4KGSA

Backbone modifications in the protein gb1 loops: beta-3-val21, beta-3-asp40
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
54
Chain Sequence
DTYKLILNGKTLKGETTTEADAATAEKVFKQYANDNGVGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
publication title Protein-like Tertiary Folding Behavior from Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
total genus 16
structure length 54
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kgsA00
4OZCA 4MACA 1EM7A 1ZXHA 2LHEA 1MVKA 1MHHE 1UWXA 4GLSC 2NMQA 1XCTL 3UI3A 2PLPA 2JZPA 2J52A 1GB1A 4HKZE 1K51A 3V3XA 1IGDA 2I38A 4IKGA 1D4BA 2IGGA 1MI0A 1FCCC 4D2KA 1PGAA 1HZ6A 3MP9A 2QSDA 4WH4A 4IOIE 1FD6A 2ONQA 2JWUA 1K53A 4HJGE 3FILA 2PTLA 2JXTA 2KQ4X 2ON8A 4KGSA 2I2YA 2KACA 1K50A 5JXVA 1PGXA 2LUMA 1MHXA 1P7FA 2OEDA 2PW9A 2KWDA 2LGIA 2IGDA 1QKZA 1C9FA 2IGHA 4KGRA 5BMGA 1XCQL 1HZ5A 2N7JA 2ZW0A 5HG2A 1IBXB 2EELA 5BMIA 4OZBA 5BMHA 2ZW1A 1P7EA 5HFYA 2KDMA 3FILB 2JSVX 2RMMA 2RPVA 1YNTE 1MPEA 2JU6X 1XF5L 1K52A 2N9LA 2QMTA 2J53A 1KH0A 3GB1A 1IGCA 4OZAA 1HEZE 1Q10A 2LHDA 5HI1A 2KN4A 2K0PA 4KGTA 2GI9A 1YMHE 1FCLA 2GB1A 1IBXA 1JMLA 1PGBA 2N9KA 1GB4A 1F2RC 1F2RI 5HHDG
chains in the Genus database with same CATH superfamily
1TTNA 1EWYC 2N9XA 5KHQA 5AUKA 4RM8A 2KMMA 3EECA 4WQMA 1YQ4B 4A9AA 1YJIA 1ZE3D 4ICUA 4MELA 1I4XA 3DHGC 2NPTB 4F8CB 2RSUA 2Z8LA 2KMAA 3A1QB 3AEEB 1TKGA 2N7EA 3W5VB 3Q3NC 4RF0A 2AQ3B 1ISNA 2KQ4X 3N1YC 3NG0A 4KIKA 1N62A 4XZ4A 1RRBA 1OGWA 1TY2A 1S1QB 1VLBA 1YX5B 4GU2A 1LM8B 3RNCC 3H8HA 2INPE 2IY1B 3ZLZA 1H8CA 1C3TA 2DYBA 2ZW0A 5HG2A 3QWZB 1FXIA 1NEKB 2WDTB 5T8IA 1WGKA 4OZBA 1MG4A 2HJ8A 1Z5SB 3Q3MC 3TBLD 4C80A 3PRMB 1MPEA 3DOWA 3GE8C 3DBLB 4RM9A 4M0WA 3OJ4B 4DXAB 3HVDA 3V6EB 4IWQA 1IGCA 5IP4D 2LEKA 3ZJUA 2VH2A 2LGYA 1JCKB 1V97A 2L8JA 5C1ZA 2CU3A 4MDKE 2D3AA 1EO6A 3U4EG 3SR6A 5C2TB 4RGMA 5AZHA 2MLBA 4EZKA 5C23A 2L0FA 2IO0B 3ZTCA 1ZW7A 1V1OA 2K6DB 4FBJB 4NJCA 2D10A 2Q5WD 2JVCA 1TS2A 4FJYA 4C7ZA 1LO5D 2K9XA 3IT4B 3ZRCA 1D4BA 3BYTB 4D2KA 1LGRA 3VUWA 2KLGA 3UINB 4LDTB 2ON8A 2Z0DB 1WGRA 5JXVA 2G4DB 1FFVA 2WXKA 3VUXA 3QA8A 4K81A 1R4MI 1S3SG 4YTNB 3V61A 1XEEA 2MQJA 3Q2AC 4FHKA 3HM3A 2E3TA 1EU3A 1SXTA 2R61A 1IBXB 4ZDVA 1WJ6A 3T8MA 4GOCA 2ACZB 3MC9A 4LNKA 4P16A 3DBHI 2Z0EB 2UWQA 2RPVA 1R4NI 2EKIA 2K1FA 2N9LA 3BYYB 3FKYA 1NI2A 2W55A 5FR6A 3NVYA 4A8XC 1WXMA 2KJ6A 1DOXA 2C7HA 1SBBB 4PS7A 2J4XA 2JPHA 1V5OA 4W9EA 1XLPA 3IXSA 5AUIA 1FO4A 3M95A 4LLGM 2LGXA 1TGZB 2QHOA 1V81A 1JMLA 1WM2A 4ZRIA 5J17A 2C9WB 3NZUA 2WDRB 1VJKA 4II2B 4US8A 3H6NA 1KOTA 5DPSA 1WRDB 1KTKA 2K3UA 1WR1A 2W3RA 1SB3C 2WXIA 5TR5A 5EE9A 3O65B 2WNMA 3AV8A 3RMKC 5L95C 1OTRB 4L2YA 1L0VB 2HD5B 3SEBA 4FN2A 5CHFA 3PPAA 3NVWA 5I4DA 3H7PA 1WJ4A 3SDLC 1FM0D 2WXLA 3P4RB 3W5UB 4K7WA 1FD6A 3BY4B 3BVGA 3TL5A 1XT9B 5JZEB 1Y56A 3VTUA 1C4PA 1X1MA 4NY0A 1PGXA 4DHZB 2KWDA 3V60A 4MJSB 2IGDA 2JT4B 3ZRFA 3DVGY 4W9DA 3ZGZA 1XCQL 4PS8A 2KVZA 5IO9A 4BKSA 2KFKB 2MRPA 2W9NA 4FJVB 2W82A 4AUQC 4K7SA 1GJZA 2KDEB 1WM3A 4WURA 4XWTA 1ET9A 1WMHB 2MCNB 4FA6A 1YQ3B 2D3GA 2L7RA 1TIFA 4ITKA 4GB9A 3Q14C 1V49A 1EF5A 2DNFA 1WX9A 3DBLI 1ET6A 2HE7A 5LXIB 5EE0A 2LXAA 4ICVA 4KZCA 2DWQA 4HPPA 1D3ZA 2KQSA 3P2BA 1OQRA 4MSQB 3NS1A 3A4SC 4IM0A 1MFWA 3WAMA 4TKNA 4DHJD 1QOAA 3PRPB 1YIWA 2M19A 4WJNA 3IAS1 1WGDA 2WP9B 1MVKA 4HCNB 4B9KA 4G50A 1JWSD 1UWXA 5CHWA 1ENFA 2BYTA 4ARCA 2JZPA 4ANVA 1B9RA 3V3XA 4AOFA 1OFFA 1YJ1A 5IN7A 4MGZE 2HTHA 3AULA 3RZFA 1E5WA 1ZOYB 4GGQA 1ZDVA 2O6VB 3N9YC 2XN9C 3Q3FA 2J0JA 2CJOA 1L0YB 4C56C 2Z59B 4BVUC 3D32A 2L00B 4I6LB 2KX0A 3VH4B 1L5PA 4BBNC 2G45B 1WXQA 4B0MA 5L83A 5J18A 1WXVA 2WXOA 2PE6B 1DOIA 1DYQA 3HM6X 4LJOB 1ZUD2 4HCPB 4BBNF 2L3ZA 5D7GA 1P7EA 1YN5A 3PO0A 2V4LA 2LZ6A 2KFJA 4B6WA 1UWMA 3BIID 1WIAA 1E8YA 2GOWA 4KIKB 5JH5C 1WRIA 4DHZE 1FPYA 3B9JA 5MPOA 4R3DA 1V2YA 2V9HA 2DAFA 1KF6B 4OZAA 4EKUA 3BZDB 2DZJA 2BB6A 1PUTA 2WDQB 3K9OB 3ONSA 4M00A 2MX2A 4M01A 3IAM1 5LXHA 3AMZA 2J7QB 1T0SC 1F2RC 1F2RI 5BYRA 5IA7A 2KN5A 3MHZA 1I35A 4G0NB 4ZYNA 2MBEA 2CHWA 4M8MA 3Q6BA 4TQ0A 2AQ1B 3JW0X 4KKJA 3L08A 3CIRB 1EUVB 3IHPC 1Z2MA 4EZJA 2CKHB 2WXRA 4WIPA 1G6JA 3IT6B 1SE2A 4IM3A 3VR9B 3VTWA 2GBNA 2MJEA 3ZYYX 2C60A 2PTLA 2V1YA 1WGYA 1LFDA 3HRDD 4ASWC 1C76A 2B76B 3PLUA 3M63B 3WALA 2MHJA 2IO3B 3DDCB 4EZLA 1QKZA 4PYUA 2I1JA 2KYWA 2J0MA 1ZGUB 3W9CB 1HZ5A 2KWVB 4LNOA 2ZZPB 2G9HD 2M1MA 4OVZA 2K8CA 3TIXA 3AB5A 1L2NA 1NVID 4GIVA 1JRPA 3RULA 1E9MA 5IKCM 4K3CA 3KYCD 3QC8B 4REZA 1WJNA 2EMTA 2GBRA 1XLNA 1HQRD 3QJZA 2YVCA 5E6JA 5DCNA 2V3NA 2DX5B 3DHIC 4W9IA 3R7RA 2UU7A 3TJPA 2W3SA 1HEZE 1Q10A 3MJWA 2MH7A 2BT6A 2K0PA 2Y5CA 2IPKD 3ZO5B 1AARA 2DZKA 2X8XX 2V3PA 3RNBC 1T3QA 3APCA 1EF1A 1PGBA 3PT2B 1EWCA 3RNEC 1GB4A 3VDZA 4NJ6A 2JX5A 2QC8A 3V05A 1QT9A 1RLFA 1C79A 1UBIA 4XYCA 3QIJA 3KUCB 2K6QA 2KANA 2N9PC 3Q8BA 2N1VA 2NR2A 4PS3A 1CQVA 2NBVB 4KSKC 5CX3A 1J7CA 2INCC 3PHWB 1JWUD 3APFA 3GE3C 4K7UA 2RGFA 3I9V1 3AE6B 3ZUNA 2CU1A 4EEWA 4L23A 3PREA 5FK9C 3I63C 1VR9A 4AJWA 1QQRA 3LXFA 5KHOA 4JGHB 1ZXIA 3AE3B 4ZRQA 2PEAA 5BYQA 1OQYA 3SHQA 4FADA 2LD9A 2IYDB 2N7JA 1D5ZC 2KLCA 3PV1A 1UH6A 2YEPF 3H7PB 1RWSA 3EA6A 2ZW1A 2AYOB 1H4RA 2NVUI 4KZ0A 2VRRB 3BVMA 2KXJA 3ZDMC 4JE3B 2FAZA 3WANA 3W1SA 4N6EB 2K5PA 3RPFC 2YLMA 1C4AA 3C0RB 2V4IB 3PGEA 4HDQA 1GOZA 3P63A 2LHDA 3SD5A 4B95A 3RCZA 3U7ZA 4ZRKA 3OWEB 4WAFA 4BKTA 2RDHA 1ACCA 3VTVA 4J6IA 1N60A 2JY6A 2R2QA 1C1YB 3WA0A 4URKA 2LASA 3N30A 3V6CB 2LJ5A 1Y8RC 5D2MB 1VZ8A 3NZ3A 3R2TA 4HLEA 1V80A 4RH6A 1TS5A 4NPNA 3U52E 1WH3A 3L13A 4DDGD 2BWFA 4DQOC 2IGGA 2LVQA 2HJ1A 1C78A 1CJEA 1QF6A 1K53A 3BK2A 2JXTA 4GDKA 1IYFA 1FNUA 2ZEQA 4I6NB 2QIEB 1YJJA 2OEDA 4II3B 4WQOB 1LXDA 4HEA1 5BYSA 4WWNA 3ZW3A 4HKQA 1GUAB 1YD8U 2KOXA 2BTEA 5D6JB 1STEA 3RT3B 5G5GA 1D6EC 1L6VA 3TMPB 4LNNA 1I4QA 2EELA 4CO7A 1C4CA 5FR3A 4RF1A 5EDSA 2KDMA 2L52A 4UDUC 2WXQA 1C77A 2JU6X 2FNJB 2KC2A 3IVFA 1K52A 1JRUA 2LMCA 2REXA 3AEFB 2OHFA 2J53A 3DVNU 4TSSA 1KH0A 3AE8B 4YTPB 1OEYJ 4EUTA 3TEWA 3RNGC 3CSTA 3NZSA 2MBBB 3GS2A 3TUOA 2BW2A 4FLHA 1RFKA 2PE9A 2ZNVB 3ZIMA 3MC8A 4BZAA 3H1UA 4TUUA 1E8XA 3HVZA 4NQLB 1UBQA 2M17A 3WAOA 3U2SC 1XLQA 3VR8B 2FCSA 2D5GA 2BS3B 1WYWB 4E74A 4A90A 3M62B 3B0AA 4ZHPA 4GLSC 3ZNZB 2GBKA 4US9A 3UI3A 1B1ZA 2LXCA 2L05A 5GXGB 1NENB 2XEWA 4F7ZA 3I3TB 1OEYA 1L0XB 4HPMB 2IZVB 4I6PA 3HK0A 1CZPA 3MP9A 2G1EA 4IW0A 4Q2JA 3EGRA 1CMXB 2BKRB 1UGJA 1TT5B 3CSFA 3VH3B 2KACA 3OJ3A 1K50A 2HDEA 1HTOA 1P7FA 1V8CA 2W54A 1WZ0A 5E6OA 2MP2A 1KRHA 2ICIA 3VVWB 4N9F4 1ZDXA 1BUIC 1AYFA 4EOYA 2KDIA 1QOBA 4MM3B 1KFYB 4WAAA 4P7IA 1WYGA 1A70A 5BMHA 3NOBA 3P42A 2VH1A 3CF6E 3CMMB 3LB8C 3PHXB 1WGGA 1NBFC 2KC1A 2B3AA 4LK0M 4BOSC 1SGHA 1NYRA 2QMTA 3MJ5A 2INDC 1F0ZA 3VXWA 3TEYA 3ABVB 1QOGA 3LYYA 2XK5A 1YMHE 3MHSD 3LJ3A 3DVGX 3LDZE 3Q3OC 2N9KA 3RI7C 3RYTA 2C7NB 1XLOA 1BXTA 3KLSX 3ML8A 2FIDA 3PS6A 2BKFA 3NUHB 4O1NA 1V1PB 2N9EB 2KTRA 4RFBA 1YX6B 2IJ0A 3Q69A 4PT5A 1MG8A 1ESFA 1HZ6A 3SU8X 3ZTDA 3KUDB 1EU4A 5H8YE 5JHAA 4ZHOA 3VHTC 2JWUA 1UNSA 3PZ8A 2WQYB 4NAWA 3PZ7A 1KJTA 1VDVA 4ANXA 2FUG1 2LGDA 4MEMA 2WXPA 4RGOS 4A3OA 5G2NA 4USAA 3OAWA 4MGYE 4IWPA 2KMCA 4LDTD 3ZXVA 2RD0A 4KGRA 2KDFB 3KQ4A 1PFDA 3JSVA 2V0GA 3JVZX 3AEBB 1NI3A 1HE8A 2YEPB 2MJ3A 1FIQA 2M0AA 1NYQA 2AQ2B 2G4SA 4K3BA 1YN4A 5DPWA 1SE3A 3FAHA 3QARA 3V62A 4MGKE 4ANWA 4XDCA 5HI1A 1N5XA 4ACFA 1N6ZA 4ZYSA 1SF0A 3ML9A 4KGTA 2GI9A 1FRRA 2GB1A 1IBXA 1UELA 2ZNVC 3AEDB 1E90A 4OVVA 4JIOU 2IO2B 2CJNA 2DYMA 1SIFA 1IP9A 3ENEA 2DHZA 4HRSA 2LUEA 4GDLA 1PQSA 1P9DU 2H88B 1TY0A 4ZOHC 1JQ4A 3SFEB 3VUYA 3W1YA 2WXFA 1VCBA 4HKZE 3DPDA 3QHTA 4GMVA 4AJYB 1UGMA 1FXAA 1SIJA 1QILA 2CS4A 3U30A 3B08A 2LVOA 3R8BA 1MI0A 2A4ZA 1WX7A 2OJWA 4A3PA 4XDDA 4LNFA 1UF0A 2FE8A 3N3KB 2JXXA 2JYEA 2AL3A 3FILA 1Q0WB 1TS4A 3PLVA 3GZNB 1YN3A 4M0WB 1D5XC 2LUMA 4N59A 1SJHD 3ZNGC 2LVPA 4BAXA 2L76A 1SE4A 3EFCA 3T9LA 4JLCA 3QK0A 1TBEA 2KVRA 1GC6A 4W9CA 4KDIC 1JWMD 4CQNA 1WY8A 2FBWB 2MBHA 3EHVA 2ZCBA 1QOFA 4W9GA 2WXJA 1V9JA 2WWZA 1GNUA 3R3MA 4DDID 3L4PA 4WJQA 3QCAA 1YNTE 2FCNA 4ARIA 2RDGA 3A9KA 3R66C 2PVGC 1RM6C 1FEHA 3MC0B 1YOVB 2CHXA 3I5JC 1T0RC 2D3CA 1RFAA 2KNBA 2ASQA 2WXHA 4C4VA 4MT5A 4C7YA 1SEBD 2TSSA 3RNAC 4YSXB 5DPTA 4HXDA 2DBYA 1E6EB 4E71A 1WWTA 3B2FA 2JUOA 2WDVB 5E6PA 2A5UA 4OVUA 4BFRA 2NCNA 3AE5B 3B1LX 4OZCA 2AX5A 1EM7A 1J8CA 2BVCA 4XE0A 1K8RB 2MW5A 1WMHA 3MTNB 2BF8B 2EKEC 1TZ1A 1WFYA 1KLUD 2JRHA 1R4MB 3KVFB 2PLPA 1P0RA 2FUHB 2KZRA 4OW0A 3UF8A 2K39A 1PGAA 3ZKJC 1L4ZB 4TMAB 3P4PB 1E7PB 2V3SA 3N20C 1JALA 4HJGE 1WE7A 1F1HA 3AM9A 3QQ8B 4RNAA 1V86A 1I4PA 3U7DA 1DGJA 2L0TA 1WZ3A 1R4NB 4HJKA 2O6VD 2JYTA 2NS5A 3ZNID 1Q1OA 1TKYA 2WLBA 1FMAD 2WYQA 4P1BC 1WF9A 2MA9B 3RD2A 4JPSA 2MSED 4GSWA 2KK8A 2FCQA 3EC8A 3FC4A 2NBWB 3KW5B 1L6UA 4LJPB 2PJHA 2J42A 2PKOA 3P4QB 1E10A 3AXCA 3W2DA 2K8HA 1VRAB 1T6BX 2ZPYA 3CWIA 3JYUA 4EE2A 2MP2B 2KO3A 2MJDA 4AWJA 1JROA 5D94A 3DQVA 4W9JA 3RNFC 2GBJA 2DYOA 3WCQA 2KD0A 1I4HA 2INNE 2WXMA 2ZVOA 3A9JA 4DXFA 1J7BA 2AEHA 4WJPA 4S0RA 1M94A 3VRAB 4JWSC 1ZXHA 2AL6A 1PDXA 1KLVA 4LTUA 1XXGA 3URYA 3EUB2 2C7MB 3KH0A 1GB1A 3W1SC 2O2VA 1K51A 1TYGB 4WJOA 1J7AA 4EFOA 3VAWA 4ZRJA 1I7HA 2BWES 4TV3A 2WS3B 2LFIA 4W9KA 2XK5B 4P6VF 1WI0A 2GLSA 3KYDD 1E7UA 4YTMB 1OQQA 2C5LC 1F9JA 3L10B 4YL8A 2UYZB 4KX6B 2WHIA 2DAJA 4IUMB 3ZVVA 3GZNI 2LRWA 1XO3A 3N32A 1WX8A 4RGTA 2H89B 2WXNA 2N4FA 3UGBB 5J2RA 2LGSA 2KTRB 4IWOA 3VRBB 3K9PB 2KQ7A 3IFWB 1A5RA 1J19A 3NHEB 4HWIB 3VFKA 5HFYA 2NTSA 4KDLB 5E6NA 4NAWB 4JWUC 4IDIA 4BOZB 1BMLC 3PSEB 3UQBA 2MWSB 4GXBA 3DCGA 3VQIA 4PYZA 3S2AA 4NZLB 3KWLA 4KSLC 4YXDB 3NJTA 4IG7B 4DHJB 2K22A 2IDYA 3NVVA 5G55A 3ZJTA 2QILA 5LNK1 3MFGA 2PVOD 3JSVB 4LNIA 1TZOA 3GP7A 4YT0B 4DXGA 1P98A 2FCMA 2BBCA 4NQKE 4JQWC 2BGFA 2MEKA 1FXTB 2D3BA 1I4GA 2CR5A 2J52A 1JWBD 2I38A 4XGAB 4AP4C 2QSDA 4IOIE 3UQAA 2GMIC 2ONQA 2JF5A 3HIZA 2ZJDA 2D2QA 1IUEA 3ETRA 4MH0E 3AH7A 2L32A 3C19A 2N0SB 1XQQA 4GDLB 4NNJB 4S17A 2WU5B 5GMVA 3AE9B 3M3JA 3DBRB 4P1CC 3EFUA 1T0QC 2GBMA 3RZWC 3GOEA 5BMGA 2QDFA 4G3XB 2K25A 4XC2A 2NBUA 3BINA 5EE3A 1E0ZA 3DVNV 5IAAC 4KVGB 4TQ1A 3B2GA 3PRZA 2BB5A 1SE9A 2VZKB 3FILB 1I4RA 2BQQA 3AE7B 1XF5L 3TSSA 2RPQA 2KJHB 2NPTA 4A20A 5HKHA 1UUPA 3DBSA 4HK2A 3GB1A 1GC7A 1F77A 3A1QA 3TEZA 4JL9A 4NJ7A 1WJUA 3AI5A 1BT0A 4E3CA 2CHZA 3WAPA 3NS8A 4YWGG 1Q5WB 4ANUA 2BS4B 4A6QA 2WU2B 3HHMA 4MACA 1E8WA 2BS2B 1FNWA 2LHEA 3N1ZC 2PIAA 1V6EA 4BKSD 4FHJA 2EMSA 3ZJVA 3A9KB 3IG3A 3I57A 1ZP0B 2DZIA 4WWPA 1IGDA 2MBQA 2K8BA 3UIPB 5AZGA 4K1RB 1CK1A 2KX3A 4C4VB 1WR6E 4XX5A 3UIOB 2L1AA 1M4VA 5BO4B 3PVLA 1T5XD 1WXAA 3IBEA 3Q8EA 4KGSA 3DWMA 2R2OA 3AN1A 4YSZB 2FIFA 5AZFA 3NVZA 1MHXA 4C00A 4F1SA 2PW9A 3RN9C 1JW9D 5G5HA 3RFZB 2OJRA 2KHWB 2IGHA 2IY0B 3BWUD 4IM2A 4FULA 1UD7A 3L16A 2D11A 2DLBA 4LCDE 4WWMA 4CYEA 4MGIE 4PK1A 1U4AA 2JSVX 2OOBB 1AWDA 4CHKA 1HA5A 4MH8A 2QJLA 5IOIA 1HXYD 1GPXA 2J0KA 4QAYA 3U8ZA 1YQBA 1FRDA 4AS1A 2GRIA 1NDDA 2IBIB 4RCOA 4ZRPA 4FJZA 5JHBA 4AQ7A 2D07B 3DWGC 1FCLA 3AE4B 4WWOA 4DBGA 1HTQA 3R2IA 2KTFA 4HDOA 1WSPA 5HHDG 2L83A 4HROA 1P3QU 1V5TA 4N58A 1P1AA 4B0EA 2JQRB 4RGNA 2DENB 1XCTL 1JWAD 3AEAB 2I1KA 1RYJA 2M4NA 2NTTA 5D3DA 4IKGA 3L0WB 1J0GA 1QZEA 1FCCC 3X0WA 1FFUA 3ZDTA 2Y3AA 1DOYA 3QAQA 3A33B 3J9CA 2Y5BB 3C8YA 1D5MC 1LQBA 1VZ7A 4L1BA 4W9HA 3A9JB 2HTME 2I2YA 3KWVA 2KKCA 2M56B 2WGSA 1QLBB 1N63A 3Q8CA 2WXGA 1VZ6A 3ZXRA 2XBBC 1WXSA 2SEBD 4GN1A 4W9FA 1FNVA 1F52A 2O2VB 4RMAA 3DBRI 3A4RA 2VZKD 2KT7A 4DWFA 4FXCA 4X57B 2KAJA 2M0XA 3O13A 2QCZA 4JX1C 3OLMD 4M02A 1KLGD 1SJED 3NY5A 3QX1A 3L17A 2RDBC 2JZZA 2MBOA 3ZQ4A 2N7DA 3BVZA 1I42A 2KJRA 1N5WA 3AE1B 1T0YA 3ALBA 3P4SB 1AN8A 1IPGA 4XWWA 3R7QA 3HUIA 2KN4A 2X38A 1R7SA 4MM3A 5C3JB 3AEGB 2LRUA 4KV2A 2WX1A 4GDKB 4DK5A 1ROEA 2G3QB 1WGHA 4IC7B 2BYFA 4G11A 3E9SA 4OHJA 3ZNHB 4MJSA 1MHHE 2NMQA 2M8SA 3DHHC 1ZKHA 5CHVC 3T3NA 3OG5A 3RUIB 3ECIA 3PZDA 2ZCCA 4YSYB 1XD3B 3KUZA 3BK1A 2JRIB 5AEKB 1KM7A 1MJDA 3Q8FA 1GG3A 3AECB 2DZMA 2KFKA 1TKEA 3H7SA 1PYWD 5H92C 4H2AA 5TSSA 3H9DA 2BPSA 2N1WA 3E56A 4NAMA 4WH4A 3AE2B 3AU4A 5EE1A 2ZVNA 5D3IB 2AWTA 2SAKA 2LWPA 2QEJC 4HPLB 1E8ZA 2LGIA 1AW7A 1SSNA 1VD2A 3N1XC 4KKIA 1V1PA 2IO1B 2PMVA 1C9FA 3T3OA 1WE6A 2KDBA 4M8NA 5CTRC 2BYVE 2KWUB 3TCAA 5BMIA 1N61A 3Q8AA 3DBHB 1UZXB 2RR9A 1TJEA 2ZPNA 5LLIA 4J3OD 1E7VA 3X23A 3NRZA 5FKAC 2RMMA 3TEXA 3PTFC 4BKGA 5DPRA 3AU5A 4HVBA 2Y5PA 1L7YA 2LI5A 2KWCA 1ZPSA 2E6XA 4A55A 2BYEA 3WIMA 1L4DB 3Q3JA 3APDA 2PPHA 2WX0A 4W9LA 4MSMB 3P1MA 2O6VA 3SFDB 3L54A 1RAXA 2JZ3B 1TS3A 2JWZA 2XNAC 1GAQB 2LJIA
chains in the Genus database with same CATH topology
1EWYC 5AUKA 1XLOA 1BXTA 3KLSX 2KMMA 3MHZA 4WQMA 1YQ4B 4A9AA 1YJIA 2MEKA 1ZE3D 3NUHB 4O1NA 4TQ0A 2AQ1B 1I4GA 1I4XA 1V1PB 4KKJA 3CIRB 2J52A 4RFBA 2IJ0A 3Q69A 1JWBD 2Z8LA 2I38A 4PT5A 2WXRA 3AEEB 1ESFA 4WIPA 1TKGA 3IT6B 3W5VB 1SE2A 3VR9B 4RF0A 1HZ6A 2MJEA 2QSDA 4IOIE 3ZYYX 1EU4A 2ONQA 5H8YE 4ZHOA 2JWUA 2AQ3B 1UNSA 3PZ8A 2WQYB 2PTLA 2KQ4X 3PZ7A 3HRDD 1C76A 1VDVA 2B76B 2FUG1 1IUEA 1N62A 2WXPA 3ETRA 1TY2A 3AH7A 2L32A 2N0SB 1VLBA 4GDLB 4RGOS 4USAA 3H8HA 2WU5B 2INPE 1QKZA 3AE9B 4KGRA 5BMGA 3W9CB 1HZ5A 3KQ4A 2ZW0A 5HG2A 2G9HD 4OVZA 1PFDA 5EE3A 2V0GA 1E0ZA 1FXIA 1NEKB 5T8IA 1WGKA 4OZBA 4TQ1A 3AEBB 3B2GA 1NI3A 2YEPB 2MJ3A 3AB5A 1FIQA 1NVID 2BB5A 4C80A 1JRPA 1E9MA 2VZKB 3FILB 4REZA 1I4RA 2M0AA 1MPEA 1NYQA 2AQ2B 3AE7B 1XLNA 1XF5L 3TSSA 1YN4A 1HQRD 4M0WA 1SE3A 1UUPA 5E6JA 3HVDA 3FAHA 2V3NA 3GB1A 1F77A 1IGCA 3TEZA 2W3SA 4XDCA 2LEKA 3ZJUA 1HEZE 1Q10A 1N5XA 5HI1A 2MH7A 2BT6A 2K0PA 2Y5CA 1JCKB 1V97A 4ZYSA 2IPKD 1SF0A 2CU3A 4KGTA 2GI9A 1FRRA 2V3PA 2GB1A 1IBXA 1T3QA 3AEDB 4YWGG 3U4EG 3SR6A 5C2TB 4RGMA 2BS4B 1PGBA 4A6QA 1EWCA 1GB4A 2CJNA 2WU2B 2DYMA 4MACA 2BS2B 1FNWA 2JX5A 2LHEA 4HRSA 3V05A 1QT9A 1V1OA 2PIAA 4NJCA 1C79A 2H88B 1TY0A 2Q5WD 3ZJVA 1TS2A 4ZOHC 4C7ZA 1JQ4A 3SFEB 1LO5D 3I57A 1ZP0B 2WXFA 3Q8BA 4HKZE 2K9XA 1IGDA 1FXAA 1SIJA 1CQVA 1QILA 3IT4B 1D4BA 3R8BA 1MI0A 1CK1A 3BYTB 4D2KA 1J7CA 1JWUD 4XDDA 2L1AA 1M4VA 2FE8A 2JYEA 3FILA 3I9V1 3AE6B 1TS4A 4L23A 5FK9C 1T5XD 1YN3A 2ON8A 3Q8EA 4KGSA 3DWMA 3AN1A 1VR9A 4YSZB 5JXVA 3NVZA 1D5XC 1FFVA 1QQRA 2LUMA 1MHXA 1SJHD 2WXKA 3LXFA 4N59A 2PW9A 1ZXIA 1JW9D 3AE3B 5G5HA 4ZRQA 3RFZB 1SE4A 5BYQA 4YTNB 1XEEA 2IGHA 1JWMD 4CQNA 2FBWB 2N7JA 1EU3A 2E3TA 1D5ZC 1SXTA 3BWUD 2R61A 1IBXB 1QOFA 2YEPF 1RWSA 2WXJA 3EA6A 2ZW1A 2ACZB 2DLBA 3BVMA 3L4PA 4WWMA 4JE3B 4P16A 2JSVX 1AWDA 1YNTE 2EKIA 2RPVA 4ARIA 1HA5A 2RDGA 4MH8A 2QJLA 3W1SA 4N6EB 1HXYD 2N9LA 2K5PA 3RPFC 3BYYB 1GPXA 2PVGC 1C4AA 1RM6C 2W55A 4A8XC 2V4IB 3NVYA 1FRDA 4AS1A 1DOXA 1FEHA 1SBBB 3MC0B 2GRIA 1GOZA 3P63A 2J4XA 4RCOA 2LHDA 4ZRPA 2WXHA 4MT5A 4C7YA 4AQ7A 1XLPA 3IXSA 1SEBD 2TSSA 5AUIA 3U7ZA 4YSXB 1FO4A 4LLGM 2DBYA 3DWGC 1E6EB 3OWEB 4WAFA 1FCLA 3AE4B 2RDHA 1ACCA 1JMLA 1N60A 1WWTA 3B2FA 2WDVB 3AE5B 3R2IA 1WSPA 5HHDG 2L83A 4HROA 4OZCA 2AX5A 1EM7A 4N58A 2WDRB 1VJKA 4US8A 4B0EA 4XE0A 2JQRB 1KTKA 4RGNA 2K3UA 1XCTL 1JWAD 1KLUD 2W3RA 3AEAB 1VZ8A 3NZ3A 3R2TA 1SB3C 2PLPA 4RH6A 1TS5A 2WXIA 5EE9A 3U52E 1RYJA 2WNMA 2NTTA 3AV8A 4L2YA 1L0VB 5D3DA 3SEBA 4IKGA 4OW0A 3NVWA 4DQOC 5I4DA 2IGGA 1FCCC 1PGAA 1FM0D 2WXLA 3P4RB 1L4ZB 4TMAB 1C78A 1FFUA 3P4PB 3W5UB 2Y3AA 1E7PB 1CJEA 1QF6A 1FD6A 1JALA 3BVGA 1DOYA 1K53A 4HJGE 3BK2A 3J9CA 2JXTA 3AM9A 4RNAA 3C8YA 1D5MC 1VZ7A 1I4PA 4L1BA 1Y56A 1FNUA 1C4PA 2HTME 2I2YA 3KWVA 1DGJA 2QIEB 1YJJA 1PGXA 2M56B 2OEDA 2KWDA 1QLBB 4HEA1 5BYSA 2IGDA 1N63A 2JYTA 3Q8CA 2WXGA 1VZ6A 4HKQA 3ZGZA 2BTEA 2SEBD 1TKYA 1XCQL 1STEA 2WLBA 1FMAD 1FNVA 5G5GA 1D6EC 1L6VA 2VZKD 4FXCA 1I4QA 2EELA 1C4CA 2KAJA 4JPSA 5FR3A 3O13A 3FC4A 4JX1C 2W82A 1KLGD 4RF1A 2KDMA 1L6UA 1SJED 2L52A 4UDUC 2PKOA 2J42A 3P4QB 1E10A 2WXQA 4WURA 1C77A 2JU6X 3W2DA 1VRAB 4XWTA 1ET9A 1K52A 2LMCA 1YQ3B 3ZQ4A 3AEFB 2OHFA 2J53A 4TSSA 4ITKA 1KH0A 3BVZA 1T6BX 3AE8B 3CWIA 4YTPB 1N5WA 3AE1B 3TEWA 4EE2A 1ET6A 3P4SB 1AN8A 4XWWA 2MJDA 3GS2A 3TUOA 3HUIA 2BW2A 2KN4A 1RFKA 5EE0A 2X38A 1R7SA 1JROA 5C3JB 2DYOA 3AEGB 3WCQA 1I4HA 2DWQA 2INNE 2WXMA 3HVZA 1OQRA 3NS1A 4GDKB 1ROEA 3U2SC 1XLQA 3VR8B 1QOAA 1J7BA 4DXFA 2M19A 3VRAB 3IAS1 4JWSC 1ZXHA 2BS3B 2D5GA 2WP9B 1MVKA 1PDXA 3E9SA 4OHJA 4A90A 4ZHPA 1MHHE 1JWSD 4LTUA 1UWXA 4GLSC 1XXGA 2NMQA 3URYA 1ENFA 3EUB2 2BYTA 4US9A 3UI3A 3T3NA 1B1ZA 2JZPA 4ARCA 4YSYB 1B9RA 1GB1A 5GXGB 1NENB 1K51A 1TYGB 3V3XA 1OFFA 3BK1A 1J7AA 3Q8FA 1I7HA 1L0XB 3AECB 1ZOYB 2WS3B 1TKEA 1ZDVA 1PYWD 2LFIA 5H92C 4H2AA 5TSSA 1CZPA 3MP9A 2G1EA 4P6VF 3N9YC 2XN9C 3E56A 4NAMA 4WH4A 4Q2JA 4YTMB 1OQQA 3AE2B 3EGRA 5EE1A 2CJOA 1UGJA 4KX6B 1L0YB 4C56C 5D3IB 2KACA 1K50A 2HDEA 2SAKA 1XO3A 2QEJC 1P7FA 1V8CA 2W54A 2LGIA 1L5PA 4RGTA 2H89B 1AW7A 1SSNA 1KRHA 2ICIA 4KKIA 1WXQA 1V1PA 2WXNA 1ZDXA 4B0MA 1BUIC 2PMVA 1C9FA 2WXOA 1AYFA 3T3OA 3VRBB 1QOBA 4MM3B 1KFYB 1DOIA 1DYQA 1ZUD2 1WYGA 1A70A 1N61A 5BMIA 5BMHA 3Q8AA 5D7GA 3P42A 1P7EA 1YN5A 5HFYA 1TJEA 2NTSA 3LB8C 3PO0A 4J3OD 3NRZA 5FKAC 2RMMA 4NAWB 3TEXA 1UWMA 4JWUC 3BIID 4IDIA 4LK0M 1NYRA 2QMTA 1BMLC 2Y5PA 1WRIA 3B9JA 3MJ5A 5MPOA 3VQIA 1ZPSA 2E6XA 4R3DA 4A55A 1L4DB 4NZLB 1KF6B 3KWLA 4OZAA 4YXDB 1F0ZA 3BZDB 3TEYA 2K22A 3ABVB 2BB6A 1PUTA 2WDQB 1QOGA 3LYYA 3P1MA 2IDYA 3NVVA 3IAM1 3ZJTA 3SFDB 3AMZA 2QILA 1YMHE 5LNK1 3MFGA 2PVOD 1TS3A 1TZOA 3GP7A 4YT0B 2N9KA 4DXGA 2XNAC 1GAQB 2LJIA 1F2RC 1F2RI 5BYRA 2BBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZC A;  4MAC A;  1EM7 A;  1ZXH A;  2LHE A;  1MVK A;  1MHH E;  1UWX A;  4GLS C;  2NMQ A;  1XCT L;  3UI3 A;  2PLP A;  2JZP A;  2J52 A;  1GB1 A;  4HKZ E;  1K51 A;  3V3X A;  1IGD A;  2I38 A;  4IKG A;  1D4B A;  2IGG A;  1MI0 A;  1FCC C;  4D2K A;  1PGA A;  1HZ6 A;  3MP9 A;  2QSD A;  4WH4 A;  4IOI E;  1FD6 A;  2ONQ A;  2JWU A;  1K53 A;  4HJG E;  3FIL A;  2PTL A;  2JXT A;  2KQ4 X;  2ON8 A;  4KGS A;  2I2Y A;  2KAC A;  1K50 A;  5JXV A;  1PGX A;  2LUM A;  1MHX A;  1P7F A;  2OED A;  2PW9 A;  2KWD A;  2LGI A;  2IGD A;  1QKZ A;  1C9F A;  2IGH A;  4KGR A;  5BMG A;  1XCQ L;  1HZ5 A;  2N7J A;  2ZW0 A;  5HG2 A;  1IBX B;  2EEL A;  5BMI A;  4OZB A;  5BMH A;  2ZW1 A;  1P7E A;  5HFY A;  2KDM A;  3FIL B;  2JSV X;  2RMM A;  2RPV A;  1YNT E;  1MPE A;  2JU6 X;  1XF5 L;  1K52 A;  2N9L A;  2QMT A;  2J53 A;  1KH0 A;  3GB1 A;  1IGC A;  4OZA A;  1HEZ E;  1Q10 A;  2LHD A;  5HI1 A;  2KN4 A;  2K0P A;  4KGT A;  2GI9 A;  1YMH E;  1FCL A;  2GB1 A;  1IBX A;  1JML A;  1PGB A;  2N9K A;  1GB4 A;  1F2R C;  1F2R I;  5HHD G; 
#chains in the Genus database with same CATH topology
 1TTN A;  1EWY C;  2N9X A;  5KHQ A;  5AUK A;  4RM8 A;  2KMM A;  3EEC A;  4WQM A;  1YQ4 B;  4A9A A;  1YJI A;  1ZE3 D;  4ICU A;  4MEL A;  1I4X A;  3DHG C;  2NPT B;  4F8C B;  2RSU A;  2Z8L A;  2KMA A;  3A1Q B;  3AEE B;  1TKG A;  2N7E A;  3W5V B;  3Q3N C;  4RF0 A;  2AQ3 B;  1ISN A;  2KQ4 X;  3N1Y C;  3NG0 A;  4KIK A;  1N62 A;  4XZ4 A;  1RRB A;  1OGW A;  1TY2 A;  1S1Q B;  1VLB A;  1YX5 B;  4GU2 A;  1LM8 B;  3RNC C;  3H8H A;  2INP E;  2IY1 B;  3ZLZ A;  1H8C A;  1C3T A;  2DYB A;  2ZW0 A;  5HG2 A;  3QWZ B;  1FXI A;  1NEK B;  2WDT B;  5T8I A;  1WGK A;  4OZB A;  1MG4 A;  2HJ8 A;  1Z5S B;  3Q3M C;  3TBL D;  4C80 A;  3PRM B;  1MPE A;  3DOW A;  3GE8 C;  3DBL B;  4RM9 A;  4M0W A;  3OJ4 B;  4DXA B;  3HVD A;  3V6E B;  4IWQ A;  1IGC A;  5IP4 D;  2LEK A;  3ZJU A;  2VH2 A;  2LGY A;  1JCK B;  1V97 A;  2L8J A;  5C1Z A;  2CU3 A;  4MDK E;  2D3A A;  1EO6 A;  3U4E G;  3SR6 A;  5C2T B;  4RGM A;  5AZH A;  2MLB A;  4EZK A;  5C23 A;  2L0F A;  2IO0 B;  3ZTC A;  1ZW7 A;  1V1O A;  2K6D B;  4FBJ B;  4NJC A;  2D10 A;  2Q5W D;  2JVC A;  1TS2 A;  4FJY A;  4C7Z A;  1LO5 D;  2K9X A;  3IT4 B;  3ZRC A;  1D4B A;  3BYT B;  4D2K A;  1LGR A;  3VUW A;  2KLG A;  3UIN B;  4LDT B;  2ON8 A;  2Z0D B;  1WGR A;  5JXV A;  2G4D B;  1FFV A;  2WXK A;  3VUX A;  3QA8 A;  4K81 A;  1R4M I;  1S3S G;  4YTN B;  3V61 A;  1XEE A;  2MQJ A;  3Q2A C;  4FHK A;  3HM3 A;  2E3T A;  1EU3 A;  1SXT A;  2R61 A;  1IBX B;  4ZDV A;  1WJ6 A;  3T8M A;  4GOC A;  2ACZ B;  3MC9 A;  4LNK A;  4P16 A;  3DBH I;  2Z0E B;  2UWQ A;  2RPV A;  1R4N I;  2EKI A;  2K1F A;  2N9L A;  3BYY B;  3FKY A;  1NI2 A;  2W55 A;  5FR6 A;  3NVY A;  4A8X C;  1WXM A;  2KJ6 A;  1DOX A;  2C7H A;  1SBB B;  4PS7 A;  2J4X A;  2JPH A;  1V5O A;  4W9E A;  1XLP A;  3IXS A;  5AUI A;  1FO4 A;  3M95 A;  4LLG M;  2LGX A;  1TGZ B;  2QHO A;  1V81 A;  1JML A;  1WM2 A;  4ZRI A;  5J17 A;  2C9W B;  3NZU A;  2WDR B;  1VJK A;  4II2 B;  4US8 A;  3H6N A;  1KOT A;  5DPS A;  1WRD B;  1KTK A;  2K3U A;  1WR1 A;  2W3R A;  1SB3 C;  2WXI A;  5TR5 A;  5EE9 A;  3O65 B;  2WNM A;  3AV8 A;  3RMK C;  5L95 C;  1OTR B;  4L2Y A;  1L0V B;  2HD5 B;  3SEB A;  4FN2 A;  5CHF A;  3PPA A;  3NVW A;  5I4D A;  3H7P A;  1WJ4 A;  3SDL C;  1FM0 D;  2WXL A;  3P4R B;  3W5U B;  4K7W A;  1FD6 A;  3BY4 B;  3BVG A;  3TL5 A;  1XT9 B;  5JZE B;  1Y56 A;  3VTU A;  1C4P A;  1X1M A;  4NY0 A;  1PGX A;  4DHZ B;  2KWD A;  3V60 A;  4MJS B;  2IGD A;  2JT4 B;  3ZRF A;  3DVG Y;  4W9D A;  3ZGZ A;  1XCQ L;  4PS8 A;  2KVZ A;  5IO9 A;  4BKS A;  2KFK B;  2MRP A;  2W9N A;  4FJV B;  2W82 A;  4AUQ C;  4K7S A;  1GJZ A;  2KDE B;  1WM3 A;  4WUR A;  4XWT A;  1ET9 A;  1WMH B;  2MCN B;  4FA6 A;  1YQ3 B;  2D3G A;  2L7R A;  1TIF A;  4ITK A;  4GB9 A;  3Q14 C;  1V49 A;  1EF5 A;  2DNF A;  1WX9 A;  3DBL I;  1ET6 A;  2HE7 A;  5LXI B;  5EE0 A;  2LXA A;  4ICV A;  4KZC A;  2DWQ A;  4HPP A;  1D3Z A;  2KQS A;  3P2B A;  1OQR A;  4MSQ B;  3NS1 A;  3A4S C;  4IM0 A;  1MFW A;  3WAM A;  4TKN A;  4DHJ D;  1QOA A;  3PRP B;  1YIW A;  2M19 A;  4WJN A;  3IAS 1;  1WGD A;  2WP9 B;  1MVK A;  4HCN B;  4B9K A;  4G50 A;  1JWS D;  1UWX A;  5CHW A;  1ENF A;  2BYT A;  4ARC A;  2JZP A;  4ANV A;  1B9R A;  3V3X A;  4AOF A;  1OFF A;  1YJ1 A;  5IN7 A;  4MGZ E;  2HTH A;  3AUL A;  3RZF A;  1E5W A;  1ZOY B;  4GGQ A;  1ZDV A;  2O6V B;  3N9Y C;  2XN9 C;  3Q3F A;  2J0J A;  2CJO A;  1L0Y B;  4C56 C;  2Z59 B;  4BVU C;  3D32 A;  2L00 B;  4I6L B;  2KX0 A;  3VH4 B;  1L5P A;  4BBN C;  2G45 B;  1WXQ A;  4B0M A;  5L83 A;  5J18 A;  1WXV A;  2WXO A;  2PE6 B;  1DOI A;  1DYQ A;  3HM6 X;  4LJO B;  1ZUD 2;  4HCP B;  4BBN F;  2L3Z A;  5D7G A;  1P7E A;  1YN5 A;  3PO0 A;  2V4L A;  2LZ6 A;  2KFJ A;  4B6W A;  1UWM A;  3BII D;  1WIA A;  1E8Y A;  2GOW A;  4KIK B;  5JH5 C;  1WRI A;  4DHZ E;  1FPY A;  3B9J A;  5MPO A;  4R3D A;  1V2Y A;  2V9H A;  2DAF A;  1KF6 B;  4OZA A;  4EKU A;  3BZD B;  2DZJ A;  2BB6 A;  1PUT A;  2WDQ B;  3K9O B;  3ONS A;  4M00 A;  2MX2 A;  4M01 A;  3IAM 1;  5LXH A;  3AMZ A;  2J7Q B;  1T0S C;  1F2R C;  1F2R I;  5BYR A;  5IA7 A;  2KN5 A;  3MHZ A;  1I35 A;  4G0N B;  4ZYN A;  2MBE A;  2CHW A;  4M8M A;  3Q6B A;  4TQ0 A;  2AQ1 B;  3JW0 X;  4KKJ A;  3L08 A;  3CIR B;  1EUV B;  3IHP C;  1Z2M A;  4EZJ A;  2CKH B;  2WXR A;  4WIP A;  1G6J A;  3IT6 B;  1SE2 A;  4IM3 A;  3VR9 B;  3VTW A;  2GBN A;  2MJE A;  3ZYY X;  2C60 A;  2PTL A;  2V1Y A;  1WGY A;  1LFD A;  3HRD D;  4ASW C;  1C76 A;  2B76 B;  3PLU A;  3M63 B;  3WAL A;  2MHJ A;  2IO3 B;  3DDC B;  4EZL A;  1QKZ A;  4PYU A;  2I1J A;  2KYW A;  2J0M A;  1ZGU B;  3W9C B;  1HZ5 A;  2KWV B;  4LNO A;  2ZZP B;  2G9H D;  2M1M A;  4OVZ A;  2K8C A;  3TIX A;  3AB5 A;  1L2N A;  1NVI D;  4GIV A;  1JRP A;  3RUL A;  1E9M A;  5IKC M;  4K3C A;  3KYC D;  3QC8 B;  4REZ A;  1WJN A;  2EMT A;  2GBR A;  1XLN A;  1HQR D;  3QJZ A;  2YVC A;  5E6J A;  5DCN A;  2V3N A;  2DX5 B;  3DHI C;  4W9I A;  3R7R A;  2UU7 A;  3TJP A;  2W3S A;  1HEZ E;  1Q10 A;  3MJW A;  2MH7 A;  2BT6 A;  2K0P A;  2Y5C A;  2IPK D;  3ZO5 B;  1AAR A;  2DZK A;  2X8X X;  2V3P A;  3RNB C;  1T3Q A;  3APC A;  1EF1 A;  1PGB A;  3PT2 B;  1EWC A;  3RNE C;  1GB4 A;  3VDZ A;  4NJ6 A;  2JX5 A;  2QC8 A;  3V05 A;  1QT9 A;  1RLF A;  1C79 A;  1UBI A;  4XYC A;  3QIJ A;  3KUC B;  2K6Q A;  2KAN A;  2N9P C;  3Q8B A;  2N1V A;  2NR2 A;  4PS3 A;  1CQV A;  2NBV B;  4KSK C;  5CX3 A;  1J7C A;  2INC C;  3PHW B;  1JWU D;  3APF A;  3GE3 C;  4K7U A;  2RGF A;  3I9V 1;  3AE6 B;  3ZUN A;  2CU1 A;  4EEW A;  4L23 A;  3PRE A;  5FK9 C;  3I63 C;  1VR9 A;  4AJW A;  1QQR A;  3LXF A;  5KHO A;  4JGH B;  1ZXI A;  3AE3 B;  4ZRQ A;  2PEA A;  5BYQ A;  1OQY A;  3SHQ A;  4FAD A;  2LD9 A;  2IYD B;  2N7J A;  1D5Z C;  2KLC A;  3PV1 A;  1UH6 A;  2YEP F;  3H7P B;  1RWS A;  3EA6 A;  2ZW1 A;  2AYO B;  1H4R A;  2NVU I;  4KZ0 A;  2VRR B;  3BVM A;  2KXJ A;  3ZDM C;  4JE3 B;  2FAZ A;  3WAN A;  3W1S A;  4N6E B;  2K5P A;  3RPF C;  2YLM A;  1C4A A;  3C0R B;  2V4I B;  3PGE A;  4HDQ A;  1GOZ A;  3P63 A;  2LHD A;  3SD5 A;  4B95 A;  3RCZ A;  3U7Z A;  4ZRK A;  3OWE B;  4WAF A;  4BKT A;  2RDH A;  1ACC A;  3VTV A;  4J6I A;  1N60 A;  2JY6 A;  2R2Q A;  1C1Y B;  3WA0 A;  4URK A;  2LAS A;  3N30 A;  3V6C B;  2LJ5 A;  1Y8R C;  5D2M B;  1VZ8 A;  3NZ3 A;  3R2T A;  4HLE A;  1V80 A;  4RH6 A;  1TS5 A;  4NPN A;  3U52 E;  1WH3 A;  3L13 A;  4DDG D;  2BWF A;  4DQO C;  2IGG A;  2LVQ A;  2HJ1 A;  1C78 A;  1CJE A;  1QF6 A;  1K53 A;  3BK2 A;  2JXT A;  4GDK A;  1IYF A;  1FNU A;  2ZEQ A;  4I6N B;  2QIE B;  1YJJ A;  2OED A;  4II3 B;  4WQO B;  1LXD A;  4HEA 1;  5BYS A;  4WWN A;  3ZW3 A;  4HKQ A;  1GUA B;  1YD8 U;  2KOX A;  2BTE A;  5D6J B;  1STE A;  3RT3 B;  5G5G A;  1D6E C;  1L6V A;  3TMP B;  4LNN A;  1I4Q A;  2EEL A;  4CO7 A;  1C4C A;  5FR3 A;  4RF1 A;  5EDS A;  2KDM A;  2L52 A;  4UDU C;  2WXQ A;  1C77 A;  2JU6 X;  2FNJ B;  2KC2 A;  3IVF A;  1K52 A;  1JRU A;  2LMC A;  2REX A;  3AEF B;  2OHF A;  2J53 A;  3DVN U;  4TSS A;  1KH0 A;  3AE8 B;  4YTP B;  1OEY J;  4EUT A;  3TEW A;  3RNG C;  3CST A;  3NZS A;  2MBB B;  3GS2 A;  3TUO A;  2BW2 A;  4FLH A;  1RFK A;  2PE9 A;  2ZNV B;  3ZIM A;  3MC8 A;  4BZA A;  3H1U A;  4TUU A;  1E8X A;  3HVZ A;  4NQL B;  1UBQ A;  2M17 A;  3WAO A;  3U2S C;  1XLQ A;  3VR8 B;  2FCS A;  2D5G A;  2BS3 B;  1WYW B;  4E74 A;  4A90 A;  3M62 B;  3B0A A;  4ZHP A;  4GLS C;  3ZNZ B;  2GBK A;  4US9 A;  3UI3 A;  1B1Z A;  2LXC A;  2L05 A;  5GXG B;  1NEN B;  2XEW A;  4F7Z A;  3I3T B;  1OEY A;  1L0X B;  4HPM B;  2IZV B;  4I6P A;  3HK0 A;  1CZP A;  3MP9 A;  2G1E A;  4IW0 A;  4Q2J A;  3EGR A;  1CMX B;  2BKR B;  1UGJ A;  1TT5 B;  3CSF A;  3VH3 B;  2KAC A;  3OJ3 A;  1K50 A;  2HDE A;  1HTO A;  1P7F A;  1V8C A;  2W54 A;  1WZ0 A;  5E6O A;  2MP2 A;  1KRH A;  2ICI A;  3VVW B;  4N9F 4;  1ZDX A;  1BUI C;  1AYF A;  4EOY A;  2KDI A;  1QOB A;  4MM3 B;  1KFY B;  4WAA A;  4P7I A;  1WYG A;  1A70 A;  5BMH A;  3NOB A;  3P42 A;  2VH1 A;  3CF6 E;  3CMM B;  3LB8 C;  3PHX B;  1WGG A;  1NBF C;  2KC1 A;  2B3A A;  4LK0 M;  4BOS C;  1SGH A;  1NYR A;  2QMT A;  3MJ5 A;  2IND C;  1F0Z A;  3VXW A;  3TEY A;  3ABV B;  1QOG A;  3LYY A;  2XK5 A;  1YMH E;  3MHS D;  3LJ3 A;  3DVG X;  3LDZ E;  3Q3O C;  2N9K A;  3RI7 C;  3RYT A;  2C7N B;  1XLO A;  1BXT A;  3KLS X;  3ML8 A;  2FID A;  3PS6 A;  2BKF A;  3NUH B;  4O1N A;  1V1P B;  2N9E B;  2KTR A;  4RFB A;  1YX6 B;  2IJ0 A;  3Q69 A;  4PT5 A;  1MG8 A;  1ESF A;  1HZ6 A;  3SU8 X;  3ZTD A;  3KUD B;  1EU4 A;  5H8Y E;  5JHA A;  4ZHO A;  3VHT C;  2JWU A;  1UNS A;  3PZ8 A;  2WQY B;  4NAW A;  3PZ7 A;  1KJT A;  1VDV A;  4ANX A;  2FUG 1;  2LGD A;  4MEM A;  2WXP A;  4RGO S;  4A3O A;  5G2N A;  4USA A;  3OAW A;  4MGY E;  4IWP A;  2KMC A;  4LDT D;  3ZXV A;  2RD0 A;  4KGR A;  2KDF B;  3KQ4 A;  1PFD A;  3JSV A;  2V0G A;  3JVZ X;  3AEB B;  1NI3 A;  1HE8 A;  2YEP B;  2MJ3 A;  1FIQ A;  2M0A A;  1NYQ A;  2AQ2 B;  2G4S A;  4K3B A;  1YN4 A;  5DPW A;  1SE3 A;  3FAH A;  3QAR A;  3V62 A;  4MGK E;  4ANW A;  4XDC A;  5HI1 A;  1N5X A;  4ACF A;  1N6Z A;  4ZYS A;  1SF0 A;  3ML9 A;  4KGT A;  2GI9 A;  1FRR A;  2GB1 A;  1IBX A;  1UEL A;  2ZNV C;  3AED B;  1E90 A;  4OVV A;  4JIO U;  2IO2 B;  2CJN A;  2DYM A;  1SIF A;  1IP9 A;  3ENE A;  2DHZ A;  4HRS A;  2LUE A;  4GDL A;  1PQS A;  1P9D U;  2H88 B;  1TY0 A;  4ZOH C;  1JQ4 A;  3SFE B;  3VUY A;  3W1Y A;  2WXF A;  1VCB A;  4HKZ E;  3DPD A;  3QHT A;  4GMV A;  4AJY B;  1UGM A;  1FXA A;  1SIJ A;  1QIL A;  2CS4 A;  3U30 A;  3B08 A;  2LVO A;  3R8B A;  1MI0 A;  2A4Z A;  1WX7 A;  2OJW A;  4A3P A;  4XDD A;  4LNF A;  1UF0 A;  2FE8 A;  3N3K B;  2JXX A;  2JYE A;  2AL3 A;  3FIL A;  1Q0W B;  1TS4 A;  3PLV A;  3GZN B;  1YN3 A;  4M0W B;  1D5X C;  2LUM A;  4N59 A;  1SJH D;  3ZNG C;  2LVP A;  4BAX A;  2L76 A;  1SE4 A;  3EFC A;  3T9L A;  4JLC A;  3QK0 A;  1TBE A;  2KVR A;  1GC6 A;  4W9C A;  4KDI C;  1JWM D;  4CQN A;  1WY8 A;  2FBW B;  2MBH A;  3EHV A;  2ZCB A;  1QOF A;  4W9G A;  2WXJ A;  1V9J A;  2WWZ A;  1GNU A;  3R3M A;  4DDI D;  3L4P A;  4WJQ A;  3QCA A;  1YNT E;  2FCN A;  4ARI A;  2RDG A;  3A9K A;  3R66 C;  2PVG C;  1RM6 C;  1FEH A;  3MC0 B;  1YOV B;  2CHX A;  3I5J C;  1T0R C;  2D3C A;  1RFA A;  2KNB A;  2ASQ A;  2WXH A;  4C4V A;  4MT5 A;  4C7Y A;  1SEB D;  2TSS A;  3RNA C;  4YSX B;  5DPT A;  4HXD A;  2DBY A;  1E6E B;  4E71 A;  1WWT A;  3B2F A;  2JUO A;  2WDV B;  5E6P A;  2A5U A;  4OVU A;  4BFR A;  2NCN A;  3AE5 B;  3B1L X;  4OZC A;  2AX5 A;  1EM7 A;  1J8C A;  2BVC A;  4XE0 A;  1K8R B;  2MW5 A;  1WMH A;  3MTN B;  2BF8 B;  2EKE C;  1TZ1 A;  1WFY A;  1KLU D;  2JRH A;  1R4M B;  3KVF B;  2PLP A;  1P0R A;  2FUH B;  2KZR A;  4OW0 A;  3UF8 A;  2K39 A;  1PGA A;  3ZKJ C;  1L4Z B;  4TMA B;  3P4P B;  1E7P B;  2V3S A;  3N20 C;  1JAL A;  4HJG E;  1WE7 A;  1F1H A;  3AM9 A;  3QQ8 B;  4RNA A;  1V86 A;  1I4P A;  3U7D A;  1DGJ A;  2L0T A;  1WZ3 A;  1R4N B;  4HJK A;  2O6V D;  2JYT A;  2NS5 A;  3ZNI D;  1Q1O A;  1TKY A;  2WLB A;  1FMA D;  2WYQ A;  4P1B C;  1WF9 A;  2MA9 B;  3RD2 A;  4JPS A;  2MSE D;  4GSW A;  2KK8 A;  2FCQ A;  3EC8 A;  3FC4 A;  2NBW B;  3KW5 B;  1L6U A;  4LJP B;  2PJH A;  2J42 A;  2PKO A;  3P4Q B;  1E10 A;  3AXC A;  3W2D A;  2K8H A;  1VRA B;  1T6B X;  2ZPY A;  3CWI A;  3JYU A;  4EE2 A;  2MP2 B;  2KO3 A;  2MJD A;  4AWJ A;  1JRO A;  5D94 A;  3DQV A;  4W9J A;  3RNF C;  2GBJ A;  2DYO A;  3WCQ A;  2KD0 A;  1I4H A;  2INN E;  2WXM A;  2ZVO A;  3A9J A;  4DXF A;  1J7B A;  2AEH A;  4WJP A;  4S0R A;  1M94 A;  3VRA B;  4JWS C;  1ZXH A;  2AL6 A;  1PDX A;  1KLV A;  4LTU A;  1XXG A;  3URY A;  3EUB 2;  2C7M B;  3KH0 A;  1GB1 A;  3W1S C;  2O2V A;  1K51 A;  1TYG B;  4WJO A;  1J7A A;  4EFO A;  3VAW A;  4ZRJ A;  1I7H A;  2BWE S;  4TV3 A;  2WS3 B;  2LFI A;  4W9K A;  2XK5 B;  4P6V F;  1WI0 A;  2GLS A;  3KYD D;  1E7U A;  4YTM B;  1OQQ A;  2C5L C;  1F9J A;  3L10 B;  4YL8 A;  2UYZ B;  4KX6 B;  2WHI A;  2DAJ A;  4IUM B;  3ZVV A;  3GZN I;  2LRW A;  1XO3 A;  3N32 A;  1WX8 A;  4RGT A;  2H89 B;  2WXN A;  2N4F A;  3UGB B;  5J2R A;  2LGS A;  2KTR B;  4IWO A;  3VRB B;  3K9P B;  2KQ7 A;  3IFW B;  1A5R A;  1J19 A;  3NHE B;  4HWI B;  3VFK A;  5HFY A;  2NTS A;  4KDL B;  5E6N A;  4NAW B;  4JWU C;  4IDI A;  4BOZ B;  1BML C;  3PSE B;  3UQB A;  2MWS B;  4GXB A;  3DCG A;  3VQI A;  4PYZ A;  3S2A A;  4NZL B;  3KWL A;  4KSL C;  4YXD B;  3NJT A;  4IG7 B;  4DHJ B;  2K22 A;  2IDY A;  3NVV A;  5G55 A;  3ZJT A;  2QIL A;  5LNK 1;  3MFG A;  2PVO D;  3JSV B;  4LNI A;  1TZO A;  3GP7 A;  4YT0 B;  4DXG A;  1P98 A;  2FCM A;  2BBC A;  4NQK E;  4JQW C;  2BGF A;  2MEK A;  1FXT B;  2D3B A;  1I4G A;  2CR5 A;  2J52 A;  1JWB D;  2I38 A;  4XGA B;  4AP4 C;  2QSD A;  4IOI E;  3UQA A;  2GMI C;  2ONQ A;  2JF5 A;  3HIZ A;  2ZJD A;  2D2Q A;  1IUE A;  3ETR A;  4MH0 E;  3AH7 A;  2L32 A;  3C19 A;  2N0S B;  1XQQ A;  4GDL B;  4NNJ B;  4S17 A;  2WU5 B;  5GMV A;  3AE9 B;  3M3J A;  3DBR B;  4P1C C;  3EFU A;  1T0Q C;  2GBM A;  3RZW C;  3GOE A;  5BMG A;  2QDF A;  4G3X B;  2K25 A;  4XC2 A;  2NBU A;  3BIN A;  5EE3 A;  1E0Z A;  3DVN V;  5IAA C;  4KVG B;  4TQ1 A;  3B2G A;  3PRZ A;  2BB5 A;  1SE9 A;  2VZK B;  3FIL B;  1I4R A;  2BQQ A;  3AE7 B;  1XF5 L;  3TSS A;  2RPQ A;  2KJH B;  2NPT A;  4A20 A;  5HKH A;  1UUP A;  3DBS A;  4HK2 A;  3GB1 A;  1GC7 A;  1F77 A;  3A1Q A;  3TEZ A;  4JL9 A;  4NJ7 A;  1WJU A;  3AI5 A;  1BT0 A;  4E3C A;  2CHZ A;  3WAP A;  3NS8 A;  4YWG G;  1Q5W B;  4ANU A;  2BS4 B;  4A6Q A;  2WU2 B;  3HHM A;  4MAC A;  1E8W A;  2BS2 B;  1FNW A;  2LHE A;  3N1Z C;  2PIA A;  1V6E A;  4BKS D;  4FHJ A;  2EMS A;  3ZJV A;  3A9K B;  3IG3 A;  3I57 A;  1ZP0 B;  2DZI A;  4WWP A;  1IGD A;  2MBQ A;  2K8B A;  3UIP B;  5AZG A;  4K1R B;  1CK1 A;  2KX3 A;  4C4V B;  1WR6 E;  4XX5 A;  3UIO B;  2L1A A;  1M4V A;  5BO4 B;  3PVL A;  1T5X D;  1WXA A;  3IBE A;  3Q8E A;  4KGS A;  3DWM A;  2R2O A;  3AN1 A;  4YSZ B;  2FIF A;  5AZF A;  3NVZ A;  1MHX A;  4C00 A;  4F1S A;  2PW9 A;  3RN9 C;  1JW9 D;  5G5H A;  3RFZ B;  2OJR A;  2KHW B;  2IGH A;  2IY0 B;  3BWU D;  4IM2 A;  4FUL A;  1UD7 A;  3L16 A;  2D11 A;  2DLB A;  4LCD E;  4WWM A;  4CYE A;  4MGI E;  4PK1 A;  1U4A A;  2JSV X;  2OOB B;  1AWD A;  4CHK A;  1HA5 A;  4MH8 A;  2QJL A;  5IOI A;  1HXY D;  1GPX A;  2J0K A;  4QAY A;  3U8Z A;  1YQB A;  1FRD A;  4AS1 A;  2GRI A;  1NDD A;  2IBI B;  4RCO A;  4ZRP A;  4FJZ A;  5JHB A;  4AQ7 A;  2D07 B;  3DWG C;  1FCL A;  3AE4 B;  4WWO A;  4DBG A;  1HTQ A;  3R2I A;  2KTF A;  4HDO A;  1WSP A;  5HHD G;  2L83 A;  4HRO A;  1P3Q U;  1V5T A;  4N58 A;  1P1A A;  4B0E A;  2JQR B;  4RGN A;  2DEN B;  1XCT L;  1JWA D;  3AEA B;  2I1K A;  1RYJ A;  2M4N A;  2NTT A;  5D3D A;  4IKG A;  3L0W B;  1J0G A;  1QZE A;  1FCC C;  3X0W A;  1FFU A;  3ZDT A;  2Y3A A;  1DOY A;  3QAQ A;  3A33 B;  3J9C A;  2Y5B B;  3C8Y A;  1D5M C;  1LQB A;  1VZ7 A;  4L1B A;  4W9H A;  3A9J B;  2HTM E;  2I2Y A;  3KWV A;  2KKC A;  2M56 B;  2WGS A;  1QLB B;  1N63 A;  3Q8C A;  2WXG A;  1VZ6 A;  3ZXR A;  2XBB C;  1WXS A;  2SEB D;  4GN1 A;  4W9F A;  1FNV A;  1F52 A;  2O2V B;  4RMA A;  3DBR I;  3A4R A;  2VZK D;  2KT7 A;  4DWF A;  4FXC A;  4X57 B;  2KAJ A;  2M0X A;  3O13 A;  2QCZ A;  4JX1 C;  3OLM D;  4M02 A;  1KLG D;  1SJE D;  3NY5 A;  3QX1 A;  3L17 A;  2RDB C;  2JZZ A;  2MBO A;  3ZQ4 A;  2N7D A;  3BVZ A;  1I42 A;  2KJR A;  1N5W A;  3AE1 B;  1T0Y A;  3ALB A;  3P4S B;  1AN8 A;  1IPG A;  4XWW A;  3R7Q A;  3HUI A;  2KN4 A;  2X38 A;  1R7S A;  4MM3 A;  5C3J B;  3AEG B;  2LRU A;  4KV2 A;  2WX1 A;  4GDK B;  4DK5 A;  1ROE A;  2G3Q B;  1WGH A;  4IC7 B;  2BYF A;  4G11 A;  3E9S A;  4OHJ A;  3ZNH B;  4MJS A;  1MHH E;  2NMQ A;  2M8S A;  3DHH C;  1ZKH A;  5CHV C;  3T3N A;  3OG5 A;  3RUI B;  3ECI A;  3PZD A;  2ZCC A;  4YSY B;  1XD3 B;  3KUZ A;  3BK1 A;  2JRI B;  5AEK B;  1KM7 A;  1MJD A;  3Q8F A;  1GG3 A;  3AEC B;  2DZM A;  2KFK A;  1TKE A;  3H7S A;  1PYW D;  5H92 C;  4H2A A;  5TSS A;  3H9D A;  2BPS A;  2N1W A;  3E56 A;  4NAM A;  4WH4 A;  3AE2 B;  3AU4 A;  5EE1 A;  2ZVN A;  5D3I B;  2AWT A;  2SAK A;  2LWP A;  2QEJ C;  4HPL B;  1E8Z A;  2LGI A;  1AW7 A;  1SSN A;  1VD2 A;  3N1X C;  4KKI A;  1V1P A;  2IO1 B;  2PMV A;  1C9F A;  3T3O A;  1WE6 A;  2KDB A;  4M8N A;  5CTR C;  2BYV E;  2KWU B;  3TCA A;  5BMI A;  1N61 A;  3Q8A A;  3DBH B;  1UZX B;  2RR9 A;  1TJE A;  2ZPN A;  5LLI A;  4J3O D;  1E7V A;  3X23 A;  3NRZ A;  5FKA C;  2RMM A;  3TEX A;  3PTF C;  4BKG A;  5DPR A;  3AU5 A;  4HVB A;  2Y5P A;  1L7Y A;  2LI5 A;  2KWC A;  1ZPS A;  2E6X A;  4A55 A;  2BYE A;  3WIM A;  1L4D B;  3Q3J A;  3APD A;  2PPH A;  2WX0 A;  4W9L A;  4MSM B;  3P1M A;  2O6V A;  3SFD B;  3L54 A;  1RAX A;  2JZ3 B;  1TS3 A;  2JWZ A;  2XNA C;  1GAQ B;  2LJI A; 
#chains in the Genus database with same CATH homology
 1EWY C;  5AUK A;  1XLO A;  1BXT A;  3KLS X;  2KMM A;  3MHZ A;  4WQM A;  1YQ4 B;  4A9A A;  1YJI A;  2MEK A;  1ZE3 D;  3NUH B;  4O1N A;  4TQ0 A;  2AQ1 B;  1I4G A;  1I4X A;  1V1P B;  4KKJ A;  3CIR B;  2J52 A;  4RFB A;  2IJ0 A;  3Q69 A;  1JWB D;  2Z8L A;  2I38 A;  4PT5 A;  2WXR A;  3AEE B;  1ESF A;  4WIP A;  1TKG A;  3IT6 B;  3W5V B;  1SE2 A;  3VR9 B;  4RF0 A;  1HZ6 A;  2MJE A;  2QSD A;  4IOI E;  3ZYY X;  1EU4 A;  2ONQ A;  5H8Y E;  4ZHO A;  2JWU A;  2AQ3 B;  1UNS A;  3PZ8 A;  2WQY B;  2PTL A;  2KQ4 X;  3PZ7 A;  3HRD D;  1C76 A;  1VDV A;  2B76 B;  2FUG 1;  1IUE A;  1N62 A;  2WXP A;  3ETR A;  1TY2 A;  3AH7 A;  2L32 A;  2N0S B;  1VLB A;  4GDL B;  4RGO S;  4USA A;  3H8H A;  2WU5 B;  2INP E;  1QKZ A;  3AE9 B;  4KGR A;  5BMG A;  3W9C B;  1HZ5 A;  3KQ4 A;  2ZW0 A;  5HG2 A;  2G9H D;  4OVZ A;  1PFD A;  5EE3 A;  2V0G A;  1E0Z A;  1FXI A;  1NEK B;  5T8I A;  1WGK A;  4OZB A;  4TQ1 A;  3AEB B;  3B2G A;  1NI3 A;  2YEP B;  2MJ3 A;  3AB5 A;  1FIQ A;  1NVI D;  2BB5 A;  4C80 A;  1JRP A;  1E9M A;  2VZK B;  3FIL B;  4REZ A;  1I4R A;  2M0A A;  1MPE A;  1NYQ A;  2AQ2 B;  3AE7 B;  1XLN A;  1XF5 L;  3TSS A;  1YN4 A;  1HQR D;  4M0W A;  1SE3 A;  1UUP A;  5E6J A;  3HVD A;  3FAH A;  2V3N A;  3GB1 A;  1F77 A;  1IGC A;  3TEZ A;  2W3S A;  4XDC A;  2LEK A;  3ZJU A;  1HEZ E;  1Q10 A;  1N5X A;  5HI1 A;  2MH7 A;  2BT6 A;  2K0P A;  2Y5C A;  1JCK B;  1V97 A;  4ZYS A;  2IPK D;  1SF0 A;  2CU3 A;  4KGT A;  2GI9 A;  1FRR A;  2V3P A;  2GB1 A;  1IBX A;  1T3Q A;  3AED B;  4YWG G;  3U4E G;  3SR6 A;  5C2T B;  4RGM A;  2BS4 B;  1PGB A;  4A6Q A;  1EWC A;  1GB4 A;  2CJN A;  2WU2 B;  2DYM A;  4MAC A;  2BS2 B;  1FNW A;  2JX5 A;  2LHE A;  4HRS A;  3V05 A;  1QT9 A;  1V1O A;  2PIA A;  4NJC A;  1C79 A;  2H88 B;  1TY0 A;  2Q5W D;  3ZJV A;  1TS2 A;  4ZOH C;  4C7Z A;  1JQ4 A;  3SFE B;  1LO5 D;  3I57 A;  1ZP0 B;  2WXF A;  3Q8B A;  4HKZ E;  2K9X A;  1IGD A;  1FXA A;  1SIJ A;  1CQV A;  1QIL A;  3IT4 B;  1D4B A;  3R8B A;  1MI0 A;  1CK1 A;  3BYT B;  4D2K A;  1J7C A;  1JWU D;  4XDD A;  2L1A A;  1M4V A;  2FE8 A;  2JYE A;  3FIL A;  3I9V 1;  3AE6 B;  1TS4 A;  4L23 A;  5FK9 C;  1T5X D;  1YN3 A;  2ON8 A;  3Q8E A;  4KGS A;  3DWM A;  3AN1 A;  1VR9 A;  4YSZ B;  5JXV A;  3NVZ A;  1D5X C;  1FFV A;  1QQR A;  2LUM A;  1MHX A;  1SJH D;  2WXK A;  3LXF A;  4N59 A;  2PW9 A;  1ZXI A;  1JW9 D;  3AE3 B;  5G5H A;  4ZRQ A;  3RFZ B;  1SE4 A;  5BYQ A;  4YTN B;  1XEE A;  2IGH A;  1JWM D;  4CQN A;  2FBW B;  2N7J A;  1EU3 A;  2E3T A;  1D5Z C;  1SXT A;  3BWU D;  2R61 A;  1IBX B;  1QOF A;  2YEP F;  1RWS A;  2WXJ A;  3EA6 A;  2ZW1 A;  2ACZ B;  2DLB A;  3BVM A;  3L4P A;  4WWM A;  4JE3 B;  4P16 A;  2JSV X;  1AWD A;  1YNT E;  2EKI A;  2RPV A;  4ARI A;  1HA5 A;  2RDG A;  4MH8 A;  2QJL A;  3W1S A;  4N6E B;  1HXY D;  2N9L A;  2K5P A;  3RPF C;  3BYY B;  1GPX A;  2PVG C;  1C4A A;  1RM6 C;  2W55 A;  4A8X C;  2V4I B;  3NVY A;  1FRD A;  4AS1 A;  1DOX A;  1FEH A;  1SBB B;  3MC0 B;  2GRI A;  1GOZ A;  3P63 A;  2J4X A;  4RCO A;  2LHD A;  4ZRP A;  2WXH A;  4MT5 A;  4C7Y A;  4AQ7 A;  1XLP A;  3IXS A;  1SEB D;  2TSS A;  5AUI A;  3U7Z A;  4YSX B;  1FO4 A;  4LLG M;  2DBY A;  3DWG C;  1E6E B;  3OWE B;  4WAF A;  1FCL A;  3AE4 B;  2RDH A;  1ACC A;  1JML A;  1N60 A;  1WWT A;  3B2F A;  2WDV B;  3AE5 B;  3R2I A;  1WSP A;  5HHD G;  2L83 A;  4HRO A;  4OZC A;  2AX5 A;  1EM7 A;  4N58 A;  2WDR B;  1VJK A;  4US8 A;  4B0E A;  4XE0 A;  2JQR B;  1KTK A;  4RGN A;  2K3U A;  1XCT L;  1JWA D;  1KLU D;  2W3R A;  3AEA B;  1VZ8 A;  3NZ3 A;  3R2T A;  1SB3 C;  2PLP A;  4RH6 A;  1TS5 A;  2WXI A;  5EE9 A;  3U52 E;  1RYJ A;  2WNM A;  2NTT A;  3AV8 A;  4L2Y A;  1L0V B;  5D3D A;  3SEB A;  4IKG A;  4OW0 A;  3NVW A;  4DQO C;  5I4D A;  2IGG A;  1FCC C;  1PGA A;  1FM0 D;  2WXL A;  3P4R B;  1L4Z B;  4TMA B;  1C78 A;  1FFU A;  3P4P B;  3W5U B;  2Y3A A;  1E7P B;  1CJE A;  1QF6 A;  1FD6 A;  1JAL A;  3BVG A;  1DOY A;  1K53 A;  4HJG E;  3BK2 A;  3J9C A;  2JXT A;  3AM9 A;  4RNA A;  3C8Y A;  1D5M C;  1VZ7 A;  1I4P A;  4L1B A;  1Y56 A;  1FNU A;  1C4P A;  2HTM E;  2I2Y A;  3KWV A;  1DGJ A;  2QIE B;  1YJJ A;  1PGX A;  2M56 B;  2OED A;  2KWD A;  1QLB B;  4HEA 1;  5BYS A;  2IGD A;  1N63 A;  2JYT A;  3Q8C A;  2WXG A;  1VZ6 A;  4HKQ A;  3ZGZ A;  2BTE A;  2SEB D;  1TKY A;  1XCQ L;  1STE A;  2WLB A;  1FMA D;  1FNV A;  5G5G A;  1D6E C;  1L6V A;  2VZK D;  4FXC A;  1I4Q A;  2EEL A;  1C4C A;  2KAJ A;  4JPS A;  5FR3 A;  3O13 A;  3FC4 A;  4JX1 C;  2W82 A;  1KLG D;  4RF1 A;  2KDM A;  1L6U A;  1SJE D;  2L52 A;  4UDU C;  2PKO A;  2J42 A;  3P4Q B;  1E10 A;  2WXQ A;  4WUR A;  1C77 A;  2JU6 X;  3W2D A;  1VRA B;  4XWT A;  1ET9 A;  1K52 A;  2LMC A;  1YQ3 B;  3ZQ4 A;  3AEF B;  2OHF A;  2J53 A;  4TSS A;  4ITK A;  1KH0 A;  3BVZ A;  1T6B X;  3AE8 B;  3CWI A;  4YTP B;  1N5W A;  3AE1 B;  3TEW A;  4EE2 A;  1ET6 A;  3P4S B;  1AN8 A;  4XWW A;  2MJD A;  3GS2 A;  3TUO A;  3HUI A;  2BW2 A;  2KN4 A;  1RFK A;  5EE0 A;  2X38 A;  1R7S A;  1JRO A;  5C3J B;  2DYO A;  3AEG B;  3WCQ A;  1I4H A;  2DWQ A;  2INN E;  2WXM A;  3HVZ A;  1OQR A;  3NS1 A;  4GDK B;  1ROE A;  3U2S C;  1XLQ A;  3VR8 B;  1QOA A;  1J7B A;  4DXF A;  2M19 A;  3VRA B;  3IAS 1;  4JWS C;  1ZXH A;  2BS3 B;  2D5G A;  2WP9 B;  1MVK A;  1PDX A;  3E9S A;  4OHJ A;  4A90 A;  4ZHP A;  1MHH E;  1JWS D;  4LTU A;  1UWX A;  4GLS C;  1XXG A;  2NMQ A;  3URY A;  1ENF A;  3EUB 2;  2BYT A;  4US9 A;  3UI3 A;  3T3N A;  1B1Z A;  2JZP A;  4ARC A;  4YSY B;  1B9R A;  1GB1 A;  5GXG B;  1NEN B;  1K51 A;  1TYG B;  3V3X A;  1OFF A;  3BK1 A;  1J7A A;  3Q8F A;  1I7H A;  1L0X B;  3AEC B;  1ZOY B;  2WS3 B;  1TKE A;  1ZDV A;  1PYW D;  2LFI A;  5H92 C;  4H2A A;  5TSS A;  1CZP A;  3MP9 A;  2G1E A;  4P6V F;  3N9Y C;  2XN9 C;  3E56 A;  4NAM A;  4WH4 A;  4Q2J A;  4YTM B;  1OQQ A;  3AE2 B;  3EGR A;  5EE1 A;  2CJO A;  1UGJ A;  4KX6 B;  1L0Y B;  4C56 C;  5D3I B;  2KAC A;  1K50 A;  2HDE A;  2SAK A;  1XO3 A;  2QEJ C;  1P7F A;  1V8C A;  2W54 A;  2LGI A;  1L5P A;  4RGT A;  2H89 B;  1AW7 A;  1SSN A;  1KRH A;  2ICI A;  4KKI A;  1WXQ A;  1V1P A;  2WXN A;  1ZDX A;  4B0M A;  1BUI C;  2PMV A;  1C9F A;  2WXO A;  1AYF A;  3T3O A;  3VRB B;  1QOB A;  4MM3 B;  1KFY B;  1DOI A;  1DYQ A;  1ZUD 2;  1WYG A;  1A70 A;  1N61 A;  5BMI A;  5BMH A;  3Q8A A;  5D7G A;  3P42 A;  1P7E A;  1YN5 A;  5HFY A;  1TJE A;  2NTS A;  3LB8 C;  3PO0 A;  4J3O D;  3NRZ A;  5FKA C;  2RMM A;  4NAW B;  3TEX A;  1UWM A;  4JWU C;  3BII D;  4IDI A;  4LK0 M;  1NYR A;  2QMT A;  1BML C;  2Y5P A;  1WRI A;  3B9J A;  3MJ5 A;  5MPO A;  3VQI A;  1ZPS A;  2E6X A;  4R3D A;  4A55 A;  1L4D B;  4NZL B;  1KF6 B;  3KWL A;  4OZA A;  4YXD B;  1F0Z A;  3BZD B;  3TEY A;  2K22 A;  3ABV B;  2BB6 A;  1PUT A;  2WDQ B;  1QOG A;  3LYY A;  3P1M A;  2IDY A;  3NVV A;  3IAM 1;  3ZJT A;  3SFD B;  3AMZ A;  2QIL A;  1YMH E;  5LNK 1;  3MFG A;  2PVO D;  1TS3 A;  1TZO A;  3GP7 A;  4YT0 B;  2N9K A;  4DXG A;  2XNA C;  1GAQ B;  2LJI A;  1F2R C;  1F2R I;  5BYR A;  2BBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...