4KGKA

Bacterial trna(his) guanylyltransferase (thg1)-like protein in complex with gtp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
237
structure length
210
Chain Sequence
SIGDRMKRYENAYRIKLPERMPVIVRIDGAHFHTYTKGCAKPFDQDLAEAFWETCKYLAQNIMGAKLVYHQSDEISILITNYDKLTTQSWFENNLQKIASVSASMATAKFNEVMREKYPDKPLATFDGRAQVLPQDEVANYFIWRQQDASKNSISMVAQANFPHWNDLPVWQKRGICIIKEFYLRSRWSVDHETPIISKDREYVEQFVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thg1-like uncharacterized protein
publication title Structural Studies of a Bacterial tRNA(HIS) Guanylyltransferase (Thg1)-Like Protein, with Nucleotide in the Activation and Nucleotidyl Transfer Sites.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Transferase
total genus 59
structure length 210
sequence length 237
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04446 Thg1 tRNAHis guanylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kgkA00
3OTCA 3OTDA 3WBZA 5AXLA 3OTBA 5AXNA 5AXKA 3OTEA 5AXMA 4KGKA 3WC0A 3WC2A 4KGMA
chains in the Genus database with same CATH superfamily
2YWHA 3KHGA 5M2UA 4ZK7M 2LYVA 4OJ1A 1RT2B 3OT9A 4JB8B 4PQAA 1D9AA 1HNZJ 3H7HB 2PEBA 4JYAJ 4C8MA 2AGOA 1EHWA 2FPHX 4UW2A 3M8PB 1U0SA 2XWXA 2CKWA 4A8SA 1VK3A 2WONB 4CO0A 4L6V3 1VQMS 1SIWB 2HHWA 2BOPA 5JXSA 5KFEA 4F4XA 4XIUA 2B9XA 3EVOA 1VQKS 4PXBA 4X4PA 1HHTP 5HI7A 4MMOA 2X1FA 4FPIA 3Q0AA 2MSTA 1VK8A 3CJ4A 1Y3JA 2HRUA 4WCEQ 4DR4J 1U2FA 5KG0A 3TUIC 3W8PA 4NE9C 5I42A 4KGKA 1HYSB 2HLTA 1WF1A 1OPZA 4U8YA 1FRHA 1FD8A 1PYSB 3KHRA 4URSA 4IRCA 1RBAA 2KYXA 4ZVRB 2BDPA 4DV2J 4ED3A 1UKUA 3MM9B 3ITHB 2VBZA 2YNGA 2ZHOA 2A3JA 5CD4A 4N77A 1YJNS 1KTQA 1WOSA 4DSIA 3Q22A 4P73A 3G6YA 1QTNB 4CLYA 2J7KA 4R0EA 1ZTWA 4ITSA 1U7LA 3SCJE 4ZHRB 1NDPA 3M8ZA 4PYDA 1ZAVA 5LSOA 1C1CA 4GMKA 4HACB 3RB0A 1H38A 4U7CA 2B4PA 2IBKA 3MOJB 2RKIB 1JK9B 3A1YG 1RTIB 5D0HA 1T9WA 2AJ2A 3ULHA 1F9FA 1HNIB 3V6JA 3QWPA 4LMZA 4QYZJ 4KH0B 2CQ0A 2L9NA 3NAHA 5LXRA 3QBCA 1CJUA 4E2FB 3BM7A 3DLJA 1FWLA 2D9PA 4USVA 4ZIVA 3D67A 4PG5A 4MK8A 3THPA 1HBNA 1Q16B 2VPWB 4QIWD 1MNEA 1HMVB 1TMMA 2XYGB 4OI2A 3V81B 1GNKA 3CCLS 1Z4UA 2MZQA 2KI2A 3W2VA 2RF2A 3MTJA 5IWAF 2DNGA 2V0NA 3QFHA 2G2YA 4X4UA 4I0WA 1NH7A 1XJWB 4J91A 4L73A 3Q8UA 4FKXA 2M0GB 1N5QA 4EEYA 3T5HA 2AGPA 4QIEA 1WOPA 2AIRB 4IR9A 4X4OA 2HYIB 3D3CJ 5KG7A 1HI1A 1QLNA 3BQ0A 2VF3A 1UWAA 4H4MB 4K50A 1H2UX 3BSAA 5KFZA 2WW4A 2AF6A 2NYHA 1NDKA 5IT9Y 3GILA 1FKPA 4LBHA 2QEXS 2PMHA 1YJUA 3LP2A 5KFBA 2IVFB 5LL6d 2VG7B 3QRRA 4K4TA 3UW1A 2H4YB 2XSFA 4KGZB 4FF4A 3S01A 3OQ2A 5HJYA 1UVJA 1HQ2A 3B82A 1CQNA 2J9CA 3G6ES 1B4SA 4QWAA 3JQMA 4FDFA 2HNZA 1NB7A 3KDOA 3NGDA 4RW9A 5BR8F 2FC9A 5IT9U 1U45A 1LQ9A 2ZZTA 2IFXA 4TY8B 3I4HX 2XTJP 4UQGA 4ED1A 1VCTA 2F3JA 4EBCA 1BLUA 2OLWA 4RUHA 3W63A 2QC3A 1SB6A 1S0MA 2XS7A 4I1TA 4OYIA 3TAPA 2YQ0A 3CJKB 1HWLA 1BC6A 2GO8A 3VZHA 4O3RA 2EK1A 1HWKA 4UUWA 4YDXA 2MQPA 1IUJA 2ZC4A 1SQFA 5L9NA 5KFSA 4ED7A 2UUTA 2DK2A 2M3DA 5F41A 4OI0A 2DNMA 3MMBB 3HFKA 3DOLB 4ID5A 4CIOA 3SV3A 1WC0A 2ZDPA 1V3RA 3OD2A 5IWAJ 5A8KB 4YP3A 4ANEA 2F1FA 3BGRB 3KUGA 1XC9A 1RCOB 4NZ0A 4M5HA 2V50A 4M8LA 4OX8A 1XNQF 3LP1B 1B3TA 1ZPVA 5D77A 1VS3A 2H54B 5A2QY 3AD8C 1X4AA 4IOAQ 4ED0A 2Z2YB 1S49A 3C16A 4P71A 2VBYA 4ATNA 4PPZA 3RBZA 1YBAA 1X5SA 4EGLA 1VISA 1BWEA 1LNQA 1UWBA 3BO4A 1IBKF 3D54A 1UA0A 3E2EA 2R9LA 1HWUA 2YNIB 1YZ7A 3I82A 1AROP 4EZ6A 2DPJA 4P2XA 4K59A 4Y28C 2Y3YA 5BYRA 7FDRA 4WP3A 3PCOB 2PA3A 4PR6A 5KOWA 4U7UD 3EWGA 3RUBL 2MQOA 1TAQA 2A18A 2AJQA 1OPIA 2LA6A 1NLKL 2IC3A 3QIPA 1SV5B 3CCES 3SSSA 2I0XA 2J6TA 2CQPA 2NXNA 4IRDA 2RUGA 4OLPA 4NL5A 3V6HA 1GTHA 3ETOA 4YB6A 3BN7A 4N47A 2DGWA 1Z2LA 3BYRA 3N4WA 3WX4A 2ATLA 2VG6A 1WI6A 5H9FK 3V4IB 4JI4F 2L08A 3R7BB 4J9NA 4ZVSB 2UU9J 1C0TA 1FFWB 4F2SA 4EFAC 1RGVA 3SBMA 2YNHA 3KLEA 2FIUA 3RW6A 2DXFA 3GV8B 4UTGA 2V2KA 1HNWF 1TL1A 2GV1A 2RMLA 3OLBA 1OYDA 3LP0B 1VC6A 3R5BA 3HHEA 2BA9A 5DLFA 3O2IA 3WC2A 2OPQB 2GIQA 4RW8A 3ZTSA 3RRGA 4CDIA 2HZVA 3MAAA 3DM2B 3PEJA 2IHR1 4H4KC 1UAWA 2XCAA 3B54A 2FJDB 4BBYA 2OIHA 4I7FB 1JB0C 3NG8A 2Z56B 3G9CA 1T05B 2DGOA 3PX4A 2DY9A 2VDHA 4YB1P 1WWHA 3C66A 2QTWA 4KTQA 2E1CA 1XNQJ 4DI6A 5CYMA 1VBZA 1ZYQA 2OPRA 4OYAA 1A9NB 1AW0A 5T7LB 2WVDA 4DX6A 2E1RA 3K7RA 2MB0B 3G4SS 4C8LA 3BGFA 4LIWA 3KXDA 2VD3A 1XBWA 4JOUA 5C5JA 1EB0A 1S1TA 2QLBB 1IBKJ 3G2XA 2HHVA 3UN3A 3BYPA 1IKWA 2ROPA 1E6YA 3EXYA 4ZPAA 1QSSA 4WKRA 3MEGA 1GEHA 4I6WA 1DTQA 3H25A 1NB2A 4C8OA 4ICLA 5LMNJ 4LFBF 1W2BR 2IYGA 5HL7Q 3ZTRA 2LXFA 5DO2A 3JYTB 1NK8A 1SKSA 4TU8A 3NNHA 4RBVA 4PZVA 4MFBA 3MUMP 4P6QA 2MQ8A 2YWFA 3UD5A 3WX8A 2DBBA 2FJWA 3LANA 2HK2A 2HIQA 2M7SA 2HQGA 2Z4PA 1YG0A 5J2QA 5CA5A 2ZITA 1S6QB 4RW6B 3SCIE 3EM1A 4DV0F 1C2PA 3N0VA 1H73A 1KQGB 2CAJA 3RJMB 4NYZA 1PIEA 4G1IA 5J2PB 4FS2A 4ZPTR 4ED2A 1IWGA 1C0UB 1NK0A 2BBEA 4LF8F 4QIVA 4YMEA 1HNWJ 2B5JB 1P1TA 2C2KB 2PT0A 1NDLA 2LQBA 1RT5A 2IM1A 5HSPA 2AEFA 3PJWA 2H1YA 4UOFA 2HLUA 1SPBP 1FFGB 3KK2B 1VOMA 1A7GE 4RWWA 5HROA 2WB1D 3DC2A 2XZWA 4ZPBA 4GVBB 3C46A 1YZ6A 2ROGA 4F36A 3GP9A 3D1QA 1TUGB 2GIFA 5GMDA 2VHGA 1S0OA 3T6JA 2AEMA 3CDUA 2MXYA 2LECA 2YKNB 1U6ZA 4ECUA 3BSCA 2NSCA 1UPPA 3SQGB 3TVYA 4FBTA 4DPUA 3DRSA 2VH7A 2AKWB 2ZH1A 5CZXA 4ZKAA 4EI2A 4GC6A 3J80Y 2DH9A 3BGLA 4KSEB 4X84A 2OEMA 1WNEA 2V8DA 3OHAA 5LOQA 2VJUA 4JI7F 3PJXA 4DUYJ 5E0OA 1FJGF 1TU0B 1RHJB 5IZHA 1Q79A 2KHDA 4RU2A 2R2TA 3CD7A 3DLBA 2I5JB 1F9EB 4B9LA 2E5LF 3M30B 1YIJS 4LFBJ 2Y1LB 1RT4B 2GQCA 2OMLA 3R2CJ 1G1XA 2WZ1A 3T9NA 3MAHA 3EGZA 2AV5A 4M5IA 2HKEA 3J80U 3QGIA 4FXDA 2CQ4A 3QJLA 4MKVA 1TZ0A 3MPWA 3KMQA 5F8HA 4XDCA 4K8RA 4U8VA 3ADAC 3T5KA 4RLEA 2W2OP 4PPDA 2RU9A 1LWEB 3CSKA 4I4BA 4NLPA 3Q8SB 1HBMB 1Y9OA 3ENVA 5HN0A 3IS9B 4DV0J 3GZ7A 5SUHA 4HHHA 3IBWA 3HT3A 1D3WA 1KDNA 2M4MA 3NAIA 3SYZA 1PC5A 3TAQA 3I0SB 3NCRA 3I4PA 2F65A 4HH0A 3PFEA 5A76A 4EUVA 3CO9A 1RYRA 4FYVB 1RTDA 1FE4A 2PO4A 4LF8J 1Y3KA 4FN5A 1HNVB 4FYDA 1LWCB 3M6VA 3PJ9A 4GVLA 3KK1B 1KLNA 4N56A 2MY8A 3N5BA 4DSFA 5RUBA 3AXKA 5D4LA 2ZKUA 1TKTB 2XC9A 4C8NA 2R4FA 4X62F 5HQ8A 3DRXA 1K9MT 4C3KA 2WB4A 3JXOA 2J8SA 4O44B 4CNZA 4BWMA 4NLGA 1CJKA 2JEFA 3KLFB 2ZM6F 4F3QA 3CUNA 4A8WA 3QO9A 1O5JA 3R1LA 2A1BA 2LU2A 2HGMA 4MIAA 3ZZUA 4WKYA 3SFUA 2F8MA 5KFGA 1RJJA 2DNHA 3HSZA 3W5XA 5B0FA 3TZZA 4JI7J 1JLQA 4AFFA 1FJGJ 3PG9A 2XG8A 2X1GA 3TZYA 3HZGA 2JLEA 2CJ9A 4WJBA 2E5LJ 3CB4A 2D3UA 3JS9A 4QIFA 9ATCB 1T03A 4ZLLA 5LJ3Y 2XO6A 1PBUA 1TUVA 4RKUC 4CYUB 2IBOA 4CCHA 3GWCA 1VQ6S 4NA2A 3IR5B 1ZM2A 1X7VA 3PR5B 2R7SA 2UUBF 4LF6F 2FC8A 3QSYB 5FJ4A 2WHOA 3GPAA 4PWWA 2WOMB 2C1EB 1FD2A 5ETKA 1BXNA 3FK4A 1NPRA 3MURP 1KC8T 4Q5VA 3K8VA 2BE9B 1M5SA 3U1MA 4AXIA 1LK5A 3HMJG 4PXEA 7FD1A 1UVMA 2CPXA 1O8BA 3HD1A 1VHIA 4BDPA 1CBKA 4WXWA 1IJEB 2ZZMA 2XLKA 1O51A 1S48A 3OFHA 2LXUA 2CWXA 2CG8A 2EFGA 5BXIA 3VGTA 2V69A 1LV5A 2I38A 1HBOA 1IKXA 3KTQA 1RT7B 3UDCA 3MECB 4QJVA 1S9GA 1R8PA 2BKPA 1ITPA 3OUYA 2CZ4A 1DLOA 2WAQD 2YWEA 1MROB 3DGPA 4EO6A 1S6OA 4CT8A 4PCQA 1FRXA 1LWFA 1K0TA 1YITS 1GFWB 4X62J 2V4QA 1IR2A 4ZVGA 4OZJA 1T94A 2CQ1A 1FNMA 3UN5A 1SQEA 1S1XB 1XK8A 4KHPF 4KRWA 2Q6CA 3MMJA 3OVAA 1RWVB 1Q4RA 5IV3A 3R6LB 3JSMA 1YKWA 3HLUA 3PEHA 1S72S 1NZAA 1T9TA 3KNGA 4MKYA 4LR8A 4AL5A 2FVSA 4P75A 4N8NA 4OI6A 1BQNA 2MSSA 2RU3A 3HK2A 2WRMA 2QZ8A 1E6VB 2FHOB 1MWZA 1YHQS 2JLGA 1K47A 1D9DA 3VVUA 3UFCX 1RU2A 2HQ3A 4YFUA 2GQ2A 2ASYA 2KXFA 5C2CA 1WKJA 1B7YB 3MUTP 2HHTA 3EX7B 2EKYA 3M8PA 1T3NA 4HT7A 2PIIA 4UZCA 4CP5A 4DZ6A 2WONA 3W61A 4KO0A 4NXMJ 3NLCA 1UPMB 1JX4A 4DPOA 5M2PA 1T9UA 5AXKA 2HHSA 4LF6J 2O01C 3LO3A 4DSKA 4QWBA 1VHFA 3AD9C 2ZEJA 4DV3J 1EJ7L 4RW7A 5H9EK 4LSNA 2HFUA 2HBYB 1AZSB 2LQ5A 3QLHB 2H5JB 1YQHA 4C3LA 1ZM4A 3EZ5A 3ZNJ1 5HMYA 2W1BA 3CE8A 4QPXA 1K44A 2ZVSA 3HSJA 3DHWC 3NMAA 2PD1A 1H3DA 3THVA 3AY0A 3MM9A 3PDNA 2CQIA 1F60B 4PXCA 3HVAA 3Q8PB 3MMAB 2CJXB 2ZH7A 2JLFA 3CD0A 1SKWA 4XK8C 2N82B 2RDIA 1WHYA 5T14A 3D28A 4QQBA 1UVKA 1XIQA 3RGIA 4UF4A 1YRTA 3OHBA 3EICA 1UFKA 3FFIB 3HX9A 4HACA 2KH9A 4DL0C 3ZNUA 2KYZA 2RRNA 1AUDA 1N54B 1JJCB 4ZMMA 2RKIA 4Y2IA 4OZ2A 3JSRA 3H42A 2HQDA 3OXGA 1C4CA 3JAMU 4U9RA 4CM0A 1HNIA 3LPEA 4C7QA 4AXJA 5IQ6A 3FEZA 2EFPA 3P5TL 2XS5A 2EEYA 1H2VZ 3CCZA 2JJ4D 1REVA 4KH1B 2KZMA 3AOAA 4ZP9A 2E5IA 4OYXA 5GAGU 4CH7A 3K5NA 4OJGA 3QPIA 3G82A 3GSIA 1HD0A 2Q6BA 5B0CA 1QE1B 3H2LA 3DLKB 2R7VA 1I51B 2L3MA 1HMVA 5KG6A 3GIMA 2B4VA 1R43A 1SC3B 3MEDA 3TARA 2R7TA 4JP8A 1FEHA 1FHTA 4YDDB 2XS2A 2R8KA 1RHQB 3WHIA 1S7IA 1WTFA 1RBLA 4JI0F 5KT4A 2AD9A 5I42B 2VBXA 1VQ9S 4KKOA 4WIQA 3CEDA 1U6FA 2DR9A 4PRFA 3FQKA 1U1QA 1KHVA 1YJWS 1Q0NA 2IRXA 5ITHA 3TZXA 4DV1J 5B0BA 1JJ4A 4H4MA 3FZBA 2XSJB 1S10A 1I6JA 3M8WA 1TL7A 4B9NA 4WP9A 4C0BA 2DR7A 4Z2XA 5GAHI 3HXMA 2KXNB 2VG7A 1FI4A 5IC4B 4OV6A 2A10A 3FGVA 3LUYA 3CULA 5KFUA 3BS9A 1HNXF 5D3GA 1RE1B 1NPKA 2QL9B 3NOGA 2EC2A 2RQCA 2LMIA 3CDWA 1UETA 1QUPA 4LVNP 4GKJJ 3M6XA 3FCVA 4DL4A 4LFAF 1U25A 2NSBA 4HDHA 2XLJA 1T95A 4KHMA 3NMRA 1UCNA 1RDRA 1OMSA 1CJUB 1IBMF 3TRGA 1HQEA 3UN2A 2HQCA 2K3IA 2ADCA 1U2RA 1U0HA 4Y00A 3SI8A 2A2DA 2K3KA 3MM5A 2Y0BB 4YY3F 3CJKA 1T9VA 2MZSA 1HBNB 4N8OA 5A6PA 4R0JA 3QMQA 3UWTA 3CDAA 2C2MB 4JI1F 3P5BP 3CCJS 2M88A 3CVKA 4XDDA 4MAKA 4XAKA 2RF2B 3M05A 3I0RA 2VOPA 3IR7B 1SC1B 3L7UA 5C25A 3VAJA 1X4HA 3Q8VA 4B9UA 2KM8B 2Z30B 4NLQA 4GRSA 3IG1A 3I55S 1GXTA 5B0AA 4W4MA 5HQLA 3HHNB 3PW0A 3QZ8A 2WVFA 3E8OA 4QYZK 5A8KA 2YKPA 4JI5F 2RS8A 3RZAA 4CO1A 3GJTB 2GHVC 2CYYA 1N56A 1S59A 1SBRA 5KG3A 1WG5A 4JI0J 2X1AA 3ISZA 3LP1A 4M1KA 3QJJA 4ZDNA 3TANA 2WVCA 3FKBA 4B08A 5AE1A 4ZP7A 1NZ8A 3RU0A 1TKDA 1JMTA 5KT7A 3PTWA 2AX0A 4USIA 3DOKA 5H9FJ 3H4DA 3ISNC 4DFJA 3B4DA 3H20A 1N0VC 4C0HA 2XI3A 4YUDA 3HSDA 3MD1A 5HAOA 1F0XA 3ZTPA 2Z2LA 4GC7A 4CT9A 2JHEA 3C14A 4C11A 2HVIA 1CULB 2DO0A 2XMUA 2HMIA 2VFTA 4NZ7A 1MW7A 4ZPDA 2PSZA 1W2IA 4ZA1A 3OL7A 1HNXJ 1NJYA 2V6AA 1WDTA 2M70A 1MN9A 2BQ3A 4X4VA 2GS8A 2W7OA 5U47A 4IKAA 3CCQS 2QLFB 2Y8WA 1IQZA 4X65J 4I2QA 3RAXA 4LFAJ 2F9JA 3LWMA 3RR7A 3PW4A 2O66A 3W3SA 2CUYA 5F3ZA 5KFKA 1K1SA 3L7OA 3GIIA 3GMGA 1XMOF 2XMVA 5CQGA 4PXDA 4A47A 5KFRA 1Q86T 1V3SA 2MJUA 3HSGA 1U8SA 2BJ7A 2EBGA 1AXQA 4P7TA 1CJVA 4M5KA 4YY3J 5E41A 5HK4A 3PW5A 1TP7A 4Q7AA 4CTAA 3DLEB 2FZKB 4ID5B 4JI1J 4IRKA 4AQYF 5LMUF 2W8KA 1EARA 1NK6A 3TUJC 3CJ8A 1MMLA 3LP0A 2VFSA 2AP6A 5EX3A 4JUZA 5C42A 2BMBA 4WU2A 2OPQA 3SSQA 3JTPA 3SEOA 4WYLA 3TR5A 4DS5A 3GFYA 2ZBRA 1NBEB 3TI0A 3HT0A 3RTVA 1WTBA 2FVPA 2ZHAA 5D78A 5BYSA 2MJNA 2ZE2A 2UVUA 4JI5J 2F5GA 3R3TA 1T05A 4JI8F 1NM2A 1WC6A 5D0GA 1NO8A 2DR5A 3W1YC 3P8BB 2GQQA 1FDNA 2R7XA 1UWBB 4MK7A 1CLFA 4OX9F 5K8PA 2I8EA 2AZ3A 3DXSX 3OFEA 4MIWA 4KV8B 3EVMA 1SJ1A 2R8HA 1VJWA 4DR5F 2HW3A 2V9KA 1P8GA 3ZZOA 2DNZA 3GLJA 3ZTQA 2E1MC 1T8EA 2ZWPA 3BKUA 4RNOA 2P9EA 3AXMA 4F3MA 2WK4A 1WG4A 2RIJA 4M95A 4RNNA 5L1KA 2IC3B 3QIPB 3THTA 3K89A 4KYZA 2DH8A 3QAUA 1CS4B 2N3LA 3VZIA 3VAHA 4BWJA 2QA1A 1BUXA 1KD1T 2WVBA 1ZA1B 1CPZA 3SQOP 4DG1A 1YDLA 2KVQE 3IWNC 3JYTA 1NJZA 2GW8A 4WXOA 1URNA 3S7RA 3D6MB 2B0GA 2VG6B 3OV7A 1HFEL 1VQ4S 2UVRA 3CF5Q 3O3LA 3KJVA 3MTKA 4L3KA 2KRBA 1C0TB 1DURA 3RR8A 4M5DB 2YNHB 2ZBCA 2RB7A 3CJ3A 3GFZA 1SL2A 4QYRA 4Q44A 3EUNA 4OI3A 2AU0A 1L3TA 1SC6A 1TL1B 2XY5A 4KY3A 2W4DA 3W9IA 2P8IA 5J2PA 4NA3A 4X64F 1C0UA 4AQYJ 5LMUJ 4DLEA 2ASDA 2CPJA 3IXQA 4LSZB 2OFHX 1BWVA 1FJ7A 4K4SA 1UJ4A 3PW2A 4QCLA 4TQRA 3CPWR 2VG5B 1TFYA 2JFKA 4F02A 5CAAA 3BGUA 1Q81T 4ED5A 1RAOA 1S7HA 4ZCLA 1WHXA 1T0TV 5HVHA 2DO4A 5AE2A 2ZH2A 4F2RA 3EMTA 3RRKA 3QGGA 1CEZA 2DGUA 1S6PA 5EHHA 2JZ5A 2LFVA 1PG5B 2V34A 4ILLA 4JI8J 4PG8A 5FD1A 4DR3F 2R7OA 1U1KA 5FDLA 1S1TB 1VMBA 5F8NA 1WJ9A 4USHA 3BSOA 2DEIA 2VICA 1NJIT 4OX9J 2BUNA 3TOQA 3CCSS 2AJ0A 1XERA 3SQGA 2AHOB 1IKWB 1U4BA 2HBRB 1GMWA 2HQIA 3MEGB 1DTQB 9RUBA 3HJVA 1A0OB 4DR5J 2ZVIA 1FEEA 1N0UA 3HFVA 1AFJA 1XTZA 3KOAA 4MT1A 4ELTA 5EN1A 4L3NA 2RILA 3MM7B 2W25A 3OR2A 4A8QA 3K2YA 2FUG9 2YBVA 1X5TA 1R8CA 2J8AA 4TU7A 4OHYA 4RW4B 1S99A 2I1RA 5KG1A 2I6WA 2KJWA 2HRTA 1DQ8A 2IJNA 4DPYA 4J9UE 4B02A 1ACMB 1ZZFA 4USJC 2DHXA 3CJ2A 4IDKA 2HVZA 3G8QA 1ZOTA 5IC6B 1TR0A 4B17A 3HI9A 3GJRB 2CQ2A 3JTOA 1LWEA 1H74A 5IQQA 1KS2A 4AD6A 2K7KA 3ILIA 3G71S 1K0VA 3NCPA 2RD5C 1LXJA 3D68A 3HF5A 3Q8QB 1PJ7A 4J9KA 4WPAA 2C2ZB 2IY5B 4OYOA 3B78A 1QAJA 1XQIA 1L3UA 1APSA 4X64J 2ASJA 1QAXA 4DV5J 3DDKA 5HROB 1TL4A 3KHHA 3P49B 2UXCJ 1RP5A 1X9WA 4A8XA 4ZCMA 2MKSA 1DY3A 2GMLA 1HNVA 1S57A 5ETSA 1WF2A 4PYAA 4HEA9 3K5LA 2B9YA 2XGQA 4DFKA 4UT4A 2UVVA 5E3QA 2AJFE 3PM9A 1UFWA 2VFUA 1LOUA 2V2QA 3DRSB 2NS1B 3N01A 3C3LA 2YKMA 2IM2A 2FVCA 3H90A 2DNPA 2JEIA 3KLHA 4WE1B 2HBQB 3H5SA 4O44A 4DR3J 3ZC4A 2MLZA 4IG0A 2H5IB 3PO5A 1Y0HA 2AJ1A 4DUTA 1WC3A 4ERDA 2XYPB 2KT5A 4F67A 3HCXA 1M5VC 1IBLF 3Q86A 2B6AB 4NXNF 1MWQA 4L72B 3R9LA 3M2RA 5F0UA 2RQMA 2GAGC 2XNRA 3N5FA 1FKOA 4P74A 1EETB 1X4FA 2QSFA 5IV4A 4PABA 4TU9A 3NBPA 4HKQA 5D15A 2QL5B 2ZC3A 4NCGA 3D6TB 1HPZA 1OQ6A 3IGVA 2CRLA 2P9CA 3KYLA 1RT3A 2CPFA 4WBFA 5KFAA 1QSYA 1W7WA 4CYUA 3J81j 4K0KJ 1HLWA 1DFDA 1UW4A 4F7VA 3TQ1A 2AW0A 2RUSA 2HAIA 2NXCA 2WOMA 2D7SA 4YHHF 2UUAF 2OPSB 4WZMA 2VA2A 1VBYA 3IGNA 4BLGA 1NSAA 4PEOA 2H5EA 5EX0A 1BE4A 1HW8A 2DRDA 2WVEA 3IWLA 2OGUA 5JJBA 4FF3A 4NLXA 1S0NA 4K5SA 3EJMA 4KR0B 1JLAA 4ZN3A 3M32B 2E9ZA 4F4KA 2B4UA 4QR2A 5K20B 1RI7A 3WIVA 5DDQC 3EPGA 4ZVQB 3DHXA 4WFAQ 3DKDA 2MY7A 4NI2A 1UVLA 3EZOA 3S8SA 4B3MJ 1RT7A 1FT8A 3BKFA 3S6EA 1CJKB 2KRRA 3I5CA 4YS2A 4B3SF 1PSDA 1MROA 3QO9B 5KOXA 4J9QA 1OY9A 3WZ0A 4C48A 1UW9A 3UCUP 4WTOB 2EG2A 1IXKA 2Y1JA 3DU5A 1WKKA 2JC0A 2NR0A 5HANA 1DHMA 1JLQB 3IC1A 1RWMB 2KDOA 3OXFA 4WYWA 3OXLA 3TAMA 3IRWP 3L95X 3AOBA 4O3SA 2GIRA 2W4CA 2GAHC 1IBLJ 4DU8A 2Z58B 2I9SA 2NXUA 1QVFR 5ADZA 2PC6A 3ISND 1HWJA 1YRXA 3E51A 4DV7F 3CJQA 1E6VA 3AD7C 3I9V9 1T02A 2YX1A 1J2VA 3R7SB 2MKYA 3DCAA 4LSLB 2L48A 3E01A 1OQ3A 3LF0A 5F8MA 1VDHA 2F7VA 2F63A 1JLEB 4WFBQ 5DGBA 5CZVA 2G13A 3GQCA 5FLXY 1IWAA 4CI0B 1SJ4P 2MZ1A 3TO8A 4ILMA 5KFIA 3T6BA 4CLPA 1BGXT 1NEEA 2JC1A 2CJYB 2E5HA 4F50A 3NGTA 1NHUA 5J2MB 2HNYB 4EU0A 2ADBA 4OYWA 3ZXWA 1ZA2B 4K5RA 4YHHJ 1KONA 1QY7A 2XBPA 1FK9B 3NKYA 4DV2F 2UUCF 2CQHA 4ZPVR 4K4WA 1S1UA 2MZRA 1FX2A 1OY6A 5CCLA 1HBOB 3ZZ0A 2FGOA 2UUWA 1IKXB 4LJMA 3T1YF 1TAUA 3MMCB 1WHVA 1Q5YA 4FNHA 2YY3A 2LKZA 5KT3A 3K57A 3PACA 3OUYB 2ZZNA 1DAXA 2IYIA 1U49A 1DLOB 3NP5A 1Y00A 3DGPB 3H0PA 2DY1A 1LWFB 4C3MA 2HFZA 5L38A 3CCRS 3GCWP 3FBBA 4PAAA 3MXHP 1UEUA 2M8DB 5FIIA 4F8RA 4B3SJ 3GYNA 1FVSA 2MDAA 4DF8A 2MKHA 1XR5A 1WEZA 3JSMB 2HZCA 4P2SA 4R8UA 2QLXA 3M9NB 1HHQA 5K8OA 1BQNB 1VRQC 1U1NA 2AX1A 1JKHB 5AXLA 4W90B 3KUEA 1RHMB 5KG2A 1RU1A 4BC7A 3AHPA 4OHZA 4CM2A 2J7WA 2Z57B 5CXTA 1VQ5S 1MG7A 1OIAA 1FWKA 1MU2B 1QE1A 2HFVA 4DV7J 3DLKA 4KO0B 4URQU 4IQXA 1ICEB 4LF7J 4KE5A 1BQMA 5KFPA 1RWPB 3V4MA 5J1EA 1SXLA 2W01A 5KFTA 4L74A 2F8HA 4RW7B 1KQFB 4LSNB 2W2PP 3IO1A 1YRUA 2QYGA 2JFDA 3BPSP 4FXVA 2DNLA 4DV6F 1B0PA 4F0KA 1Z2ZA 3C15A 1JQGA 3GV7B 3QNWB 4YOEA 4KPCA 5ETRA 4J37A 2UUCJ 2VV5A 2IIHA 2XSJA 3DLGB 5KFJA 1KNZA 2VC0A 3CJ0A 3EZUA 3N6NA 4HYKA 4N7TA 3KKFA 4BC9A 1YJTA 3GR1A 3O5TB 4PG7A 3TP2A 3I32A 3VVTA 3T1YJ 2FQQB 2HNDA 1LFWA 1V3ZA 2YPYA 3M8QA 3MPVA 1KFSA 5IM0B 2D69A 3MOZA 3W2WB 3MHYA 2C2OB 1F1BB 2ASLA 4JI6F 1RT1B 1NKCA 3CCTA 4B9SA 4RBUA 4IH5A 5KFVA 5AXMA 1FERA 3CIMA 4NZ6A 3UDVA 2GVZA 4HTIA 3OL8A 4Q8FA 3DDIA 5K8MA 4FVCA 2OH2A 2MMYA 4M63A 4ZVTB 3LWLA 2J9DE 2VOOA 3MR3A 3QFWA 5C2GA 2GC8A 2DHSA 3UO0A 3VGUA 1REVB 3PR4A 4RNMA 2CDRB 4K4ZA 1VR6A 3ELHA 1M1GA 3DRYA 3G82B 1G7CB 3SIPB 2GX8A 4S0MA 3CD6S 1R0BG 1SIZA 2QSWA 7AT1B 1RSCA 2DIVA 1PGZA 2QMUB 4IYQA 3HFZB 2C42A 2XMTA 4OYZA 4OX7A 3MEDB 4LREA 3NOCA 1QUVA 4OYMA 1NK7A 4TXSA 1V5VA 1L3SA 2EKNA 3GSDA 5F8IA 2D9OA 3G87A 2XEXA 4DPWA 4B9MA 4KKOB 2KXHA 1RAFB 2DVIA 3OW2R 2FZGB 1FRLA 3DLHA 3UCGA 1M5PC 1SJ3P 2M8HA 1Q53A 3PX6A 1VC0A 3BQ2A 4PG6A 5E2QA 2LQ8A 4O3OA 1N5YB 1X4CA 4NLOA 1TL7B 1VRTB 4DV6J 2BR0A 4DUZF 1DTTB 3IM9A 1J5OB 2MLXA 2XMJA 3OTDA 1Q95G 2JDJA 1M1HA 2W9BA 1BY9A 3T5LA 2FHJD 3ZZRA 5DRKA 2AQ4A 3Q83A 1Q7LB 1VLYA 4FF1A 2X1BA 3PKMA 2PDAA 5GAEU 3J7YU 3PKYA 2YPZA 3BZQA 5D3GB 4QWCA 3CMES 1KQKA 3ENQA 3C6TA 2GJFA 3T19A 2A6OA 3D3BJ 2IJFA 4WP8A 3TNVA 3CW2C 3F56A 1CULA 3IAM9 3PYFA 5CABA 3RB6A 1D09B 2MHEA 1V5IB 4ZLNA 4RBTA 3FQLA 1M5KC 1K73T 2E1PA 2DTJA 2RH3A 8RUCA 4X4QA 4JI6J 2XMWA 1HQEB 5DZ6A 3GE9A 5HP1B 4WZQA 3NXZA 1WACA 2VONA 5KAKA 3KDNA 1U0HB 4DPXA 4O23A 5DQIA 4F04B 3MM5B 2EFQA 2UU9F 3EDRB 4WFXA 4EBDA 1WF0A 2E9RX 2VU5A 2IJRA 4UOCA 3R5CA 1FNOA 3CIZA 4MYUA 3SV4A 3IFEA 2UV8G 1Q78A 3I0RB 2IMOA 2DRBA 1UL3A 1RAEB 5I3PA 5C25B 3CJRA 1VIXA 1ZAXA 2ZUAA 1GX6A 3J81Y 2DITA 3DLEA 2CNNB 2PI5A 2BW2A 2XHCA 3OPKA 1NK4A 3IG1B 3VAMA 2JEGA 4ECVA 2V4RA 3FNNA 1EQMA 1LK7A 1TL3A 2HS0A 1RISA 3UQSA 2C28A 2CXEA 3AJ2A 3EGWB 1WC1A 3R6GB 2R7WA 2JL9A 2V8HA 5KFHA 1S0VA 2ABYA 3KFWX 2W9AA 3CT9A 5L1IA 4F0HA 3M7VA 3Q8YA 2IM0A 1D9FA 3R5GA 2UV8A 5DJBA 2QFIA 3G86A 2N4CA 5GMEA 3DOKB 2GHWA 2AGQA 4DQIA 4DUZJ 2B8QA 3I96A 2OAUA 4KV8A 4OZNA 3C14B 4C11B 3H2VE 1SH3A 2HMIB 1YJ7A 2OD4A 2E44A 5LMNF 5A2QU 2K1RA 4QU6A 1TUWA 4G3IA 4BS2A 1RT6B 3DFEA 1IKVA 4I2QB 4M5LA 2OUGA 4RO0A 4D3GA 1KHWA 4UQTA 2I2YA 2MGZA 1CS4A 1XN9A 2XZTB 4LQ9A 3MR6A 1NRKA 4DWIA 5LSRA 1I1GA 2R2SA 4JI3F 2A6MA 1RWKB 1RABB 2B9EA 3WBZA 4J9MA 1JJHA 2UZAA 4Y3CA 5J2NA 3L9ZA 1EAYC 2ZH4A 3VWSA 4F4WA 2W4PA 4O3QA 1CJVB 2KN4A 3US5A 2L41A 4WK3A 3NEKA 2UXDF 1FDDA 4CTAB 4M5DA 3D1OA 4I56A 3SCLE 5HMZA 4F4ZA 2YVSA 2U1AA 1SI9A 4OLOA 3HHDA 1EKSA 3VR1A 1NSQA 5C42B 2KZZA 3TUPA 4P2MA 3UE2A 2XO7A 4EYHB 5GAEI 2EG1A 1H72C 1HHSA 3GJQB 1HQUA 4U96A 2XMAA 5AXNA 1N5TA 2G4BA 4JV5F 1JLBA 3T1HF 2VZ9A 4AYBD 2K06A 3LALA 2VG5A 5AE3A 4ETZA 2ZE2B 1HW9A 4LRAA 3W5ZA 2EC0A 3EXCX 3I5AA 4Y6IA 3JSBA 1UZDA 4NLWA 2KO1A 3W65A 5CD4H 2BM0A 5L46A 1G2EA 2LXIA 2KT2A 3J7ZT 1B99A 4H4OA 4ZOSA 2RSQA 2BJEA 3BSNA 4KB7A 4DLGA 1Y5IB 1CG2A 1RLDA 4KGXB 2HWTA 4UY8T 5C24B 3FSXA 3P45B 4DR1F 4DUYF 1VQPS 2KTQA 4DR7F 4EK2A 3HKZD 5D4OA 4U6PA 2UXBF 4WWSA 3MFHA 1GK8A 4F4AA 2V2VA 2XHWA 4DG1B 2FJAB 2KU7A 4L76A 1RWOB 4Y2CA 2NXEA 2FHJA 3MM7A 4URGA 2ERRA 2NUUG 3FEYB 3KNAA 5KFXA 3KJVB 2V4JA 5D4PA 1P1LA 3KMSA 4RW4A 2XMMA 4JI3J 5HLFB 2YQ3A 2KKHA 1D0EA 2IRYA 5KFOA 1GH8A 2OMOA 1PC4A 4DF4A 4KBIA 3MCOA 1F6TA 3ZTOA 3ILLA 1X60A 1R8BA 4MK9A 1K8AT 2MQNA 1NK9A 1R89A 1ZS6A 1YGYA 3U7JA 1NH8A 2UXDJ 3M8SA 3M4XA 4ED8A 2J6SA 4CO2A 1QDUB 2WBMA 2ROEA 3R1HA 3X3UA 2OSQA 3G8SA 2BJDA 4WFNQ 3PHEA 4HT5A 2GJIA 2D1CA 4USKA 2RS2A 3DNCA 2OEKA 3KG0A 3BN4A 5DLGA 1FX4A 4M5MA 2ZH8A 2KFNA 2ZBIA 2KHCA 3R5AA 4Q45A 2CNOB 4JV5J 3T1HJ 3MEEA 3POTB 1S6PB 4OZ5A 4DL6A 4LR9A 1AT1B 3K0JA 5A8RA 5FDLB 2GMJA 4NWBA 2HQFA 2VPXB 4BCAA 1KLMA 2DR8A 2OPPB 2ZUGA 1JIHA 4WE1A 3MPUB 2FLPA 3IRXA 1OY8A 1WEYA 4IOCQ 3QT7A 1QTMA 1XWLA 2QN6B 4DR1J 4LF9J 3U02A 4X4RA 1ZTTA 1IQTA 3CCUS 3I31A 3OR2B 1SVDA 4DR7J 3QAEA 4NLRA 1N5VA 3RRHA 1RKIA 4WF9Q 2B6AA 4KJIA 2UXBJ 3A12A 4J90A 3UDEA 2RRBA 3GR0A 2ZFHA 1RA7A 4Y0FA 2YWGA 2RVJA 2HVEA 1HBUB 2O67A 1EETA 2Z2ZA 4K4YA 5A6WA 4R5PB 4FKYA 1WUUA 3PIPQ 1CC7A 2LQJA 4IDKB 3X1LB 1B64A 2XWYA 2VODA 2PMWA 4RX6A 1FFSB 3AJ1A 2B7BB 2DHAA 1CJTA 1FVQA 3FZ2A 2A2CA 2ZOFA 5JVGQ 2BJ3A 2C2NA 3SCKE 4I64A 2DHGA 4J9VA 4FXWA 1IBCB 3D0HE 2FZCB 1X4EA 3UD4P 2OPSA 5M2RA 3VAIA 3DRRA 5HBMB 2J9EA 3Q8RB 4EZ9A 3IM8A 2YX7A 2O1PA 2CZ9A 2QA4S 3KHLA 3DLLQ 4DZDA 3LGMA 3M9OB 3PV8A 3TJ9A 5KT5A 4DHVA 1LW2A 3MFIA 3PRBA 3M32A 5G0RB 2QIFA 4P52A 2QO3A 3R8YA 4LRBA 2MQQA 4FZVA 2EFVA 4YEAA 2YKMB 2EWHA 3AQOA 3LTOA 4IOBA 2HIYA 3KLHB 4MKBA 4OHWA 4TVAB 3H5UA 4V19J 4ZS6A 4B3TF 2KG0A 4DQSA 4C6AA 3RAQA 4IG0B 1U48A 1BMQB 3GTYX 4F3OA 3SXLA 4DN0A 2M5YA 1KBRA 2HBZB 3F0NA 4Q0BA 1KVIA 4YB7A 4TKTA 2GVDB 3OSPA 2J76E 1KFDA 3M2RB 3UR3C 1X8DA 5GMKa 2LEAA 1WOOA 2EW9A 1FKOB 1NDCA 3FCWA 1HARA 2GA7A 2V5HG 2RT3A 2V8VA 4Q8EA 4X4TA 3HULA 2HGNA 3NBPB 2NZ4A 3ENWA 1P6TA 1S1WB 3O8WA 2J0QD 4NCGB 4ZCKA 3B8HA 1ZPWX 1HPZB 2QLJB 2XI2A 3LW5C 4Q43A 4DL3A 1TK5A 1RT3B 3QQCD 2DH7A 4NXMF 2R8GA 4NPOA 1AA1B 4NX9A 1RTHA 1FXLA 4LSLA 4JI2F 1P27B 4QBUA 1SUQA 1HKAA 3VAGA 1Y5LB 3KK3B 3NCQA 4M5NA 1JLEA 4DX8H 3NS5A 4LRFA 2BJ9A 2HVDA 2JSXA 2HHHF 4DV3F 2H65B 1FTRA 3R2DJ 3QYYA 4TLRA 4DN9A 1RCXB 2H51B 4NMLA 2E1AA 4O4GA 3T1AA 2DB1A 1CSJA 1N6QB 1WSVA 1NHKL 4ECQA 3MCSA 5J2MA 2HNYA 2ZH6A 1QAIA 2MQMA 1MWYA 5DETA 3G96A 4OZ1A 1RAJA 2MKJA 3IA0A 1FK9A 2DGVA 2X7IA 4Y2MA 2IPOB 1JLAB 4CLTA 3PHTA 2G0IA 1G4CA 3DGVA 4Z37A 4EMDA 2G2OA 5DG7A 1UEVA 2JX2A 1S9EB 3OR1A 3MMCA 3P3DA 4NI2B 1JLGA 2ZH3A 4IG3B 2BM1A 3W8GA 1VQYA 2BABA 3BF4A 2K8GA 5ETOA 2C3YA 4K4VA 2DEJA 1OJ4A 4TYAA 3ICLA 4LF2A 4DR6F 2PEHA 3HO1A 5HQMA 5CYQA 4B3TJ 2OELA 2Q79A 1SL0A 4CO4A 3DMJB 1MMDA 3MM6B 3TAMB 1KVKA 1HI8A 5J1PA 2V8GA 2JEJA 4LRDA 4NRTA 5DG8A 2YKOA 2BOAA 4G1QB 1H7WA 5E3PA 2LQ9A 5H1SV 4RL1A 5L1JA 4PQUA 4UOHA 2OHDA 1N5SA 4DCJB 3HM9A 2QG9B 3C8YA 4EBEA 1JKHA 2DCLA 2DKOB 2OI2A 3E01B 3Q2TC 1N33F 4IFVB 2PMZD 3LAKA 3D66A 4Y65A 3MZIA 1ELOA 4KFBA 4OV1A 3L7PA 2JVOA 1MU2A 3JB9k 1VQOS 3IN5A 4JI2J 2FJVA 3HHLB 5GVQA 4IH6A 5L8RC 4XPCA 1MLAA 1T11A 3GV5B 2IM3A 5B09A 2XB2D 2Y8YA 2HHHJ 1RAGB 1X4DA 3ETMA 4DV1F 5IFMA 4ETXA 3KLIA 3EPIA 1ZBTA 1S1UB 5EDWA 8ATCB 3FMWA 5D4NA 4CLSA 1JWWA 4OFZA 2COLA 3M2VA 1PYOB 2HWHA 4LIRA 2V68A 2IVYA 2ZOGA 3HHLC 3OBIA 1RWNB 3C6UA 3DRPB 2Q66A 3DLGA 2QJ3A 3F44A 2BACA 3U27A 3RG6A 4ZITA 4YQWA 2GFFA 3CO0P 1JLCA 1VRUA 3MD3A 4GKJF 2PA8D 2KG1A 1W25A 4NLSA 3NS7B 4RUAA 2VBWA 2HGLA 4NA1A 5IM0A 1NK5A 3BR8A 1T7PA 3FJ2A 5KG4A 2R8JA 4A8OA 1B0VA 3TWZA 3W2WA 1M1KT 2H9ZA 1EQ0A 1RT1A 1LWXA 2ILYA 4DR6J 4R8UB 4DSEA 4ILRA 2ZDOA 3GYGA 4ER8A 3KLGA 5EUHA 5K14A 3MDFA 2F40A 3BDPA 4ECYA 2F4FA 3D9BA 1RAIB 1F3VA 2YNFA 1R7IA 2HVHA 2XMKA 4GKKF 3FEXB 1WDDA 3GG0A 1RLCL 2BE7D 4NLVA 1TMJA 3EE3A 1C1BB 3EDQB 2W2MP 3NGRA 2B3TB 3J7A1 1GMUA 3AA8A 3CWJA 4G6VB 2GGPB 5KG5A 2QV6A 5KFLA 4CLLA 1JXVA 4USMA 2FGCA 3AODA 2MPUA 4ZJLA 3GIRA 4X4SA 1N33J 1BQMB 1Q7YT 2IA0A 1Q8LA 3HJFA 1YBTA 3RYLA 5J1EB 5E3CA 3VALA 4DFMA 2VL1A 4ZLJA 3V2UC 2AZ1A 4KT0C 3TUZC 2KL8A 1WHWA 3TW0A 2VA3A 3UNGC 4YR2A 1QM9A 1FTCA 3C15B 1EP4A 5I4MA 1RHUB 3TJAA 4IR1A 1FF2A 2YWKA 4A8KA 1ULRA 2HEKA 2JVRA 2W24A 2EXUA 2NREA 1N5YA 3TZWA 1VRTA 2KFZA 2ZOMA 3AOCA 1DTTA 1J5OA 2FVQA 5DZ7A 1XEZA 4ELUA 3NY0A 3M8RA 1RTJA 1I94F 4TYBA 2DNRA 2HNDB 3L4BC 4ZVHA 1TK8A 2IA6A 2GJ2A 3M8QB 1HIYA 5G4DA 3PRDA 3GCXP 1H98A 1AUSL 2XYHB 2V9WA 4RR5A 4F26A 2F9DA 3ZFVA 3AJDA 2WW8A 2D3OR 4X65F 1PYTA 2C3PA 2FDNA 1P9QC 2YH1A 5BR8J 2QT7A 1U2CA 4F25A 2GVZB 3PIOQ 4PG4A 2J0SD 5KFDA 4J5OA 1U09A 2PN6A 1D1UA 2RQKA 4K4UA 4CO5A 4O0NA 1DARA 1OYEA 2ZWOA 4C0OC 4CLZA 2DR6A 1T3OA 4X4NA 2IRUA 2GZOA 5HP1A 1FXRA 2DNNA 1QSLA 2H48B 3VAFA 2F4VF 1TKZA 2W2QP 3OL6A 1N52B 2C3OA 3L3CA 4NCBA 5E5NA 4YR3A 4P10A 3MEKA 5A8WA 2PGCA 3GB0A 1VQNS 5I3UA 5LT5A 5DQGA 4GKKJ 3RW7A 2ILZA 2W2NP 1VQLS 2B51A 3M1VA 2EVZA 2CJKA 5KFMA 3W9HA 1WSRA 3HKWA 1JXLA 1U02A 1IR1A 3W66A 2CADA 3IBCB 4USTA 4ZVOB 3M2UB 4ES1A 2J9DA 1UZHA 1R0AB 3HPOA 1F2HA 1F9HA 1IKYB 3T5JA 4LBIA 3K17A 3HVTA 2BANB 5B0EA 2E7XA 5BYQA 1B7FA 2DGTA 4U7UK 4LFCF 1NSPA 3IR6B 3CMQA 4QOTA 4KAIA 5SZTA 2W9BB 3G6VA 3MR5A 3VQSA 2APOA 4DR2F 2CWKA 2NZCA 3Q23A 2CA9A 2VFRA 2VQEF 3A3PB 3C6TB 1H7XA 5KT2A 3M6WA 1I94J 1TKXA 1YTYA 4JV1A 5GAGI 2Y1IA 1HA1A 1UTAA 1KVJA 2NCKL 2OTLS 4N5SA 5HO4A 2C2DA 2J0WA 1S77D 1Y5NB 2D41A 4TN2A 3BQ1A 3W5YA 5IT4A 3UI3A 2XNQA 3SDEB 3QGPA 1RT6A 5MAOA 2IAJA 4A46A 2BE2A 5JUMA 3M6UA 5DGAA 4O0IA 2MQLA 3BJYA 1RHRB 4ZPCA 1DBDA 3VGVA 2DGXA 5A0YB 2FJXA 2B4OA 2QFJA 4P2FA 4JI4J 5ETPA 4RU9A 3IWXA 4CNYA 1WEXA 1F5AA 4C8KA 1UEKA 2JWNA 2F4VJ 2Q1LA 3D0IE 2FTRA 2E9TA 4HHUA 1F2GA 3MM8A 1NPPA 1U6BA 4LRCA 4C97A 1PKUA 4AL6A 2OSRA 4CRJA 4DQRA 4HLBA 4GO7X 4QR0A 2W9CA 2BJ1A 3FC9A 3AT1B 3LGHA 1WG1A 3A8KA 3BBFA 3AB4B 4A8MP 1MN7A 1TL3B 3PYEA 2ZJRQ 3SFGA 1MMNA 3K59A 2O5DA 3DOMA 2Q43A 2B56A 2AYEA 5K5MA 2VIHA 2FLLA 2FHMA 1CC8A 3ZZPA 4PWUA 2RAQA 3RBXA 4RZRA 4J9RA 2MZJA 2P6SA 4USUA 1Q1KA 1D8ZA 3AB2B 5E33A 2CNKB 1F5CA 4A4JA 3KJNB 1NHVA 4E98A 1U1LA 2XY6A 4FYXB 1U47A 4LFCJ 2KT3A 4CWBA 3LH2S 4OJ3A 2DJWA 1R31A 2W7PA 3KG4A 1NAQA 1J27A 5ETTA 2VJVA 4DR2J 2BQRA 3BV8A 4GO5X 1JNZB 2K1RB 1GMVA 5C24A 5EWGA 2VQEJ 2RHSB 3PYGA 2BQUA 2NPFA 2CZVC 4HR2A 1IKVB 1FRIA 2ATCB 4NASA 2MGZB 1MSWD 4JV2A 4ZVEA 1HL6A 3CMAS 2HS4A 4WFZA 3MGJA 3N79A 3H5XA 4BHQA 3UVJA 3WC0A 2RDJA 3A8JA 5J2NB 4ES2A 1PCAA 2V67A 2C2EA 2P9GA 2EI5A 4ZP8A 1Q5VA 3OSNA 2E7VA 1U24A 4I69A 2M52A 1JXEA 2QMXA 5HLFA 3IP0A 2FB0A 3LGNA 4NYOA 5L1LA 1KR4A 4QR1A 1JLFB 3O6QA 4XO0A 3ET6A 4FYYB 2CIMA 1G3OA 4ECRA 3OFFA 4F4YA 5B0GA 3W64A 2LP4A 1S97A 1Q8BA 4DFPA 3CDBA 4DXLA 4WK1A 3TVKA 4DV5F 2LEBA 1HQUB 2KFYA 4NLYA 1JLBB 2UXCF 1GTEA 1GAOA 1BD6A 1KOHA 2GNKA 1TELA 1I5OB 2C2RA 3BEGB 1FCAA 2WBRA 1LW0B 4F0MA 1UVNA 2MYFA 2D74B 4LBPA 4AE5A 2GCFA 5K8NA 1RWUA 5EGYA 3U1NA 1IM4A 3RAMA 3POTA 3GU0A 1N8RT 1Q8IA 4H4OB 4PWDA 5IOLA 3H4BA 2UP1A 4J9PA 2H4WB 2QLWA 2YX4A 3AFGA 3DYAA 3DN9A 2P6TA 1QD1A 3I9ZA 4DSJA 1PILA 4C9DA 2OPPA 4HL9A 4ZVPB 4IFYB 4P9SA 4TY9A 2B9WA 5ETMA 4JBCA 5DDOC 3I56S 2DGQA 3DI6A 2RRAA 4CH1A 3MR7A 5AT1B 3IBFB 2LVWA 3HHLD 2V4JB 4I2PA 3BKTA 2BYCA 4YB5A 6FDRA 5E3RA 1YVFA 3TEHB 4KC5A 4IQMA 4DOZA 2UVWA 2IDLA 4UZBA 1KEKA 1HBUA 2G1DA 3KUHA 3G8TA 1VC5A 4KIAA 4K0KF 4DSLA 3CCMS 2OTJS 4R5PA 4ZVFA 1VBKA 2PI4A 1R8HA 1FDAA 2R7UA 1NKEA 4DJBA 5KFFA 4C4WA 1Y7PA 2X3GA 5HJXA 2AEJA 4HDGA 4PUOB 1Q8KA 4RNHA 4WFYA 2CPZA 3I5BA 4JV0A 1N48A 1FDBA 1FXDA 2MZTA 1ZETA 2EPIA 3QT8A 5IS2A 2HS3A 1PBAA 5CCMA 1RACB 3W62A 1QAYA 3OTBA 5HBMA 1TVRB 2FD2A 5LJ5Y 3S1TA 3RBDA 3MEEB 2KJVA 1KQSR 4ANDA 4QW8A 4LVOP 4B3MF 5L9XA 3GIKA 3V6DB 4H54A 2QX0A 3CJSA 3NNCA 2CQDA 1S1VB 5C7PA 5A8RB 1NUEA 3CC7S 1S79A 2O3DA 3R5JB 2HZAA 3A3OB 4QU7A 1SJFA 1XMBA 5G0RA 3UD3P 2FY8A 3OLAA 4J9LA 2C3UA 5CYJA 3UCZP 1KLMB 2WSFC 4B3OB 1KRPA 3QT5A 3HVRA 3IRXB 3QRPA 4L75A 2RDDA 1RHKB 1R0CB 4DX5A 1ROFA 2VASA 5HVGA 2ZM6J 2FYXA 4FVMA 5GAHU 1UMJA 5KFWA 1OSCA 2DPIA 3TYTA 2J0XA 4RWXA 2MLYA 1N36F 2ZNZA 1T9XA 1YJ9S 4RUCA 3CNQP 2MHNA 2V8PA 2GVDA 3GIJA 1AB8A 4AUKA 3ZZZA 3NNAA 1S4FA 4ECWA 1RT2A 3A13A 2J6UA 1UJ5A 6AT1B 2WSEC 1M5OC 1FO1A 1X0PA 3FSYA 3BPDA 2XCPA 4NRUA 3HHKA 4K4XA 1S1WA 2DHHA 1TV6B 4DL2A 4FF2A 1WC4A 1HR0F 2R8IA 2FLOA 4ALZA 1CJTB 3FRYA 1YK9A 2LU1A 2UUBJ 1X5PA 1NJXA 3KG1A 4ZCIA 3KK3A 2SXLA 1Z1ZA 2HFNA 2NUHA 5IXUA 3DRRB 3H2UB 3LAMA 1Y4ZB 2LLZA 1HYSA 3KWMA 2AYMA 1SL1A 3QSIA 4NLDA 1N6QA 1ZH5A 4YR0A 4HTJA 5AJ3F 2QL7B 2XLIA 1VJQA 3H5YA 2ZD1B 3KJFB 2CQCA 4EO8A 1ZZNA 1BHNA 4P7VA 4DBQA 2BRKA 3JAMY 3ITHA 1LW2B 4AT1B 1FA0A 1NCLA 1R3NA 2ZHBA 1VIOA 2V2ZA 3R27A 4A8FA 5EWEA 4CLKA 1GX5A 3W60A 1S9EA 3I6PA 1RUSA 4ZHRA 2POKA 4J9SA 4LT6A 2FLNA 1PJ5A 4IG3A 1PJ6A 2EBEA 3JQKA 4M5GA 4Z7YA 3MPDA 3MAQA 1KWMA 1WELA 5GADU 1AYEA 1R8AA 4C2MA 4R25A 1NMEB 1RTIA 4MJKA 1JJ2R 4Q0BB 2NPIA 4KHPJ 2L9WA 3CD5A 3CCWA 1WI8A 1YSJA 3PNIA 3DMJA 4IO9Q 1L3KA 3MM6A 4C98A 3BO2A 4V19X 4EWTA 4C8YA 3GONA 5B7WA 2AJ4A 2KVIA 1U1MA 5CH7B 1N36J 1UFLA 2DRAA 3BREA 5J1NA 2ZBPA 4G1QA 4OL8A 1VQ7S 1BQXA 1UVIA 4OYPA 1YI2S 4CO3A 2OFGX 3V81A 4ES3A 4M94A 3VGSA 1H2TZ 1RTHB 1X31C 3H98A 4LF7F 4DEZA 3NGKA 1SUQB 2VB6A 1KP6A 5E3AA 4IFVA 4DQPA 2JH3A 1G6BA 4NMXA 4FP9A 3IAS9 2BEFA 4I67A 1V9OA 3GG1A 2BKNA 4ZJQA 2OKQA 5KT6A 3LPYA 1OS5A 2Z8QA 1HR0J 1D8YA 4HI2A 2FJEB 4TQSA 4ZP6A 2G1HA 2MKIA 4O4GB 1FE0A 1GXLA 3HHLA 2HFOA 2W7AA 2C3MA 1VGYA 2HURA 2FVRA 2ACYA 4LF5F 1YBUA 2GO9A 2YNGB 4MKAA 1DZ5A 5HVFA 3OTEA 3OVBA 4O3PA 2XZDB 5FLXU 2C22A 3BDEA 3OR1B 5AJ3J 2HSEB 1JLGB 2YWWA 1YJRA 2E5GA 1C1CB 2BJ8A 3OTCA 4QZVB 1EKRA 3DRPA 2P2CB 3U1LA 3EGVA 2LDYA 1NSKL 3TA2A 4B9VA 1NXIA 3N6LA 3DXBA 2DISA 4OI1A 2YQ1A 5CYQB 3MR2A 4CH0S 3CC4S 2VQFF 4TY8A 3HP6A 3W7BA 4NOHA 3ZZTA 3CJTA 3BH7B 5HMXA 2DIUA 3F73A 1FKAF 3TX8A 2HHPA 2LCWA 2M2BA 2DGSA 2DNKA 2QYCA 2JNJA 5F8JA 3VAKA 3MF5A 4PQUB 1M90T 4W92B 2BKOA 2QMWA 1IVZA 4DCPB 4FYWB 4FNIA 3CC2S 5DM6Q 1X9SA 2ZH5A 4I6YA 3W2VB 4G65A 5D0RA 1VQ8S 1FESA 3D6HB 4DV4F 1C1BA 5LSLA 3FBFA 5K9FA 3KJQB 3R7NB 1U1RA 3OJUA 2CQGA 4KFBB 1TL5A 1Y11A 3MMBA 2GGPA 3DOLA 2QA2A 3NWRA 1PO6A 1RQ0A 1XR7A 2OP5A 4OMFG 3MCMA 1RWWB 3F41A 4NEZA 4B3RF 1KTVA 1ZM3A 3BGRA 2FJBB 3H8YA 2MEWA 1GMWD 2AMCB 2BV3A 5KTQA 3NWGA 2DT9A 3PFOA 2E5JA 3J7AN 3KLIB 2QRRA 2ZH9A 4XTTA 1FKPB 2V94A 4CQ1A 3LP2B 3MI7X 5GADI 3UDLA 2KM8C 4IH7A 1SKRA 3JTNA 3M2VB 4J9OA 3CGIA 3CJ5A 3MUVP 2D3ZA 4QPTA 4FBUA 4ED6A 5HMWA 3UR0A 4LF5J 1O0PA 3FVYA 3C6UB 2N3OA 1N32F 1CVJA 2B7CB 2G0JA 3NS6A 2YNIA 4DDFA 5KFYA 2ALZA 2HNZB 4ZPWR 5KFCA 1JLCB 4LF1A 1VRUB 4DU7A 4RW9B 3OVSA 4Q2MA 3RBEA 1TTHB 2DXDA 1FRMA 2R42A 2XY7A 1DRZA 4ZN1A 3FDSA 5BJRA 2CDQA 2PE8A 4A8YA 2M9KA 3MWBA 3D0GE 1SJQA 2CQBA 2G2ZA 2DYAA 2OJ3A 1SV5A 1XR6A 1VQSA 2EK6A 3ILOA 3KLGB 5K14B 1X0FA 4OJHA 3CXCR 2VQFJ 2GMHA 2MKCA 3I87A 3H59A 1X4GA 1RWXB 2YNFB 5L39A 1N4LA 3V5RA 3N6MA 1IBMJ 3V6KA 5JMNA 5MLCV 4DQQA 3V4IA 4H4KA 3R5DA 2CJBA 4O4RA 1H6KX 3QT6A 1ZAWA 2A0FB 3UPFA 3K5PA 1KSPA 1DQAA 4P72A 1DJ0A 4NEYA 4FPRA 5ETQA 1C4AA 1IN0A 4DV4J 2MTLA 3CTRA 3QRQA 1PAUB 4USWA 3ILJA 3ZO7A 3DM2A 4A48A 3ONQA 4DMZA 5E7OB 3M2UA 1LEOA 4RPFA 4B3RJ 1LXNA 5THWA 4I7FA 3C16B 1R0AA 8AT1B 1EP4B 5DG9A 1IKYA 3D4JA 3K5OA 2NLWA 4WTYA 1GXUA 2ZBQA 3FBCA 3KLVA 2BANA 3BBCA 1NU4A 5T7LA 1M5HA 1O6XA 1JNRB 4NLUA 2G9OA 3IMQJ 4OYBA 4ANCA 1RTJB 2NQPA 1SC4B 4ECTA 3LA0A 1RADB 1CQMA 3OFGA 3PZPA 1ZM9A 1R6YA 1N32J 1I3OB 2E29A 4MYTA 1IJFB 4DL5A 3B4MA 2X51A 3N9UC 1FNXH 3HVWA 1U1PA 4OX6A 5I3QA 3G6XA 4UOGA 2CFXA 2WSCC 3FSIA 3DDNA 1RKJA 2HPUA 2YXLA 5DQHA 1K1QA 2K7JA 1IM6A 2DNQA 3T9ZA 2BXJA 4Y2KA 3SDEA 1QJHA 2B43A 1WORA 2EFNA 5F9NA 4ENOA 4OZLA 2AT1B 1YLXA 1TKZB 4QWDA 4QIGA 3VF0B 2LEPA 3N28A 1XMOJ 3KLEB 3BH6B 5A8WB 2VKZG 1GT8A 5B0DA 5I3UB 3VV2B 4N41A 2BZ2A 3CDEA 5A0YA 1S6QA 4RW6A 4OZ0A 2V63A 2B8PA 1B0TA 2VPYB 2ACMA 3M1VB 4CLFA 3UNYA 1RZMA 4RW8B 4ZJOA 3GJSB 4OHVA 3MAAB 1RYSA 1B70B 5F0WA 4ECZA 2Y0SD 5KFQA 3L09A 2OD6A 2B5JA 3TQEA 1SH2A 3P96A 2CPHA 1RXOB 3SSRA 4NCAA 3QIDA 3M9MB 4N76A 3K8WA 2RE1A 3QATA 3HVTB 3KK2A 4DS4A 5CYMB 2PFFB 2OPRB 2CPIA 2PFDA 3RB4A 2DNOA 4GVBA 2OEJA 3FMBA 1R6VA 2ZKTA 1J5EF 3J81U 1N34F 1X9MA 4NYPA 3WQPA 3GFHA 2FHKA 2YKNA 3TVZA 5F9LA 3JQJA 1YJVA 4HI1A 2YTCA 1E6YB 1DQ9A 2ZJQQ 4PKDB 2VPZB 3PRVA 1TKXB 4ICLB 4KHRA 4ELVA 1YX2A 2XQCA 4HHJA 3VHQA 1M0SA 3ENAA 2CNLB 3QJPA 2AYBA 2HHXA 2ZJPQ 5D8HB 1KN6A 1EX8A 1QVGR 1N88A 4MFBB 2IDEA 2RHQB 2I5JA 2HK3A 5D6GA 3LQVA 2YH0A 1W26A 3M30A 2HG4A 3T3FA 2IAJB 2BE2B 2OO4A 3SMZA 3T41A 1RT4A 1VI7A 5ETVA 2G0CA 3EVWA 3QGHA 4HVZA 3NRBA 2BX6A 1OSDA 3OJSA 5J2QB 4Y34A 3OTOF 3Q24A 2CJQA 2YKAA 5IT0A 3A8EA 3MM8B 5ETLA 1SQGA 5CHCB 2HFSA 4CLWA 4ECXA 5D0EA 4EYIB 1HBMA 1VFJA 3D6FB 3EGNA 5DM7Q 3IS9A 2W9CB 1OWXA 4QW9A 1RA6A 1JLFA 4IUFA 4Y2AA 2XULA 1RT5B 3CCVS 1VLOA 4KGVB 3TA0A 1SKUB 5HATA 5DS7A 3BB5A 3I0SA 1UP1A 4XPEA 3J7YI 3DOMB 2HHQA 4ID8A 4OQJA 2W8LA 3EYZA 2IVMA 4K2JA 1S5ZA 1RAAB 3PY8A 3R97A 2F8EX 3TJ8A 1RB0A 1P9YA 2R7RA 1LWCA 3KK1A 1RK8A 2QA4G 2ALYB 2AYGA 1LW0A 1TK0A 1A6LA 3D7SB 2L9DA 1F3FA 4DCOB 2XGPA 2CG4A 2QGFB 2VDIA 4J7CA 2K2PA 4DX7A 1SCJB 1TKTA 3K5MA 1RBOB 1NKBA 1HD1A 1R27B 2ZNYA 1NJWA 3PYDA 1GQEA 3WIUA 1J5EJ 1N34J 1L5UA 5LM7E 4U95A 4RNFA 4G1PA 4LF4F 3AA9A 4TNOA 5DDPC 1S4EA 3KLFA 4LF9F 1HWIA 4HH1A 2JOQA 2RJZA 4IO1A 5B08A 2N7CA 2AWZA 2HRYA 4WU3A 4K2XA 4IFYA 1XNRF 1KKHA 3HD2A 2Y1RI 3RB3A 4WIIA 3O1LA 3C2PA 2WCXA 4MIBA 4QWEA 1V6HA 3GYXB 4LR7A 3UVJB 2XM3A 4O3NA 4DPTA 4LUBA 1FRJA 1VBXA 2RQ4A 1PAEX 2QE5A 2EFOA 4NLTA 4YN3B 3OL9A 3OTOJ 3VQTA 2DNYA 1RTZA 4KGMA 3DU6A 3ET6B 3AAWB 6FD1A 2WTFA 4ED4A 2N4DA 3PX0A 4UUXA 2CVEA 5F3TA 3BBBA 1L3VA 1XMQF 3D2WA 1RTDB 3A8IA 4PUOA 4FS1A 3B6BA 3C19A 3O44A 2IMWP 1U8WA 3TX0A 4E0DA 2MKKA 2CPDA 4OZ3A 2J5AA 4I68A 1FRKA 2HWIA 4MH8A 3K58A 3VCDA 3A3NB 1T9YA 2VKRA 1TVRA 4X66F 2DCUB 2N7YA 4CLUA 1SJRA 3D5MA 2DD8S 4E8UA 1WC5A 1LFPA 1S9FA 2X3DA 4OHXA 4PWDB 1YWXA 4D3HA 2NXJA 3MECA 1EIYB 3V6DA 2R3VA 1S1VA 3DYAB 3BR9A 1EZZB 1U1OA 1HI0P 5F8LA 3WDOA 1FJEB 3PVXA 4KQZA 1RAHB 2R7QA 5EWFA 3HZEA 1S76D 4B3OA 2CQ3A 3ZZYA 2Z0GA 3JSYA 2CJAA 4LF4J 4V1Ak 4TLQA 1S1XA 3SZ2A 4B9TA 3NGUA 2LA4A 3DI6B 2R2UA 3A4TA 4CZCA 1AFIA 5LXYA 2CVIA 2J7UA 1H0HB 3PXGa 1HNZF 2R2RA 3W9JA 5H9EJ 4JYAF 4K7QA 4X2BA 4KPYA 3BGOP 4MTPA 4NXNJ 1T03B 2VFVA 1XNRJ 3P6YC 4I2PB 1F5BA 1S12A 2VC1A 4ZVUB 3AQPA 4OIXA 1NNDA 4RJVA 5ETNA 2CPYA 2GHPA 3M8YA 2VUGA 2Y9HA 1S6UA 4DL7A 1U26A 1WKLA 1SH0A 1LKZA 3QWUA 1TV6A 4DR4F 2FY1A 1URRA 3HDSA 2JRSA 3VTIA 3TA1A 3QZ7A 1UJ6A 2Q3PA 2UUAJ 3D1HA 1Q82T 4OI4A 2DXEA 2P5VA 4C8ZA 4RUBA 2BRLA 1AZSA 1VYAA 2KB2A 3TEGA 1XMQJ 1TQLA 2BW7A 1KOOA 3H40A 3NL0A 3QLHA 3Q2SC 4Z7CA 4M5JA 5KFNA 3FBEA 4ZIWA 3BO3A 3MPYA 4W98A 3FRZA 5DDRC 3NGSA 1X4BA 1IR0A 1S9GB 1UA1A 3P4UB 2ZD1A 4Q2LA 5JVHQ 2HAFA 4I6AA 2BVZA 2CPEA 1FWPA 5F8GA 3MMAA 4X66J 3Q89A 3PO4A 2E66A 1TFWA 4AL7A 1WD6A 1X5OA 2YKQA 3E3XA 3GFXA 2HHUA 2E7WA 1FJCA 4U67Q 3PW7A 2NYIA 3LOUA 3FFIA 4LQ3A 3J7Z5 4ZLPA 4ECSA 2D3O1 1REGX 1OO0B 3FCHA 3FUYA 2RNEA 2U2FA 1Y10A 3AH6A 2LDIA 4UY85 2Z2MA 2H3EB 3MCNA 5T41A
chains in the Genus database with same CATH topology
2RRAA 2YWHA 3KHGA 4D3GA 1RDRA 5M2UA 1KHWA 4UQTA 2I2YA 2MGZA 4CH1A 1XN9A 1IBMF 4LQ9A 3TRGA 1HQEA 3MR6A 1NRKA 4DWIA 5LSRA 4ZK7M 2K3IA 1I1GA 2LYVA 2R2SA 4JI3F 2ADCA 1U2RA 4OJ1A 4Y00A 3SI8A 1RT2B 2LVWA 2A2DA 2K3KA 3HHLD 2V4JB 3MM5A 4PQAA 4I2PA 1D9AA 4YY3F 3CJKA 2MZSA 3WBZA 4J9MA 1JJHA 2BYCA 2UZAA 4YB5A 1HBNB 4N8OA 4Y3CA 5A6PA 6FDRA 4R0JA 3QMQA 1YVFA 5E3RA 4C8MA 3CDAA 2FPHX 3UWTA 4KC5A 2ZH4A 4IQMA 3VWSA 4DOZA 2AGOA 4F4WA 2UVWA 1KEKA 1HBUA 2W4PA 2G1DA 4O3QA 3G8TA 1VC5A 3CCJS 4JI1F 4KIAA 4UW2A 2M88A 3M8PB 4K0KF 2KN4A 3US5A 3CVKA 2XWXA 2L41A 2CKWA 4DSLA 4WK3A 4XDDA 3CCMS 2OTJS 4A8SA 2UXDF 1VK3A 2WONB 4R5PA 4MAKA 4XAKA 2RF2B 1FDDA 4ZVFA 4M5DA 4CO0A 4CTAB 4L6V3 3D1OA 4I56A 1VQMS 1SIWB 3M05A 2PI4A 1R8HA 3SCLE 3I0RA 5HMZA 2HHWA 2VOPA 2BOPA 1FDAA 2R7UA 4F4ZA 5JXSA 3IR7B 2YVSA 1NKEA 5C25A 2U1AA 5KFEA 4F4XA 4XIUA 4DJBA 3VAJA 2B9XA 1SI9A 1X4HA 4OLOA 4B9UA 1VQKS 3HHDA 2KM8B 4PXBA 4X4PA 5KFFA 4C4WA 1Y7PA 3VR1A 2X3GA 5C42B 1HHTP 4NLQA 5HI7A 4MMOA 2X1FA 4HDGA 3Q0AA 4PUOB 2MSTA 4RNHA 3IG1A 2KZZA 4WFYA 1VK8A 3I55S 2CPZA 1GXTA 3CJ4A 3I5BA 5B0AA 1Y3JA 2HRUA 3UE2A 4JV0A 4WCEQ 2XO7A 1N48A 3HHNB 4EYHB 5GAEI 1FDBA 1FXDA 2EG1A 3PW0A 1U2FA 2MZTA 5KG0A 3TUIC 1ZETA 2EPIA 3QZ8A 3E8OA 5I42A 1HHSA 4KGKA 2HS3A 5A8KA 5IS2A 1HYSB 2YKPA 2HLTA 1HQUA 2RS8A 3RZAA 4JI5F 1WF1A 5CCMA 1OPZA 1QAYA 4CO1A 1N5TA 5AXNA 2GHVC 2G4BA 1JLBA 2CYYA 4JV5F 1N56A 3T1HF 1FRHA 2VZ9A 1SBRA 3OTBA 5KG3A 3LALA 4AYBD 2VG5A 1FD8A 1WG5A 5HBMA 4ETZA 5AE3A 3ISZA 2X1AA 3LP1A 4M1KA 1TVRB 2FD2A 3KHRA 3QJJA 4URSA 4ZDNA 3TANA 2ZE2B 5LJ5Y 1HW9A 3S1TA 4IRCA 2EC0A 2KYXA 3EXCX 3I5AA 3RBDA 4Y6IA 4B08A 3JSBA 2BDPA 4NLWA 3MEEB 4ED3A 2KJVA 1KQSR 2KO1A 5AE1A 1UKUA 4ZP7A 3MM9B 3ITHB 2VBZA 5CD4H 2YNGA 4QW8A 2BM0A 2A3JA 2ZHOA 3RU0A 1TKDA 4N77A 1JMTA 4LVOP 1G2EA 5KT7A 1YJNS 4B3MF 5L9XA 1KTQA 2AX0A 3GIKA 3V6DB 3Q22A 4DSIA 4H54A 3G6YA 2J7KA 4USIA 3NNCA 2CQDA 1S1VB 2LXIA 5A8RB 2KT2A 4R0EA 3J7ZT 3CC7S 4H4OA 3DOKA 1S79A 2O3DA 5H9FJ 3H4DA 3ISNC 4ITSA 4ZOSA 1ZTWA 2RSQA 2BJEA 3BSNA 4DFJA 3B4DA 1U7LA 4KB7A 4DLGA 3H20A 4QU7A 1Y5IB 1SJFA 3SCJE 1XMBA 4ZHRB 1N0VC 4C0HA 5G0RA 3UD3P 3OLAA 1CG2A 2XI3A 1ZAVA 4J9LA 2C3UA 2HWTA 4YUDA 3MD1A 5LSOA 5CYJA 1C1CA 4UY8T 3UCZP 1F0XA 4GMKA 3RB0A 1KLMB 2WSFC 5C24B 2Z2LA 4GC7A 1KRPA 3FSXA 4CT9A 4B3OB 2JHEA 4C11A 1H38A 2HVIA 4U7CA 4DR1F 2DO0A 2XMUA 4DUYF 2HMIA 2B4PA 3HVRA 2VFTA 4NZ7A 1VQPS 2IBKA 3IRXB 3MOJB 1MW7A 4ZPDA 2PSZA 2RKIB 2KTQA 1JK9B 3A1YG 1W2IA 4DR7F 4ZA1A 3OL7A 1ROFA 1NJYA 3HKZD 5D4OA 2VASA 1RTIB 4U6PA 2M70A 3ULHA 2UXBF 4FVMA 1F9FA 5GAHU 1UMJA 2BQ3A 4X4VA 5KFWA 2W7OA 5U47A 1OSCA 2DPIA 1HNIB 3MFHA 4IKAA 3CCQS 3TYTA 3V6JA 1IQZA 3QWPA 4I2QA 2XHWA 2J0XA 4RWXA 3RAXA 4DG1B 2FJAB 2KU7A 1N36F 2ZNZA 4LMZA 1YJ9S 4QYZJ 4RUCA 2CQ0A 2L9NA 3NAHA 5LXRA 2F9JA 3LWMA 4Y2CA 2MHNA 3RR7A 3GIJA 3PW4A 2O66A 3W3SA 3BM7A 2FHJA 3MM7A 4AUKA 4URGA 5F3ZA 2ERRA 5KFKA 2NUUG 3DLJA 1K1SA 3L7OA 3ZZZA 3NNAA 3FEYB 3GIIA 3KNAA 3GMGA 2D9PA 1XMOF 1S4FA 4ECWA 2XMVA 1RT2A 5KFXA 4PG5A 3KJVB 2J6UA 4MK8A 5CQGA 1UJ5A 2V4JA 5D4PA 4PXDA 4A47A 1P1LA 3KMSA 5KFRA 1Q86T 2WSEC 4RW4A 3THPA 1M5OC 1HBNA 1V3SA 1FO1A 1Q16B 2MJUA 2VPWB 2XMMA 1X0PA 4QIWD 3FSYA 5HLFB 1MNEA 1U8SA 2YQ3A 2XCPA 1HMVB 2EBGA 4OI2A 4NRUA 3V81B 1AXQA 3HHKA 2KKHA 1D0EA 4P7TA 1S1WA 2IRYA 4K4XA 1GNKA 5KFOA 1GH8A 2OMOA 1PC4A 1TV6B 4DF4A 3CCLS 4KBIA 4DL2A 5E41A 1Z4UA 2MZQA 2KI2A 3W2VA 3PW5A 4FF2A 2RF2A 1TP7A 4Q7AA 4CTAA 1HR0F 2R8IA 2FLOA 3DLEB 3MTJA 5IWAF 2DNGA 4ALZA 4ID5B 3FRYA 1R8BA 4MK9A 1K8AT 2LU1A 2MQNA 2V0NA 4IRKA 4AQYF 1NK9A 5LMUF 2W8KA 1R89A 4X4UA 4I0WA 1NH7A 1YGYA 3U7JA 1NK6A 3TUJC 1NH8A 1X5PA 1NJXA 1MMLA 3LP0A 3KG1A 2VFSA 2AP6A 4ZCIA 3KK3A 5EX3A 3M8SA 3M4XA 4JUZA 5C42A 4ED8A 2J6SA 4CO2A 2WBMA 2ROEA 3R1HA 2SXLA 4WU2A 2OPQA 3X3UA 2M0GB 1N5QA 2OSQA 4EEYA 3SSQA 3G8SA 2BJDA 3JTPA 3T5HA 3SEOA 2AGPA 4QIEA 1Z1ZA 2HFNA 4WFNQ 4WYLA 3PHEA 2NUHA 5IXUA 3DRRB 4HT5A 2GJIA 3TR5A 4DS5A 3GFYA 4IR9A 2D1CA 3H2UB 3LAMA 1Y4ZB 4X4OA 2HYIB 2LLZA 1HYSA 5KG7A 2RS2A 3KWMA 3DNCA 1HI1A 1QLNA 3KG0A 3BQ0A 3TI0A 2AYMA 3BN4A 5DLGA 1SL1A 3RTVA 4H4MB 1WTBA 4K50A 4NLDA 1H2UX 3BSAA 1N6QA 2FVPA 2ZHAA 5D78A 5KFZA 2AF6A 5BYSA 2ZH8A 1ZH5A 2MJNA 2KFNA 4YR0A 5IT9Y 4HTJA 2ZE2A 5AJ3F 2ZBIA 2UVUA 3GILA 3R3TA 1T05A 2KHCA 3R5AA 1FKPA 2QEXS 4JI8F 2XLIA 2PMHA 4Q45A 3H5YA 2ZD1B 1YJUA 2CQCA 3LP2A 4P7VA 4DBQA 4EO8A 5KFBA 1ZZNA 3MEEA 2BRKA 1S6PB 3POTB 4OZ5A 2IVFB 1NO8A 5LL6d 4DL6A 2VG7B 2DR5A 4K4TA 2GQQA 3UW1A 3JAMY 3ITHA 2XSFA 1FDNA 2R7XA 1UWBB 1LW2B 1FA0A 1R3NA 2ZHBA 1VIOA 3R27A 4MK7A 4A8FA 1CLFA 4OX9F 4FF4A 3K0JA 5K8PA 5EWEA 2I8EA 5A8RA 3S01A 3DXSX 3OFEA 3OQ2A 4MIWA 5FDLB 1GX5A 4KV8B 1S9EA 3I6PA 1UVJA 3B82A 2GMJA 1CQNA 4ZHRA 1SJ1A 2J9CA 2POKA 4J9SA 4NWBA 4LT6A 3G6ES 2R8HA 1VJWA 4QWAA 2FLNA 4DR5F 4IG3A 2VPXB 4BCAA 2HW3A 2V9KA 1KLMA 1P8GA 2DNZA 3ZZOA 2EBEA 2HNZA 1NB7A 2DR8A 2E1MC 2OPPB 2ZUGA 3NGDA 4RW9A 1T8EA 1JIHA 4WE1A 5BR8F 2FLPA 3MAQA 1WELA 2FC9A 1U45A 3IRXA 5GADU 1LQ9A 1R8AA 4RNOA 2P9EA 2IFXA 4F3MA 1WEYA 4C2MA 4TY8B 2WK4A 1WG4A 3I4HX 2RIJA 4R25A 4IOCQ 4RNNA 4M95A 5L1KA 1QTMA 2IC3B 3QIPB 3THTA 1RTIA 1XWLA 4UQGA 3U02A 4X4RA 4MJKA 1ZTTA 1JJ2R 4Q0BB 2DH8A 3QAUA 4ED1A 1IQTA 2N3LA 3VZIA 2NPIA 3VAHA 2F3JA 4BWJA 2QA1A 4EBCA 3CCUS 3I31A 2L9WA 1BLUA 3OR2B 1KD1T 2OLWA 3QAEA 3CD5A 3CCWA 1WI8A 1YSJA 4RUHA 1CPZA 4NLRA 3PNIA 1N5VA 3DMJA 4DG1A 4IO9Q 3RRHA 1RKIA 1L3KA 3MM6A 3IWNC 4C98A 3BO2A 1SB6A 3JYTA 1S0MA 4WF9Q 2B6AA 4V19X 4KJIA 2XS7A 1NJZA 4I1TA 4EWTA 4C8YA 2GW8A 2RRBA 4WXOA 3TAPA 1URNA 3CJKB 1HWLA 3GR0A 3S7RA 5B7WA 1BC6A 2AJ4A 2B0GA 2VG6B 2ZFHA 2KVIA 3OV7A 1RA7A 1HFEL 2GO8A 1VQ4S 4Y0FA 2YWGA 3VZHA 2RVJA 5CH7B 1U1MA 4O3RA 1UFLA 2DRAA 2EK1A 2UVRA 3CF5Q 1HBUB 1HWKA 2O67A 1EETA 3BREA 3O3LA 4UUWA 5J1NA 4G1QA 3KJVA 3MTKA 4OL8A 2KRBA 1C0TB 4K4YA 5A6WA 4YDXA 1VQ7S 2MQPA 1IUJA 1DURA 3RR8A 4R5PB 1BQXA 1UVIA 2ZC4A 1YI2S 4M5DB 4CO3A 2OFGX 3PIPQ 2YNHB 1CC7A 2RB7A 2ZBCA 5L9NA 3CJ3A 3GFZA 3V81A 1SL2A 5KFSA 2LQJA 4IDKB 4QYRA 4ES3A 3EUNA 4OI3A 4Q44A 4ED7A 2UUTA 2DK2A 3X1LB 4M94A 2M3DA 5F41A 2AU0A 1B64A 2XWYA 2VODA 4OI0A 1H2TZ 1RTHB 4LF7F 3H98A 1L3TA 1SC6A 2DNMA 1TL1B 4DEZA 3NGKA 1SUQB 2VB6A 4RX6A 5E3AA 4IFVA 3MMBB 4DQPA 3AJ1A 3HFKA 2B7BB 2DHAA 2JH3A 3DOLB 2XY5A 4ID5A 4CIOA 1G6BA 1FVQA 3FZ2A 4FP9A 3IAS9 4I67A 3SV3A 2W4DA 2A2CA 2ZOFA 5JVGQ 1V9OA 3GG1A 5J2PA 2OKQA 2ZDPA 5KT6A 3LPYA 1OS5A 2Z8QA 3SCKE 1V3RA 4NA3A 4I64A 1D8YA 2DHGA 4FXWA 4X64F 4HI2A 1C0UA 5A8KB 2FJEB 4YP3A 3D0HE 4TQSA 2F1FA 3BGRB 4ZP6A 4DLEA 2ASDA 2CPJA 3IXQA 2OFHX 1X4EA 1XC9A 3UD4P 2MKIA 4O4GB 1FJ7A 2OPSA 4K4SA 1UJ4A 5M2RA 3VAIA 1FE0A 3PW2A 4QCLA 1GXLA 4NZ0A 3DRRA 4TQRA 3CPWR 3HHLA 2HFOA 2VG5B 2W7AA 4M8LA 1TFYA 2JFKA 2C3MA 2J9EA 4OX8A 5HBMB 3Q8RB 3LP1B 1VGYA 1XNQF 4EZ9A 4F02A 3BGUA 1ZPVA 5D77A 1Q81T 1VS3A 5J2NA 2YX7A 4ED5A 5A2QY 2FVRA 1S7HA 4ZCLA 1X4AA 1WHXA 2O1PA 1X9WA 2ACYA 4ED0A 4LF5F 2QA4S 2GO9A 3KHLA 4IOAQ 1S49A 2YNGB 2DO4A 3DLLQ 5AE2A 2ZH2A 2VBYA 4ATNA 4PPZA 4MKAA 4F2RA 3RRKA 1YBAA 3QGGA 1DZ5A 1X5SA 1CEZA 3LGMA 3M9OB 2DGUA 1S6PA 4EGLA 3PV8A 3OTEA 5EHHA 3OVBA 2JZ5A 4O3PA 5KT5A 1BWEA 2C22A 4DHVA 3BDEA 1UWBA 1LW2A 3BO4A 1IBKF 4ILLA 3OR1B 3MFIA 3D54A 3PRBA 3M32A 5G0RB 1UA0A 2QIFA 1JLGB 4PG8A 3E2EA 2R9LA 1HWUA 1YJRA 2YNIB 5FD1A 2QO3A 4DR3F 2E5GA 1C1CB 2MQQA 3I82A 3OTCA 4FZVA 2R7OA 1U1KA 1AROP 5FDLA 4EZ6A 2EFVA 4YEAA 4QZVB 2YKMB 2EWHA 2DPJA 3AQOA 4K59A 1S1TB 3DRPA 4IOBA 1VMBA 3KLHB 5F8NA 4MKBA 4Y28C 3U1LA 4USHA 2LDYA 3BSOA 4OHWA 3H5UA 1NJIT 5BYRA 4ZS6A 4V19J 2BUNA 4B3TF 3TOQA 3CCSS 2AJ0A 1XERA 3SQGA 7FDRA 2KG0A 2PA3A 1IKWB 4PR6A 5KOWA 4DQSA 1U4BA 3RAQA 3TA2A 2HQIA 4B9VA 3MEGB 3N6LA 4IG0B 3DXBA 1U48A 2MQOA 2DISA 1TAQA 4OI1A 1DTQB 2A18A 2AJQA 5CYQB 3MR2A 4CH0S 3CC4S 1OPIA 1FEEA 4F3OA 2VQFF 4TY8A 1N0UA 3SXLA 2LA6A 3HP6A 3W7BA 1AFJA 4DN0A 2M5YA 2IC3A 3QIPA 1SV5B 4NOHA 3CCES 3SSSA 3ZZTA 1XTZA 3KOAA 4Q0BA 2I0XA 1KVIA 2J6TA 5HMXA 2CQPA 2DIUA 4YB7A 4ELTA 4TKTA 5EN1A 4L3NA 3OSPA 2J76E 3F73A 1KFDA 2RILA 3M2RB 2W25A 1X8DA 3MM7B 3OR2A 3UR3C 1FKAF 5GMKa 2RUGA 4IRDA 4OLPA 4NL5A 3TX8A 2LEAA 4A8QA 2EW9A 3K2YA 1FKOB 3V6HA 1GTHA 3ETOA 2FUG9 2HHPA 2LCWA 4YB6A 3BN7A 4N47A 1X5TA 2M2BA 2DGWA 1Z2LA 3N4WA 2DGSA 2DNKA 1HARA 1R8CA 2GA7A 2QYCA 2V5HG 2J8AA 3WX4A 5F8JA 2RT3A 4TU7A 4OHYA 2V8VA 2ATLA 4Q8EA 4RW4B 4X4TA 3VAKA 1S99A 2VG6A 3MF5A 1WI6A 4PQUB 2HGNA 3V4IB 1M90T 4W92B 3NBPB 4JI4F 2QMWA 2I1RA 2L08A 2NZ4A 3ENWA 1P6TA 5KG1A 1S1WB 4J9NA 4FNIA 3CC2S 2KJWA 3O8WA 5DM6Q 2J0QD 1C0TA 1DQ8A 2IJNA 4NCGB 1X9SA 4F2SA 4B02A 4EFAC 4ZCKA 1RGVA 3B8HA 2ZH5A 1ZPWX 4I6YA 1ZZFA 1HPZB 3W2VB 2XI2A 4USJC 3LW5C 4Q43A 4DL3A 1TK5A 1RT3B 2DH7A 2YNHA 2DHXA 3CJ2A 3KLEA 1FESA 2FIUA 1VQ8S 4NXMF 4IDKA