4KFRA

Structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with sulfate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
207
structure length
204
Chain Sequence
NPDDIVVLVGRKKSGKSYLIKHYFIPVLKAHKISYIIDDHNLGSEYSKFGYNATSLSDIVSKQYVVVYDRAKNDDFFEKLWQASKLHSKKYGTTVLIIDEAYYHFKYKQKVTPAIDEALHANRHAGLGLILSTQRVYDLMPIVYKQADLIIMFYTREPNELRWISKYISAEAAEKVKTLKQYHFLIYDVNSQTIKIHKPILEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Genome packaging NTPase B204
publication title The Structure of the NTPase That Powers DNA Packaging into Sulfolobus Turreted Icosahedral Virus 2.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus 2
total genus 63
structure length 204
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 3.-.-.-:
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kfrA00
1TU3A 5GJBA 1R4AA 2AXNA 2GCOB 1XTRA 2WWXA 1QBKC 1T8TA 3GFPA 3TUIC 2MMCA 1TMKA 3O47A 1DAFA 3K70D 4JL6A 3JZMA 4MKGA 2QAGA 3VR6A 2ORIA 3O8RA 3CUEF 3A4LA 1W36C 1ODFA 4URZR 3D7MA 4D0NA 1X1SA 2X8AA 2VHQA 2IYUA 2G77B 4XWAA 4A36A 1WCV1 1KO1A 2VHUA 5HE9A 4UXHA 3W6NA 2CHGA 1E2KA 5DHFA 5FUYA 1YU9A 1H8HA 3AUYA 4TT3D 3BFKA 2O8BA 1X1RA 2ODBA 5LBIA 1N0WA 1HYQA 1NMYA 3GQBA 5FL3A 5FL7D 4JVLA 4GP7A 1IN5A 4RJLA 2XJ4A 1ZAKA 1FFHA 1N25A 3T34A 4G5RA 5TDHA 4ZO4A 5KNDA 3FMIA 1JI0A 3Q8XB 4PQFA 3ZD6A 2A9KA 3UWOA 4JLNA 1ZC4A 5KSPA 3ADBA 3MCAA 4Q1BA 4US2R 3VR3A 1JECA 1NMZA 3DL0A 4HEJA 5DH9A 4E07A 1S1CA 2EW1A 4C0HA 5JJIA 3M0EA 2ZRKA 3LVQE 3D31A 2GBLC 5F3WB 4MDEA 2YC4C 2CLCX 4IDNA 3GPLA 2ZI3A 1EFHA 1VPLA 421PA 3QXSA 2HJVA 1CRPA 2PT5A 1OFUX 2ZJ5A 1Z2CA 4A6XA 4TYNA 2B7BA 2HT6A 3KQNA 3RWMB 4B35A 1Z3IX 2UZIR 2WV9A 3KJIA 2A5GA 3KKNA 3PUYA 4N3NA 1EFTA 1FQJA 4PQRA 5C1BA 4GOKA 3GJ7A 1J99A 4IJMA 4O25A 4LBYA 4Q1EA 5FPSA 2IS6A 4EQ6B 3KXLA 5FOSA 4P33A 2NO7A 4WA7A 1VHTA 1JQJC 1T8UA 2OLKA 2J1LA 3C8UA 5EP2A 3TUJC 1MR3F 4BFXA 3FB4A 4B48A 1GOTA 3PV0A 4M1OA 5C4GB 4AG6A 2QMHA 1OKKA 3KB1A 3BH0A 5CK4A 1LTQA 8OHMA 1ZM7A 2C04A 4HDQB 4OQNA 2BMEA 1IAQA 5K8LA 4EJSC 2R65A 4PTLA 1CTQA 2MSCB 4M2LA 1IJEA 3UANA 2Q9CA 1UEIA 3TH5A 1SGWA 3PIRA 1U9IC 1AM4D 1N5LA 2OSBA 2PLFA 5KSYA 3D3QA 4PSVA 2DFLA 3NVAA 1W0JD 4MYHA 2DCUA 3ZS9A 1YZLA 4IHQA 2VP4A 1LB1B 4OBEA 1G5TA 1RRCA 2JGNA 1W0KA 2IXFA 2R9VA 3EZ6A 1S1MA 2QP9X 2UVQA 4TMZA 4I1UA 3BXZA 2IWRA 2A78A 2VYFA 4QL3A 5AUNB 2ZYVX 2OAQ1 3UKDA 2ZUDA 6Q21A 2RGDA 1NN5A 2REXB 1AGPA 1HQCA 2FPLA 4P31A 2JCSA 4Q7MB 4EAQA 3QENA 1FZQA 3QI2A 2GEUA 3LY5A 2PH1A 3TVDA 2IUSA 4XVUA 4PHFA 1OHHA 1VDZA 3TVTA 4E03A 2W58A 2WKQA 4Q5IA 3PEUA 3QOFA 3AF1A 2WOJA 1DO0A 4TQ9A 5EP3A 2FDCA 3KXKA 1XU4A 5KPJA 1GP2A 1E32A 2NZJA 1BKDR 4LSGA 1N5JA 1CP2A 2V1XA 4B76A 3KQKA 4KFRA 2Z43A 4BEBA 4LV8B 2WVJA 5JWOA 3EARA 3QBTA 4QHYA 2ZRDA 2CK3A 1ZNXA 3R9XA 3UMRA 1TQDA 2W0SA 2ZROA 1QZXA 4OQLA 4TYQA 1KK0A 1SVMA 5FUXA 3GJ8A 2ZR7A 3FYHA 1XEXB 5FTNA 621PA 3ZZ0A 3PUWA 3ZVNA 1Z08A 3R7WB 2NIPA 1J2JA 1ZJ6A 4TL8A 2MMGA 1LVGA 5DN6A 1F60A 2JASA 1PVOA 3K0FA 4OHWA 4K46A 4XOIA 2GZHA 3AF3A 3A1WA 5L3RA 4JIMA 1DAGA 4UNQA 1HTWA 2ZE5A 2QGZA 1IQPA 4B2PA 1Z22A 3EASA 5JJKA 2C2HA 2VBCA 3H2YA 3TRFA 4Q9HA 3QKUA 1C4OA 1Y3AA 3QE0A 4Q19A 1QHGA 1G7SA 2D62A 2OILA 3THXA 3HYRA 1VIYA 2CJWA 1SZPA 1GL7A 2ZRGA 2GTPA 4P4SB 5CLQA 1VIAA 2BVNA 1KI1A 2V6IA 1T3LA 1DTSA 1XWIA 2QAGC 3HDTA 3KKMA 1SXJA 4HAWA 1BIFA 2CMKA 4OI0A 4C4PA 3QJYA 1OB5A 4KVGA 1YE8A 2H17A 1UKYA 2DB3A 2O8EA 2ZSBA 1GNPA 4LJ5A 1GTVA 3CRW1 5KU1A 1W36B 2J0SA 4CEIB 2XAUA 2NZ8A 4AKEA 2FA9A 1T6NA 2H8KA 2VF7A 4F7WA 1OIWA 1OH8A 2CCKA 4V0KA 3X1DA 2F9MA 4Q4JA 5EXTA 3SR0A 1UBFA 1UEJA 1AQYA 1R10A 5EUMA 1G8YA 4MITA 5H8WA 3TAUA 4L8GA 2CNWA 3K8YA 1VTKA 2ZRFA 2JJ1D 1UADA 1R0YA 3DVLA 2HYDA 3CZQA 1RJ9B 3ASZA 2WKRA 4FW9A 4BASA 4BWYA 1E2NA 3CR7A 1Z29A 4V0LA 3FOZA 4A6PA 4CDGA 5SZHB 2FH5B 3M1IA 1KTVA 2ZRMA 5G41A 4ZPXA 5AJZA 2ATVA 1TQ6A 4NCJA 4NCHA 2IS4A 2WJHA 2Z6VA 1COWD 2C9YA 5AK0A 1GRRA 4WZAE 1Z0IA 1G7RA 3KTAB 3BFXA 4K8OA 1AIPA 3EZ2A 2PCJA 1MO4A 3TLXA 2LCFA 4AWXA 4M1YA 1Z0FA 2ZI4A 4LI0A 3U3MA 1P9RA 3IQWA 1F5NA 2QG6A 1ZBDA 3W9YA 1Z83A 1ZCBA 3GLIE 1CLUA 2BIFA 4RD3A 1II8B 1D9ZA 1RYFA 1SVSA 5A5GA 2W6IA 2N46A 3DM5A 4LRWA 1OJLA 4JT4A 1OIXA 4BUJA 1JEEA 3ND8A 5HKKA 5KHOC 1M7GA 2FZLA 3FGNA 2WTUA 1DPFA 4D4KA 1W1WA 2IUUA 2VHCA 2R8RA 3RAPR 2GJ8A 5BYJA 3B1WA 3EAQA 2Z5FA 3B60A 4TYWA 4S2EA 1NY6A 4ESHA 5KTYA 1MT0A 1N6PA 1RRGA 2JDID 2ODWA 2XITA 5FBRB 3GFTA 1Z06A 2ZS8A 3FVQA 4YXWD 2KBEA 4GOXA 4HUQA 1UKVY 4EJSB 1IONA 5AJWA 3W5IA 3LQRA 3R20A 3U60B 4TTQA 1LF0A 5GJCA 1RZ3A 4HYYA 2ZUBA 5AJYA 2JLXA 4LV5B 4IVPA 1FP7A 5K8TA 1NLZA 3SJBA 4RKEA 1WA5A 2GF9A 1FL9A 4PHGA 5J4LA 1R5OA 3TR0A 2XGJA 1XD2B 2O52A 1Q44A 1BYUA 3DHWC 2AK3A 2BEJA 2C78A 1D2EA 2F7SA 2ZAMA 3E5HA 3K0AB 3OAAA 4RVCA 5DYGA 4ZKEA 2FN4A 2P5SA 4DT1B 2GILA 3VNUA 2FGKA 1Z63A 3AF2A 4Q1AA 5EUQB 1Q57A 2EWWA 1U2RA 2ZVQX 1AKYA 2GAAA 2G6BA 2ZM5A 1KMQA 1EGAA 1YJ5A 3RDPA 4TN1A 3BD9A 1OPXA 2GXQA 1F3OA 2WMNB 3CNNA 3P32A 4XD7D 3RLFA 5GJVC 5KYKA 4IDHA 4I4LA 1P2UA 5KDDA 2BC9A 5JEEA 3IILA 1X3SA 3KDSE 3O8BA 4LHYA 4LBVA 4MGZR 1G8GA 2AFIE 3IBYA 3GEIA 1HUQA 3JZAA 2XB2A 3K9HA 2O8DA 1W4RA 2FG5A 1E2IA 1IBRA 1ZD1A 2ANBA 2CL7X 3C41J 5A4JA 3NKVA 2C96A 2QP3A 5G3YA 4JLVA 1BO6A 1BMFA 2VHTA 4H1VA 3ZH9B 1GRQA 4OL0A 3ASYA 4QBGB 5EQTA 2HV8A 2BV3A 3VKGA 3CRVA 1I2DA 1EFCA 3QNUA 4CRWB 3D8BA 1MABA 1GNRA 3LLUA 3LW8A 3CX7A 2X77A 3TIFA 4W5JA 4NONA 5B58C 2ZSFA 4KVAA 4ESVA 3VR5A 4FXPA 3B1YA 4PXAA 1LS6A 2ZSDA 2WIAA 2P6RA 2QN6A 3U7EB 2RGCA 2BJWA 5FOTA 2JAQA 1JNYA 1SXJC 2SHKA 3U2QA 3WP1B 1P7CA 2F1IA 2PL3A 2D4HA 1ZW6A 4PC6A 2IT1A 4LJ8A 2ZYUX 3S1AA 5JRZA 2VH5R 3QG5A 5TVKA 2O8CA 1GUAA 2ZI7A 1S8FA 1UDWA 2QAGB 4KFTA 2ZJAA 2IL1A 3HU3A 3B9QA 3QKRA 1KI8A 4JVSB 2B8WA 5CDFA 1S9DA 5C18A 4D0LB 3U4QB 3WYAA 1EG7A 1NSTA 2ZJ2A 4LJ9A 1E96A 4PZLA 1R8QA 5J47A 4FWTA 1JR3A 2P65A 3MMPA 1TUIA 2F1RA 4UNSA 3OEED 3U3RA 3GLHA 2O8BB 3UWKA 1TUEA 2BM0A 3OF5A 4BFWA 2C9OA 1NJFA 5TB5A 4O2RA 2ONJA 3IPYA 2XOKA 5JRJA 3SE0A 1M1YE 3CIOA 2NTYC 3O8CA 2PZFA 3P20A 2QU8A 4AKHA 3G82C 1J70A 2FE4A 1G3UA 1WRBA 2LKDA 3ZZTA 1P75A 4QGGA 3T1TA 4BRWA 1NRJB 3A8TA 4A92A 4LK2A 4Z1MD 3NEYA 4AKGA 1JJVA 4Q9LA 5LPNA 4LY6A 2IF2A 2JEOA 3GD7A 4P32A 5KUTA 5L3VA 4C0LA 4NL4H 2IYYA 4MRPA 4ASUD 1MOZA 5SZKB 4BLTA 4F93B 5ELXA 4A82A 5KDOA 1XZPA 3TW4A 5IT5A 1T9HA 2LWIA 2V7QA 1DELA 1XB2A 2OFOA 3RRZA 3BS4A 2EWVA 2NGRA 4US0R 3OZXA 1GL6A 4ZDWA 3WY9A 1WB9A 2NMVA 4KITB 1IXRC 2E9SA 3ECCA 1TAGA 4Q9JA 1TEXA 2F3TA 5DSZA 1F2UA 4M1SA 3OEHA 3AH8A 1QHHA 2RGXA 3GCGA 2GRJA 4OJKA 1XTQA 1PLJA 2Z0MA 3T15A 5DLQC 2VSFA 5JHHB 1JAHA 3CZPA 4QHTA 3WP0A 1RC8A 3GJ0A 2GVDC 2YOGA 3V4RA 5UKDA 2G9NA 3LDAA 4BLPA 1PLKA 3E1SA 4IRUB 1VYVA 4EFMA 3PENA 1E1QA 3NTUA 1YRAA 4JL5A 2XZLA 1G4AE 5FBLB 3HPRA 4HB2A 2QPAA 4JSYA 4XVQA 3THYA 3NDBB 1ZIPA 5E7MA 4ZI3A 3HR8A 4OI2A 1DARA 2ZVPX 3EWSA 4KXFB 2GDJA 3SQXA 1Z0AA 2XJ9A 4W7SA 4AG5A 2BJVA 2DR3A 4JSTA 2DBYA 3BH7A 1N6HA 4PAOA 1F2TA 1PV4A 4IXNA 4NYJQ 2WWYA 4DZZA 3KQUA 1GILA 2ZS7A 2DY1A 2BCGY 2QSYA 3KFVA 4DEXA 5GJWC 3NWJA 3AM1A 1CJMA 1EFRD 1QDEA 2WPDD 2AR7A 1E6CA 3AQ4A 3VU9A 1N5KA 2N1BA 2QA5A 3FPAA 1JPJA 1E1RD 1ESMA 2B21A 2MSEB 3L43A 1OIVA 3I8SA 2F43A 3IDQA 4ACBA 2Z4SA 4NYJR 5JJLA 3T1OA 5CLLA 4QM7A 3CRMA 3ETLA 3A1TA 3TJZA 1Z07A 4QM6A 1W4CA 1WBDA 2FSGA 4TMWA 1R5NA 2IK8A 3IIKA 1PUJA 3CX6A 2FZ4A 4JLPA 1IN4A 4C0SA 1G3MA 2ZRPA 2JIZD 4LPKA 5IK2D 4JYCA 4JT2A 3VR2A 1D2NA 3EZ7A 1KDTA 3MUFA 4AYXA 1KI2A 4GI7A 4WVFA 2PMDA 5FOVA 2NQ2C 2OLJA 1XPOA 4OK5A 3KKPA 2GVZC 2ASEA 4FMDB 5A0FA 5CM8B 3UG7A 4TYYA 4ZV4A 2ZITA 3LXXA 1WMSA 2OE2A 1KNQA 1NJGA 2JJ2D 4Y0VA 1OXTA 5C2JB 5IDVA 3GJ3A 4MUBA 2DPXA 5CB6A 1TNDA 2WWHA 2G3YA 1G9XA 2HT1A 4CEJA 4A0GA 3GJXC 2QT0A 5F2EA 1TU4A 1R7RA 3SQWA 2QM7A 2WMOB 4TMTA 3WRXC 4V0OA 2J0QA 3AKCA 3K0FB 1H65A 2BCJQ 1XEWX 5JI2E 3ADCA 2X2FA 2ZS9A 1T91A 2RGBA 4D6PA 1P6XA 4RD2A 3UG6A 5JWHA 3R9IA 2HF9A 1TEVA 2JLQA 4BPBA 3LX8A 1E4VA 5J4HA 2GESA 3OIWA 3OFNA 2G0NA 5GVSA 2YYZA 3EZ9A 1RKBA 3THXB 1Q1QA 4KBFA 2R62A 3MGCA 2CJWB 3FDIA 2BBOA 4HZUB 4BRUA 2GCNA 4C9BA 2QT1A 3IKJA 4RZ3A 3SEAA 3VR4A 3MRSA 4GL2A 4L9WA 4A1FA 1UJ2A 1MH1A 2W6JD 1NVWQ 4JLKA 4DLSA 2XTZA 1IOZA 2OCPA 5BWMA 1KSFX 2A2ZA 2V54A 1L4UA 1WP9A 3LH5A 2RAPA 3I1FA 1B0UA 3K0SA 4M8NE 3W8NA 1OH5A 4IDPA 2I1QA 4NHOA 1NP6A 3H0KA 4QRHA 2X19A 4YMWA 2F1JA 2V8OA 1IY2A 1ZD9A 2FJUA 1EFUA 2QMOA 4B75A 4BECA 2NOAA 4UNPA 4D26A 1N2CE 5FUWA 4Q4JB 2EFDB 3IQXA 3Q5DA 1D9XA 1XNJA 3CNOA 4D82A 1AKEA 4LGMA 3KZ1E 3U7HB 4PC1A 1P62B 2O5VA 3P26A 2IYVA 721PA 1YR6A 1E2PA 3QF4A 2C77A 2ZYWX 3I61A 4OHZA 1QHXA 3BB3A 4UJ3A 4DBLC 4XH9B 1Z2AA 2GXSA 1BOFA 4KU4A 4DCVA 5FR1A 4AY2A 1FOEB 1JXMA 2HEIA 2G1JA 4RD4A 3SJCA 3N2IA 1L4YA 1W5TA 1E94E 2QPTA 3ZGXA 5DNYB 4R2HA 2JJ8A 2HCBA 5FUVA 5EXXA 2JLZA 1M7BA 3MWJA 4DRZA 1G5RA 3VQTA 4DUGD 4RFSB 2OEPA 4CEHA 4BEJA 1E2JA 1WF3A 2FSHA 5TARA 3HJNA 5FH9A 2RB4A 1MRSA 1E9SA 4LC0A 4TZ6A 3BB1A 2ZE7A 3QVVA 4D81A 3GLGA 3PEYA 2GAOA 3LVRE 2DFTA 2YHSA 3AVOA 2FGJA 4G5GA 2G83A 5EE3A 4PFSA 1ZUHA 4Z8XA 3VFDA 3VMFA 4E5UA 2GXAA 1YZKA 4DCNA 4WOPA 2KWIA 4XSGA 4JBWA 2IS1A 4FMDF 1XCMA 2W0MA 4AC9A 1UAAA 2ZJYA 1ZIOA 3RSLA 1Q1BA 2X1VA 2EFCB 2XXAA 3U7FB 3BJIC 5AJVB 1ZUNB 2BMJA 4EPRA 2FPMA 4TMKA 3LFUA 3Q85A 4KFUA 4KLZA 4RZUA 1TF5A 5TY0A 2J87A 1W5SA 4TT3A 1T3SA 4JLOA 3R8FA 4M9XA 4JJKA 1CEEA 3WYFA 1FP6A 2IYWA 1S2MA 1US8A 3CBQA 4HUQB 3CH4B 1ZM9A 4KV9A 1MRNA 1KO7A 1G18A 3FHCB 1RYHA 2QEQA 4DKXA 2WBLC 1ZP6A 1D8TA 1Q0UA 4DCUA 4B2IA 1E98A 1I4LD 3HU1A 1JQLB 4P4TA 2XSZD 2OESA 2CVHA 4JBYA 3NBYC 3PVSA 2ZRNA 1E9FA 2Q6TA 4W5HA 1MO5A 3KL4A 4MKIA 4PC3A 2J59A 5DHAA 2NPFA 2W2TA 4N0DA 5M04A 3NBZC 3WNCA 3U44A 5LD2C 2J0UB 4MDFA 1AZSC 4GNKA 4M1MA 2V1UA 4ZDKA 3CPJB 3H84A 4JYBA 3B1XA 3SU8A 4URVR 2YJTD 5GADl 1NMXA 4KYIB 2GZAA 2XTMA 1KAGA 4FN5A 4R98A 2FFQA 3AP2A 5G53C 5KO2A 1W46A 1ONBA 4DLYA 4MQBA 5JCPA 3VKHA 1NBME 2WAYA 3U3OA 5KSOA 5K8UA 1A2BA 3NC1C 4F4IA 4MYUA 1Q22A 1YZGA 1QHYA 5EE0A 1XZQA 1VHLA 1IN7A 1GKYA 2WHXA 4QXAA 1ZM3A 4EIWA 2RGEA 3WRYC 4LZZA 4LJ4A 1KI6A 1DADA 1OFTA 1VG0B 3QXJA 4M9ZA 4GMDA 4ARZA 2FF7A 3VKWA 1OYWA 4Q4AB 4B3XA 1D6JA 1G16A 4F91B 2WWIA 4LYAA 3SS8A 2O0KA 2VLIA 4IDQA 3DM9B 2PMKA 2BKEA 2BM1A 4U5XA 2RGGA 1VECA 3M6AA 1QRAA 2OBNA 2J5XA 2CK3D 4D4MA 1GKUB 1W0JA 5KOYA 2CL0X 1KSHA 1EK0A 2ZANA 2FEMA 3IHWA 1DS6A 4TSFD 1DE0A 1AS0A 1NL3A 1E2FA 3THWA 4G5QA 3M4YA 4QNMA 3B7GA 3T12A 1R8SA 1OF1A 1VYUA 2QTVB 3I3SR 3NBFA 1E9DA 1EX6A 2Q9AA 4WZ6A 2C8VA 3CRRA 1SVWA 1G4UR 2N42A 1P60A 3U6KA 2ZPTX 3PEWA 2GJAA 3QPVA 3N5CA 4YDHB 2AWNA 4IOLA 2OM2A 4IEIA 5H68A 4XJXA 4HZIA 1KI4A 3S1AB 2R44A 3L0PA 3TSOA 4RD6A 2O8CB 4DVGA 4QBFA 2XNDA 3BE4A 3FE2A 1ZD8A 1G21E 3PFIA 3CRQA 3HU2A 3QKRB 1KDRA 2AK2A 4PPQA 4XWKA 3Q72A 1S0UA 2O8FA 4GFDA 4RSGA 1R0ZA 4HUTA 3T5GA 3BERA 2I3BA 4DHEA 1T3HA 2OCAA 4DIEA 3KKQA 3QG1A 4HLQB 1S3SA 2QMUA 4CIDA 1S4QA 4MH0R 1ZU4A 4B33A 4PPFA 3RNLA 3AVUA 1M7HA 3NHBA 2XNSA 3H86A 2NPIA 2ZUCA 1TQ4A 3W6PA 5JSZA 2XEXA 3IO5A 2A5JA 1YHNA 4JLDA 2F55A 4L5BA 1EESA 3K0CA 4OYHA 1XXHA 2VEDA 5E7IA 2ZI9A 4QC2A 2WM9B 4NTZA 5JZVA 2NO9A 1OXVA 4H9GA 3DZ8A 4PANA 1ETUA 3I72A 4FI3C 4YQFA 4IOMA 3LW7A 4PZYA 2CNWD 3NC0C 2DFKB 2GK7A 2F6RA 2ZRIA 3EC2A 1C9KA 5HZKA 5G3ZA 1VKJA 2ZU0C 3CWZA 2BBWA 4YMTA 3GJ4A 4K81B 1HE8B 1C1YA 3TSWA 3HP1A 2V4ZA 4OHYA 1L2TA 1N0UA 4FCWA 2QP4A 1E2HA 1QG2A 4HSEA 1VG8A 5DISB 1FQKA 5DIFA 1F2UB 3K70C 2YV5A 1QHHB 3OHMA 4NCIA 2QRNA 4TL9A 2AL7A 1TQ2A 2WOOA 1UKEA 2VTKA 3H1TA 1GIAA 2WWGA 4G5SA 2WWWA 1PJRA 4HAZA 2XZPA 2RHMA 2PZEA 5G40A 2ONKA 5TV2A 1QF9A 3RABA 2QORA 5IRCD 2WJIA 4M1TA 4ABYA 4EUNA 4BFVA 4D4LA 4HAXA 2ZU6A 2XX3A 3I73A 2Z4RA 1NVXQ 4HLDA 3SHWA 2WZQA 1K8RA 2WIBA 5FPYA 2HJGA 4ZDIA 3THYB 4QBHA 1VMAA 4UQOA 1KGDA 4EPXA 2ERXA 3F0TA 1TX4B 4FMCB 1NKTA 3K53A 4OK6A 3L2OB 4DDTA 4GZMA 3MFYA 1F2TB 2D06A 4JLBA 1XTSA 3EXAA 3IEUA 4UJ5A 2IUTA 1Q12A 3JVVA 1SVKA 3KX2A 4IVRA 2ANCA 1CULC 2YWGA 2D2EA 4JLJA 2HCJB 4HI0E 1KK2A 3KQLA 5DI9A 3C16C 4JKIA 1KSGA 3VU9B 2YWFA 3A58B 4O0MA 3KJEA 1YZQA 4E22A 1DAEA 3KJGA 3T5DA 1NN3A 4MKFA 3VNVA 4PPGA 3FHTA 2F43B 3I32A 3ICQB 2A5DA 2DFNA 4A0HA 3CM0A 3LV8A 3TGPA 1AJEA 3CF0A 5EP1A 4EPVA 2V6JA 5L3SB 1R6BX 4Q47A 5JBQA 5LD2B 1NN0A 2ZSEA 5J40A 3LX5A 4OI1A 1DG1G 3X1ZA 1T4GA 4ON9A 4U00A 4BLSA 3SOPA 821PA 1NG9A 5CB8A 1NF3A 3ZIAA 1YKSA 1Q1ZA 3ADDA 2KBFA 1ZRHA 2C98A 4RD1A 3LQQA 2JLRA 1YQTA 4AIIA 1PUIA 2D2FA 4RCZA 5H70A 2VPPA 4OQMA 1RRPA 4MRVA 4D80A 1S96A 3EX7C 1Z6AA 3QSYA 4WBSA 2GJ9A 2YWEA 5BN3A 5AR1A 1E2QA 1HEIA 4X8MA 5E3HA 2IYXA 3RS0A 3THOA 1RE0A 4XTRA 4PC2A 4EFLA 1XTIA 2QUZA 1ZU5A 2JDIA 4TLEA 4YXWA 4J0QA 1RIFA 4UXIA 3MG9A 2RHDA 1TF2A 3PCRB 3GEEA 2Q9BA 1U8YA 3MLEA 4G0NA 1NIPA 1CBUA 1UF9A 1ZNYA 4N1AA 1SKQA 4QKQA 2I4IA 3TBKA 4OI4A 1CJVC 2X2EA 2ZRLA 3I8XA 1M2OB 4YONB 1NI3A 1AS2A 4EDHA 1KK3A 2PEYA 1K5DA 4JLAA 2YOFA 2C99A 2YZ2A 5FBVB 3MD0A 4HDCA 1GSIA 3CO5A 3ZD7A 3SDZA 4CVNA 3TK1A 4N0EA 2QNRA 1VCNA 3SYNA 2P6NA 1CR0A 1CJTC 3K9LA 4IEEA 1XD9A 3UMSA 1E0KA 2CCGA 2JLVA 5BN5A 2R2AA 2QL6A 4Q03A 4DLTA 1ESNA 1G19A 4D25A 4DC9A 4IVQA 4A0FA 5FTMA 1JALA 1E2DA 1XEFA 3U6BA 1S9HA 3TR5A 2B8TA 3WNBA 1BYIA 3LD9A 2IW3A 5FFMA 4UNNA 2GZDA 2PX0A 2WKPA 4Q4HB 4C0AC 5EE5B 1U90A 4DLVA 3GLFB 1E69A 3CLVA 1M6NA 5FI1B 5IF9A 1K5GA 2P67A 3PQCA 1VCIA 2ZEJA 4V0NA 3REGA 1OXSC 4DCSA 1NNEA 2BBSA 4GRAA 4XWOA 3VR1A 2J46A 4FMCF 2MSDB 1BH2A 4HATA 1JR3D 3K0CC 4D2IA 4YDSA 4M9QA 4QFMA 2AD1A 3P27A 1Q21A 4TZ0A 4A0RA 2IC5A 1OB2A 4Q66C 4YLGA 3QF4B 4KAXA 4BZPA 2G88A 3T1VA 2TMKA 3K0EA 1YR7A 1LNZA 3Q9LA 2A30A 4RKFA 1X8JA 4X8OA 2JLYA 4LBWA 1P2TA 1JAIA 3MJHA 3W6OA 4C0BA 5EE1A 2Q3MA 5LDDC 1VCOA 1Y63A 4MRSA 5JHGB 1W36D 2OBLA 1IM2A 1YZNA 5B30A 5C46F 2CHVA 4URYR 2ODEA 3BFVA 3W8RA 1KNXA 1EWRA 1M74A 1SVLA 3U5ZB 1SVIA 3IPXA 4CEHB 4JVNA 4TLBA 1ZVQA 3AB3A 2FSFA 2J3EA 4DCTA 4F38A 3GLGB 4HB0A 3DKVA 1NLYA 1U99A 4DWJA 4S35A 4MYTA 1II0A 3K70B 2IYLD 2KJQA 3ADKA 1DEKA 3I62A 4FD2A 3BK7A 1XMIA 1XPRA 1V5WA 1AK2A 4C7OA 1ELOA 5DYIA 2YNMA 2XXAB 4WW0A 1TF7A 4I1VA 1FNNA 3K09A 4W9MC 3OE7D 1N6IA 4HLUA 2C03A 5AUPB 4R71A 3OEEA 2JA1A 4X8HA 3FFBA 1W48A 4AKIA 4DLZA 4PSKA 1P72A 3DMNA 1U0LA 2GF0A 1US8B 3NBXX 3OESA 4TMXA 3X1YA 4R2IA 4QJ5A 2ZYTX 4CEIA 3X1XA 1Q1EA 3UIEA 1N6NA 5FPHA 1QG4A 2CXXA 1BS1A 4KBGA 5CJPA 1SHZA 2KE5A 2WICA 4GT1A 3HPQA 1O87A 4HAYA 4URXR 1N6OA 3MAAC 4Z1MA 1AQUA 3BGWA 1AGRA 3SJAA 1E3MA 5FBWB 2ZI5A 4NH0A 1G3RA 2FX3A 1H8ED 1XEWY 3HR7A 3SFZA 1OH7A 1D5CA 4Q7JB 4BFSA 3U3JA 3W34A 1CJKC 1YR9A 4KHZA 1AA9A 5HE8A 3RRMA 4ASUA 3FFAA 2G0TA 2XTNA 1NN1A 2ORVA 3DMDA 3B1VA 3EW9A 3U44B 3UMFA 5FR2A 4F92B 2GEVA 3C4JA 3LO5A 4Y0AA 1U8AA 2ZQ5A 2YOHA 2OXCA 4ZDJA 4RZ2A 2CL6X 3G5UA 4ZCMA 4X8LA 4GBMA 1G64A 3GEHA 1NY5A 5JMTA 2HLDD 1AZTA 1UDXA 4IDOA 4DB4A 1X8LA 1U98A 3QBVA 5FTJA 4LYJA 4KFSA 1OE0A 3EIQA 3RS5A 5KSZA 5JS8A 4AI6A 3CNLA 2ZE8A 4B6FA 3KUCA 3GFOA 4ARZB 2E1RA 2H5EA 2GCPA 4WXRA 1GVNB 2IYZA 1T0HB 3CPHA 1IXSB 3I92A 2P2LA 2H1LA 1E9CA 1ANKA 3AGPA 3EZFA 1XCPA 4R9UC 3RC3A 4EPWA 4ZIRA 4Q02A 4PHTA 4CT5A 4NKRA 3EC1A 4TLCA 5E4FA 1E9AA 2ZRCA 2F3RA 5EZ6B 1KSJA 4F4JA 1E79D 4C2TA 2RGNA 3SC3A 1SVOA 2O0HA 2RKOA 1GL9B 2VP9A 1P3JA 3THWB 2IHYA 4AD8A 3B85A 1EFRA 1GWNA 3IIJA 4QBIA 5HCIA 2WPDA 2IXGA 1E2LA 1JR3E 2XB4A 2J7PD 4V0ME 3RSOA 1E1RA 2H57A 2Q0HA 4FMBB 2OCBA 4A2WA 4GZLA 3QPWA 1Z6GA 2AKAB 3QF7A 1IHUA 3JVUA 1VG9B 4YMSA 1Z8FA 2FU5C 1XDBA 1Z0KA 3LBNA 3SYLA 1J8MF 2ZTSA 4BFUA 1EXMA 4CZ2A 1U0HC 5IK2A 1VG1A 1KJWA 2JIZA 2P0EA 1NBMD 1W2GA 2PZGA 2YWHA 3AP3A 3MWLA 2WSSD 5SZIA 2O8FB 2WSMA 2GKSA 3TQFA 3ZVRA 5K8IA 4AYWA 2QPOA 4PAQA 4LC1A 3RVBA 4JVMA 1P4SA 4QG7A 2PJZA 4DLXA 2EQBA 3ND9A 2CDNA 1KKMA 2VA8A 2W00A 5B2ZA 3FKSA 2JJ2A 2CE7A 4OHXA 1SXJB 1OH6A 5KPDA 4A9AA 1ZYUA 5JSZB 4M1WA 4FWIB 5EZ5A 1XXHB 1I2MA 2QRZA 3WHLA 2O8EB 4LHVA 3X1WA 2HDNB 4Q00A 5JWRA 3PUZA 1A82A 1Z6XA 2C95A 1CJUC 1KDPA 3BIFA 1XJ0A 2IF0A 2NG1A 3AUXA 4L9SA 2WJGA 5HCNA 4BLQA 4UNRA 1YZUA 5HTKA 4B32A 1I4DD 2EU8A 5FPTA 4PPNA 4WZBE 1XP8A 3F8TA 3W90A 1HV8A 3TW8B 1H8HD 5J4KA 4PR0A 1MKYA 2QMEA 1ZUIA 3BRWD 4TWZA 1OFHA 3R8CA 3RS3A 2D7DA 2QE7A 1FX0A 2W6JA 5CK5A 3VHLB 1ZC3A 3ZZUA 1XTKA 3L8ZA 1A5TA 1OXXK 2GK6A 4BFZA 5L3QA 3K09C 3AGQA 2V3CC 1IXZA 2GWHA 4HLUC 3ZQ6A 4G1UC 4KCGA 1G6HA 2HF8A 1GNQA 2QTFA 4OQFA 1CR4A 1Q20A 4TMVA 4RY2A 3AKYA 5HPYB 5KNBA 2BBTA 3U4QA 1GFIA 1OSNA 1N0VC 2IBMA 4KSBA 4L4UA 2GHIA 1FTNA 5JEDA 2AN9A 4Q4LA 4QNRA 1E9RA 2H16A 5GVRA 2QQEA 1FNMA 1UBCA 1CS4C 2FMXA 3RS4A 2AFHE 3DDCA 4NCKA 1KI7A 5KDLA 1XX6A 2WWFA 3QQ5A 3OIVA 3AV0B 4W5WA 5FTLA 3T1QA 2ZREA 4NE2A 2HUPA 1OW3B 2QAJA 2ZJZA 3DPUA 4TYPA 3SFVA 1R0XA 1G8PA 2VQSA 1KJYA 3BBPA 3EIHA 4D0GA 3VX4A 3LWNA 2ZRJA 1DVRA 4I81A 4B44A 2RH5A 4AK9A 1OKKD 1Z0JA 5FL7A 3B82A 4HB4A 1S3GA 2P6UA 2JLUA 4Q9IA 3F3YA 3H4MA 4I99A 3WBKA 4GDFA 3CF6R 4DUGA 1G291 1EX7A 1KMHA 1P2SA 2ZSAA 2BHRA 5TXGA 4G01B 2CE2X 3IBGA 4PHHA 2CVFA 5EXPA 1P9NA 4IOJA 2H7VA 4TQAA 3QPUA 4TL6A 1II9A 5D3QA 2FPKA 2KSQA 4CW7A 1HY3A 4MRNA 3WBJA 2RCNA 5H1YA 2J7KA 2REOA 5JCZA 1KJZA 2GXUA 3KFXA 1W0KD 2BDTA 1X6VA 4QJ4A 1PLLA 1KZ7B 1VYTA 2PX3A 4TLAA 2VL7A 3TNFA 4GPTA 3B2EA 2D3WA 2Q3HA 1XFAA 5FOXA 1NIJA 1UFQA 3CB4A 2QROA 1KO4A 1SHKA 3IO3A 3TMKA 2IEZA 3WHKA 2PEZA 4B34A 2RGNC 3LRPA 1GKIA 2J9RA 2D7CA 4Q01A 3SYKA 1HA3A 1YR8A 1E4YA 2QI9C 4A8JA 1OHHD 4Q18A 2PLRA 2ZRAA 4EPYA 2ZJBA 3AVQA 2DWPA 2QBYA 4JBXA 1T5IA 4MRRA 3TE6A 1L7VC 4DIDA 1OV4A 2GA8A 2XSZA 4CGZA 2IYQA 2VP0A 2I1VB 2QGNA 2F9LA 5BXQC 3C5CA 2QY9A 1QVRA 4KLNA 4DDVA 4OHVA 1FMLA 4DXAA 4P0TA 3ICEA 5BW8A 2O8DB 2BMFA 3GLFE 1PZNA 2OV2A 2OXRA 2HXSA 1GAJA 2ZETA 4XVRA 5D3MA 1I4TD 3EG5A 4TTRA 2FOLA 1G41A 1DBSA 3NEJA 4Q7KA 3TKLA 2QSZA 3PG5A 4LCBA 4OQXA 2E87A 2VP2A 1ZNZA 4I1OA 4KODA 3T35A 2REBA 2VO1A 4BZXA 3KJHA 5CIQA 1KO5A 3QKSA 5JS7A 3GLIA 3RRYA 4RD0A 1MABB 4IFEA 4WIAA 4Q48A 3FHOA 4B47A 3B13B 3MSXA 4JZKA 5IHPA 4CT4B 1T5LA 5DI3A 5DN6D 2AXPA 4PO1A 3GMTA 1ZCAA 2IYRA 2XNDD 5J5CA 4M21A 4NMMA 1RPZA 1UBEA 2FWRA 2JLSA 1ZINA 3AVWA 4LJAA 2AD5A 3IUYA 2CEAA 2NO1A 1N3BA 3NH9A 3IHLA 1TL7C 1W49A 4DEYA 3BWDD 2VP6A 2EYQA 4WAUA 5SZJA 1SKYB 5EP4A 1J8YF 4DJTA 1NSFA 2AX4A 4B3DA 4QJ3A 5EJEA 4QGHA 4ILEA 3EPJA 4IKEA 1GM5A 1G20E 1XD8A 2EFEB 3CPEA 4ZCIA 4B6EA 1P2VA 3GLGE 1SXJD 3N2EA 1GZSA 3AEZA 4PAMA 3L0IB 4U7DA 4C0KA 3T61A 3SI7A 1RW4A 1M34E 1NG1A 2A3RA 2Y8EA 4JMPA 1E2GA 1K6MA 3QKTA 2UKDA 3GLHB 4TSFA 4JKYA 1ZM2A 3AVPA 2BKUA 4KO8A 121PA 2IWHA 5CITA 2GNOA 4NCNA 4UKDA 4A4DA 2BEKA 4MGKR 3SZRA 2D74A 2IEYA 5FOUA 221PA 1AS3A 5CJ2A 3V9PA 3REFA 3W3AA 3NHAA 4XIGS 1YRBA 1J7KA 1XJQA 3CKLA 4G5OA 1CIPA 4GSYA 4EPTA 3R9WA 3RWOA 3GJ5A 1J90A 3C7KA 3CR8A 4QGAA 4DLRA 3BH6A 2FFBA 2OUKA 3CF2A 1VCMA 1WXQA 4HZUA 4JL8A 5LB2A 1O3YA 4LPSA 2ATXA 2KI5A 4CYMA 5FBQB 4C7OB 3EWAA 3SJZA 2OCYC 5EXSA 2C5LA 4MGIR 4RFVA 1KDOA 1QHIA 5BN4A 1UPTA 2P3SA 1FUUA 1P5ZB 2FFAA 4Z8YA 1XMVA 1KYIA 2IX3A 1EWQA 3BAFA 1NKSA 1KKLA 5DE3A 3W3ZB 3L8YA 2H92A 3QIAA 3CW2A 4TL7A 2Z83A 2K5UA 1FW6A 4KJZA 3Q5EA 1LFDB 3FMFA 2VP5A 4GMXA 4LJ6A 3SN6A 5B57C 3BORA 1WQ1R 2GCOA 1WDTA 3QVUA 4DSOA 2CHQA 3LA6A 2DWQA 1TADA 5FOWA 4P4UA 4PO8A 1HT2E 4B74A 4M0LA 5CYOA 2FV8A 2GJKA 2W6ID 1CF4A 5B64A 5HR5A 5JLJA 4ZI2A 3NG1A 2EFGA 4NBSA 5HKKD 4PO9A 2HXYA 2Q3FA 4RCYA 4ZCLA 3QXHA 1G17A 5HZHA 3EPHA 4LYHA 5CM9C 3NH6A 1OT3A 2QZ4A 3LLMA 1L8QA 4LJ7A 4AURA 5FPKA 1ZNWA 2BMDA 4E09A 3NIBA 2W83A 2AHOA 3EA0A 3RRNA 2J45A 4C30A 4YC7A 5AJXA 1RRFA 2JJ1A 4Q21A 5J4YA 5TMPA 1A2KC 2DHRA 2JATA 3A36A 4RFSA 5J4VA 5F98A 1Z6YA 1XF9A 3NXSA 2ECKA 1FTSA 3IIMA 3B9PA 1U94A 4LOAA 4PX9A 2IHBA 2O0JA 3ZIAD 1COWA 5CYPA 3DZDA 4Q1FA 1HE1C 2CLDX 3OIYA 4HAVA 3L82B 2ZR9A 3W5JA 4Q1CA 4KI0A 4NYMQ 4OJQA 2OT3B 1CU1A 3LAWA 4A8JC 1ZMXA 3B5JA 4ZIRB 2QM8A 3OAAD 2NO6A 2BOVA 5ANRB 1B23P 1CKEA 2G1KA 3ZYCA 2OAP1 1WBBA 3AKEA 1JXOA 1A7JA 4B3CA 2ORWA 1NVUQ 1N6LA 4UXJA 1QHNA 4LV6A 2OO7A 1W44A 2A5YB 2EVWX 4LHWA 4MKHA 2ZXUA 2VSOA 4EKDA 2JLWA 1KHTA 1JB1A 3QXCA 3ZS8A 1E0AA 4EQ6A 3Q7PA 4NYMR 3QEJA 4B3FX 3AF4A 3B8HA 5JECA 2DWOA 2A7QA 4WXPA 5FTKA 1Z5ZA 1OLOA 1Z47A 4O2LA 3WMGA 3EPLA 1XCGB 2B92A 3X2SA 1E9EA 1Q3TA 4CEJB 1CRQA 3MJRA 3ZQJA 2ZI6A 4C0QC 1SXJE 1XPUA 3F5FA 4L15A 3FMPB 1A4RA 1Q3HA 2CBZA 3T06B 2J0UA 2ZAOA 2IYSA 1XXHE 4KYUA 1BMFD 3HWSA 4RZXA 4URUR 1G6OA 4CF7A 3FWYA 2GEDA 3VAAA 4IOKA 4YMVA 4LHZA 3CONA 1E0JA 1IN8A 1FMJA 3RC8A 4LX0A 4A2QA 1G5PA 4V02A 1HURA 3Q3JB 3V00A 1U8ZA 3E70C 4LUCA 3UPUA 3DOFA 5DGXA 1E99A 2NO0A 2HYIC 2IYTA 2QQ0A 3IGFA 3PJRA 2IS2A 5L8VA 3AVTA 1DAMA 1DAIA 2R6CA 4DDUA 1V43A 3CWQA 4Q4AA 3ZDQA 3EPKA 3KXIA 2UZ3A 1UM8A 1YZTA 2ZIAA 2QENA 1IY1A 1U0JA 3BOSA 4V03A 4XD7A 4FCTA 3ZJYA 1X8KA 4B73A 1FUKA 5JI3E 2GETA 3U3KA 4B3GA 1SQ5A 1HH4A 4OK3A 4BQSA 3MWKA 1DO2A 3KB2A 3LBIA 4LBZA 1N6RA 4Q1DA 1RVDA 2WAXA 1XTJA 4PZZA 3V4FA 1AN0A 1LS1A 3AF0A 4PC7A 4XSHA 4FCVA 4O3MA 4ACAA 3QY0A 4URWR 3KQHA 2Q21A 1Z6TA 4U02A 4AYTA 3AP1A 2XOKD 1FX0B 4MA4A 4B43A 1P61B 3CH5A 2WJVA 2R6FA 2F1HA 4L16A 2R6GA 5L3QB 1XEXA 1G3QA 2ZR0A 1G3IA 3R7WA 3OIUA 3K9GA 3CX8A 4XTCS 3UATA 2YINC 1KOFA 2DYKA 2OFWA 1UKZA 4M4SA 4ZKDA 4M22A 2YKGA 3PITA 1CR1A 3E2IA 1XRJA 4C2UA 1GRNA 4OKSA 3FMOB 4IFBA 2V7QD 1LY1A 3QEOA 2EYUA 2WJYA 3RANA 5LB4A 3LXRA 4A15A 2W2XA 2OBMA 4LYFA 2PBRA 3LBHA 3ONWA 4B2LA 2PT7A 4D4JA 521PA 4V0MA 4FINA 1MV5A 3B78A 4PSAA 4P4SA 4DDWA 4BZQA 2ZRBA 1OYYA 2L0XA 3C5HA 3OEHD 3G0HA 3A1VA 5DO9A 4TQUS 4DB2A 4A2PA 1G8FA 3C14C 3ZVLA 2IA5A 1IJFA 1E0SA 4QOSA 1U81A 5FI0B 3LNCA 4LJYA 1LW7A 4B71A 3GP8A 1GITA 1E1QD 1XMSA 1MO6A 5EE9A 4YMUA 1E2EA 3PUXA 2AKYA 3TSZA 1KMHB 1KZGB 1P9WA 2ZRHA 2ZJ8A 3DKPA 1KY3A 5AUOB 3B6EA 3B1ZA 1D2MA 1WE2A 1DG3A 3EA5A 3A1UA 3L0OA 2BWJA 3D6TB 3QUSA 2FEOA 2FNAA 2VRWA 5BYKA 1R5BA 2OFXA 1X86B 1CR2A 4Q9KA 4GOJA 4M53A 2J0VA 5C4MA 1HQYE 4MYCA 1RJ9A 3A4MA 1JEDA 3GJ6A 4JLMA 4HLCA 3AVYA 3P1JA 1G1MA 3I4LA 3OE7A 4I1SA 4R7ZA 5AWFC 1LV7A 1JBKA 2AWOA 1OFIA 4DSTA 3ZVMA 1W47A 4KSCA 2RMKA 1F6BA 2GBLA 1FPMA 2FFHA 3SNHA 2OHFA 4BFYA 3KTAA 5KNCA 1KY2A 4A8JB 3FTQA 2V55B 5E7JA 1XBTA 3I5YA 3IEVA 1TPZA 2QBYB 1Z28A 3KKOA 3P4YA 3A4NA 3U61B 2B6HA 3WMFA 4P3YA 1GDDA 3C15C 1II8A 1KI6B 4HDOB 1H8EA 3PR1A 2WJJA 2RGAA 1SULA 1G7TA 3HYTA 3NDPA 3RS7A 3MWYW 4JJZA 5D3MB 3AKDA 3TAHA 4BLRA 3SBDA 2QTHA 4NPHA 1HT1E 1SKYE 2VIIA 4NZYA 1LF5A 4US1R 2LKCA 3PUVA 4QGFA 3WXMA 2P5TB 5CIWA 3PEVA 2ZJOA 4BGDA 4BLOA 2R6DA 1G8HA 3QKSB 4ITRC 3N70A 4G3XA 3GLIB 3K1JA 1W4AA 3J81k 2HLDA 4EJSA 5CDFE 1NLFA 4F4CA 1ZM4A 4MUAA 4EFNA 5L3SA 3VHXA 5DI3B 4NYIQ 1CXZA 3EIEA 3VX3A 1MO3A 1U9IA 3BB4A 1DOAA 5E95A 1JJ7A 2VHJA 2IXEA 1NVVQ 2J41A 3FKQA 4M1KA 2CLSA 3GLHE 2PJRA 1Z0DA 2PCLA 3VTKA 1RFLA 3A37A 3AVVA 1KK1A 3QXXA 1XD2A 2YVUA 3UK6A 2ODNA 3OFND 2A5FA 4LDJA 1M8PA 4C3ZA 1R2QA 2C9CA 4NYIR 1N5IA 1XJCA 4LWZA 2KB0A 4DLUA 3K0AA 4BE7B 3FKSD 1NVVR 1KI3A 1DAHA 2ZE6A 4POAA 4LHXA 3RHFA 1E79A 1T0JB 3TQCA 4DSNA 5JFGA 2FSIA 4HAUA 3WNDA 3WMEA 5BQ5A 4DT1A 3UXMA 1E2MA 2VSXA 2YC2C 1JPNA 3WYGA 1OXUA 4BFTA 3BC1A 1KIMA 1W2HA 4II7A 2B7CA 2OZEA 2CCJA 1YVDA 3SBEA 4TLDA 2EFHB 1G7CA 5AUQA 1DAKA 1GG2A 4QHSA 4TTPA 4FIDA 1N6KA 2J7PA 1QHSA 4NP6A 2XZOA 4DLWA 3I5XA 1E9BA 2H18A 1XMJA 4GP6A 4H1UA 3AVXA 1IY0A 2V9PA 1QVAA 1KI9A 3DO6A 5F9FA 4M9SA 2ERYA 5F9HA 4Q7LA 3L0SA 4DSUA 3KUDA 1F48A 1UBGA 1TTTA 1KO8A 3TUZC 1W4BA 1NBMA 4NU0A 2WSSA 2QE7D 1IN6A 3K9NA 4Z54A 3DEFA 4IXMA 3DOEA 3PXGA 3U7GA 3SHFA 4HB3A 4B3BA 2R6AA 2W2VA 3RS2A 4NDZA 1KAOA 3ZLJA 3A1SA 1JR6A 4JS0A 4MGYR 4C0JA 1A1VA 3P4XA 4ERNA 2GJSA 4IW3B 5P21A 4PQYA 1W7AA 3O8DA 1R0WA 4Q4HA 1P73A 4Z51A 3RYTC 3A6PC 3GLFA 2VF8A 2OG2A 3Q7QA
chains in the Genus database with same CATH superfamily
1JGTA 3HB0A 2IYOA 1R88A 4FNMA 4X1OA 5K2MA 1XTRA 3WSTA 2HNAA 1I5OA 1VE5A 2FDRA 3E23A 4X3OA 1ZK2A 2X0EA 4LQDA 5B4TA 1N8SA 2MMCA 3KR2A 3KU4A 2VYNA 4MKGA 2ORIA 3UXEA 4DCCA 5DSXA 4E5KA 4Z4QA 3KSRA 3VO2A 1ODFA 1ARZA 2W22A 1Z62A 5CVVA 4D4GA 4DANA 5LU9A 1WCIA 1X1SA 2X8AA 6LDHA 1N5OX 2IYUA 2Q6OA 3B6IA 1WCV1 1X3LA 3DHNA 5JC1A 3RROA 5BSGA 3FNHA 3LXMA 3ZBUA 5FUYA 1CEXA 4D1YA 4ME6A 1PJLA 1YU9A 5JVDA 4MRAA 3CNQS 2IEDA 2DPGA 1WY7A 1X1RA 2ODBA 4O5AA 1N0WA 2X9NA 5LBIA 3W7BA 2EARA 2LVBA 4YNBA 5FL3A 4Y1FA 4MJ3A 2H59A 4RJLA 3HL0A 3TVYA 5A3SA 2AKEA 3DB2A 4G5RA 4EW2A 1PSWA 5C8ZA 2VRBA 3Q8XB 3WK9A 4AS2A 2JCXA 1CZHA 5JDCA 1ZC4A 4BQIA 1TFUA 4RVHA 7YASA 1UMDB 1EXDA 1NWHA 4Q1BA 1B42A 3SZOA 4IHJA 3Q9UA 4JP2A 1M6WA 1IC6A 4E4TA 4HV4A 4HEJA 3DL0A 4RTRA 2OYCA 1S1CA 4FC7A 4HYTA 3K2EA 3P9CA 4ARAA 4R1SA 1RWWA 4LDQA 5EY5B 3LXUX 3M0EA 5JJIA 2ZRKA 2DRIA 3D31A 3LVQE 1U7HA 4HTFB 3TOCA 4JBNA 1GZVA 3ND7A 2YC4C 4IDNA 3PYLA 3B7WA 4LVOA 3PFNA 1I1OA 3JALB 5JSHA 2FHSA 1A8SA 2YUIA 2OYSA 5IBCA 5K8JB 2NZUG 1ZH6A 1IUKA 2ZJ5A 4TYNA 3D8NA 3WY9A 3RWMB 5ALUA 3RKRA 1CUZA 3BIOA 3EQ9A 3KJIA 3D8SA 2GOYA 3QMMA 2XMPA 3UV7A 6REQA 2XMDA 1JIIA 1SHLA 3CW9A 3NGLA 3BMXA 3H2SA 5C1BA 3DBHB 3GJ7A 4EB6B 1J99A 4O25A 5FPSA 3HI4A 3I12A 4P33A 2EJTA 2B0CA 2OLKA 2XYHA 3VPBA 3ZU5A 2PKQP 5F7OA 4MGHA 4W99A 3U80A 2FY8A 2RONA 3TUJC 2Q9UA 3GU3A 3CTMA 1GXSA 4O4JF 5C4GB 1P19A 4FHZA 3RVJA 3NANA 4ZVLA 3KB1A 1IUOA 5CK4A 5TQ0A 2JKZA 1WCXA 1EX9A 3FSGD 3OZIA 3RASA 5IPFA 1PYDA 4N3AA 1YFZA 2QUIA 1ISHA 3SKXA 4KNYA 4OQNA 4HDQB 1K8QA 3M8KA 3KL2A 3JARB 4Q9AA 1SD5A 3UANA 1R12A 2Y3IA 1GT91 5A03A 3TH5A 3ZUGA 1L7PA 1AM4D 1N5LA 2H4XA 2PLFA 2V65A 3ANNA 3PC8C 1OVMA 2OCIA 3NVAA 1IOLA 4X20A 4MIEA 2DCUA 3ZS9A 2GPYA 1T2UA 5HGJA 1UCFA 2JGNA 1W0KA 4OJYA 4E2XA 1S1MA 1KMIY 1CERA 1NVBA 1NRIA 2QLNA 4AJ9A 4EG4A 4XQ9A 4Q9DA 1HE2A 3BXZA 2W2LA 2IWRA 3SD7A 2BEVA 1A9QA 2PMWB 2QDKA 2OAQ1 2OGWA 2X8WA 3FIUA 1BA2A 4HNQA 5AM4A 3ZWNA 6Q21A 2O3QA 3ZNOA 1JP7A 3SYMA 1DRUA 3T0IA 3WLEA 2GSDA 1YASA 4YO8A 5EJ6A 3CLUC 4LF5B 4W5QA 1B16A 1BWQA 5DOVA 3TVDA 4XVUA 1A76A 3DZBA 1QVWA 1OHHA 3IAXA 4UMDA 3TVTA 1ZGAA 1K4MA 3C6MA 3T3HA 2WKQA 4DJAA 1DIGA 3GAMA 1TLLA 3PEUA 3FPHA 4ZT6A 1DO0A 1F20A 2H0QA 4M6WA 4X41A 1KBQA 5H80A 3ZWOA 1VL2A 2VG8A 5CFRA 2HR1A 2RHHA 1BFUA 5C1IA 3GWGA 1HKHA 1E32A 3TTUA 1W75A 3JAKA 2IELA 2WFLB 3N07A 1YZFA 4A6EA 4Y6GB 4HFNA 3TECE 1VLZA 1ID1A 3L1UA 1BKDR 4GX0A 4I4CA 4JI8B 2JBHA 2RBKA 4WN9A 1X9HA 3A9VA 1I1QB 2Z43A 1RPNA 4BEBA 4LV8B 2XNCA 3FCUB 3TWOA 5AESA 2UU9B 5I8PA 4WN3A 4ZO9A 3EARA 1K68A 3QBTA 2VH1A 2YS7A 3NUGA 2ZRDA 4KLCA 3OT1A 3N2NA 4JX8A 4TTSA 1XVLA 2YIDA 1E62A 3TX6A 2DHCA 2UUPA 4L74A 1JSZA 5L95A 1X42A 3NIWA 4H0FA 1L3CA 3WIOA 1BEUB 4B9EA 3E9RA 5F35A 3CKMA 2BGMA 3GV0A 3OZBA 3DULA 3IELA 3R8XA 4BV8A 2FKAA 3JQDA 5D6NA 1NM5C 1VB5A 2JASA 3IAS6 4DZTA 2XY4A 4BRSA 2W70A 3T4XA 3ZIDA 1RRKA 3A1WA 5L3RA 3W3AH 2UYQA 2ZBQA 1XZNA 4Y6QA 4CR6A 1Q0PA 5FFFA 3H2YA 1EM6A 4HFMA 2JGFA 4BQRA 4UTXA 5IKPA 2AG8A 3O2SB 4KK3A 5H4HA 3U4DA 4F46A 4RBNA 5FTWA 3QE0A 3AC0A 4MINA 2CHFA 2FMUA 2X0DA 3HCFA 3MILA 4GF5A 3ZK7A 3HYRA 2CJWA 1SZPA 2PL5A 3CUKA 1KFBB 2GTPA 2C58A 1VIAA 4R41A 2BVNA 1T26A 4CDMA 3OQHA 2QAGC 1DTSA 2D59A 2PQ6A 1XTUA 3HDTA 1RPAA 3OBIA 4IIUA 3TPCA 3H5RA 3AUFA 1BIFA 4OI0A 2WF5A 2ZUWA 2GBPA 4KVGA 2CFCA 2WUWE 1OI4A 3ONNA 1AKWA 3EZNA 3KOUA 4IX9A 4WK2B 3Q6MA 1DAPA 1QP7A 1SUEA 1GTVA 1FTWA 3CRW1 3CZ9A 3KCQA 1JAYA 1AXRA 1E61A 2VAPA 1VMKA 1XHLA 5FHRA 3UM9A 4D42A 2FA9A 4RGQA 1NRXA 1T6NA 1UMBA 4YH1A 1Z7GA 2IIQA 2GO7A 1JJBA 3ZWKA 1OIWA 2HA5A 3MWFA 4WLFA 1R5JA 2DSTA 4UZSA 3FNQA 2TMDA 1HG1A 3X1DA 3VTFA 3KWFA 1UBFA 5JALA 3ABZA 4N9WA 1HE4A 1XZMA 3NAZA 5EUMA 1NF2A 2B99A 3PC2A 2C94A 3Q7EA 3OCJA 1IDN1 5CVCA 3VPGA 2CNWA 1A9YA 4QXRA 3ZHSA 1XN4A 1P4RA 1WUTA 4Q05A 4CN9A 1GAQA 3KJFA 2EERA 3OY7A 1UADA 4MUNA 4O8ZA 4AJKA 2NM0A 2HYDA 1MG0A 1RJ9B 1SCNE 1E2NA 4NMLA 4IP0A 3MNFA 4HFRA 3UWPA 3NVMB 2QYOA 2ZTLA 3G8YA 3M1IA 1PT9A 1T9GS 2H52A 1C7RA 4RJKA 5AJZA 5DYTA 2WJAA 2GXAA 3EXFA 2QE6A 1GUFA 3WA7A 2VHZA 2OFFA 4XUDA 2IIVA 4DR1B 3GUHA 2Z6VA 1COWD 2HPVA 4HX5A 4U9IS 4JI3B 4ZU1X 3K35A 4YP0A 4ARIA 5BO5A 1YC5A 4LXYA 3W4JA 1AIPA 3EZ2A 4H6PA 3KBOA 4JITA 3U09A 4C08A 1DFHA 3IOEA 3L4BA 3IQEA 4M1YA 1TA4A 1PS9A 1Z0FA 1GR0A 2ZI4A 4NOMA 4QQKA 1UJ4A 1P9RA 9LDTA 1F5NA 5LZ8A 3W9YA 1ZCBA 4JAVC 1CLUA 5E6SB 1UP7A 1RYFA 4G1VA 4CMHA 5A5GA 2FQWA 4XGQA 1I2BA 3PICA 3E4DA 1AHNA 2O9JA 4ZCSA 2EFJA 1JMYA 2J5BA 1GQRA 2EGHA 2BGKA 2Q4OA 3H8VA 2H29A 1KFJB 4OP1A 5PGMA 4F84A 1M7GA 1CNFA 1DPFA 1U2PA 3NKFA 3RAPR 4AWAA 5BYJA 5CXQA 3SF8A 1CX9B 3U1VA 4F3KA 5KTYA 3GFVA 1J9GA 4LISA 2ZYIA 4QIHA 2UXBB 2PGIA 3GFTA 3K9FC 4YXWD 4MA5A 1RHKA 2KBEA 4GOXA 2AJDA 1UKVY 1QH1A 4LDNA 1VE7A 2PKRA 1D09A 1LX6A 1VBKA 5AJWA 3VHXB 2ZIZA 2GAJA 4GOOD 5GJCA 1USGA 1QK4A 1GNVA 1O4WA 4HYYA 1UBHS 2ZUFA 4LV5B 4BVAA 2GK4A 1NLZA 4BVLA 1Y8RB 2JAUA 4RKEA 2M9MA 2GF9A 2Z9CA 3JAMA 3J81A 1OZGA 1J06A 1KHHA 2J9XB 3FNRA 3SXUB 2Z8ZA 4PHGA 3WL3A 5HOEA 5I7SA 4BAZA 3JWPA 3VUEA 3W4KA 1J1UA 2O52A 2GFIA 1AU9A 1BYUA 3HKBB 1Y5IA 3DL7A 3PT9A 4NZPA 2BEJA 3ES9A 4KO2S 1UBNA 1DRKA 3ISTA 4PN3A 2H6EA 2F7SA 2ZAMA 2OM6A 3W6PA 3BD6A 3K0AB 1QS0A 2D0DA 3BXEA 3WK5A 4G84A 3SGLA 1SQFA 1UBUS 2I33A 1RWBA 3JWHA 3FLMA 4I4NA 5JBIA 2XCSB 1MB2A 1UOEA 4XX1A 2V6BA 1WSWA 1FMTA 1Y33E 1GZ7A 2GILA 4ZQBA 3E3OA 3TIXB 5EUQB 1RU3A 3ZQKA 1TAUA 1RRVA 3UY4A 4NZOA 4ZJPA 2A4MA 1AKYA 2GAAA 2WK1A 3O4VA 4EM6A 3KUKA 1BVYF 2PPLA 5IJWA 1Y3FE 4XGNA 4JV5B 1U4SA 1VJTA 2IE8A 2E4WA 4KGXA 5CFNA 2OO3A 5FHQA 5DBEX 3R75A 3RIYA 3V8NA 3WLHA 3K2QA 4WRRA 3BL6A 5DMXA 1ZL2A 3U7JA 1DQYA 4I4LA 4MUMA 4X71A 3V33A 1TPYA 1OAOA 4YRLA 5KVAA 1BVRA 5KBYA 2CSXA 1B0ZA 5L4LA 3O8BA 3OWHA 2WHYA 4LBVA 1YCGA 4LZNA 5K3SA 4DREA 3GEIA 1PQ4A 3JZAA 3JZDA 1M0WA 4PYJA 1PCXA 3K9HA 3FUXA 2O8DA 4RU1A 2NTEA 2BKAA 3E1KA 4J9VA 3NUQA 4MWBA 1E2IA 1IBRA 3DZIA 4DS3A 1K1EA 4IIGA 5A4JA 3UK0A 1X7XB 3V4VB 4JLVA 5IJ0B 2C4WA 1GRQA 1Z7EA 1K6EA 2YQ4A 3OECA 3PHJA 4UEQA 3NT4A 1V5IA 1G6KA 2HV8A 3CRVA 1ISIA 1EFCA 4KI7A 4YCBA 3UJBA 2WQZA 4X5OA 2BEUA 4KE7A 5KWJA 4Q3NA 3AR3A 3COPA 3CX7A 4IUDS 3TIFA 1V7PC 4NONA 4E1AA 1DT5A 4OXRA 5BSWA 5C5EA 3STTA 1RLIA 3S2FA 1KYXA 4B8YA 4EKIA 2QJWA 3B1YA 3BREA 4ESVA 1IZZA 1LS6A 1F9EA 2PSDA 1Q7TA 1FLDA 1WG8A 1P8AA 1GV1A 5FOTA 4I6JA 1L7QA 3G2JA 5DLPA 3LYHA 2NLOA 1KAQA 1JNYA 1SXJC 2JAQA 1O6GA 3U2QA 5CG2A 10MHA 1P7CA 2AV6A 3CVXA 4GYJA 1JAZA 2RARA 3UA4A 1I3OA 1UBRS 2ODQA 4PC6A 1AF7A 1ZOIA 1WB4A 4LJ8A 2UAGA 4BLVA 5JRZA 5TVKA 4L5AA 5C1DA 4OQYA 2QAGB 4EW3A 2ZJAA 3HU3A 3B9QA 3QKRA 3DCJA 1S9DA 1M2HA 5C18A 2D0OB 3NORA 3NXKA 2YNMD 4BO8A 4YCSA 1PVVA 1E96A 4PZLA 3HWWA 4C2BA 3N74A 4PGFA 5DM4A 5F21A 3ZI4A 1A71A 2XVMA 3AINA 4UNSA 1XMXA 4JI0B 3PRKE 1YUBA 4N3CA 1Q0RA 4M1EA 4YJ3A 4UVHA 2O8BB 3UWKA 1TUEA 3QMPA 1NFFA 4GS5A 2BM0A 2FPOA 5COBA 4NNJA 1I94B 3RYIB 1NJFA 1YE5A 3UJPA 5CB0A 1LQTA 3WDSA 5JRJA 1YZ3A 2BFEA 1M1YE 1NQWA 2NTYC 2WNIA 2YJ6A 3O8CA 1GSOA 1KVSA 2H85A 1BFKA 2HWYA 3TCNA 3G82C 1G21B 4INOA 3FOWA 3EIFA 4O2AA 3ZCPA 1G3UA 1WRBA 3WWCA 4BEWA 1P75A 3FRHA 3T1TA 1FYEA 4OVKA 2YFKA 4A92A 2XOXA 2G4LA 4FQ5A 1UUFA 2PH7A 2R48A 4UTZA 4YCJA 4KQIA 5J3JA 2W9XA 2IF2A 1T6ZA 2JEOA 1M34B 3E1GA 4P3OA 1T25A 1ZH8A 4RK7A 2FEAA 2H9IA 2IYYA 4ENTA 1MAUA 1W9HA 3HFSA 1VGRA 1CE8B 2PDAA 1XZPA 2P7IA 5ES3A 5IT5A 4D56A 5KDOA 3K32A 3CH6A 1I3LA 5ITSA 2HMAA 3BF7A 4KZKA 4RY9A 3TX2A 2RSLA 3LSTA 1R16A 3CRZA 4UD2A 1C81A 3GJZA 3OZXA 4GUDA 4M8LA 4US0R 2H4FA 3PC6A 5K01A 1CUXA 1IXRC 2V97A 4D57A 5C80A 3VSCA 5FBZA 4C87A 1B6GA 3KOXA 4N5NA 3NU1A 1K9VF 3ANSA 5DSZA 3X2EA 3SQMA 3FZQA 1SKUA 1ZITA 3LOQA 4EY3A 4EL5A 1BE0A 1QHHA 2GRJA 1XTQA 2WG0A 3FNBA 2C5BA 4KQXA 4B4DA 1XCBA 2VSFA 1HDYA 4PCLA 1JAHA 3VKUA 2QRLA 3U1TA 4W5WA 1RC8A 2XGOA 3GJ0A 2IX9A 1C9YA 2YOGA 4EVSA 5EWMA 3V4RA 3D5TA 3ETCA 4ARSA 3T7EA 1G2IA 4BLPA 3AEYA 2BHNA 3GH1A 1XP5A 4WZBA 3UUEA 4EATA 4F97A 4Q7QA 4Z3KA 1PQWA 2WP0A 3DBIA 4D9GA 1E1QA 5BYAA 3KEMA 1G4AE 4OBBA 5ICEA 3LT2A 2AG1A 2Q4EA 1LQUA 2XHEA 3EVCA 1NAIA 4BP1A 1SCUB 4UREA 4CQMB 3DW3X 3THYA 2KQUA 3IR5A 4DMRA 4OI2A 2QD1A 4I6GA 3BWYA 3ZX5A 4ZI3A 3CZAA 4DNPA 3PD1A 2QZPA 3A2NA 4GRDA 5F7ZA 4MRMB 3SQXA 2X1HA 4TXHA 4JEHA 3KHSA 1KJNA 4GE0A 4J1TA 2DBYA 2W98A 3BSWA 4LZOA 1F2TA 1PV4A 3R09A 2Q50A 4HNAA 4KX3A 4DZZA 5FWYB 3UPTA 2ZWVA 3OLZA 3KQUA 4P7GA 2I2DA 4N0MA 4DV6B 3AM1A 1B0PA 1EFRD 1FCJA 2IOFA 2SNIE 3LF1A 3WNZA 5LQAA 4EYGA 1TI7A 1P29A 4PR3A 4OH7A 3AQ4A 5BVHB 1E6KA 1RHJA 5FYQA 1OBVA 1BZYA 2PJUA 2QA5A 3FPAA 5EUBA 3H4VA 1ESMA 3G7UA 1OIVA 3I8SA 3IDQA 2WMYA 3DCIA 3WYEA 1F2DA 4ACBA 2Z08A 2Z4SA 3O1IC 4CV1A 4D41A 5CB4B 2ESRA 5KOJA 1PG5A 1N2EA 3L0DA 3A1TA 3OOSA 4B82A 4QM6A 1W4CA 3FKJA 2FSGA 2O05A 4TMWA 4PRKA 1KWKA 3IIKA 1PUJA 1IN4A 2PGOA 4KDEA 5ALJA 5J23A 4LJRA 1DFIA 1T9BA 5LMUB 3B3GA 3HJGA 1DC6A 2QVGA 3M33A 1CEYA 2FRDA 2J9ZB 5DSTA 5FADA 4LNAA 4AYXA 1KI2A 4ROTA 3HDGA 4BGUA 2Q2OA 2HJWA 1A4IA 4NOLA 5JVDF 2GN9A 3AF5A 4K1XA 2BD0A 4YQEA 2ASEA 1VP3A 2CZQA 2CXSA 3ZLTA 2QTBA 1J0DA 2WLTA 3WGZA 3HVHA 3ZE1B 2OE2A 5TMDA 1LDGA 2BI7A 3L1VA 4NH4A 1T2NA 2CUKA 4ZZ0A 1FIUA 4F3CA 1J5EB 2C5AA 4K6OA 3GJ3A 1L5NA 3RTDA 4PTYA 1IOWA 2V7EA 5AMXA 3NJ4A 2I80A 2XQGA 1FSZA 3U40A 3DQQA 2Q99A 1BDMA 1TNDA 5A4DA 4Z53A 1G9XA 4AUMA 2NTNA 4U7HA 1H5UA 2UZ4A 2QT0A 2WF9A 2FVXA 4BN0A 4MVJI 5JZ9A 5KMGB 5FD8A 1V3VA 4YCCA 2IH5A 4TMTA 3WRXC 3OFJA 4HGRA 4CN8A 3AKCA 3V9AA 2ETVA 1JSRA 3ZE0B 2Q5QA 3LRTA 5LA6A 4E11A 4FYHA 2EJVA 3ADCA 1T91A 2PD4A 2RHCA 2ZBFA 3CISA 4RD2A 4Q3KA 2HU5A 3R9IA 3LUPA 4CCYB 2HF9A 3TTTA 4R8KA 4OY3A 1I3NA 1Y37A 4QSMA 4BL5A 4P98A 1H2AS 4D45A 2G0NA 1YA6A 1P74A 5TSDA 4AAYA 4D6XA 3EZ9A 4YR9A 3S8YA 4O4HA 4KBFA 2MINB 4JP8A 1GUYA 2FFJA 2CDBA 2VF4X 3FDIA 2FZVA 2GCNA 1DCKA 1GQOA 2IPOA 3D4OA 3IKJA 3N0XA 3SEAA 4E3ZA 4S0ZA 7GPBA 2VJMA 4L9WA 1JG4A 4KGZA 1Z17A 5IVPA 2FR8C 1KRHA 3DVAA 1ZS9A 2ZIWB 4DLSA 5C8YF 3EQ7A 5BWMA 4DNOA 5NULA 3ZZNA 2A2ZA 4HS9A 3IOCA 1CFJA 4JR0A 3DD1A 4X66B 2QMYA 4YMLA 1WP9A 1CZUA 4KPUB 1RXEA 4BMPB 2RDMA 2EATA 1OH7A 3LUGA 2HSDA 2YICA 3PSHA 3W8NA 4RKRA 4NHOA 2F9FA 3MB5A 2CLKB 3ABIA 4QRHA 4BP9A 1SC9A 2BTOA 2YIMA 4LSZA 1ZD9A 3WJAA 5KNBD 2VSYA 4JB2A 1X0VA 1JS1X 4LWOA 4BECA 4HBZA 4CMAA 2A9FA 3F4BA 1K06A 3TZEA 2VWGA 2WSBA 4Q4JB 3WLLA 3IQXA 1ZK4A 1W6RA 5DP1A 1EA7A 2SECE 1QG6A 3RR2A 2G08A 4PC1A 1WABA 4F2PA 4DA9A 1L9XA 3NWBA 3P26A 1EJ6A 3H1EA 3W2HA 1AHPA 3FNEA 1QHXA 1V6AA 1Y4ZA 2GA9A 4DMLA 2QZJA 2HA0A 1FYDA 4UJ3A 4BX0A 5CVEA 3V1YA 1NOJA 2OOSA 1YBAA 3CUTA 3QFHA 4Z99A 4DBLC 4NV1A 2CSUA 2VBGA 2WG1A 3CVJA 3GZ4A 5C8DA 4N82A 3W6ZA 4F4DA 2HEIA 4MWTA 2FK8A 4Y2JA 1KE1A 1TM2A 2G1JA 4BP8A 4ZVMA 1SUFA 5L45A 2O2GA 3O0TA 3WLIA 5KQMA 3V7FA 5DNYB 5JSQA 3TLGA 1FMCA 3JQEA 1WDKA 5D87A 3QE4A 4YMHA 4JOCA 5EXXA 2ILVA 2JLZA 2ZIFA 2QVXX 2B5OA 1T13A 4DUGD 3BQMB 4Q24A 1HFEL 2DBZA 4U2CA 1Z2DA 1E2JA 4BEJA 3M6WA 2WA1A 1Z6QA 2ONCA 3FX2A 4KAJA 3UA3A 5B6IA 3MCZA 1MJ5A 4K2HA 2ENWA 1E9SA 3ESDA 2PBLA 4D9KA 4PG5A 3BB1A 1MGPA 1DLIA 3ZU3A 3CZRA 5KHAA 1FRZA 4HXEB 3BEDA 3L93A 1FRNA 3AVOA 3BF8A 1FPQA 5EE3A 4Z8XA 1ZUHA 4IPTA 3VMFA 4BNGA 1QV9A 1YZKA 3G2KA 4WOPA 3H2KA 1UPXA 4BATA 4KWEA 1PNVA 2P3LA 1JDVA 4FMDF 2W0MA 1XI2A 4FUTA 4AC9A 2XCTB 3RSLA 3PYMA 2XT6A 3CU5A 2AUMA 1UANA 3ZDBA 2O3SA 3FZNA 3C6XA 5AJVB 1GCIA 2BMJA 3LQKA 4AMZA 2XTAA 4OXXA 3I9KA 3V2UA 4TROA 1TF5A 1O54A 2NT4A 2WKSA 5TY0A 1P91A 3HZRA 1T3SA 5TVGA 3VJKA 2JARA 3S5UA 1PL6A 1CEEA 1M1NB 3IQDB 1U2ZA 3K6RA 4Y30A 3MT9A 1XJ5A 1IPEA 1GQYA 1KO7A 2FN7A 1RYHA 1Y5LA 2X5JO 2EHDA 1H22A 1YHZA 3KPUA 4DCUA 3RH0A 5AVTA 3MT8A 2ZTVA 1JJFA 1YCDA 1Z56C 2FUEA 4RA9A 4OJMX 3F5SA 1Q84A 2RHGB 3N2YA 1RZRD 4KDRA 3PRJA 2G1UA 1YI8A 4MI3A 2NSDA 2HNBA 1IG0A 4OFBA 1O5IA 4KVFA 4OA5A 2IODA 5CTJA 2IHNA 5EXEA 3DE1X 1KFCB 5M2QA 2YZ7A 3KL4A 4BMVA 1CYEA 4OHFA 4HDRB 3S6JA 4AQYB 1Y3HA 5M04A 1LJ8A 4FDVA 4QDKA 1YJBA 2UYCA 3WNCA 2J9GA 3FYUC 3SJ7A 5LD2C 2F59A 1TJYA 3RV4A 3VPHA 2PZMA 4Q16A 3T5CA 3CPJB 3HN7A 1E1MA 3AHHA 4URVR 3KQWA 2W4IA 1NMXA 2CWWA 5AM0A 5IANA 2GZAA 4B5LA 4FN5A 4RQUA 4FZ3A 1PS0A 2FFQA 2YXEA 1WW3A 3AP2A 4TKUB 4AB1A 1ONBA 2YJ3A 4ARVA 1EJBA 5LWHA 3BZWA 2UYYA 2XHZA 4MDYA 2PL9A 1ONOA 1P77A 1A2BA 2HW8A 2FXIA 2R1VA 1L3IA 2YFYA 1K3UB 4F4HA 1RWNA 4YY3B 2VQDA 4EHLA 1YQDA 5U1PA 2BSAA 3JQAD 4LJ4A 1KI6A 1VG0B 2CHUA 3AKZA 4JFAA 3FSGA 4GMDA 1JHZA 3JWGA 3LPNA 4MNTA 4QTYA 2B2XA 1UJMA 1OYWA 5ADHA 1ZZGA 3LT4A 4C4XA 4Z49A 3B48A 3A6LA 2VLIA 2CFTA 3AERA 4BYGA 2C59A 2YL2A 5BSKA 1D03A 3Q8LA 2CMDA 2QVLA 1PRYA 3IOMA 3PLNA 2J6HA 2Q8PA 2RGGA 3EGEA 3M6AA 3AM3A 3H3FA 1QRAA 1UJNA 4NBTA 3BWVA 5LLTA 4UBMA 1UQUA 1KEUA 4D4MA 1GKUB 2G70A 4RZIA 1XLTA 1K92A 4AFNA 4D3XA 5KOYA 2C4UA 1HNXB 2AOTA 3UMBA 4BLUA 3T7RA 4P3KA 1UZMA 3LPCA 2FEMA 1FXSA 5H7XA 4TSFD 3KSAC 1ECCA 3N28A 3C6YA 1JHQA 3B7GA 3DZJA 2P3QA 3SHVA 5GTDA 5JEEA 4WZ6A 2WW8A 4QWWA 4GPAA 3TTXA 4RHTA 1OD6A 5LZ7A 3GUZA 3NYWA 2H2IA 2CVOA 2N42A 3U6KA 4JI2B 1OROA 1YRWA 4QTUB 1BGWA 4YDHB 2AWNA 2F3SA 4IOLA 1PSZA 4MV6A 1NR5A 3IURA 5F1KA 3TSOA 1JVBA 4QBFA 1RXCA 5HF6A 3BE4A 4FQ7A 1G21E 2HLPA 3CRQA 3PFIA 4XWKA 2B35A 2X41A 3OKPA 3Q72A 2AZTA 5I7OA 1WDMA 4I3HA 2AYYA 1RM0A 4IY1A 4AJLA 3R3YA 4NBKA 3T5GA 1Z39A 5D5QA 4EW6A 3BERA 5I48A 2COUA 1T3HA 3A7DA 3F1KA 4DIEA 1T5SA 1HYEA 1S3SA 4P7JA 2XGGA 2I76A 4MB0A 3VUFA 4CUZA 1THTA 5C37A 3Q0TA 3GT7A 4ND4A 4ECEA 4B33A 2NZYA 4OOFA 3AVUA 5DWDA 1M7HA 4DY6A 1L4KA 2FLVA 3H86A 3ZDZB 2VZ9A 4DEVA 2KHZA 4LF7B 1J2EA 2I6GA 3URKA 2WWTA 1TQ4A 2QRKA 3O4HA 5DRYA 3M6IA 1JFRA 3IALA 4YMGA 2R85A 1EESA 1XXHA 4HKTA 1DKMA 1LWOA 4BWFB 4QC2A 1XZKA 3P5BA 4NTZA 1OXVA 3EZYA 4NS1A 1V35A 4XR9A 4JBIA 4FI3C 4JQYA 5DHTA 1EXNA 3GIWA 3I2IA 4IOMA 4B6JA 5CDUA 1VA5A 4ZYYA 1IB0A 1TYEB 2C4NA 2R6R1 1TQ8A 2ZRIA 3EDYA 4HF7A 5FEMA 5ILQA 4QBKA 4TKVA 4UTVA 2XD9A 2DECA 4GVLA 1VKJA 3CWZA 2BGGA 2BBWA 1APBA 4E5PA 2I9KA 1QR2A 1TD9A 2QTAA 3GJ4A 1U9YA 4RK4A 1CQZA 3K0KA 2AVDA 1L2TA 4I9NA 1XZAA 1PFGA 3OMLA 2JIRA 4FCWA 3ZK9A 3BMOB 2D6FA 1FQKA 2NU7A 5ELMA 2IEGA 2YV5A 3OPYA 5ALHA 2MYPA 4YWJA 4H0CA 3ENVA 3EG9A 1BRTA 3IMCA 2WOOA 2VDWA 4YBZA 1GIAA 2WWWA 3QV1A 3T9DA 1MNQA 2RHMA 3GFGA 1CF9A 4GMFA 1QF9A 3GA5A 4J16A 1LBEA 3RABA 2HK9A 2P9HA 4ABYA 4JI6B 2XCUA 4BFVA 5IUKC 4BDTA 2XX3A 3HR4A 2E4VA 2N9UA 4H18A 4HLDA 4N65A 3SHWA 2Y6UA 2B34A 4IMJB 4QLBA 5HDQA 4N47A 2ZBPA 4XIFA 4CKBA 1I32A 1K8RA 2I6QA 3FIJA 1RLOA 2ACEA 3K3PA 3RB8A 4ZDIA 1QFZA 1GAWA 3WLKX 1Z4MA 1UWLA 2ERXA 2DQSA 4FMCB 4HQOA 2VJCA 3K53A 5JXHA 1UQRA 4GZMA 4K0KB 3MFYA 4JLBA 2XH8A 3IEUA 4WDRA 4UJ5A 3KAJA 1Z3CA 3WLOA 2LGJA 3E7XA 3EVFA 1TUBB 2H9AA 2PX6A 1Q12A 1J21A 4FFRA 3VNSA 3IV9A 5REQA 2IZ1A 2ANCA 3BM5A 3UGJA 1ZN7A 1E7SA 3I9V1 4D9FA 2D2EA 1AQIA 1KYVA 1GA4A 3QVLA 4HQ6A 1WBJB 1B41A 4NU5A 1M8JA 3KQLA 2CV1A 3F73A 4JKIA 1BX1A 4H4EA 3SKYA 2OZLA 5FLYA 1DC4A 2C0PA 1JA9A 1FBNA 1YZQA 3KJGA 4E22A 1NN3A 2O2XA 3EVGA 3FUCA 3L9XA 3ZWPA 2XYQA 5K9ZA 3LCJA 3TGPA 4A0HA 3LV8A 1VXRA 4MKXA 4YJ2A 3ZV6A 1SZCA 3GJRA 3ZCUA 3MTQA 4EPVA 3FPKA 5L3SB 1R6BX 3G0GA 3FYUB 3HFRA 5JBQA 1ZOSA 5LD2B 5J40A 4OI1A 3EVZA 4R40A 5ARBA 4O2BA 5A3VA 4ON9A 4F5WA 5B1EA 3LU1A 3KPVA 1I0ZA 3PWSA 2POQX 2VPYA 3A9UA 3PQFA 5E7QA 1AH2A 2R5NA 3A6ZA 1Q17A 2KBFA 4FW8A 4E5SA 3AF6A 2C98A 3WB9A 3LQQA 1H2FA 4Z7QB 1XFDA 3O26A 5H70A 4YJ3F 4BNFA 4HN2A 3CMCO 1KH3A 3OPNA 3THSA 1JIVA 3WX0A 5IKMA 3I1IA 5CA0B 4W8GA 2O1SA 3NIDB 4RPHA 4WBSA 5BN3A 4LA4A 1HEIA 4G24A 4WASA 3ZWWA 5E3HA 1EFLA 2IY9A 5FUBA 3UAZA 1R0CA 4L73A 3WYDA 4GEGA 4EFLA 2QUZA 3E9EA 4LW8A 4O2AF 3WXBA 3GHYA 1XV5A 1P1CA 2PQ2A 2IEAA 1ULUA 1RM4A 4TLEA 4JNKA 4YXWA 4MQEB 5HBGA 3WOHA 3MG9A 4CL3A 5A6VA 4DUYB 1V11B 1OLUB 1R9GA 4R69A 2OCGA 2CV2A 3CN9A 4B4OA 2W11A 4MW5A 5I9LA 4TZKA 1U8YA 1QQTA 2Q62A 1VSVA 4CLXA 4G0NA 5KEIA 5JS1A 1M2VA 2B1JA 4OGLA 3TOVA 1UIRA 3G2NA 4BNNA 4OI4A 3P2JA 4JEUA 1EDOA 5E2AA 1RNLA 2KS6A 5AOBA 3ZLVA 1NI3A 3QEBZ 4ND7A 4QUGA 1KK3A 1T8PA 1XYVA 1VFNA 1QC5A 4MIKA 4R1LA 4RVDA 3CO5A 1PYOA 2PU5A 3KAQA 4CVNA 4FR2A 4CG3A 4RW0A 4WMLA 4XIYA 1IEVA 2PH5A 3C24A 1VCNA 4S12A 2PRIA 4ZVSA 5F5LA 2WAMA 4BMNA 5ADWA 2VJNA 3K9LA 1TOAA 3O38A 3UMSA 2CCGA 5LZ9A 1SXHA 5BN5A 2R2AA 2RI1A 1PGQA 4IQ8A 1J0BA 4Q03A 2IEBA 4L78A 3DKKA 4DC9A 4IVQA 2FUG1 1JDPA 1ICEA 1E2DA 1VSTA 1XEFA 4DMFA 3GT4A 1S9HA 4GYYA 3VR5H 4YCMA 1CY7A 1PEYA 2QLBA 3AOGA 2NX2A 3DTVB 3IAM6 1BYIA 3LD9A 2IW3A 3M5WA 4LDPA 1DAOA 3T94A 2VF2A 2GZDA 2PX0A 2WKPA 3TAXA 1P4AA 5EE5B 1PJAA 4BNTA 2ZDGA 3J7TA 3JQGA 3GLFB 1M6NA 5IZ4A 1WUHS 3K8OE 1QGZA 3L4EA 4DCSA 1E5TA 3A70A 2O6HA 2BBSA 1XEAA 2PZBA 2J30A 4TRRA 3OTWA 5KVQA 3RSFA 4WCFC 4XWOA 1MQAA 3QX3A 5EIEA 4HATA 5DKFA 1H6DA 1JR3D 4CI0B 4D2IA 5CFZA 3FPJA 1JL3A 4TZ0A 1ZVVA 4MQUA 4G9GA 4IGIA 3T5TA 1Y9JA 2HQ1A 4KAXA 3L6RA 2VHWA 4G2NA 1DO8A 4O4LA 3T1VA 2BTEA 5AXCA 3MJFA 4FIZA 2FSVA 1YR7A 1THMA 3IP6A 3I6YA 1QH8A 5DYWA 1RXWA 4RKFA 4X8OA 5IT4A 4KW7A 1WXFA 4MPRA 2VJDA 2W8BB 3KO8A 3HYLA 2QR3A 1PJ2A 3FDFA 4BNUA 1E2UA 2UDPA 5DLEA 1VCOA 2O6LA 4DM7A 4P86A 1Y63A 5JHGB 3WGVA 4XA8A 2JLBA 2ORYA 2CHVA 3QP9A 2ODEA 3BFVA 4NJEA 3DE3X 4CIAA 2BFAA 1SVLA 1M74A 4REQA 4DADA 2QOEA 4X44A 2L2QA 4O1HA 1Y8ZA 2HRBA 4KXLA 4OJTA 4D92A 4F38A 4HB0A 3FPLA 4H3KB 3GUUA 4J49A 3RTAA 3ZWVA 2JAOA 2VWPA 1OT5A 4W1QA 4MYTA 4ZOQI 1Z8HA 4OHKA 1EGQA 1Q3KA 2KJQA 1DEKA 1ISRA 1E6LA 2BL4A 2FZ5A 2L82A 1XMIA 1YL7A 3EIWA 3NHJA 4I55A 3I62A 3K9WA 1ELOA 3B6MA 2YNMA 3VSAA 4KWIA 1OXMA 1TF7A 5ULLA 1SIWA 2JFUA 4I1VA 5HUJA 4E21A 4P8RA 1FNNA 4EUHA 3K09A 5BMOA 3U3XA 4BWGA 5AVQA 4GD3Q 5AK4A 5AUPB 4KK4A 5H59A 4Z4IA 5HTOA 2NT3A 3Q8WA 5KQSA 2XWQA 1A5ZA 3CUYA 3O7WA 5I7UA 1A7UA 4RHYA 1NE7A 4GX5A 1T35A 1T9AA 3IBSA 4JJ8A 1T43A 5CPBA 5FQOA 1E3SA 4AS1A 1HYGA 2ZYTX 3HACA 4FYYA 4KQWA 3X1XA 1AZWA 1YGPA 3HRIA 4MR7A 5FPHA 3V3KA 3JQ9C 4DV1B 3C4VA 5FA8A 3UCXA 1SHZA 4UUNA 3L92A 5LA6F 3TKYA 1N6OA 3MAAC 1AQUA 1E3MA 1XU9A 3IC5A 1YO6A 2QLFA 2ZI5A 3K9BA 4GO1A 4NH0A 2JKVA 2FX3A 4GPZA 1H8ED 1XEWY 2H11A 3HR7A 5U4QA 3SFZA 2VNSA 4X95A 3GDFA 4Q4DA 4C7JA 4Z4HA 3ZJVA 3W34A 1CJKC 4KHZA 4BHTA 2PA3A 1I2CA 3FFAA 2G0TA 3IPRA 2XTNA 5TGTA 1HQDA 3L7LA 1M0EA 3EW9A 2EW2A 4CKCB </