4KGCD

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcD00
3LZ0D 2NZDB 3UTBC 5BNXB 3AZKC 1F1EA 3AN2D 4LD9C 1M19B 5AV6C 5B2JA 3LZ0C 3AV1B 1B6WA 4CSRB 3C1BB 1P3PA 1KX4D 3AN2C 1KX5A 3WTPD 3AFAB 2RVQC 5F99B 5B40B 3KXBB 4YM6B 4G91C 2FJ7D 5GSUA 5BO0B 3REID 3UT9A 1KX4C 1HTAA 2NZDD 4WU8D 3WTPC 3AZFB 1KX3A 3B0BA 5B24B 3MGPB 1M19D 1P3OD 3UTAA 1P34B 4XZQB 5B32B 5DNMB 2FJ7C 3REIC 1TAFA 2NZDC 1R4VA 1F66B 4WZSB 5BNVB 5JA4B 5B31A 3C1CD 4X23B 1P3GB 1M19C 1P3OC 1M18A 3AV2D 3WA9D 4WU9B 3LELA 5B40D 1BFMA 3KXBD 3MGQA 5B2ID 5E5AB 3AZIB 4J8VB 4Z5TD 3AZFD 4Z2MH 4ZUXB 3AV2C 3WA9C 3UTBA 5F99C 3MGPD 2YFVB 5B40C 3AZNB 3KXBC 3AZKA 2PYOD 4LD9A 3VH5W 5B32D 1P3AD 5AV6A 3LZ1D 1EQZB 4H9NA 4KGCD 5BS7C 3KUYD 3AZHB 3AZLB 4Z5TC 3AZFC 4AWLB 1P3GD 4NE3A 5B24C 3MGPC 2PYOC 3AN2A 4KHAA 1P3AC 5B32C 5AV5B 3REHB 3LZ1C 4H9RB 4KGCC 4H9OA 4YS3B 5CPJB 3NQUA 1S32D 5B2JD 1JFIB 3X1TB 1ZLAD 3AZID 1P3GC 4J8VD 3MGSD 3VH5T 2JSSA 1KX4A 3WTPA 4WU9C 3AZND 1B67A 1S32C 4XUJD 3REKB 1EQZD 1ZLAC 3AZIC 2FJ7A 4J8VC 2LY8A 2AROB 1BH9A 3MGSC 3REIA 5GSUD 4DRAA 3AZMB 3X1SD 4R8PA 3UT9D 3AZLD 2NZDA 2NQBB 3AZNC 4NE5A 2CWEA 3REJD 1M19A 5AV5D 5JRGB 1P3OA 4XUJC 1EQZC 3WAAB 4YS3D 5GSUC 3AZLC 3X1SC 3B6GB 3TU4B 5DNNB 3AV1A 3W99B 4CSRA 4AWLC 2HUEB 3KWQB 3C1BA 2F8ND 3REJC 5C3IB 5AV5C 2YFWB 1N1JB 3AV2A 3RELB 3NQJB 4YS3C 3WA9A 5F99A 5B40A 3KXBA 3AZJB 4YM6A 3X1TC 4J8WB 1P3BD 3AZMD 5BO0A 4J8UB 5BS7A 4Z5TA 3AZFA 3A6NB 1U35B 3MGRB 5B24A 3MGPA 2PYOA 3W98D 3LJAB 1P34A 1P3AA 5B32A 3AZEB 5B1MD 4LD9D 3WAAD 1P3MB 1P3BC 3LZ1A 3AZMC 3B6GD 3TU4D 5KDMB 3W99D 5CPKB 5JA4A 4KUDB 4J8XD 1P3GA 5B32G 3W98C 3VH5A 2CV5D 5B1MC 3WAAC 1P3KD 2L5AA 4WU9A 3B6GC 3TU4C 1S32A 2RVQD 3W99C 4J8WD 1ZLAA 4J8XC 3AZIA 4J8VA 5GXQB 3MGSA 2HIOB 5C3IC 4H9SC 2CV5C 4ZUXA 4H9QA 3A6ND 3W96D 1P3KC 3KSYA 3AZNA 5AY8B 2F8NK 4J8WC 5GT0B 3V9RB 4QLCD 4XUJA 1EQZA 3W97B 3X1SA 3AZLA 5FUGA 3W96C 1KU5A 4R8PD 5CP6B 3A6NC 3O62B 3MGRC 3AYWB 3REJA 1P3IB 5AV5A 3AZEC 4QLCC 2BYKB 3B0DB 4H9RA 4YS3A 5CPJA 3WKJB 5CPKC 1JFIA 4R8PC 4DRBA 3X1TA 4KUDC 4WNNB 3AV1D 5GXQD 3B6FB 2HIOD 2F8NA 3C1BD 1TZYB 5GT3B 3X1UB 4G92B 3AFAD 5F99D 2F8NG 4YM6D 5B31G 3AV1C 1P3BA 3R45B 5GXQC 3AZMA 2HIOC 3C1BC 1A7WA 4E45A 3AYWD 3AFAC 5B0ZB 3W98A 3VH6W 1P3ID 5B24D 5B0YB 4YM6C 1P34D 5B1MA 3WAAA 4XZQD 3WKJD 5DNMD 3B6GA 3TU4A 3W99A 3O62C 3AYWC 1F66D 3KWQA 3B6FD 4J8XA 4X23D 3AZGB 1P3IC 1TZYD 5GT3D 3X1VB 4H9SA 5AV8B 1N1JA 3X1UD 2CV5A 1P34C 3NQJA 4XZQC 4H9PB 5DNMC 1P3KA 3WKJC 1ID3B 4WU9D 4EO5B 4J8WA 1F66C 3B6FC 3VH6T 5E5AD 4X23C 1TZYC 5GT3C 3X1UC 3W96A 3A6NA 5B33B 5AV9B 3MGRA 4ZUXD 2BYMB 3AZEA 1P3MA 4QLCA 5E5AC 5CPIB 3WTPE 5KDMA 5CPKA 5AVCB 3AZHD 1KX3B 4KUDA 4ZUXC 5B0ZC 5B0YC 4JJNB 3REIB 5BNXA 3X1VD 5BT1D 3REHD 1ID3D 1P3LB 5CPJD 3AZHC 1M1AB 3X1TD 5GXQA 2HIOA 3AZGC 3X1VC 1M18B 5AV8C 5BT1C 5AV9D 3REHC 1ID3C 5AY8A 3AFAA 1AOIB 5CPJC 5GT0A 3V9RA 3REKD 2AROD 5AVCD 5AV9C 5B33C 3O62A 3UTBB 3AYWA 2NQBD 1P3FB 1P3IA 1HQ3B 5CHLB 5JRGD 4H9NB 5CPIC 4XZQA 3REKC 5DNMA 3WKJA 1P3LD 2AROC 3LZ0B 5AVCC 4WNNA 5DNND 1F66A 3B6FA 2NQBC 3KWQD 4JJNC 5BNVA 3AN2B 3VH6A 4M6BA 4X23A 1TZYA 5GT3A 4WV4B 5JRGC 3X1UA 3NQUB 3RELD 1AOID 1P3LC 1Q9CA 3AZJD 1M1AC 5DNNC 2HUEC 5E5AA 3KWQC 4J8UD 2F8NH 3WTPB 1U35D 5B0ZA 3MGRD 3RELC 1P3FD 1AOIC 2YFVA 5B0YA 3LJAD 5G49B 3AZJC 2FJ7B 3AZED 1P3MD 4NE6A 4J8UC 4CAYB 4WU8B 3MNNB 3AZHA 5CPKD 1U35C 4KUDD 1P3FC 3AZGA 1P3OB 1HQ3C 3X1VA 3LJAC 5B1LB 5AV8A 3REHA 4H9PA 1P3MC 1ID3A 4Z66B 3MVDB 5AVBB 3C1CB 3AV2B 2IO5B 5B33A 5AV9A 3WA9B 1BH8B 5AY8D 1H3OB 2BYMA 5B2IB 4UUZB 5GT0D 5CPIA 3REKA 1ULYA 3W97D 2AROA 3MNND 4Z5TB 5AVCA 5CP6D 2PYOB 3O62D 2NQBA 5AY8C 4JJNA 5B1LD 1P3AB 5GT0C 5JRGA 3LZ1B 4KGCB 3KUYB 3W97C 1P3LA 4WU8C 4Z66D 3MNNC 3MVDD 5AVBD 1M1AA 5DNNA 5CP6C 5B1LC 2YFWA 3B0DC 1S32B 3RELA 1AOIA 5B2JB 4Z66C 1WWIA 3MVDC 5AVBC 3AZJA 1ZLAB 3C1CC 3MGSB 4J8UA 1P3PB 2IO5C 4H9QB 1KX5B 4G92C 1U35A 1P3FA 5B2IC 5B0ZD 1HQ3A 3LJAA 4XUJB 5B0YD 5GSUB 3X1SB 3UT9B 5FUGB 3LZ0A 3REJB 3AZGD 3UTAB 4NFTA 5AV8D 3KUYC 1TAFB 4E44A 2F8NB 5B31B 4ZBJB 1P3PD 1KX5D 1WWSA 3B0CW 5B33D 3LELB 5B2JC 5G49A 4EO5C 3MGQB 1P3BB 4Z2MG 4HGAB 4CAYA 5CPID 3W97A 1P3PC 4WU8A 3MNNA 1KX5C 1KX3D 5CP6A 3W98B 3AZKB 5B1LA 4JJND 5B1MB 3UTAD 4LD9B 5AV6B 3UT9C 2BYKA 4Z66A 3MVDA 3B0CT 5AVBA 3C1CA 4J8XB 5B31D 1KX3C 1M1AD 2CV5B 3UTAC 1M18D 4KHAB 1P3KB 1BH8A 3LELD 1H3OA 4H9OB 5B2IA 3MGQD 4UUZA 4G91B 5B31C 4ZBJC 3R45A 1KX4B 1M18C 3W96B 3UTBD 3LELC 3AZKD 3MGQC 4QLCB 1HQ3D 5AV6D 4KGCA 4HGAC 3KUYA 1BH9B 4R8PB
chains in the Genus database with same CATH superfamily
3LZ0D 2NZDB 3UTBC 5BNXB 3AZKC 1F1EA 3AN2D 4LD9C 1M19B 5AV6C 5B2JA 3LZ0C 3AV1B 1B6WA 4CSRB 3H0RC 3C1BB 1P3PA 1KX4D 3AN2C 1KX5A 3WTPD 3AFAB 2RVQC 5F99B 5B40B 3P5JB 3KXBB 4YM6B 4G91C 2FJ7D 5GSUA 5BO0B 3REID 3UT9A 1KX4C 1HTAA 2NZDD 4WU8D 3WTPC 3AZFB 1KX3A 3B0BA 5B24B 3MGPB 1M19D 1P3OD 3UTAA 1P34B 4XZQB 5B32B 5DNMB 2FJ7C 2G5HC 3REIC 1TAFA 2RIQA 2NZDC 1R4VA 1F66B 4WZSB 1Z2CB 5BNVB 5JA4B 5B31A 4X23B 3C1CD 1P3GB 1M19C 1P3OC 1M18A 3AV2D 3WA9D 4WU9B 3LELA 5B40D 1BFMA 3KXBD 3FDDA 3MGQA 5B2ID 2ZY2A 5E5AB 2ZY4A 2DQNC 3AZIB 3IP4C 4J8VB 4Z5TD 3AZFD 4Z2MH 2FFFB 4ZUXB 3AV2C 3WA9C 3UTBA 5F99C 3MGPD 2YFVB 5B40C 3AZNB 3KXBC 3AZKA 2PYOD 4LD9A 3VH5W 5B32D 1P3AD 5AV6A 3LZ1D 1EQZB 2Y2JA 4H9NA 4KGCD 5BS7C 3KUYD 3AZHB 3AZLB 4Z5TC 3AZFC 4AWLB 1P3GD 4NE3A 5B24C 3MGPC 2PYOC 3AN2A 4KHAA 1P3AC 5B32C 5AV5B 3REHB 3KFUG 3LZ1C 2JCHA 4H9RB 4KGCC 4H9OA 4YS3B 5CPJB 3NQUA 1S32D 5B2JD 1JFIB 3X1TB 1ZLAD 3AZID 1P3GC 4J8VD 3MGSD 3VH5T 2W8SA 2JSSA 1KX4A 3WTPA 4WU9C 3AZND 1B67A 1S32C 3AL0C 4XUJD 3REKB 1EQZD 1ZLAC 3AZIC 2FJ7A 4WJ3C 4J8VC 2LY8A 2AROB 1BH9A 3MGSC 3REIA 5GSUD 4DRAA 3AZMB 3X1SD 4R8PA 3UT9D 3AZLD 2NZDA 2NQBB 3AZNC 4NE5A 2CWEA 3REJD 2UWXA 1M19A 5AV5D 5JRGB 1P3OA 4XUJC 1EQZC 3WAAB 4YS3D 5GSUC 3AZLC 3X1SC 3B6GB 3TU4B 5DNNB 3AV1A 3W99B 4CSRA 4AWLC 2HUEB 3KWQB 3C1BA 2F8ND 3REJC 5C3IB 5AV5C 2YFWB 1N1JB 3AV2A 2ZM5A 3RELB 3NQJB 4YS3C 3WA9A 5F99A 5B40A 3KXBA 3EG5B 3AZJB 4YM6A 3X1TC 4J8WB 2Y2NA 1P3BD 3AZMD 5BO0A 4J8UB 2Y2OA 5BS7A 4Z5TA 3AZFA 3A6NB 1U35B 2Y2GA 3MGRB 5B24A 3MGPA 2PYOA 3W98D 3LJAB 1P34A 1P3AA 5B32A 3AZEB 5B1MD 4LD9D 3WAAD 1P3MB 1P3BC 3LZ1A 3AZMC 3B6GD 3TU4D 5KDMB 3W99D 3H0LC 5CPKB 5JA4A 4KUDB 3EPKA 4J8XD 1P3GA 5B32G 3W98C 3VH5A 2CV5D 5B1MC 2G5IC 3WAAC 1P3KD 2L5AA 4WU9A 3B6GC 3TU4C 1S32A 2RVQD 3W99C 4J8WD 1ZLAA 4J8XC 3AZIA 4J8VA 5GXQB 3MGSA 2HIOB 5C3IC 4H9SC 2CV5C 4ZUXA 4H9QA 3A6ND 3W96D 1P3KC 3KSYA 3AZNA 5AY8B 2F8NK 4J8WC 5GT0B 3V9RB 4QLCD 4XUJA 1EQZA 3W97B 3X1SA 3AZLA 5FUGA 3W96C 1KU5A 4R8PD 5CP6B 3A6NC 3O62B 3MGRC 3AYWB 3REJA 1P3IB 5AV5A 3AZEC 4QLCC 2BYKB 3B0DB 4H9RA 4YS3A 2BG1A 5CPJA 3WKJB 5CPKC 1JFIA 4R8PC 4DRBA 3X1TA 4KUDC 4WNNB 3AV1D 5GXQD 3B6FB 2HIOD 2F8NA 3C1BD 1TZYB 5GT3B 3X1UB 4G92B 3AFAD 5F99D 2F8NG 4YM6D 5B31G 3AV1C 1P3BA 2Y2IA 3R45B 5GXQC 2HIOC 3AZMA 3C1BC 3A1IA 1A7WA 2DF4C 3F6TA 4E45A 3AYWD 3AFAC 5B0ZB 3W98A 3VH6W 1P3ID 5B24D 3H0MC 5B0YB 4YM6C 1P34D 5B1MA 3WAAA 4XZQD 3WKJD 5DNMD 3B6GA 3TU4A 3W99A 3O62C 3AYWC 2Y2PA 3KWQA 1F66D 3B6FD 4J8XA 4X23D 3AZGB 1P3IC 1TZYD 5GT3D 3X1VB 4H9SA 5AV8B 1N1JA 3X1UD 2CV5A 1P34C 3NQJA 4XZQC 4H9PB 5DNMC 1P3KA 3WKJC 1ID3B 4WU9D 2JE5A 4EO5B 4J8WA 1F66C 3B6FC 3VH6T 5E5AD 2XD5A 4X23C 1TZYC 5GT3C 3X1UC 3W96A 3A6NA 5B33B 5AV9B 3MGRA 4ZUXD 2BYMB 3AZEA 1P3MA 4QLCA 5E5AC 5CPIB 2Y2QA 3WTPE 5KDMA 5CPKA 5AVCB 3AZHD 1KX3B 4KUDA 4ZUXC 5B0ZC 5B0YC 4JJNB 1PZRA 5BNXA 3REIB 3X1VD 5BT1D 3REHD 1ID3D 1P3LB 5CPJD 3EPHA 3AZHC 1M1AB 3X1TD 5GXQA 2HIOA 3AZGC 3X1VC 1M18B 5AV8C 5BT1C 5AV9D 3REHC 1ID3C 5AY8A 3AFAA 1AOIB 5CPJC 5GT0A 3V9RA 2Y2KA 3EPLA 3REKD 2J8PA 2AROD 2Y2MA 5AVCD 5AV9C 5B33C 3O62A 3UTBB 3AYWA 2NQBD 1P3FB 1P3IA 1HQ3B 5CHLB 5JRGD 4H9NB 5CPIC 4XZQA 3REKC 5DNMA 3WKJA 1P3LD 2AROC 3LZ0B 5AVCC 4WNNA 5DNND 1F66A 3B6FA 2NQBC 3KWQD 4JJNC 5BNVA 3AN2B 3VH6A 4M6BA 4X23A 1TZYA 5GT3A 4WV4B 5JRGC 3X1UA 3NQUB 3RELD 1AOID 1P3LC 1Q9CA 3AZJD 1M1AC 5DNNC 2HUEC 5E5AA 3KWQC 4J8UD 2F8NH 3WTPB 1U35D 5B0ZA 3MGRD 3RELC 1P3FD 1AOIC 2YFVA 5B0YA 4DQYB 3LJAD 5G49B 3AZJC 2FJ7B 3AZED 1P3MD 4NE6A 4J8UC 4CAYB 4WU8B 3MNNB 3AZHA 2Y2HA 5CPKD 2F2AC 1U35C 4KUDD 1P3FC 3AZGA 1P3OB 1HQ3C 3X1VA 3LJAC 5B1LB 5AV8A 3REHA 4H9PA 3EPJA 1P3MC 1ID3A 4UPKA 2ZY5A 4Z66B 3MVDB 5AVBB 3C1CB 2ZY3A 3AV2B 2IO5B 5B33A 5AV9A 3WA9B 1BH8B 5AY8D 1H3OB 2BYMA 5B2IB 4UUZB 5GT0D 5CPIA 3REKA 1ULYA 3W97D 2AROA 3MNND 4Z5TB 5AVCA 5CP6D 2PYOB 3O62D 2NQBA 5AY8C 4JJNA 5B1LD 1P3AB 5GT0C 5JRGA 3LZ1B 4KGCB 3KUYB 3W97C 1P3LA 4WU8C 4Z66D 3MNNC 3MVDD 5AVBD 1M1AA 5DNNA 5CP6C 5B1LC 2YFWA 3B0DC 1S32B 3RELA 1AOIA 5B2JB 1T3UA 1WWIA 4Z66C 5AVBC 3MVDC 3AZJA 2VQRA 1ZLAB 3C1CC 2XD1A 3MGSB 4J8UA 1P3PB 2IO5C 4H9QB 1KX5B 4G92C 1U35A 1P3FA 5B2IC 5B0ZD 1HQ3A 3LJAA 4XUJB 5B0YD 5GSUB 3X1SB 3UT9B 5FUGB 3LZ0A 3REJB 3AZGD 3UTAB 4NFTA 5AV8D 3KUYC 1TAFB 4E44A 2F8NB 5B31B 4ZBJB 1P3PD 1KX5D 1WWSA 3B0CW 5B33D 3LELB 5B2JC 5G49A 4EO5C 3MGQB 1P3BB 4Z2MG 4HGAB 4CAYA 5CPID 3W97A 1P3PC 4WU8A 3MNNA 1KX5C 1KX3D 5CP6A 3W98B 2Y2LA 3AZKB 5B1LA 4JJND 5B1MB 3UTAD 4LD9B 5AV6B 3UT9C 2BYKA 1W2EA 4Z66A 3MVDA 3B0CT 5AVBA 3C1CA 4J8XB 5B31D 1KX3C 1M1AD 2CV5B 3UTAC 1M18D 4KHAB 1P3KB 1BH8A 3LELD 1H3OA 4H9OB 5B2IA 3MGQD 4UUZA 4G91B 5B31C 4ZBJC 3R45A 3A1KA 1KX4B 1M18C 3W96B 3UTBD 3LELC 3AZKD 3MGQC 4QLCB 1HQ3D 5AV6D 4KGCA 4HGAC 3KUYA 1BH9B 4R8PB
chains in the Genus database with same CATH topology
3LZ0D 2NZDB 3UTBC 5BNXB 3AZKC 1F1EA 3AN2D 4LD9C 1M19B 5AV6C 5B2JA 3LZ0C 3AV1B 1B6WA 4CSRB 3H0RC 3C1BB 1P3PA 1KX4D 3AN2C 1KX5A 3WTPD 3AFAB 2RVQC 5F99B 5B40B 3P5JB 3KXBB 4YM6B 4G91C 2FJ7D 5GSUA 5BO0B 3REID 3UT9A 1KX4C 1HTAA 2NZDD 4WU8D 3WTPC 3AZFB 1KX3A 3B0BA 5B24B 3MGPB 1M19D 1P3OD 3UTAA 1P34B 4XZQB 5B32B 5DNMB 2FJ7C 2G5HC 3REIC 1TAFA 2RIQA 2NZDC 1R4VA 1F66B 4WZSB 1Z2CB 5BNVB 5JA4B 5B31A 4X23B 3C1CD 1P3GB 1M19C 1P3OC 1M18A 3AV2D 3WA9D 4WU9B 3LELA 5B40D 1BFMA 3KXBD 3FDDA 3MGQA 5B2ID 2ZY2A 5E5AB 2ZY4A 2DQNC 3AZIB 3IP4C 4J8VB 4Z5TD 3AZFD 4Z2MH 2FFFB 4ZUXB 3AV2C 3WA9C 3UTBA 5F99C 3MGPD 2YFVB 5B40C 3AZNB 3KXBC 3AZKA 2PYOD 4LD9A 3VH5W 5B32D 1P3AD 5AV6A 3LZ1D 1EQZB 2Y2JA 4H9NA 4KGCD 5BS7C 3KUYD 3AZHB 3AZLB 4Z5TC 3AZFC 4AWLB 1P3GD 4NE3A 5B24C 3MGPC 2PYOC 3AN2A 4KHAA 1P3AC 5B32C 5AV5B 3REHB 3KFUG 3LZ1C 2JCHA 4H9RB 4KGCC 4H9OA 4YS3B 5CPJB 3NQUA 1S32D 5B2JD 1JFIB 3X1TB 1ZLAD 3AZID 1P3GC 4J8VD 3MGSD 3VH5T 2W8SA 2JSSA 1KX4A 3WTPA 4WU9C 3AZND 1B67A 1S32C 3AL0C 4XUJD 3REKB 1EQZD 1ZLAC 3AZIC 2FJ7A 4WJ3C 4J8VC 2LY8A 2AROB 1BH9A 3MGSC 3REIA 5GSUD 4DRAA 3AZMB 3X1SD 4R8PA 3UT9D 3AZLD 2NZDA 2NQBB 3AZNC 4NE5A 2CWEA 3REJD 2UWXA 1M19A 5AV5D 5JRGB 1P3OA 4XUJC 1EQZC 3WAAB 4YS3D 5GSUC 3AZLC 3X1SC 3B6GB 3TU4B 5DNNB 3AV1A 3W99B 4CSRA 4AWLC 2HUEB 3KWQB 3C1BA 2F8ND 3REJC 5C3IB 5AV5C 2YFWB 1N1JB 3AV2A 2ZM5A 3RELB 3NQJB 4YS3C 3WA9A 5F99A 5B40A 3KXBA 3EG5B 3AZJB 4YM6A 3X1TC 4J8WB 2Y2NA 1P3BD 3AZMD 5BO0A 4J8UB 2Y2OA 5BS7A 4Z5TA 3AZFA 3A6NB 1U35B 2Y2GA 3MGRB 5B24A 3MGPA 2PYOA 3W98D 3LJAB 1P34A 1P3AA 5B32A 3AZEB 5B1MD 4LD9D 3WAAD 1P3MB 1P3BC 3LZ1A 3AZMC 3B6GD 3TU4D 5KDMB 3W99D 3H0LC 5CPKB 5JA4A 4KUDB 3EPKA 4J8XD 1P3GA 5B32G 3W98C 3VH5A 2CV5D 5B1MC 2G5IC 3WAAC 1P3KD 2L5AA 4WU9A 3B6GC 3TU4C 1S32A 2RVQD 3W99C 4J8WD 1ZLAA 4J8XC 3AZIA 4J8VA 5GXQB 3MGSA 2HIOB 5C3IC 4H9SC 2CV5C 4ZUXA 4H9QA 3A6ND 3W96D 1P3KC 3KSYA 3AZNA 5AY8B 2F8NK 4J8WC 5GT0B 3V9RB 4QLCD 4XUJA 1EQZA 3W97B 3X1SA 3AZLA 5FUGA 3W96C 1KU5A 4R8PD 5CP6B 3A6NC 3O62B 3MGRC 3AYWB 3REJA 1P3IB 5AV5A 3AZEC 4QLCC 2BYKB 3B0DB 4H9RA 4YS3A 2BG1A 5CPJA 3WKJB 5CPKC 1JFIA 4R8PC 4DRBA 3X1TA 4KUDC 4WNNB 3AV1D 5GXQD 3B6FB 2HIOD 2F8NA 3C1BD 1TZYB 5GT3B 3X1UB 4G92B 3AFAD 5F99D 2F8NG 4YM6D 5B31G 3AV1C 1P3BA 2Y2IA 3R45B 5GXQC 2HIOC 3AZMA 3C1BC 3A1IA 1A7WA 2DF4C 3F6TA 4E45A 3AYWD 3AFAC 5B0ZB 3W98A 3VH6W 1P3ID 5B24D 3H0MC 5B0YB 4YM6C 1P34D 5B1MA 3WAAA 4XZQD 3WKJD 5DNMD 3B6GA 3TU4A 3W99A 3O62C 3AYWC 2Y2PA 3KWQA 1F66D 3B6FD 4J8XA 4X23D 3AZGB 1P3IC 1TZYD 5GT3D 3X1VB 4H9SA 5AV8B 1N1JA 3X1UD 2CV5A 1P34C 3NQJA 4XZQC 4H9PB 5DNMC 1P3KA 3WKJC 1ID3B 4WU9D 2JE5A 4EO5B 4J8WA 1F66C 3B6FC 3VH6T 5E5AD 2XD5A 4X23C 1TZYC 5GT3C 3X1UC 3W96A 3A6NA 5B33B 5AV9B 3MGRA 4ZUXD 2BYMB 3AZEA 1P3MA 4QLCA 5E5AC 5CPIB 2Y2QA 3WTPE 5KDMA 5CPKA 5AVCB 3AZHD 1KX3B 4KUDA 4ZUXC 5B0ZC 5B0YC 4JJNB 1PZRA 5BNXA 3REIB 3X1VD 5BT1D 3REHD 1ID3D 1P3LB 5CPJD 3EPHA 3AZHC 1M1AB 3X1TD 5GXQA 2HIOA 3AZGC 3X1VC 1M18B 5AV8C 5BT1C 5AV9D 3REHC 1ID3C 5AY8A 3AFAA 1AOIB 5CPJC 5GT0A 3V9RA 2Y2KA 3EPLA 3REKD 2J8PA 2AROD 2Y2MA 5AVCD 5AV9C 5B33C 3O62A 3UTBB 3AYWA 2NQBD 1P3FB 1P3IA 1HQ3B 5CHLB 5JRGD 4H9NB 5CPIC 4XZQA 3REKC 5DNMA 3WKJA 1P3LD 2AROC 3LZ0B 5AVCC 4WNNA 5DNND 1F66A 3B6FA 2NQBC 3KWQD 4JJNC 5BNVA 3AN2B 3VH6A 4M6BA 4X23A 1TZYA 5GT3A 4WV4B 5JRGC 3X1UA 3NQUB 3RELD 1AOID 1P3LC 1Q9CA 3AZJD 1M1AC 5DNNC 2HUEC 5E5AA 3KWQC 4J8UD 2F8NH 3WTPB 1U35D 5B0ZA 3MGRD 3RELC 1P3FD 1AOIC 2YFVA 5B0YA 4DQYB 3LJAD 5G49B 3AZJC 2FJ7B 3AZED 1P3MD 4NE6A 4J8UC 4CAYB 4WU8B 3MNNB 3AZHA 2Y2HA 5CPKD 2F2AC 1U35C 4KUDD 1P3FC 3AZGA 1P3OB 1HQ3C 3X1VA 3LJAC 5B1LB 5AV8A 3REHA 4H9PA 3EPJA 1P3MC 1ID3A 4UPKA 2ZY5A 4Z66B 3MVDB 5AVBB 3C1CB 2ZY3A 3AV2B 2IO5B 5B33A 5AV9A 3WA9B 1BH8B 5AY8D 1H3OB 2BYMA 5B2IB 4UUZB 5GT0D 5CPIA 3REKA 1ULYA 3W97D 2AROA 3MNND 4Z5TB 5AVCA 5CP6D 2PYOB 3O62D 2NQBA 5AY8C 4JJNA 5B1LD 1P3AB 5GT0C 5JRGA 3LZ1B 4KGCB 3KUYB 3W97C 1P3LA 4WU8C 4Z66D 3MNNC 3MVDD 5AVBD 1M1AA 5DNNA 5CP6C 5B1LC 2YFWA 3B0DC 1S32B 3RELA 1AOIA 5B2JB 1T3UA 1WWIA 4Z66C 5AVBC 3MVDC 3AZJA 2VQRA 1ZLAB 3C1CC 2XD1A 3MGSB 4J8UA 1P3PB 2IO5C 4H9QB 1KX5B 4G92C 1U35A 1P3FA 5B2IC 5B0ZD 1HQ3A 3LJAA 4XUJB 5B0YD 5GSUB 3X1SB 3UT9B 5FUGB 3LZ0A 3REJB 3AZGD 3UTAB 4NFTA 5AV8D 3KUYC 1TAFB 4E44A 2F8NB 5B31B 4ZBJB 1P3PD 1KX5D 1WWSA 3B0CW 5B33D 3LELB 5B2JC 5G49A 4EO5C 3MGQB 1P3BB 4Z2MG 4HGAB 4CAYA 5CPID 3W97A 1P3PC 4WU8A 3MNNA 1KX5C 1KX3D 5CP6A 3W98B 2Y2LA 3AZKB 5B1LA 4JJND 5B1MB 3UTAD 4LD9B 5AV6B 3UT9C 2BYKA 1W2EA 4Z66A 3MVDA 3B0CT 5AVBA 3C1CA 4J8XB 5B31D 1KX3C 1M1AD 2CV5B 3UTAC 1M18D 4KHAB 1P3KB 1BH8A 3LELD 1H3OA 4H9OB 5B2IA 3MGQD 4UUZA 4G91B 5B31C 4ZBJC 3R45A 3A1KA 1KX4B 1M18C 3W96B 3UTBD 3LELC 3AZKD 3MGQC 4QLCB 1HQ3D 5AV6D 4KGCA 4HGAC 3KUYA 1BH9B 4R8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 D;  2NZD B;  3UTB C;  5BNX B;  3AZK C;  1F1E A;  3AN2 D;  4LD9 C;  1M19 B;  5AV6 C;  5B2J A;  3LZ0 C;  3AV1 B;  1B6W A;  4CSR B;  3C1B B;  1P3P A;  1KX4 D;  3AN2 C;  1KX5 A;  3WTP D;  3AFA B;  2RVQ C;  5F99 B;  5B40 B;  3KXB B;  4YM6 B;  4G91 C;  2FJ7 D;  5GSU A;  5BO0 B;  3REI D;  3UT9 A;  1KX4 C;  1HTA A;  2NZD D;  4WU8 D;  3WTP C;  3AZF B;  1KX3 A;  3B0B A;  5B24 B;  3MGP B;  1M19 D;  1P3O D;  3UTA A;  1P34 B;  4XZQ B;  5B32 B;  5DNM B;  2FJ7 C;  3REI C;  1TAF A;  2NZD C;  1R4V A;  1F66 B;  4WZS B;  5BNV B;  5JA4 B;  5B31 A;  3C1C D;  4X23 B;  1P3G B;  1M19 C;  1P3O C;  1M18 A;  3AV2 D;  3WA9 D;  4WU9 B;  3LEL A;  5B40 D;  1BFM A;  3KXB D;  3MGQ A;  5B2I D;  5E5A B;  3AZI B;  4J8V B;  4Z5T D;  3AZF D;  4Z2M H;  4ZUX B;  3AV2 C;  3WA9 C;  3UTB A;  5F99 C;  3MGP D;  2YFV B;  5B40 C;  3AZN B;  3KXB C;  3AZK A;  2PYO D;  4LD9 A;  3VH5 W;  5B32 D;  1P3A D;  5AV6 A;  3LZ1 D;  1EQZ B;  4H9N A;  4KGC D;  5BS7 C;  3KUY D;  3AZH B;  3AZL B;  4Z5T C;  3AZF C;  4AWL B;  1P3G D;  4NE3 A;  5B24 C;  3MGP C;  2PYO C;  3AN2 A;  4KHA A;  1P3A C;  5B32 C;  5AV5 B;  3REH B;  3LZ1 C;  4H9R B;  4KGC C;  4H9O A;  4YS3 B;  5CPJ B;  3NQU A;  1S32 D;  5B2J D;  1JFI B;  3X1T B;  1ZLA D;  3AZI D;  1P3G C;  4J8V D;  3MGS D;  3VH5 T;  2JSS A;  1KX4 A;  3WTP A;  4WU9 C;  3AZN D;  1B67 A;  1S32 C;  4XUJ D;  3REK B;  1EQZ D;  1ZLA C;  3AZI C;  2FJ7 A;  4J8V C;  2LY8 A;  2ARO B;  1BH9 A;  3MGS C;  3REI A;  5GSU D;  4DRA A;  3AZM B;  3X1S D;  4R8P A;  3UT9 D;  3AZL D;  2NZD A;  2NQB B;  3AZN C;  4NE5 A;  2CWE A;  3REJ D;  1M19 A;  5AV5 D;  5JRG B;  1P3O A;  4XUJ C;  1EQZ C;  3WAA B;  4YS3 D;  5GSU C;  3AZL C;  3X1S C;  3B6G B;  3TU4 B;  5DNN B;  3AV1 A;  3W99 B;  4CSR A;  4AWL C;  2HUE B;  3KWQ B;  3C1B A;  2F8N D;  3REJ C;  5C3I B;  5AV5 C;  2YFW B;  1N1J B;  3AV2 A;  3REL B;  3NQJ B;  4YS3 C;  3WA9 A;  5F99 A;  5B40 A;  3KXB A;  3AZJ B;  4YM6 A;  3X1T C;  4J8W B;  1P3B D;  3AZM D;  5BO0 A;  4J8U B;  5BS7 A;  4Z5T A;  3AZF A;  3A6N B;  1U35 B;  3MGR B;  5B24 A;  3MGP A;  2PYO A;  3W98 D;  3LJA B;  1P34 A;  1P3A A;  5B32 A;  3AZE B;  5B1M D;  4LD9 D;  3WAA D;  1P3M B;  1P3B C;  3LZ1 A;  3AZM C;  3B6G D;  3TU4 D;  5KDM B;  3W99 D;  5CPK B;  5JA4 A;  4KUD B;  4J8X D;  1P3G A;  5B32 G;  3W98 C;  3VH5 A;  2CV5 D;  5B1M C;  3WAA C;  1P3K D;  2L5A A;  4WU9 A;  3B6G C;  3TU4 C;  1S32 A;  2RVQ D;  3W99 C;  4J8W D;  1ZLA A;  4J8X C;  3AZI A;  4J8V A;  5GXQ B;  3MGS A;  2HIO B;  5C3I C;  4H9S C;  2CV5 C;  4ZUX A;  4H9Q A;  3A6N D;  3W96 D;  1P3K C;  3KSY A;  3AZN A;  5AY8 B;  2F8N K;  4J8W C;  5GT0 B;  3V9R B;  4QLC D;  4XUJ A;  1EQZ A;  3W97 B;  3X1S A;  3AZL A;  5FUG A;  3W96 C;  1KU5 A;  4R8P D;  5CP6 B;  3A6N C;  3O62 B;  3MGR C;  3AYW B;  3REJ A;  1P3I B;  5AV5 A;  3AZE C;  4QLC C;  2BYK B;  3B0D B;  4H9R A;  4YS3 A;  5CPJ A;  3WKJ B;  5CPK C;  1JFI A;  4R8P C;  4DRB A;  3X1T A;  4KUD C;  4WNN B;  3AV1 D;  5GXQ D;  3B6F B;  2HIO D;  2F8N A;  3C1B D;  1TZY B;  5GT3 B;  3X1U B;  4G92 B;  3AFA D;  5F99 D;  2F8N G;  4YM6 D;  5B31 G;  3AV1 C;  1P3B A;  3R45 B;  5GXQ C;  3AZM A;  2HIO C;  3C1B C;  1A7W A;  4E45 A;  3AYW D;  3AFA C;  5B0Z B;  3W98 A;  3VH6 W;  1P3I D;  5B24 D;  5B0Y B;  4YM6 C;  1P34 D;  5B1M A;  3WAA A;  4XZQ D;  3WKJ D;  5DNM D;  3B6G A;  3TU4 A;  3W99 A;  3O62 C;  3AYW C;  1F66 D;  3KWQ A;  3B6F D;  4J8X A;  4X23 D;  3AZG B;  1P3I C;  1TZY D;  5GT3 D;  3X1V B;  4H9S A;  5AV8 B;  1N1J A;  3X1U D;  2CV5 A;  1P34 C;  3NQJ A;  4XZQ C;  4H9P B;  5DNM C;  1P3K A;  3WKJ C;  1ID3 B;  4WU9 D;  4EO5 B;  4J8W A;  1F66 C;  3B6F C;  3VH6 T;  5E5A D;  4X23 C;  1TZY C;  5GT3 C;  3X1U C;  3W96 A;  3A6N A;  5B33 B;  5AV9 B;  3MGR A;  4ZUX D;  2BYM B;  3AZE A;  1P3M A;  4QLC A;  5E5A C;  5CPI B;  3WTP E;  5KDM A;  5CPK A;  5AVC B;  3AZH D;  1KX3 B;  4KUD A;  4ZUX C;  5B0Z C;  5B0Y C;  4JJN B;  3REI B;  5BNX A;  3X1V D;  5BT1 D;  3REH D;  1ID3 D;  1P3L B;  5CPJ D;  3AZH C;  1M1A B;  3X1T D;  5GXQ A;  2HIO A;  3AZG C;  3X1V C;  1M18 B;  5AV8 C;  5BT1 C;  5AV9 D;  3REH C;  1ID3 C;  5AY8 A;  3AFA A;  1AOI B;  5CPJ C;  5GT0 A;  3V9R A;  3REK D;  2ARO D;  5AVC D;  5AV9 C;  5B33 C;  3O62 A;  3UTB B;  3AYW A;  2NQB D;  1P3F B;  1P3I A;  1HQ3 B;  5CHL B;  5JRG D;  4H9N B;  5CPI C;  4XZQ A;  3REK C;  5DNM A;  3WKJ A;  1P3L D;  2ARO C;  3LZ0 B;  5AVC C;  4WNN A;  5DNN D;  1F66 A;  3B6F A;  2NQB C;  3KWQ D;  4JJN C;  5BNV A;  3AN2 B;  3VH6 A;  4M6B A;  4X23 A;  1TZY A;  5GT3 A;  4WV4 B;  5JRG C;  3X1U A;  3NQU B;  3REL D;  1AOI D;  1P3L C;  1Q9C A;  3AZJ D;  1M1A C;  5DNN C;  2HUE C;  5E5A A;  3KWQ C;  4J8U D;  2F8N H;  3WTP B;  1U35 D;  5B0Z A;  3MGR D;  3REL C;  1P3F D;  1AOI C;  2YFV A;  5B0Y A;  3LJA D;  5G49 B;  3AZJ C;  2FJ7 B;  3AZE D;  1P3M D;  4NE6 A;  4J8U C;  4CAY B;  4WU8 B;  3MNN B;  3AZH A;  5CPK D;  1U35 C;  4KUD D;  1P3F C;  3AZG A;  1P3O B;  1HQ3 C;  3X1V A;  3LJA C;  5B1L B;  5AV8 A;  3REH A;  4H9P A;  1P3M C;  1ID3 A;  4Z66 B;  3MVD B;  5AVB B;  3C1C B;  3AV2 B;  2IO5 B;  5B33 A;  5AV9 A;  3WA9 B;  1BH8 B;  5AY8 D;  1H3O B;  2BYM A;  5B2I B;  4UUZ B;  5GT0 D;  5CPI A;  3REK A;  1ULY A;  3W97 D;  2ARO A;  3MNN D;  4Z5T B;  5AVC A;  5CP6 D;  2PYO B;  3O62 D;  2NQB A;  5AY8 C;  4JJN A;  5B1L D;  1P3A B;  5GT0 C;  5JRG A;  3LZ1 B;  4KGC B;  3KUY B;  3W97 C;  1P3L A;  4WU8 C;  4Z66 D;  3MNN C;  3MVD D;  5AVB D;  1M1A A;  5DNN A;  5CP6 C;  5B1L C;  2YFW A;  3B0D C;  1S32 B;  3REL A;  1AOI A;  5B2J B;  4Z66 C;  1WWI A;  3MVD C;  5AVB C;  3AZJ A;  1ZLA B;  3C1C C;  3MGS B;  4J8U A;  1P3P B;  2IO5 C;  4H9Q B;  1KX5 B;  4G92 C;  1U35 A;  1P3F A;  5B2I C;  5B0Z D;  1HQ3 A;  3LJA A;  4XUJ B;  5B0Y D;  5GSU B;  3X1S B;  3UT9 B;  5FUG B;  3LZ0 A;  3REJ B;  3AZG D;  3UTA B;  4NFT A;  5AV8 D;  3KUY C;  1TAF B;  4E44 A;  2F8N B;  5B31 B;  4ZBJ B;  1P3P D;  1KX5 D;  1WWS A;  3B0C W;  5B33 D;  3LEL B;  5B2J C;  5G49 A;  4EO5 C;  3MGQ B;  1P3B B;  4Z2M G;  4HGA B;  4CAY A;  5CPI D;  3W97 A;  1P3P C;  4WU8 A;  3MNN A;  1KX5 C;  1KX3 D;  5CP6 A;  3W98 B;  3AZK B;  5B1L A;  4JJN D;  5B1M B;  3UTA D;  4LD9 B;  5AV6 B;  3UT9 C;  2BYK A;  4Z66 A;  3MVD A;  3B0C T;  5AVB A;  3C1C A;  4J8X B;  5B31 D;  1KX3 C;  1M1A D;  2CV5 B;  3UTA C;  1M18 D;  4KHA B;  1P3K B;  1BH8 A;  3LEL D;  1H3O A;  4H9O B;  5B2I A;  3MGQ D;  4UUZ A;  4G91 B;  5B31 C;  4ZBJ C;  3R45 A;  1KX4 B;  1M18 C;  3W96 B;  3UTB D;  3LEL C;  3AZK D;  3MGQ C;  4QLC B;  1HQ3 D;  5AV6 D;  4KGC A;  4HGA C;  3KUY A;  1BH9 B;  4R8P B; 
#chains in the Genus database with same CATH topology
 3LZ0 D;  2NZD B;  3UTB C;  5BNX B;  3AZK C;  1F1E A;  3AN2 D;  4LD9 C;  1M19 B;  5AV6 C;  5B2J A;  3LZ0 C;  3AV1 B;  1B6W A;  4CSR B;  3H0R C;  3C1B B;  1P3P A;  1KX4 D;  3AN2 C;  1KX5 A;  3WTP D;  3AFA B;  2RVQ C;  5F99 B;  5B40 B;  3P5J B;  3KXB B;  4YM6 B;  4G91 C;  2FJ7 D;  5GSU A;  5BO0 B;  3REI D;  3UT9 A;  1KX4 C;  1HTA A;  2NZD D;  4WU8 D;  3WTP C;  3AZF B;  1KX3 A;  3B0B A;  5B24 B;  3MGP B;  1M19 D;  1P3O D;  3UTA A;  1P34 B;  4XZQ B;  5B32 B;  5DNM B;  2FJ7 C;  2G5H C;  3REI C;  1TAF A;  2RIQ A;  2NZD C;  1R4V A;  1F66 B;  4WZS B;  1Z2C B;  5BNV B;  5JA4 B;  5B31 A;  4X23 B;  3C1C D;  1P3G B;  1M19 C;  1P3O C;  1M18 A;  3AV2 D;  3WA9 D;  4WU9 B;  3LEL A;  5B40 D;  1BFM A;  3KXB D;  3FDD A;  3MGQ A;  5B2I D;  2ZY2 A;  5E5A B;  2ZY4 A;  2DQN C;  3AZI B;  3IP4 C;  4J8V B;  4Z5T D;  3AZF D;  4Z2M H;  2FFF B;  4ZUX B;  3AV2 C;  3WA9 C;  3UTB A;  5F99 C;  3MGP D;  2YFV B;  5B40 C;  3AZN B;  3KXB C;  3AZK A;  2PYO D;  4LD9 A;  3VH5 W;  5B32 D;  1P3A D;  5AV6 A;  3LZ1 D;  1EQZ B;  2Y2J A;  4H9N A;  4KGC D;  5BS7 C;  3KUY D;  3AZH B;  3AZL B;  4Z5T C;  3AZF C;  4AWL B;  1P3G D;  4NE3 A;  5B24 C;  3MGP C;  2PYO C;  3AN2 A;  4KHA A;  1P3A C;  5B32 C;  5AV5 B;  3REH B;  3KFU G;  3LZ1 C;  2JCH A;  4H9R B;  4KGC C;  4H9O A;  4YS3 B;  5CPJ B;  3NQU A;  1S32 D;  5B2J D;  1JFI B;  3X1T B;  1ZLA D;  3AZI D;  1P3G C;  4J8V D;  3MGS D;  3VH5 T;  2W8S A;  2JSS A;  1KX4 A;  3WTP A;  4WU9 C;  3AZN D;  1B67 A;  1S32 C;  3AL0 C;  4XUJ D;  3REK B;  1EQZ D;  1ZLA C;  3AZI C;  2FJ7 A;  4WJ3 C;  4J8V C;  2LY8 A;  2ARO B;  1BH9 A;  3MGS C;  3REI A;  5GSU D;  4DRA A;  3AZM B;  3X1S D;  4R8P A;  3UT9 D;  3AZL D;  2NZD A;  2NQB B;  3AZN C;  4NE5 A;  2CWE A;  3REJ D;  2UWX A;  1M19 A;  5AV5 D;  5JRG B;  1P3O A;  4XUJ C;  1EQZ C;  3WAA B;  4YS3 D;  5GSU C;  3AZL C;  3X1S C;  3B6G B;  3TU4 B;  5DNN B;  3AV1 A;  3W99 B;  4CSR A;  4AWL C;  2HUE B;  3KWQ B;  3C1B A;  2F8N D;  3REJ C;  5C3I B;  5AV5 C;  2YFW B;  1N1J B;  3AV2 A;  2ZM5 A;  3REL B;  3NQJ B;  4YS3 C;  3WA9 A;  5F99 A;  5B40 A;  3KXB A;  3EG5 B;  3AZJ B;  4YM6 A;  3X1T C;  4J8W B;  2Y2N A;  1P3B D;  3AZM D;  5BO0 A;  4J8U B;  2Y2O A;  5BS7 A;  4Z5T A;  3AZF A;  3A6N B;  1U35 B;  2Y2G A;  3MGR B;  5B24 A;  3MGP A;  2PYO A;  3W98 D;  3LJA B;  1P34 A;  1P3A A;  5B32 A;  3AZE B;  5B1M D;  4LD9 D;  3WAA D;  1P3M B;  1P3B C;  3LZ1 A;  3AZM C;  3B6G D;  3TU4 D;  5KDM B;  3W99 D;  3H0L C;  5CPK B;  5JA4 A;  4KUD B;  3EPK A;  4J8X D;  1P3G A;  5B32 G;  3W98 C;  3VH5 A;  2CV5 D;  5B1M C;  2G5I C;  3WAA C;  1P3K D;  2L5A A;  4WU9 A;  3B6G C;  3TU4 C;  1S32 A;  2RVQ D;  3W99 C;  4J8W D;  1ZLA A;  4J8X C;  3AZI A;  4J8V A;  5GXQ B;  3MGS A;  2HIO B;  5C3I C;  4H9S C;  2CV5 C;  4ZUX A;  4H9Q A;  3A6N D;  3W96 D;  1P3K C;  3KSY A;  3AZN A;  5AY8 B;  2F8N K;  4J8W C;  5GT0 B;  3V9R B;  4QLC D;  4XUJ A;  1EQZ A;  3W97 B;  3X1S A;  3AZL A;  5FUG A;  3W96 C;  1KU5 A;  4R8P D;  5CP6 B;  3A6N C;  3O62 B;  3MGR C;  3AYW B;  3REJ A;  1P3I B;  5AV5 A;  3AZE C;  4QLC C;  2BYK B;  3B0D B;  4H9R A;  4YS3 A;  2BG1 A;  5CPJ A;  3WKJ B;  5CPK C;  1JFI A;  4R8P C;  4DRB A;  3X1T A;  4KUD C;  4WNN B;  3AV1 D;  5GXQ D;  3B6F B;  2HIO D;  2F8N A;  3C1B D;  1TZY B;  5GT3 B;  3X1U B;  4G92 B;  3AFA D;  5F99 D;  2F8N G;  4YM6 D;  5B31 G;  3AV1 C;  1P3B A;  2Y2I A;  3R45 B;  5GXQ C;  2HIO C;  3AZM A;  3C1B C;  3A1I A;  1A7W A;  2DF4 C;  3F6T A;  4E45 A;  3AYW D;  3AFA C;  5B0Z B;  3W98 A;  3VH6 W;  1P3I D;  5B24 D;  3H0M C;  5B0Y B;  4YM6 C;  1P34 D;  5B1M A;  3WAA A;  4XZQ D;  3WKJ D;  5DNM D;  3B6G A;  3TU4 A;  3W99 A;  3O62 C;  3AYW C;  2Y2P A;  3KWQ A;  1F66 D;  3B6F D;  4J8X A;  4X23 D;  3AZG B;  1P3I C;  1TZY D;  5GT3 D;  3X1V B;  4H9S A;  5AV8 B;  1N1J A;  3X1U D;  2CV5 A;  1P34 C;  3NQJ A;  4XZQ C;  4H9P B;  5DNM C;  1P3K A;  3WKJ C;  1ID3 B;  4WU9 D;  2JE5 A;  4EO5 B;  4J8W A;  1F66 C;  3B6F C;  3VH6 T;  5E5A D;  2XD5 A;  4X23 C;  1TZY C;  5GT3 C;  3X1U C;  3W96 A;  3A6N A;  5B33 B;  5AV9 B;  3MGR A;  4ZUX D;  2BYM B;  3AZE A;  1P3M A;  4QLC A;  5E5A C;  5CPI B;  2Y2Q A;  3WTP E;  5KDM A;  5CPK A;  5AVC B;  3AZH D;  1KX3 B;  4KUD A;  4ZUX C;  5B0Z C;  5B0Y C;  4JJN B;  1PZR A;  5BNX A;  3REI B;  3X1V D;  5BT1 D;  3REH D;  1ID3 D;  1P3L B;  5CPJ D;  3EPH A;  3AZH C;  1M1A B;  3X1T D;  5GXQ A;  2HIO A;  3AZG C;  3X1V C;  1M18 B;  5AV8 C;  5BT1 C;  5AV9 D;  3REH C;  1ID3 C;  5AY8 A;  3AFA A;  1AOI B;  5CPJ C;  5GT0 A;  3V9R A;  2Y2K A;  3EPL A;  3REK D;  2J8P A;  2ARO D;  2Y2M A;  5AVC D;  5AV9 C;  5B33 C;  3O62 A;  3UTB B;  3AYW A;  2NQB D;  1P3F B;  1P3I A;  1HQ3 B;  5CHL B;  5JRG D;  4H9N B;  5CPI C;  4XZQ A;  3REK C;  5DNM A;  3WKJ A;  1P3L D;  2ARO C;  3LZ0 B;  5AVC C;  4WNN A;  5DNN D;  1F66 A;  3B6F A;  2NQB C;  3KWQ D;  4JJN C;  5BNV A;  3AN2 B;  3VH6 A;  4M6B A;  4X23 A;  1TZY A;  5GT3 A;  4WV4 B;  5JRG C;  3X1U A;  3NQU B;  3REL D;  1AOI D;  1P3L C;  1Q9C A;  3AZJ D;  1M1A C;  5DNN C;  2HUE C;  5E5A A;  3KWQ C;  4J8U D;  2F8N H;  3WTP B;  1U35 D;  5B0Z A;  3MGR D;  3REL C;  1P3F D;  1AOI C;  2YFV A;  5B0Y A;  4DQY B;  3LJA D;  5G49 B;  3AZJ C;  2FJ7 B;  3AZE D;  1P3M D;  4NE6 A;  4J8U C;  4CAY B;  4WU8 B;  3MNN B;  3AZH A;  2Y2H A;  5CPK D;  2F2A C;  1U35 C;  4KUD D;  1P3F C;  3AZG A;  1P3O B;  1HQ3 C;  3X1V A;  3LJA C;  5B1L B;  5AV8 A;  3REH A;  4H9P A;  3EPJ A;  1P3M C;  1ID3 A;  4UPK A;  2ZY5 A;  4Z66 B;  3MVD B;  5AVB B;  3C1C B;  2ZY3 A;  3AV2 B;  2IO5 B;  5B33 A;  5AV9 A;  3WA9 B;  1BH8 B;  5AY8 D;  1H3O B;  2BYM A;  5B2I B;  4UUZ B;  5GT0 D;  5CPI A;  3REK A;  1ULY A;  3W97 D;  2ARO A;  3MNN D;  4Z5T B;  5AVC A;  5CP6 D;  2PYO B;  3O62 D;  2NQB A;  5AY8 C;  4JJN A;  5B1L D;  1P3A B;  5GT0 C;  5JRG A;  3LZ1 B;  4KGC B;  3KUY B;  3W97 C;  1P3L A;  4WU8 C;  4Z66 D;  3MNN C;  3MVD D;  5AVB D;  1M1A A;  5DNN A;  5CP6 C;  5B1L C;  2YFW A;  3B0D C;  1S32 B;  3REL A;  1AOI A;  5B2J B;  1T3U A;  1WWI A;  4Z66 C;  5AVB C;  3MVD C;  3AZJ A;  2VQR A;  1ZLA B;  3C1C C;  2XD1 A;  3MGS B;  4J8U A;  1P3P B;  2IO5 C;  4H9Q B;  1KX5 B;  4G92 C;  1U35 A;  1P3F A;  5B2I C;  5B0Z D;  1HQ3 A;  3LJA A;  4XUJ B;  5B0Y D;  5GSU B;  3X1S B;  3UT9 B;  5FUG B;  3LZ0 A;  3REJ B;  3AZG D;  3UTA B;  4NFT A;  5AV8 D;  3KUY C;  1TAF B;  4E44 A;  2F8N B;  5B31 B;  4ZBJ B;  1P3P D;  1KX5 D;  1WWS A;  3B0C W;  5B33 D;  3LEL B;  5B2J C;  5G49 A;  4EO5 C;  3MGQ B;  1P3B B;  4Z2M G;  4HGA B;  4CAY A;  5CPI D;  3W97 A;  1P3P C;  4WU8 A;  3MNN A;  1KX5 C;  1KX3 D;  5CP6 A;  3W98 B;  2Y2L A;  3AZK B;  5B1L A;  4JJN D;  5B1M B;  3UTA D;  4LD9 B;  5AV6 B;  3UT9 C;  2BYK A;  1W2E A;  4Z66 A;  3MVD A;  3B0C T;  5AVB A;  3C1C A;  4J8X B;  5B31 D;  1KX3 C;  1M1A D;  2CV5 B;  3UTA C;  1M18 D;  4KHA B;  1P3K B;  1BH8 A;  3LEL D;  1H3O A;  4H9O B;  5B2I A;  3MGQ D;  4UUZ A;  4G91 B;  5B31 C;  4ZBJ C;  3R45 A;  3A1K A;  1KX4 B;  1M18 C;  3W96 B;  3UTB D;  3LEL C;  3AZK D;  3MGQ C;  4QLC B;  1HQ3 D;  5AV6 D;  4KGC A;  4HGA C;  3KUY A;  1BH9 B;  4R8P B; 
#chains in the Genus database with same CATH homology
 3LZ0 D;  2NZD B;  3UTB C;  5BNX B;  3AZK C;  1F1E A;  3AN2 D;  4LD9 C;  1M19 B;  5AV6 C;  5B2J A;  3LZ0 C;  3AV1 B;  1B6W A;  4CSR B;  3H0R C;  3C1B B;  1P3P A;  1KX4 D;  3AN2 C;  1KX5 A;  3WTP D;  3AFA B;  2RVQ C;  5F99 B;  5B40 B;  3P5J B;  3KXB B;  4YM6 B;  4G91 C;  2FJ7 D;  5GSU A;  5BO0 B;  3REI D;  3UT9 A;  1KX4 C;  1HTA A;  2NZD D;  4WU8 D;  3WTP C;  3AZF B;  1KX3 A;  3B0B A;  5B24 B;  3MGP B;  1M19 D;  1P3O D;  3UTA A;  1P34 B;  4XZQ B;  5B32 B;  5DNM B;  2FJ7 C;  2G5H C;  3REI C;  1TAF A;  2RIQ A;  2NZD C;  1R4V A;  1F66 B;  4WZS B;  1Z2C B;  5BNV B;  5JA4 B;  5B31 A;  4X23 B;  3C1C D;  1P3G B;  1M19 C;  1P3O C;  1M18 A;  3AV2 D;  3WA9 D;  4WU9 B;  3LEL A;  5B40 D;  1BFM A;  3KXB D;  3FDD A;  3MGQ A;  5B2I D;  2ZY2 A;  5E5A B;  2ZY4 A;  2DQN C;  3AZI B;  3IP4 C;  4J8V B;  4Z5T D;  3AZF D;  4Z2M H;  2FFF B;  4ZUX B;  3AV2 C;  3WA9 C;  3UTB A;  5F99 C;  3MGP D;  2YFV B;  5B40 C;  3AZN B;  3KXB C;  3AZK A;  2PYO D;  4LD9 A;  3VH5 W;  5B32 D;  1P3A D;  5AV6 A;  3LZ1 D;  1EQZ B;  2Y2J A;  4H9N A;  4KGC D;  5BS7 C;  3KUY D;  3AZH B;  3AZL B;  4Z5T C;  3AZF C;  4AWL B;  1P3G D;  4NE3 A;  5B24 C;  3MGP C;  2PYO C;  3AN2 A;  4KHA A;  1P3A C;  5B32 C;  5AV5 B;  3REH B;  3KFU G;  3LZ1 C;  2JCH A;  4H9R B;  4KGC C;  4H9O A;  4YS3 B;  5CPJ B;  3NQU A;  1S32 D;  5B2J D;  1JFI B;  3X1T B;  1ZLA D;  3AZI D;  1P3G C;  4J8V D;  3MGS D;  3VH5 T;  2W8S A;  2JSS A;  1KX4 A;  3WTP A;  4WU9 C;  3AZN D;  1B67 A;  1S32 C;  3AL0 C;  4XUJ D;  3REK B;  1EQZ D;  1ZLA C;  3AZI C;  2FJ7 A;  4WJ3 C;  4J8V C;  2LY8 A;  2ARO B;  1BH9 A;  3MGS C;  3REI A;  5GSU D;  4DRA A;  3AZM B;  3X1S D;  4R8P A;  3UT9 D;  3AZL D;  2NZD A;  2NQB B;  3AZN C;  4NE5 A;  2CWE A;  3REJ D;  2UWX A;  1M19 A;  5AV5 D;  5JRG B;  1P3O A;  4XUJ C;  1EQZ C;  3WAA B;  4YS3 D;  5GSU C;  3AZL C;  3X1S C;  3B6G B;  3TU4 B;  5DNN B;  3AV1 A;  3W99 B;  4CSR A;  4AWL C;  2HUE B;  3KWQ B;  3C1B A;  2F8N D;  3REJ C;  5C3I B;  5AV5 C;  2YFW B;  1N1J B;  3AV2 A;  2ZM5 A;  3REL B;  3NQJ B;  4YS3 C;  3WA9 A;  5F99 A;  5B40 A;  3KXB A;  3EG5 B;  3AZJ B;  4YM6 A;  3X1T C;  4J8W B;  2Y2N A;  1P3B D;  3AZM D;  5BO0 A;  4J8U B;  2Y2O A;  5BS7 A;  4Z5T A;  3AZF A;  3A6N B;  1U35 B;  2Y2G A;  3MGR B;  5B24 A;  3MGP A;  2PYO A;  3W98 D;  3LJA B;  1P34 A;  1P3A A;  5B32 A;  3AZE B;  5B1M D;  4LD9 D;  3WAA D;  1P3M B;  1P3B C;  3LZ1 A;  3AZM C;  3B6G D;  3TU4 D;  5KDM B;  3W99 D;  3H0L C;  5CPK B;  5JA4 A;  4KUD B;  3EPK A;  4J8X D;  1P3G A;  5B32 G;  3W98 C;  3VH5 A;  2CV5 D;  5B1M C;  2G5I C;  3WAA C;  1P3K D;  2L5A A;  4WU9 A;  3B6G C;  3TU4 C;  1S32 A;  2RVQ D;  3W99 C;  4J8W D;  1ZLA A;  4J8X C;  3AZI A;  4J8V A;  5GXQ B;  3MGS A;  2HIO B;  5C3I C;  4H9S C;  2CV5 C;  4ZUX A;  4H9Q A;  3A6N D;  3W96 D;  1P3K C;  3KSY A;  3AZN A;  5AY8 B;  2F8N K;  4J8W C;  5GT0 B;  3V9R B;  4QLC D;  4XUJ A;  1EQZ A;  3W97 B;  3X1S A;  3AZL A;  5FUG A;  3W96 C;  1KU5 A;  4R8P D;  5CP6 B;  3A6N C;  3O62 B;  3MGR C;  3AYW B;  3REJ A;  1P3I B;  5AV5 A;  3AZE C;  4QLC C;  2BYK B;  3B0D B;  4H9R A;  4YS3 A;  2BG1 A;  5CPJ A;  3WKJ B;  5CPK C;  1JFI A;  4R8P C;  4DRB A;  3X1T A;  4KUD C;  4WNN B;  3AV1 D;  5GXQ D;  3B6F B;  2HIO D;  2F8N A;  3C1B D;  1TZY B;  5GT3 B;  3X1U B;  4G92 B;  3AFA D;  5F99 D;  2F8N G;  4YM6 D;  5B31 G;  3AV1 C;  1P3B A;  2Y2I A;  3R45 B;  5GXQ C;  2HIO C;  3AZM A;  3C1B C;  3A1I A;  1A7W A;  2DF4 C;  3F6T A;  4E45 A;  3AYW D;  3AFA C;  5B0Z B;  3W98 A;  3VH6 W;  1P3I D;  5B24 D;  3H0M C;  5B0Y B;  4YM6 C;  1P34 D;  5B1M A;  3WAA A;  4XZQ D;  3WKJ D;  5DNM D;  3B6G A;  3TU4 A;  3W99 A;  3O62 C;  3AYW C;  2Y2P A;  3KWQ A;  1F66 D;  3B6F D;  4J8X A;  4X23 D;  3AZG B;  1P3I C;  1TZY D;  5GT3 D;  3X1V B;  4H9S A;  5AV8 B;  1N1J A;  3X1U D;  2CV5 A;  1P34 C;  3NQJ A;  4XZQ C;  4H9P B;  5DNM C;  1P3K A;  3WKJ C;  1ID3 B;  4WU9 D;  2JE5 A;  4EO5 B;  4J8W A;  1F66 C;  3B6F C;  3VH6 T;  5E5A D;  2XD5 A;  4X23 C;  1TZY C;  5GT3 C;  3X1U C;  3W96 A;  3A6N A;  5B33 B;  5AV9 B;  3MGR A;  4ZUX D;  2BYM B;  3AZE A;  1P3M A;  4QLC A;  5E5A C;  5CPI B;  2Y2Q A;  3WTP E;  5KDM A;  5CPK A;  5AVC B;  3AZH D;  1KX3 B;  4KUD A;  4ZUX C;  5B0Z C;  5B0Y C;  4JJN B;  1PZR A;  5BNX A;  3REI B;  3X1V D;  5BT1 D;  3REH D;  1ID3 D;  1P3L B;  5CPJ D;  3EPH A;  3AZH C;  1M1A B;  3X1T D;  5GXQ A;  2HIO A;  3AZG C;  3X1V C;  1M18 B;  5AV8 C;  5BT1 C;  5AV9 D;  3REH C;  1ID3 C;  5AY8 A;  3AFA A;  1AOI B;  5CPJ C;  5GT0 A;  3V9R A;  2Y2K A;  3EPL A;  3REK D;  2J8P A;  2ARO D;  2Y2M A;  5AVC D;  5AV9 C;  5B33 C;  3O62 A;  3UTB B;  3AYW A;  2NQB D;  1P3F B;  1P3I A;  1HQ3 B;  5CHL B;  5JRG D;  4H9N B;  5CPI C;  4XZQ A;  3REK C;  5DNM A;  3WKJ A;  1P3L D;  2ARO C;  3LZ0 B;  5AVC C;  4WNN A;  5DNN D;  1F66 A;  3B6F A;  2NQB C;  3KWQ D;  4JJN C;  5BNV A;  3AN2 B;  3VH6 A;  4M6B A;  4X23 A;  1TZY A;  5GT3 A;  4WV4 B;  5JRG C;  3X1U A;  3NQU B;  3REL D;  1AOI D;  1P3L C;  1Q9C A;  3AZJ D;  1M1A C;  5DNN C;  2HUE C;  5E5A A;  3KWQ C;  4J8U D;  2F8N H;  3WTP B;  1U35 D;  5B0Z A;  3MGR D;  3REL C;  1P3F D;  1AOI C;  2YFV A;  5B0Y A;  4DQY B;  3LJA D;  5G49 B;  3AZJ C;  2FJ7 B;  3AZE D;  1P3M D;  4NE6 A;  4J8U C;  4CAY B;  4WU8 B;  3MNN B;  3AZH A;  2Y2H A;  5CPK D;  2F2A C;  1U35 C;  4KUD D;  1P3F C;  3AZG A;  1P3O B;  1HQ3 C;  3X1V A;  3LJA C;  5B1L B;  5AV8 A;  3REH A;  4H9P A;  3EPJ A;  1P3M C;  1ID3 A;  4UPK A;  2ZY5 A;  4Z66 B;  3MVD B;  5AVB B;  3C1C B;  2ZY3 A;  3AV2 B;  2IO5 B;  5B33 A;  5AV9 A;  3WA9 B;  1BH8 B;  5AY8 D;  1H3O B;  2BYM A;  5B2I B;  4UUZ B;  5GT0 D;  5CPI A;  3REK A;  1ULY A;  3W97 D;  2ARO A;  3MNN D;  4Z5T B;  5AVC A;  5CP6 D;  2PYO B;  3O62 D;  2NQB A;  5AY8 C;  4JJN A;  5B1L D;  1P3A B;  5GT0 C;  5JRG A;  3LZ1 B;  4KGC B;  3KUY B;  3W97 C;  1P3L A;  4WU8 C;  4Z66 D;  3MNN C;  3MVD D;  5AVB D;  1M1A A;  5DNN A;  5CP6 C;  5B1L C;  2YFW A;  3B0D C;  1S32 B;  3REL A;  1AOI A;  5B2J B;  1T3U A;  1WWI A;  4Z66 C;  5AVB C;  3MVD C;  3AZJ A;  2VQR A;  1ZLA B;  3C1C C;  2XD1 A;  3MGS B;  4J8U A;  1P3P B;  2IO5 C;  4H9Q B;  1KX5 B;  4G92 C;  1U35 A;  1P3F A;  5B2I C;  5B0Z D;  1HQ3 A;  3LJA A;  4XUJ B;  5B0Y D;  5GSU B;  3X1S B;  3UT9 B;  5FUG B;  3LZ0 A;  3REJ B;  3AZG D;  3UTA B;  4NFT A;  5AV8 D;  3KUY C;  1TAF B;  4E44 A;  2F8N B;  5B31 B;  4ZBJ B;  1P3P D;  1KX5 D;  1WWS A;  3B0C W;  5B33 D;  3LEL B;  5B2J C;  5G49 A;  4EO5 C;  3MGQ B;  1P3B B;  4Z2M G;  4HGA B;  4CAY A;  5CPI D;  3W97 A;  1P3P C;  4WU8 A;  3MNN A;  1KX5 C;  1KX3 D;  5CP6 A;  3W98 B;  2Y2L A;  3AZK B;  5B1L A;  4JJN D;  5B1M B;  3UTA D;  4LD9 B;  5AV6 B;  3UT9 C;  2BYK A;  1W2E A;  4Z66 A;  3MVD A;  3B0C T;  5AVB A;  3C1C A;  4J8X B;  5B31 D;  1KX3 C;  1M1A D;  2CV5 B;  3UTA C;  1M18 D;  4KHA B;  1P3K B;  1BH8 A;  3LEL D;  1H3O A;  4H9O B;  5B2I A;  3MGQ D;  4UUZ A;  4G91 B;  5B31 C;  4ZBJ C;  3R45 A;  3A1K A;  1KX4 B;  1M18 C;  3W96 B;  3UTB D;  3LEL C;  3AZK D;  3MGQ C;  4QLC B;  1HQ3 D;  5AV6 D;  4KGC A;  4HGA C;  3KUY A;  1BH9 B;  4R8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...