1XJ0A 4UJ5A 3QXHA 3HYTA 3WYAA 1ZD1A 2MMCA 4KAXA 5DLQC 3IPXA 1YRAA 2C96A 3RANA 3GLIA 3THXA 4B76A 4D6PA 1NBMA 1QVAA 2ZSDA 1UEJA 2BM1A 2YWEA 3QEOA 4OQFA 1E4VA 3A1WA 1Z6YA 4ZIRA 3BD9A 5KO2A 2JLWA 1NKSA 2QGZA 2IEYA 1LF5A 1EFRA 2C78A 4CEHA 3VHLB 1NMXA 3V4FA 4TL9A 2WWFA 4AG6A 3CNLA 1BOFA 1N6KA 3I62A 1KTVA 1G7CA 1H8HD 2GA8A 2N46A 4Q1AA 5G53C 4CZ2A 3WBJA 1E1RA 1R0XA 1UADA 4DIEA 3LDAA 4TN1A 2IT1A 2OCAA 3DKPA 5AR1A 1FMLA 2QM8A 3OHMA 4IRUB 4Q9LA 4PO8A 2WWHA 1DE0A 4FWTA 3MG9A 2PMDA 3EWSA 3FHTA 5TY0A 5KDLA 4TYQA 1WBBA 3WMGA 1T5IA 1BYIA 1NSTA 2QPAA 4E07A 2YWGA 3E1SA 3TAUA 5FPTA 1W0JD 3P27A 4I1OA 4MRSA 1OXSC 3PITA 3RS2A 1CJVC 4FMBB 4LYFA 2GXAA 1OXUA 4O2LA 2FJUA 2WV9A 2BJWA 1YZKA 2RH5A 3RVBA 3N2IA 2GETA 3TQFA 1NBME 2WVJA 2JJ2D 3RS0A 5FI0B 4YMUA 4Q7MB 2WTUA 1GNPA 2H1LA 3Q5DA 1XD9A 3WP1B 4MYHA 1NIPA 2DPXA 4R9UC 3FTQA 4BFTA 3VKHA 1NJFA 3PR1A 1KO8A 3IIKA 1JBKA 1BS1A 3BB3A 4O2RA 3GLIE 4V0KA 2HEIA 2QP9X 3MRSA 2IXEA 4QG7A 2J0SA 4FCVA 3LBIA 1OW3B 1QHGA 2GJ8A 1NY6A 2WJYA 3SDZA 1F2UB 4JVMA 3A4MA 3EZFA 2QBYA 2QI9C 2BWJA 3B1YA 4Q1BA 1II0A 1E32A 2ORVA 4FMDF 5BYKA 2EYUA 2PCLA 5J4VA 2UZ3A 2WOOA 1DBSA 3AH8A 1G3QA 3CUEF 3IPYA 4NZYA 5K8TA 1W5SA 3QKSA 2WOJA 3W6NA 2IS2A 2H7VA 5FOXA 2JDIA 2L0XA 4YMVA 3JZMA 4AYTA 5BN4A 4MRVA 1HH4A 1LS1A 2VEDA 1Z47A 1E9AA 1L2TA 5JRJA 2JDID 5HCNA 4EJSA 1W5TA 2HF8A 1Z0FA 3I5XA 3IHWA 3BB4A 2XGJA 1P7CA 2BEJA 2J41A 2JLXA 4JLPA 1G5RA 1XEXB 3QKRA 1Z0IA 5IDVA 3RWOA 2ANCA 1A2KC 3GCGA 2YJTD 1KZGB 4PZLA 5F9HA 2XSZA 4S35A 3KZ1E 1A2BA 1UPTA 5TDHA 2NQ2C 2P2LA 2HCJB 4HB0A 4MGYR 1KK1A 3Q9LA 4OK3A 3L2OB 3NHBA 2CL6X 4LBWA 2HDNB 2P6RA 3BAFA 3GJ6A 2WPDA 3MSXA 1TQ6A 2GZDA 4EKDA 2REXB 3ADCA 3I8SA 1C4OA 2BBTA 1S9DA 1WDTA 2R6GA 4JJZA 2O8CB 1N0UA 1XXHE 4N0EA 2GCPA 1ZM7A 2ZSAA 1Z6AA 4OQXA 2HUPA 3L0SA 4LSGA 2IC5A 2A3RA 4YMSA 5EP3A 4QJ3A 1KOFA 4JKYA 4I1VA 5EJEA 2O0JA 4NTZA 2GEUA 1DARA 3SC3A 4US2R 1AIPA 3CRW1 3K0CA 4BE7B 4A4DA 3IIJA 1YZNA 3ECCA 4LJ8A 3SHWA 4EFLA 5EE9A 4IVPA 1T6NA 1JXMA 2PX3A 3MWJA 2IK8A 3CPJB 5EXTA 4BZQA 2WWYA 3AEZA 3QPUA 4KFSA 5CLQA 1MABA 1US8B 2FE4A 4HI0E 5FUYA 2D7DA 3PEYA 3A1VA 1JNYA 5FUWA 2H57A 4M1WA 1T5LA 2IXGA 2P0EA 1S1MA 1J8MF 1GRNA 3OFND 3EPKA 2IYSA 4YXWD 1UKZA 2IYTA 1CKEA 2FX3A 2QT0A 4H1UA 2BOVA 4JYBA 1F6BA 3ZS8A 1SVKA 2IYLD 1AZTA 1ESNA 4M1SA 4OQNA 2WICA 5E4FA 5M04A 1T91A 2NMVA 1AS3A 4OHWA 2ASEA 3W8NA 3ONWA 1VMAA 4KU4A 4PAOA 3ZVLA 4DIDA 1IY2A 4ZCLA 1R8QA 1M1YE 4DLUA 4IHQA 1P9RA 2D2EA 4JBYA 4B2IA 2ODBA 5EP1A 3W6PA 1ZUIA 1HUQA 1IN7A 3ZVNA 2WKQA 1DO0A 5EP4A 3GMTA 3HWSA 4E22A 3KXIA 1UEIA 1MABB 2W58A 4HDCA 4XSGA 4GOJA 1G3RA 1Z29A 1I4TD 4QM7A 2PMKA 4HSEA 4R2IA 4UNNA 2XNSA 1PLJA 5JCZA 4EPRA 2GAAA 2GCOB 1GKIA 1NVWQ 1DTSA 1S9HA 2DWPA 1HA3A 4IOMA 4B35A 5HE9A 1U2RA 1T9HA 3SYLA 4Q5IA 3EWAA 4ESHA 4CGZA 3B5JA 1E96A 4DCUA 3BH7A 4PC6A 2NPIA 4KVAA 2X8AA 2GK7A 2AD1A 3AKEA 4LC0A 4LJ6A 4RD6A 1MV5A 3CW2A 3B7GA 2WJGA 2ZYTX 4PPFA 5DI9A 3DHWC 4BEBA 2GEDA 1UBGA 3HR8A 5LBIA 3EZ6A 5FBRB 4RD4A 5G40A 2IX3A 1BH2A 4B71A 4I81A 4XTRA 3K0AB 3U7GA 2CL0X 1S2MA 1E9DA 2AX4A 2KE5A 3VR2A 3AVWA 3QF4B 4IVQA 2QUZA 4NCNA 1GILA 3KKQA 4GBMA 4LPSA 4CW7A 4GOKA 4DRZA 4DLTA 4NU0A 1NJGA 1RPZA 3ZS9A 5KYKA 1MO4A 5ELXA 4P4UA 2O0HA
chains in the Genus database with same CATH superfamily
2I9PA 4NMWA 4M1MA 3BT7A 4YLYA 4PYRA 2NN3C 5CYPA 4HX9A 4C0JA 1VE1A 2VTBA 4G25A 3ZNPA 3D3QA 3F6PA 4QUAA 3EXAA 2B8TA 3ZCTA 3NIDB 1R0YA 2FMTA 4EFKA 1G59A 1F7UA 1CETA 1G5FA 1BC5A 1X74A 2E87A 2B3TA 2PX4A 3KUKA 4ZKEA 3ZW9A 3SKYA 2LE0A 1E9BA 1QHHB 3SN6A 3ZWQA 1H9AA 3IGFA 4L73A 4MINA 3O3CA 3I58A 5BVHB 1SRRA 1T4CA 1F8GA 4OI1A 1C1DA 5DEOA 3X1JA 4DBVO 3TIGA 2H11A 4AROA 3O7WA 1KI1A 1MOSA 1DC7A 1O5IA 1QX3A 3FIJA 3DDCA 1ABEA 3G2HA 3MOGA 3NRBA 3C7DB 4RK7A 5A71A 3TW0A 5LPNA 3LCMA 3VOAA 3P71T 1K8RA 3QMVA 1E5TA 3LY9A 1Z6TA 3LO8A 4NJEB 4YGYA 2AMVA 4QDOA 3K9LA 1N6PA 2REQA 2J4DA 3NFYA 2WWTA 2QQ5A 1O6BA 3LHSA 4R5HA 3UV7A 4BGIA 5B53A 3SYMA 4HGOA 2X5JO 1ORHA 3QE2A 4EFNA 4W1PA 5MHTA 4MS1A 2LCIA 2C9OA 4H77A 2VDVE 2UXBB 1D5WA 4P1ZA 4PXYA 1FYEA 2GJKA 3MTJA 3FB4A 2GPJA 5EC8A 1FDIA 1W0CA 1E1NA 3HGQA 4M0FA 3CKLA 1WETA 4M8IA 1FMFA 2LDXA 4JB8A 1GU1A 4O29A 3RVKA 4WOPA 5KYTA 3HYSA 1HV8A 1S6YA 1DJMA 1Y4AE 2C5SA 1ZL0A 5KYWB 4EG6A 4OI4A 5B57C 4YFVA 4ZU1X 3DH0A 4U0JA 3EMVA 3LFUA 1SK8A 3HBFA 5TGZA 3SZLA 3Q8XB 4D99A 4DLZA 4CL2A 2UZ4A 3B5IA 2PQ6A 2ZITA 3PUKA 2CNWA 3AOEA 3WA6A 1O9GA 3ZWMA 4CT5A 2Y66A 3DEIA 3S44A 2DC1A 2ZSKA 3T61A 4INZA 3IEIA 1R5NA 3FPKA 4X91A 3AY7A 3KVOA 2YJ4A 3HV0A 3BGIA 3O26A 2EWMA 2L17A 5D84A 4CG0A 3I64A 1Z4JA 2DBRA 2H54A 4V0NA 5JSFA 1E3MA 1CHDA 4CLDA 4E7OA 4EELA 2NU8B 1RC8A 3K2QA 4UVGA 2VT3A 2Z8YA 3LT5A 5E9WA 4Z6KA 3O8OB 4ETNA 4NV0A 4RV5A 3CNHA 1RXVA 2WHEA 4L75A 4I50B 2MSCB 4XKJA 1E2HA 4R8LA 1QO7A 1ZH2A 4Z9FA 5EE1A 3UAOA 1CQIA 4FHEA 1H42A 3HABA 3KTDA 1OKKD 3F8TA 4LK2A 1FRFS 2F8LA 2YFYA 4DGSA 3U4QA 1XNRB 4U2GA 3ZCSA 1SCBA 4LSMA 4UNPA 3AILA 3TSAA 2Z57A 3U9SA 1WA5A 3NMUF 3DMTC 3DVQX 5EWMB 2NADA 3A9TA 5SY4A 4C7OB 4HQLA 4K26A 2I87A 3HY4A 3U31A 2ZSUA 4LNAA 3TRDA 3E5HA 4UHKA 1YO6A 4U6NA 3M4XA 3STUA 3IQXA 3AI3A 3L07A 3QE4A 2GZAA 1MPXA 2A6PA 1ZM4A 3EZ9A 4M6WB 4WKPA 4XOUA 2RBEA 2F00A 2OVFA 4EI2A 2H7YA 4GRDA 5AKHA 5B1DA 1O7JA 1Y4DE 4QPZA 2WZCA 4M55A 4F06A 1G5IA 5F23A 1ECFA 1OYYA 2WNIA 3ETLA 4XFKA 1XAJA 3Q2IA 4A8PA 3DJFA 2VQEB 3W77A 1KBOA 4FMDB 1BFDA 1JE0A 4WVLA 2APJA 2W37A 5DHUA 1FFDA 1I0ZA 3CZMA 4JWTA 1WPGA 3A11A 1HLDA 4K6OA 3LUFA 4Z1MA 4ZCPA 3T1OA 4L1KA 2CV2A 4L0QA 1Z06A 4G85A 4XWWA 2FF7A 4BDSA 2IOHA 5JU6A 1YVPA 1SQFA 1DOAA 4H59A 4S1TA 1H2YA 5IMSA 3IMGA 4Y2QA 4UM7A 1ODCA 1PSZA 2JATA 2N75A 4MUEA 1PO7A 5ILQA 2OENG 2B1IA 4GGOA 4IDCA 4MR8A 2EJCA 2PZ8A 4H4CA 4CFZA 1KQFA 3HFGA 5K6TA 3CVWA 2PUAA 3SCZA 1NBEA 1TFUA 2HFJA 3NONA 2Y68A 4V3BA 1TCVA 3QUBA 1T9GR 3LCRA 4EX7A 1P2UA 1USUA 1M6EX 3R6GA 1NXPA 2ORYA 3MMSA 3I6BA 1U7OA 1LVUA 3R0ZA 4BKUA 2YBEA 4YMTA 4NEHB 1BMFA 4MI6A 1RKBA 3EIUA 3MWFA 4BWVA 3QFSA 1OXTA 221PA 4PS1A 1EESA 4RMIA 2QA5A 2VKTA 2EWVA 1FJGB 3D43A 2W0MA 3Q3JB 4EHDA 2C5BA 2GM9A 5JZMA 2OQRA 2C88A 4LECA 2NO5A 1J07A 4DCMA 3OZ7A 4IINA 5LB4A 3V97A 2V55B 5KQLA 4O0LA 1WBJB 3F0TA 3L4BA 4PVDA 1U11A 4CEJA 3U56A 2GBCA 4II7A 5G4LA 3V8EA 3DNPA 1OT5A 3AOGA 1KOLA 3RVLA 1F3LA 3L6UA 4RTLA 4YJGB 3GHHA 1RQNA 1UFRA 5CDHA 5JISA 4OM7A 2VZEA 4REMA 4HNVA 1J70A 2QAGB 3S55A 4R8KA 5CLHA 3UUEA 2PWPA 2QVLA 5ABPA 3FD8A 1NQOA 4MKRA 5TMPA 3U49A 5C8YF 4JBGA 4R8VA 5REQB 2QVYX 2X1LA 3A1CA 4PHHA 3UFXB 4BKRA 3C1OA 4HVAA 5E2BA 3UK0A 3HXLA 4NCKA 1FJXA 3L7LA 4YPFA 2C59A 4JMPA 3IOYA 1UBNA 1SC3A 3V4ZA 2I65A 3CW9A 3K8QA 3PHGA 4QXRA 4RJIA 3RB8A 1SBZA 2BFBB 3F3YA 5H3HA 5EMJA 3AXSA 4AB1A 5JHGB 3FYSA 3VR0A 1BDIA 4GDMA 2PGOA 2YXDA 2BGTA 3PPIA 1RRPA 2HCRA 3LU1A 4PHCA 3RRNA 5AICA 1CDDA 4EA9A 5G1OA 1SMKA 2DB3A 4IIBA 3R9XA 2IHYA 4TKVA 5TQJA 1DCKA 3M2TA 2ZE5A 3T7EA 4C3UA 1QRTA 3ORQA 1ZN2A 3FCEA 3UA4A 4QZVA 2GLTA 1U63A 1PJAA 1FB5A 1YAJA 4Q3OA 4D6YA 1BRMA 3IB6A 1PGPA 2B4RO 4WZZA 4HN2A 1NN3A 4LDQA 4A5OA 4D25A 3GH1A 4LJAA 5K0SA 3HPRA 3JAKA 1I3LA 5T4BA 3PCXA 1OAOA 4JYPA 4MYTA 5DO9A 4UDNA 4CF5A 4XVRA 2N42A 4FGSA 4B3TB 1FFCA 2A58A 2R2AA 2H1CA 3W7AA 2CNDA 5TV2A 1EK0A 3LC2O 3JQQA 3ZWBA 4Q16A 4ESOA 3G2OA 4I7EA 1XMJA 4IHAA 2RHCA 1AKRA 1NDUA 3CKMA 3UPTA 1SUSA 5BR1A 4BECA 1X1SA 1VLMA 4DLWA 3AO0B 2YQ5A 4AY2A 5I9LA 1OA0A 3GW8A 1JDVA 4TOIA 1OIVA 3VV2A 3X0DA 1QHIA 4HQRA 3ZN2A 2OEPA 2Q4BA 4AWAA 4BVEA 3UXMA 3U26A 4HRVA 5CNMA 3KB6A 2R47A 1PUXA 1EI9A 4BIMA 1FTQA 4F4CA 1BXGB 3S5JA 2JFBA 3DZCA 1JH8A 1OXKB 1QZTA 3LBAA 3M3HA 2QEQA 1I7LA 3P7MA 1K89A 4NQRA 4YCLA 4KIGA 3TRJA 2RGCA 2Q1XA 2WMOB 3FVWA 2O7NA 4CCSA 3ZZNA 2BN4A 2COKA 1A7JA 3U3JA 4KWIA 5LLDA 4C06A 1EZZA 1ZNQO 1B76A 2AN3A 3L7YA 4B0OA 4KPUB 1LTQA 3B7WA 4AURA 5AIBA 4M99A 1CTQA 1SHZA 2NO9A 4OGFA 4A9AA 2IXFA 3BWYA 4GMHA 4MLZA 3ZE2B 4YBZA 1WMBA 3L0IB 5DCYA 1OTXA 5PGMA 3AR5A 2RIRA 5MDHA 2H9IA 3WRYA 2CYCA 2R8OA 4QPCA 3TEJA 3MMZA 4R81A 1ZJ6A 2ZANA 4UBJA 4BTVA 4Y1GA 4NENA 3OO1A 1JAZA 5H5JA 2F2TA 4V38A 1FVXA 2EX4A 4KRFA 2QG4A 4IUYA 2Q3DA 2PH1A 4PM4A 1IBLB 1R6XA 2D0IA 3TN7A 5LNK6 5AVXA 3L0OA 3TD6A 4LRYA 5DTJA 3F9CA 4MLCA 1BRTA 3HHPA 1XTTA 2EFHB 5J2TA 2FG6C 1EKXA 3O4HA 3E53A 1RACA 2QTTA 2D5AA 4EKGA 5KQGA 1BXRA 2EGGA 1YTLA 2QM0A 2XV1A 1KRXA 3R20A 2QLNA 1ELOA 2ZIFA 3GA5A 3PEFA 4HUQA 3U09A 3QFFA 1V3QE 1M8JA 3I9V6 3RRYA 3SAJA 1LBTA 3CSUA 5HILA 5I7RA 4DTIA 1NDHA 1HTBA 1AZLA 2HF2A 3KFXA 1YIDA 4K9SA 3F6EX 4ITRC 4Y2RA 4W5TA 2ZUBA 1G1AA 3OJFA 4B45A 1K7FB 2QN2A 1Y1RA 3VU9A 5JI3E 1AT1A 1NVMB 1JX6A 3D4PA 3IRUA 1DI0A 1ZW6A 3A06A 3WHLA 4NDAA 2WJ4A 5AFSA 4MJ3A 3DE1X 3P1JA 3QVXA 1NF3A 1W1WA 5BNTA 4GI5A 2QMZA 3O4RA 1HT2E 1U7PA 1Z68A 5DASA 1SFRA 3CLRD 1QHEA 4TYNA 2RH9B 5DCWA 1KEUA 3ZVMA 2FX5A 2FMFA 5K2OA 3NYWA 3PU6A 5AJHA 1ZLXA 1FFSA 1PZGA 4PSDA 1RM0A 1PJSA 1TCUA 2ZK7A 5ALZA 1PFKA 1TKRA 4ESVA 4FYVA 1ODTC 1P5RA 1ITZA 1ZIPA 1VXOA 3RT9A 4GU5A 3S29A 4E2WA 1VCIA 2DFDA 2P5YA 3JR3A 4MTCA 3L6DA 4XUCA 1J22A 3INYA 4OHOA 3L41A 1BDMA 2PD4A 3HNOA 4NPHA 2Q7DA 4FT4A 2VK4A 5FOUA 2XITA 3E9RA 3GPCA 1I2CA 4ZT3A 2GYYA 3D8NA 2J6BA 2JFWA 3IAUA 5IZCC 1YD7A 5F7XA 1H0RA 2AWNA 4MW7A 2HXYA 2ORED 2E37A 2M1ZA 3OZIA 4MVJP 3RVDA 1EBFA 1ISIA 1FP4A 2BDEA 2FETA 2HJ9A 1ODFA 3F5MA 3H99A 4FZVA 3NYRA 4A0FA 4YCNA 3HCPA 5JFGA 5A1JA 2V1XA 5DHFA 1WW2A 4DT1A 3H8SA 1E1YA 4CDNA 3RRZA 4D4GA 3IP7A 1H2FA 1KYWA 2XDWA 2NUBA 3BFKA 3PQ6A 2C9ZA 5IG2A 1T6YA 4IDQA 1GLNA 3ZEIA 1FDOA 4LJRA 5AW1A 4AS3A 5E8JA 4I19A 3UIEA 2YWDA 4BQOA 1SD2A 3DAFA 4HDQB 3KTAB 1TMYA 1SN7A 3IKTA 1V8PA 3WAGA 1MTZA 2C00A 5DGIA 5F1OA 1MX3A 2VATA 4EKIA 1CVLA 1CP2A 2KX7A 2IYZA 1Z16A 1DG1G 1NN1A 3BREA 3O83A 4DLKA 3LC0A 1Z56C 3IX7A 3KB8A 4ZYTA 2VDWA 3LUCA 4TZ0A 3R5SA 4QHSA 4XUDA 4OHZA 5KB3A 4A6XA 1UXJA 4KSYA 5I8WA 3JWGA 4AP6A 4CF4A 3QFCA 1RKUA 3FOAA 1ZH0A 5JAQA 3P4XA 1LBIA 4U2KA 4ZGGA 5LB2A 1TDJA 1KEEA 2P9QA 3LQFA 4L2IB 3PVZA 5EQJB 1OWNA 3FOEC 1YZLA 1OLUA 3BWBA 4XQCA 2PG3A 2YFHA 1BXGA 1N3LA 1QHYA 2Y1FA 4NCIA 3WLEA 2CK3D 2H5LA 2VZLA 3UMSA 3LFTA 1U2EA 4ILKA 4IJUA 5DHSA 3O9MA 1F17A 4MPRA 1UMBB 1C0KA 1GKLA 1P0QA 1DU4A 2FSHA 2NT3A 2XYQA 3E82A 1O58A 4P4SB 3N6RA 4RA9A 2ZIXA 1NU8A 1CDEA 2W9XA 4TS1A 3KE9A 3DG9A 2O5CA 3BJMA 1XO1A 5M2QA 3GIWA 1P45A 2X3FA 1N2ZA 5A7FA 1OVMA 3RUCA 1OAAA 4C5AA 4WNYA 3HR4A 4E4RA 1VM6A 4GZ6A 1Z7WA 1EX7A 1XZGA 1J33A 2XRMA 1XU9A 3AVUA 2BL4A 5KC9A 3AKCA 2OPBA 1KYQA 1M73E 1XZQA 3DCJA 5F78A 4B44A 1QP4A 5EWJB 3F1KA 2X0IA 4GSLA 3ZLTA 2BZGA 5DWVA 2PANA 3W78A 1KC3A 1Z4KA 3I6IA 3K9NA 3ZXIA 4RHCA 3O8BA 1E61A 3RU7A 3EG5A 4JI3B 3R5FA 2JLZA 1AB5A 2C8JA 3M49A 2XMCA 3H9CA 3HB4X 3MJVA 4MP8A 1T9KA 3PZBA 1YIAA 1VYHA 3WVNA 2ACEA 3ADOA 3NT4A 2AMLA 4MRMB 1L3BA 3F47A 1G19A 3QVUA 1BH6A 2C4KA 4JD5A 4IDPA 3RFCA 5EMNA 3FPBA 2OP1A 1YJXA 8GPBA 1VCHA 1EB8A 2WF6A 2YOFA 1YASA 1Y3DE 3HGTA 3IVMA 2D4HA 4RK1A 1KY2A 4ZU6X 3ZIUA 3DZFA 5DHRA 2AB0A 3HCFA 3JQRA 4HJRA 1FCJA 2QSJA 1WZUA 2VNSA 3UMGA 1PIWA 2AVDA 5DIZA 2JH8A 3H9GA 2NVBA 1F38A 1ULBA 1X80A 4HNUA 4EW2A 3UGQA 2PTGA 3VU9B 3MS2A 2PYIA 4HQ6A 3RU9A 5L53A 1A69A 5LBUA 2ONYA 5LQKA 2HW8A 5KCMA 4JUDX 4L72A 4NMHA 3WOHA 4DQ0A 1NZJA 2G8LA 3LGSA 5IJ9A 1V2GA 2V0GA 1DCFA 1K97A 4YONB 4FCCA 2WQ7A 3CZAA 1D2NA 2EP7A 4QECA 3AF4A 2I2WA 4AJKA 3GUYA 4Q9JA 1FUEA 2LCFA 3EDCA 4QUBA 1FDWA 4KLAA 1Z7BA 3M5DA 4K81B 4QE3A 5EZ5A 2R0QC 1CJMA 3AESB 1C4XA 3GGOA 3WZMA 3VVCA 1E3SA 2AX3A 2R6HA 2XUKA 1ZWKA 3JW8A 4DJJA 2C77A 3M6AA 3CLVA 2Q2VA 1UC9A 2WYOA 1AB6A 4I2NA 2BGKA 3EBOA 2UYYA 3G88A 1E7YA 2FQ1A 4OI2A 2O1WA 2PJZA 1WHTA 2FPPB 3LQYA 2G63A 1M2JA 1E3WB 1QGUB 4JJ8A 3K0CC 4G8JA 2VSXA 1RP1A 5I5GA 5T4HA 1KO1A 1XOIA 3WLSA 1L4YA 4DCJA 3F73A 1E3QA 4YX9A 2OXCA 1I7SB 1AY0A 2XQJA 2PD6A 2L69A 2IPLA 1UBFA 3V4VB 1P4HA 1UBUS 1W9MA 2B9VA 2JHAA 3SBOA 2AG0A 3NH9A 2WTMA 3DYIA 3Q0TA 2WW8A 4INJA 1EUZA 1EM8A 1ECJA 1UL1X 1YZYA 4J0HA 3GJ0A 1EGAA 2AF3C 2JBAA 2UVQA 4S05A 4F8YA 3GFRA 4RDIA 4UHHA 4KXVA 3WKEA 2I67A 2FRXA 5DSXA 1KWGA 4FDMA 4TKVB 3RGWS 3VFDA 3W2TA 3WE7A 2W2TA 3GUVA 2YYZA 3CU5A 3ORFA 4FYHA 3EJ6A 4H7FA 4CM3A 4PFSA 3I0ZA 1WMFA 1AA9A 1NXOA 1VHJA 1X1DA 2WHYA 1SOAA 1Y6GA 1YS2X 2C9BA 2V4MA 5C8YA 5C8XA 1CC1S 4GLOA 1APBA 2H29A 4UBNA 2BEUB 4GZ5A 4RFSA 3FMOB 5EYPB 3OPVA 3CEPB 4BY9E 4PYQA 2ZBDA 4CQLB 1WVGA 2CKMA 3VYRB 3QBJA 3BM5A 4H0NA 4CDRA 5HX7A 3W3ZB 3I39X 3IJRA 4FINA 2QVXX 3NHUA 5B64A 4IRMA 5ALDA 1M1XB 1W85A 4EVSA 4DIMA 3STYA 3W5SA 4GM4A 5DM70 1UC4B 4IXWA 3GPLA 4Z0TA 4JUIA 2IXTA 2R79A 4FNOA 3S2GA 2AFHE 1U9YA 4AK9A 5JAMA 2MT9A 4KAAA 3H1PA 4Q21A 2WSMA 4Q4AB 4TZKA 3SBEA 2CCGA 1K6XA 3DBLB 1HETA 5EKSA 5F9MA 3VVLA 1AC5A 3V8VA 1RRVA 1EE9A 1I8TA 2OBFA 1N32B 2X8LA 3DB2A 1AQLA 3F67A 3FX2A 3OZXA 1X6VA 3OEED 2YUIA 1NC3A 5DZSA 1KIAA 2B7LA 2DKFA 3L6BA 3UWPA 4YRZA 2PZMA 3PFIA 4IJMA 3RLIA 1MFZA 2QRMA 4JP2A 3CWZA 4MR8B 3WRWA 2FW6A 5FR2A 1GNQA 4G5GA 1QIGA 1J1ZA 2G0TA 7ADHA 1VHTA 3TDNA 5JH7F 3EOBI 3HNPA 1SULA 2NIPA 3MS4A 4YMGA 2SCUA 4JVNA 3ADPA 3PDCA 1S7GA 4R4JA 4GZLA 5KQMA 1JG2A 5K6AC 3NBXX 4RHXA 2WU3A 1GCGA 4JAVC 3U3ZA 3ZG6A 2GAIA 2OHFA 4RSHA 2X3UA 2ZGVA 2VXCA 4K6CA 5ILOA 3THYB 4RXUA 1KZYC 4U63A 1RC0A 2AT1A 1Y3CE 3GFPA 3B89A 1UJMA 3MS7A 3M1AA 1BCRB 4LFCB 3CE6A 4PYKA 4OMDA 2ID7A 2O0MA 5HK9A 3IXMA 3LI2A 4BWYA 1TT5B 1VB3A 1WR8A 4FR5A 4X1YA 3GC6A 1UBMS 3GJYA 2FTKE 1GKYA 1HPLA 1VL6A 2CMKA 2H5EA 4GLFA 5IFKA 4RFLA 2QGNA 1Q16A 1VYTA 1GO2A 3OIYA 2Z4RA 4MKXA 3HCCA 1TKAA 1ZMOA 3NTLA 4IXTA 4MV3A 3GROA 3RTBA 1RWPA 3DOIA 3SEFA 5B55A 2OGWA 3P4UA 1I7NA 2Q6KA 2PZEA 3F7TA 1QYDA 4TWZA 1Z82A 3SHQA 4JU9A 2DETA 5L3VA 2A14A 3E7XA 4Y3UA 3R9XB 1XTRA 3QLEA 4MR9B 4BGUA 3WLKX 1VCMA 1P33A 2QYTA 4LISA 4MUJA 1XGKA 3RJ5A 2KHZA 2EP5A 5TEVA 1QS0A 1B23P 1D9ZA 1R12A 3EIFA 2OC9A 1JILA 2I2DA 2QWXA 3OF2A 5AXCA 1M5RA 5KYYA 5ALUA 1WE2A 4TYYA 3IPAA 4FDTA 1JJVA 5AKEA 3ZCQA 3RYHB 4B48A 1LBHA 4XIFA 5A0VA 2ZI7A 1H3FA 3JWJA 4NOKA 2RMKA 1G4AE 2HFKA 1YCHA 4G2TA 1FS4A 2A9KA 4X3OA 4ECAA 5D6NA 1HNXB 4UU0A 2ATIA 3ZXYA 5H3LA 4WNAA 5CXQA 4MULA 3JX9A 2BDUA 1KGDA 2DFLA 2H1OA 4YP5A 1V3UA 4IJVA 5DF1A 1IBRA 4KGVA 1GFWA 1VBKA 1ZESA 3M6VA 4OYYA 1V5IA 1PR4A 5A9RA 1ZFNA 2D8AA 4Q3EA 4HFNA 4JLNA 1NNLA 1ZUNB 1N6RA 2H0QA 1T5DX 3A10A 3QKSB 4OM8A 5JD4A 4F9TA 2OZLA 2Q3FA 2PSJA 1Q7BA 1BROA 5KSWB 1PZEA 1L8XA 3WKAA 1N5DA 1A5SB 2JNWA 3H8JA 5CCBA 4MDFA 1HFJA 3CVJA 5AXBA 3TZHA 2ZUUA 4F8JA 4DR4B 3OUZA 5KNBD 2XGMA 4IS3A 1HNZB 4F92B 2YJNA 4YGXB 2AW3A 1JPNA 2V7BA 1LSUA 4WJZA 4RVOA 2IFTA 4OHXA 1Y1LA 5T67A 5HG0A 3ZHVA 1OMOA 1NGSA 4YJ3F 3AFIA 3TKAA 3JWEA 4BP3A 1EFRD 1EXVA 1P2SA 1QKKA 1TYDE 3OZWA 4JHLA 3SS8A 1A97A 3UCFA 2PZLA 3MUFA 4XLTA 4OUDB 1ZGJA 2VYQA 4PAMA 4RVNA 1ZNYA 3V9PA 1IE3A 3DULA 5FTWA 2C4NA 1Q19A 1LQUA 3CA8A 3EC1A 1R8SA 1FP7A 4LC1A 4WASA 3UW3A 3WL7A 1KAGA 4HGNA 4XWOA 1GLGA 4LDJA 5U4XA 4G0YA 1RE1A 1QHNA 3FMGA 1BG6A 4J43A 3AKYA 3UK2A 1Y5RA 2NV2B 1MZVA 3UHAA 1YUBA 2FQQA 3UAGA 3H84A 1G3UA 4M0DA 4R05A 4DADA 1F0NA 2MSKA 3D6JA 3GRCA 3O8CA 1DOHA 2PS9A 4UKDA 4D82A 2ZQYA 3PEEA 1MIHA 2DGDA 2YYAA 3WXMA 4B79A 3NRJA 4I9NA 4F6RA 3TW8B 2VJAA 3TPFA 4M21A 4EYKA 2JLBA 4QKQA 3L77A 1F2DA 4US1R 1FDRA 2PLFA 4A36A 2V5AA 1GGKA 1A4UA 2H1IA 1GAXA 4V0LA 3SX4A 1F9EA 5K3SA 1A8HA 4CIAA 1MCZA 6ABPA 3IVXA 2OXTA 2NTEA 2CNKA 2TYSB 3L7JA 4E5DA 3DGFC 3QVWA 3RVNA 1TUIA 4CF6A 1QVZA 1A7UA 2H3EA 1S8NA 2X8BA 4HEJA 5IP5A 4M9SA 4IXNA 1ODLA 4ZYYA 2UXCB 1UK7A 1VL5A 1OT3A 2V74B 1M34E 3H18A 5IYZF 4FB4A 2RJ3A 4QU0A 4GZ3A 1ZD8A 5JCOA 3ZZTA 1ZI6A 4LRXA 4D8YA 1CJUC 1QHFA 2ZXEA 3AG5A 1KE2A 1V8OA 3RPEA 4JITA 4Z53A 1OYVA 1QAQA 2F43A 3G8AA 3P2MA 4HTFA 4DDVA 1OV6A 3D3WB 4JZKA 4A0SA 1J1IA 3BGVA 4OA5A 1KS2A 1SEPA 4BO6A 1P74A 4ZU3A 3TUIC 1VL0A 4TX1A 2PL1A 5A2GA 5ADVA 3NHAA 3R8CA 1YRQA 2CVHA 5I7WA 1ZP6A 4QGBA 2JFGA 1KY5A 1P72A 4LHZA 1X38A 4P5EA 5HF8A 4A5SA 2MSDB 1JSCA 4LXTA 3WGIA 3GLHB 3E2MA 1EA7A 1BX3A 1NBMD 2NTVA 4B6FA 3AJEA 4ZK2A 3IBFA 3H4IA 4MWBA 5ALIA 4FFBA 3SMQA 3FAZA 3JTEA 3A3OA 4O5OA 3IVCA 2I3ZA 1E4EB 1UKYA 3MGGA 3W4KA 4TTQA 5KU1A 3UKOA 4RZHA 1L5FA 3DKRA 2RI6A 4MPJA 2ZKIA 2PY6A 4GVLA 2YYSA 4LG1A 3ZHSA 1JEYB 4H0FA 3H8VA 1GFSA 2YXLA 2ID8A 4Y6OA 2W70A 1KGSA 5GIOE 1QRDA 5GZ6A 3VKWA 2ECFA 3OLYA 3E8MA 3L0ZA 4ZT2A 3JPWA 2ONJA 1MBZA 2UUPA 1IRIA 3PR2B 2E49A 1Z2OX 1E5VA 3O90A 3R44A 4NFSA 3WGUA 2WSBA 4IHJA 3QVLA 4DC0A 1ENPA 2QLMA 4AULA 1G66A 4JQCA 4RUKA 1U7XA 3W8FA 2RGAA 4FHGA 1GA4A 3OT5A 1CUBA 4KMRA 5IK2A 2C9DA 4KPFC 2RBGA 2P6OA 2ZAGA 4DJEC 4YCSA 2GT1A 3ETDA 5GPBA 1QGZA 4OY3A 1CQXA 2QYOA 3KQVA 3PUWA 4DVGA 2X0DA 2HQ1A 2CXNA 2ZB4A 4JLVA 1JHAA 5ICGA 2CXSA 3KU1A 4HPWA 1B0UA 1BX1A 4XJTA 4OUKX 2OGZA 1YBVA 3ROXA 3M1IA 1GHTA 2R1TB 3ZLJA 1BVRA 1KVUA 1UIRA 1YB2A 2SBTA 3A6HA 2QMUA 3EOZA 4IJ6A 4MQEB 4TTVA 1T8UA 1HE5A 3UK6A 4YP9A 4GWGA 2B2CA 3DL4A 4GL2A 1U04A 2E4VA 3UB4A 4HO1X 1JLSA 5EERA 2GEFA 4RJTA 4XSHA 3GYBA 4BDTA 1FVOA 4Y6LA 5FULA 2RH8A 2WIBA 3I3SR 4Q1EA 3PQ4A 5CDTA 1USVA 2FZLA 2XUGA 3W8RA 1Y7LA 2CLHB 3AJAA 4ZI2A 2B7BA 5DN6D 2PSSA 2IS4A 1LWNA 3F4LA 3H6HA 3GLFA 3WBFA 4E12A 3WNQA 1RXCA 2KPOA 4IIDA 1ZAKA 4TRJA 1CP3A 3OQMA 3MM4A 1X2BA 2O2XA 3BULA 3CLTD 3NYIA 3GJ4A 5K0TA 3FKSD 2AOUA 2WIJA 4BYMA 4KO4S 1FSPA 3SJBA 2QD2A 5AKJA 4ARZA 1EVYA 3DV0A 4RF5A 1KRHA 3WK4A 4BO3A 3O2QB 5IWCA 1DC3A 3QRWA 4KFUA 5BYJA 2IYUA 4XDGA 3I37X 4D0SA 2DU8A 2V5UA 4NJMB 3I9KA 4BO4A 3V4PB 3R5XA 3DDHA 2WWYA 3DL0A 3RHSA 1FPMA 2DQZA 3U37A 3P2EA 5DSTA 1FTNA 5CM2Z 2VYCA 1G9TA 2G6TA 2O9JA 1ZJ4A 3THSA 1SOUA 4OXNA 3WNVA 4G86A 1LNZA 3GRPA 3N2YA 1NJ8A 2BFCA 3P9RA 1CDZA 2K6GA 4HT3B 5L8VA 1E7QA 2BMJA 1KI8A 5BPHA 4S1NA 2OD9A 3NANA 5KYXA 1XEXA 2COEA 3B1JA 4B32A 1T10A 3R41A 4I1PA 4HWPA 5DCUA 2B36A 4Q3LA 5HBRA 4LHYA 1ZCBA 3J81A 3UFXA 5B2ZA 3ROPA 3W5JA 2XE4A 1LK7A 1RLTA 2FPSA 3OE4A 4PG7A 3LKVA 2PZGA 4M7OA 4YUVA 1E7SA 4IMIB 1KI6A 4KI7A 2QVGA 3K5IA 5CFNA 2GXUA 3R0VA 4QUJA 5HZKA 3QPVA 5KNCD 3ASVA 2CHUA 4MW9A 1Z4NA 2QQ0A 3TK1A 3E22A 4ZJYA 5BSFA 5C5EA 2JJ1A 1YOVB 2X1VA 4PLZA 2PCJA 3NTUA 1P5JA 2Z5GA 3IUJA 2J7PD 1DKQA 4IGKA 2VJMA 4KI0A 3WNZA 2PBFA 5E95A 1ECGA 3DDWA 3FYDA 3QGMA 4PIMA 2W98A 4W7SA 2PEYA 3ZR4B 2BONA 5AJXA 3K5WA 5BQPA 4HVTA 3ZHUA 3UAWA 4CUZA 5FRDA 2ZR0A 3QFTA 3D6MA 3STVA 3BDIA 4LI0A 3VPFA 1X8KA 3LS2A 5CJJA 1Z74A 2W2OA 4B6SA 1BFUA 3RT7A 2BUBA 3TLYA 3TUJC 2SKEA 1ZUWA 3A36A 2RARA 2X0FA 3S1LA 1JYFA 4UE6A 1SZPA 3LBNA 3ZC3A 1G4UR 2CMFA 3PUZA 4AL4A 4EP1A 3A4LA 4LYHA 3RH0A 1P2BA 4DXAA 4EB6B 1MP0A 5CIQA 3K6KA 3ZDBA 5L51A 1P4RA 5ICCA 3SPXA 1PG0A 2VJNA 5JNLA 2AZTA 2B8EA 1VIDA 1FRVA 1R9GA 1WLSA 1BE0A 2BGJA 1Z4OA 1DO2A 2QRZA 2VTDA 1RTTA 4JH0A 5JMTA 5JWOA 3N0WA 1UK9A 3MB5A 2C1XA 5D1NA 3QKUA 2ZBPA 3W5AA 4ZAYA 4OH1A 3KAJA 3ZIAD 4K9KA 1Y7IA 3QUSA 3GLVA 1CJBA 3R74A 4COOA 5K8CA 1ZMXA 3V6MA 4N9WA 1I6LA 2E1PA 2VP5A 3MD0A 2AKEA 2Z0MA 1GAJA 1F1JA 3NORA 4WK4B 4G0WA 1YBHA 1GGVA 3U81A 4PQRA 3L7MA 3FUTA 2ZRBA 2QTNA 1U7HA 1TJ4A 1QC5A 2RC5A 3DTVA 1XEWY 3PD1A 3P9QA 3R6LA 2JK1A 4FKBA 4I5EA 4WH0A 3USES 4BNIA 4F8EA 2WYIA 4LRUA 4N6OA 2HF7A 3LYLA 4KXUA 2YRFA 4MRAA 2B78A 3ZBTA 1ZUD1 4BUJA 1J42A 1HSOA 1D04A 1IEWA 2PLAA 4E4YA 4BKMA 5EIFA 2YHSA 2CLCX 5I7EA 4TSFD 2R87A 3MJ4A 3QJGA 3UCXA 1QP0A 2GHQA 2PUEA 1K75A 2NYRA 3WQHA 3L0PA 4NCHA 2CHVA 1PNOA 3S5UA 3AJ9A 1TYZA 2E4XA 3NXKA 4AC9A 4DNOA 1VP3A 3ROMA 3Q41A 3ZGYA 4HP8A 2QQEA 3JQ7A 3VNUA 1RXYA 2Q3HA 4WZBE 1V7CA 4WPGA 4TTPA 1ZJJA 4Y1RA 1E94E 1ZGBA 3EVFA 5B7PA 1XU7A 2NXJA 3OSUA 3TRFA 1O95A 4CM1A 1PJ3A 5TPWA 4W99A 3D4LA 2WSSD 3O1JC 1D2HA 3SVZA 4PR3A 1FFBA 2CXRA 4YV0A 2AN4A 4LXHA 1E6WA 3AVXA 4E09A 1VJ0A 1X9IA 1G0NA 3OA0A 4OHPA 4RENA 2E89A 4JT9A 4U9UA 1KJ9A 2FPUA 3B78A 1XTKA 4Y1FA 2FCAA 5AVKA 4RTKA 4BTLA 3FCOA 3EZ2A 4ID9A 1E9VA 1YJ5A 3R3JA 4M37A 4X7BA 1UZUA 1TO6A 4U00A 2OGSA 4GUAA 3R7WB 1LDMA 4NATA 1ZRSA 4J29A 4V02A 4H31A 3MVEA 2DG2A 3FH0A 3K35A 4WW0A 3E27A 1BQ4A 3WLTA 3JVEA 4BBZA 2D2IA 1W30A 1YUNA 1NR1A 1X19A 2D4AA 3T3HA 5TGDA 3ANMA 1Z2DA 4CTKA 1Z5ZA 1JE1A 4N03A 5E6UB 2VCHA 1E79D 1GT6A 1JHRA 2FN9A 2WD9A 4FGKA 2DJ5A 3QITA 4QT0A 5EP2A 3B52X 5TMEA 3F46A 1T8PA 2VPIA 3S28A 3KYDA 1IM5A 3UT6A 4H3KB 5IWAB 1QK4A 5AW2A 4XIIA 3SSNA 1A9ZA 2GZSA 1EX9A 4NAVA 2FK8A 4ODIA 4AN0A 2UVPA 1CJKC 1TU3A 1PJQA 2G7ZA 3K4PA 2BHLA 3V80A 4PRZA 3LGAA 5EHQA 4JP5A 1Q3KA 1GGHA 4ARZB 3VNSA 4UFOA 5CX1A 5F77A 4AJEA 4YCAA 1R3UA 2JK0A 4LV5B 2ZCJA 4NI5A 5H02A 1Y42X 3AOEC 3NVKI 1CEQA 4LQDA 4K3VA 1Z8FA 2QJWA 2VK1A 5AXDA 3F8SA 3IRVA 4A03A 1NSYA 1P5ZB 1CD5A 1Y3IA 4ZI7F 3H05A 1GFZA 1X8LA 3GRRA 3W3AH 4B80A 3PLAE 3ZJ5A 2W4QA 1K8ZB 2HYIC 4EBFA 3FCUB 4CQLA 1F2TA 2IYOA 4I66A 1GZDA 2OT3B 3K6SA 5JBQA 5ES3A 4G4SP 4MS4B 2AG5A 4ZC8A 1QZUA 2VP0A 4F2HA 3IJEB 3FOBA 3BGDA 1IB0A 4QU5A 1R88A 1ZIXA 4CQNA 5HS6A 4DT1B 1JL3A 3TSCA 3LQRA 1Z8HA 2RGYA 1XCGB 1HDZA 4UCQA 4EYGA 2XWSA 3NM6B 1H5QA 4GWLA 1SBYA 2IRWA 4Y30A 1T5HX 4K28A 5I3CA 3K9BA 1ZC4A 4MGIR 1U81A 4M1EA 3WIDA 1ICEA 4AVYA 3KETA 1JEOA 1XZJA 3RT1A 1WPRA 3MTIA 1EUCA 2ZQ5A 5TT1A 1R37A 3CMCO 4DA7A 2HV8A 2GNPA 1IHYA 1J97A 5EWLA 4JLUA 2X5XA 3WIBA 5HW0A 4H6WA 5IC4A 5IYZA 3AW9A 3FNGA 1AQJA 4LZWA 1QR6A 4JLAA 2PXHA 4YRRA 2YYYA 4G0MA 2R65A 2CNNA 1HT1E 5KDOA 3U19A 4RXTA 2I1VB 4WACA 2J7PA 1GNTA 3E4CA 4BVFA 5JCJD 5B2EA 1SOWA 5CDFA 5A3VA 4DLAA 3ZJTA 5BUZA 4QBGB 4EVRA 3GLSA 2XBLA 3BWMA 1TTPB 3U16A 5IM5A 2D5BA 2QL6A 2FV8A 1Z22A 1PKXA 1QM5A 4KW7A 3RHFA 4NWIA 3OTQA 3GI1A 2CMHA 5L4LA 2AFHB 4IDGA 3USZA 1XL1A 1DV2A 2FH5B 5D7BA 4ZOAA 3VTZA 2HADA 3NHPA 5KW