4KGTA

Backbone modifications in the protein gb1 turns: aib10, d-pro47
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
54
structure length
52
Chain Sequence
DTYKLILNGGLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDGTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: Aib10,
publication title Protein-like Tertiary Folding Behavior from Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
total genus 13
structure length 52
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kgtA00
1P7EA 5BMHA 1UWXA 1F2RC 1F2RI 2ON8A 1FD6A 3MP9A 1MI0A 2PW9A 2K0PA 1HZ6A 1IBXB 1P7FA 4OZCA 1K53A 2GI9A 2JZPA 1K50A 1PGAA 2KDMA 1JMLA 2IGDA 3GB1A 5BMIA 2KWDA 1XCQL 2ZW1A 1QKZA 2LUMA 1PGXA 1GB4A 4HKZE 1GB1A 1EM7A 1C9FA 1MVKA 5HFYA 4D2KA 1IBXA 2I2YA 5HHDG 2GB1A 1HZ5A 4WH4A 2ONQA 4OZAA 2PTLA 1HEZE 1IGCA 1MHXA 2LHEA 2JXTA 5HG2A 4OZBA 2KQ4X 2OEDA 3FILB 2J53A 1K52A 1MPEA 2JSVX 1Q10A 4MACA 4HJGE 2JWUA 2LHDA 2IGHA 4GLSC 1K51A 3V3XA 4IOIE 2RPVA 2PLPA 2N7JA 2QMTA 2I38A 5BMGA 4IKGA 2RMMA 2QSDA 2JU6X 1PGBA 2LGIA 1YNTE 1YMHE 2J52A 1IGDA 2KN4A 3UI3A 3FILA 1D4BA 2EELA 4KGSA 4KGTA 1MHHE 1XF5L 2NMQA 1FCCC 1XCTL 4KGRA 2KACA 2ZW0A 2N9KA 1ZXHA 2IGGA 1FCLA 1KH0A 2N9LA 5HI1A 5JXVA
chains in the Genus database with same CATH superfamily
4BVUC 2KDBA 4E71A 1TS2A 2LRWA 3AI5A 3K9OB 4RFBA 1YX6B 3P42A 1P7FA 1WF9A 4G11A 1QQRA 1EWYC 2BS3B 3FAHA 3UQAA 1WM3A 1E6EB 5BMIA 4HEA1 2MJDA 3DCGA 4MGYE 3BY4B 3AE7B 4KDLB 2BF8B 1I35A 4W9CA 2JY6A 3PSEB 2C5LC 1KM7A 5BYQA 2KTFA 2H89B 3GP7A 1WJ6A 2BPSA 3VUYA 1QOGA 1WX7A 1XQQA 3ZTCA 5D2MB 3DBHI 1N5XA 1SE2A 2PJHA 5EDSA 1HEZE 2KMAA 1FXIA 1ZDVA 1RYJA 4BKSD 4S0RA 3EHVA 4OW0A 5MPOA 4DHJD 3Q3NC 1K52A 4WQMA 3UF8A 2WHIA 5J2RA 4FULA 3C8YA 3KWVA 2G4SA 1FRRA 1SSNA 2DYBA 2KFJA 4M0WA 4M00A 3Q8FA 4RF0A 3I9V1 4BFRA 4FN2A 3A9JA 3ML8A 2KAJA 4KGTA 1UWMA 3W9CB 4YSYB 4A9AA 2WQYB 4EZKA 2MEKA 4P1CC 2LMCA 1TJEA 1TS3A 3UIOB 5L95C 2BYVE 4NZLB 1HE8A 3ZKJC 3L0WB 4EUTA 3KWLA 2K1FA 3MC9A 3BWUD 2KJHB 1EU3A 4JLCA 3VR9B 3MP9A 1R4MI 1TGZB 4GIVA 5EE0A 2MCNB 2M8SA 2KHWB 2JVCA 1DOYA 5AUKA 1WGDA 2KDEB 3PS6A 3W5UB 3OWEB 2J0JA 1SB3C 2AQ2B 4EZLA 4F7ZA 1KRHA 1UZXB 1PGXA 4XDDA 4MGIE 2ZVOA 4HKZE 2KMMA 1C4AA 2WXOA 1S3SG 3DHIC 3VUXA 2J7QB 3I57A 4PS8A 1B9RA 2LEKA 2INPE 1E7VA 1J8CA 4HPPA 3U7DA 2SAKA 1CQVA 4DQOC 4HDQA 2CU3A 1TKYA 3P4QB 3DBRI 2L0FA 5AUIA 2KZRA 2D3GA 3PZ7A 3LB8C 2C7NB 2PKOA 2KXJA 2LHDA 1RFAA 3ZQ4A 5IKCM 1QOAA 1UNSA 2WNMA 1LM8B 2K5PA 3JVZX 2RPVA 3EC8A 2IO3B 4GSWA 1GAQB 4QAYA 1D3ZA 1L0YB 3MC8A 2WX1A 4K3BA 1E5WA 3ZJUA 3A1QA 1Q0WB 3ECIA 1M4VA 5KHOA 2WGSA 3NJTA 1FNVA 3BYYB 4RH6A 4I6NB 1ZKHA 3IHPC 2MHJA 4REZA 2KO3A 3BK1A 4ICUA 2J4XA 4C56C 1UD7A 1RLFA 2WXJA 2RSUA 3L10B 3RCZA 3I5JC 1ZUD2 3OJ3A 2X8XX 2YEPF 1K53A 2A5UA 3P4SB 3EFCA 3NOBA 1OQRA 3T8MA 4N59A 2IGDA 4X57B 3RUIB 4JWUC 4MH0E 4TUUA 4EFOA 4KV2A 3HK0A 2B76B 2XK5A 2BYEA 3HRDD 2QILA 2JYTA 2LJ5A 1CMXB 1UUPA 2K3UA 2WP9B 2FCQA 1RFKA 2KK8A 1DGJA 3PHWB 1JRUA 4M0WB 4OZAA 1V81A 1L2NA 4GB9A 2CJNA 3GOEA 4OVUA 2IJ0A 3A9JB 5DPSA 2BW2A 4MM3A 4EE2A 2ZZPB 1SE9A 3N30A 3V3XA 4IOIE 3PREA 3OAWA 4JX1C 2ZPNA 2UYZB 4WWNA 2I38A 2N9EB 1WSPA 3ZRFA 3V62A 4YSXB 1Y8RC 3LYYA 1GC6A 3O13A 1TTNA 4P1BC 3SR6A 3UI3A 1D4BA 2KJ6A 3NZSA 4LNIA 1GNUA 2IY1B 2CR5A 2NPTA 2B3AA 2KACA 3ETRA 2JWZA 1MG8A 2MRPA 3FC4A 3GE8C 4M02A 3AH7A 4PK1A 4ACFA 1SJHD 3AE8B 3UINB 3C0RB 1F2RC 4E3CA 1KLUD 2V4IB 4TSSA 4ZOHC 3QX1A 4KX6B 3U8ZA 2MA9B 1JWAD 2DZKA 2NBWB 1NYRA 1KF6B 3DHHC 1WGKA 4C7ZA 4LCDE 1FMAD 4XDCA 3Q8BA 1ZW7A 3AU4A 2C7HA 1XCQL 4RGOS 3B08A 2MBEA 2ZW1A 3TEWA 4HXDA 2ACZB 2QIEB 1DOXA 3MC0B 5DCNA 1EM7A 3DVGX 2DWQA 1N61A 1AN8A 1FPYA 2ZCCA 2J0KA 2M17A 1XEEA 3DVNV 3KH0A 1QT9A 2RDBC 3BVZA 4ZRIA 4ZRKA 1HZ5A 3APFA 3LDZE 2CHZA 3IXSA 3L08A 2Y3AA 1QLBB 2JXTA 4DHZB 4NAWB 4JWSC 3A1QB 3L54A 4MT5A 3AEGB 4K7SA 2PPHA 2WXMA 1VCBA 2J53A 5T8IA 3U30A 1PFDA 1WXQA 1MG4A 4PYUA 2EKEC 1I42A 2BS4B 3URYA 1L0VB 2DLBA 4A3PA 1F9JA 2WDVB 3PPAA 3QK0A 4ANXA 2OOBB 5CHWA 2GBJA 2Y5BB 2J42A 5AZFA 3M95A 1P1AA 1SE3A 4HWIB 1E8YA 3RT3B 3ZXRA 1N6ZA 4C80A 4L1BA 1TIFA 4C00A 4K7UA 4B9KA 4WJQA 3JYUA 3PRZA 2KWUB 1WM2A 4I6PA 5JZEB 1QOFA 1N62A 1UELA 4MDKE 1ZXHA 5LXIB 3R3MA 4XX5A 1KLGD 1T0SC 2N9LA 3X23A 4IUMB 4AUQC 3PV1A 5CX3A 2XK5B 4FJYA 1DYQA 3U7ZA 1HZ6A 3CSTA 3B0AA 2D2QA 1TS5A 4CO7A 2WDRB 3ZIMA 4B6WA 1VLBA 2IO2B 2QDFA 1I4GA 2W54A 1GG3A 2Z0EB 5BO4B 2CKHB 4KKIA 4ZYNA 2DAFA 2W9NA 3H7PA 3ALBA 2D11A 5CHFA 3DQVA 2XN9C 2Q5WD 5H92C 3A9KA 1WR1A 1TKGA 2KVZA 4DDID 1MVKA 2BWFA 4GMVA 4AS1A 1J7BA 1UBQA 4MM3B 2WX0A 2K25A 2M0AA 4FBJB 1VRAB 4RM9A 4URKA 2MBBB 3QC8B 3W1SC 2HDEA 3H1UA 4II3B 4KZCA 5FR6A 2WU5B 3NG0A 3NRZA 2BQQA 2OEDA 1OFFA 2KOXA 3NY5A 3BYTB 1MPEA 3NVWA 2NPTB 1YJJA 2G3QB 5IN7A 4L23A 3BZDB 2GRIA 4YL8A 3KUDB 1JCKB 4HDOA 2JU6X 1FFVA 4FJZA 4W9LA 1GC7A 1ZDXA 2J52A 4DXGA 4DXFA 4G50A 2KTRA 3WAOA 1WRDB 1MHHE 2K6QA 3Q3FA 2R61A 2ZNVB 3A33B 2AWTA 4ZRQA 5IA7A 3ZXVA 4LTUA 1T0QC 1OTRB 2QHOA 3BVMA 5BMHA 2JQRB 2KWVB 1C77A 2YLMA 3H6NA 3NZUA 2Y5CA 3N9YC 1I4RA 3R2IA 2BTEA 1F77A 4W9KA 5DPTA 1TT5B 4HROA 1UBIA 3RPFC 3P2BA 1BMLC 4Q2JA 1OEYA 2HJ8A 1F1HA 5TR5A 5J18A 1EU4A 5LNK1 3A4RA 3EA6A 3R7RA 1IBXA 2FIFA 1FM0D 1DOIA 1JWUD 4GDKB 4B0EA 2M56B 3R8BA 1YQ3B 4WJOA 3IAM1 5TSSA 1WE7A 1MJDA 4DWFA 3AEAB 4OZBA 4O1NA 3PO0A 2L1AA 4ARIA 3H7SA 3V6CB 1Q10A 4R3DA 3JSVA 2DZJA 2PLPA 3NHEB 4LK0M 1WE6A 5E6NA 3V6EB 4A20A 2BBCA 1FXTB 2K8BA 1NEKB 2DYMA 4XZ4A 1ZE3D 2LGIA 2W3SA 1YNTE 2I1JA 3JW0X 2RR9A 3ZUNA 2L05A 3BINA 4ZRJA 2DENB 3MFGA 1J19A 1ISNA 1FRDA 1NBFC 3RNCC 2IGGA 3H7PB 1WX8A 3GS2A 3RN9C 2L76A 4NJ7A 1HA5A 4WWMA 5D3DA 2AYOB 4LNNA 1Q1OA 5C1ZA 1FD6A 3K9PB 2UWQA 2N1WA 3CIRB 3Q8AA 3W1YA 1SEBD 2GBRA 2J0MA 4NQLB 3NZ3A 1EUVB 4WQOB 1K50A 1WJ4A 4GN1A 3VH4B 4DXAB 2ICIA 1NDDA 2PVGC 3NVVA 4A6QA 3W2DA 2G45B 2LVPA 2INDC 3AE3B 2IY0B 4GDLA 2JX5A 2FNJB 4F8CB 2FCMA 1NENB 1KJTA 5DPRA 3I63C 3WAPA 4C4VA 1SXTA 2BKFA 1ET9A 3PHXB 2V0GA 4J6IA 3TMPB 2KMCA 1BUIC 2D07B 5FK9C 3TEXA 2PMVA 1KTKA 1RWSA 2IPKD 2V4LA 2KTRB 1WJNA 2K9XA 1Z2MA 2JWUA 2IGHA 1K51A 4ASWC 2VH1A 3N20C 4IKGA 3N1XC 2DX5B 3VRAB 1PYWD 4MSQB 4WAAA 4FHJA 1N63A 1WI0A 3SDLC 3HVZA 1JALA 2NTTA 4KSKC 2EELA 2AX5A 1ESFA 1XF5L 3N3KB 4IWQA 4WWOA 2KVRA 4K81A 4EZJA 3Q14C 3AXCA 4IM0A 1FCLA 1AARA 4WIPA 2D3BA 5EE9A 3H9DA 1L4DB 1P7EA 1V9JA 3KW5B 1F2RI 2GOWA 4CYEA 2K8HA 1IBXB 2REXA 1HQRD 3P1MA 3AB5A 1GOZA 4M8NA 4IWPA 4AJYB 2JPHA 2LVOA 5G55A 1SIFA 1WXMA 2LXCA 1WZ0A 3VH3B 3HHMA 3PVLA 1C9FA 1FIQA 3VUWA 2WXKA 1V86A 2JUOA 1QOBA 2N0SB 1ZPSA 2W82A 3JSVB 2NVUI 4A3OA 4B95A 3DVNU 3T3NA 4BBNF 1LGRA 1XLQA 1IGCA 3APCA 4N6EB 2WXPA 4RF1A 3WALA 3NS1A 2Z8LA 2FAZA 4MH8A 3W5VB 1ZXIA 4LJPB 3L16A 3OG5A 3NUHB 2KDIA 2MX2A 2HE7A 4HJGE 1ZOYB 3Q3JA 1T3QA 2DNFA 1VR9A 1C79A 2FBWB 4M01A 5AEKB 2C60A 3DBLB 2LGDA 4KSLC 2CS4A 4XC2A 2L52A 3AN1A 3ABVB 4YSZB 1V6EA 1L6UA 2AEHA 1XLNA 1YMHE 1WMHA 2YVCA 3AE4B 4N9F4 3FILA 3B2GA 4KGSA 2CHWA 3GZNB 4ANVA 3TIXA 2WXQA 1R4NB 2G1EA 1YQ4B 3R7QA 2MQJA 5JHAA 3B1LX 4WWPA 1V97A 5JXVA 3AE2B 4NJ6A 4GXBA 4BOZB 4HPLB 2M0XA 1MI0A 4MEMA 4MELA 1RRBA 2JRHA 2GLSA 1PQSA 4OZCA 5JHBA 4A8XC 2WXHA 4C4VB 1JWMD 2LI5A 4ZDVA 4K7WA 3TSSA 1CJEA 4P6VF 3IFWB 2LUMA 4JL9A 1YN4A 3RI7C 2QJLA 1YD8U 1WGRA 2EMTA 4HK2A 3A4SC 3B9JA 1L4ZB 1ET6A 2MLBA 5FR3A 4FJVB 2O6VA 4GOCA 2KN5A 4W9FA 2LXAA 1E10A 4ICVA 4IM2A 1YN5A 2DBYA 5BYSA 3R2TA 3KYCD 4WJNA 4TV3A 1WFYA 4XGAB 3OJ4B 2CJOA 1SBBB 2PE9A 4KKJA 1XT9B 1Z5SB 2IDYA 3ZNID 3TEYA 2BKRB 5IO9A 3APDA 1TS4A 4I6LB 4YTMB 4OVVA 2WU2B 2N7JA 4JGHB 1QF6A 1V8CA 3ENEA 4AOFA 2ZNVC 4BAXA 5C3JB 3V60A 3BVGA 3Q3OC 2KN4A 4PYZA 1OGWA 2INNE 2QC8A 2L7RA 4TMAB 2C9WB 2SEBD 2WYQA 4ANUA 3MHSD 2WWZA 3PRMB 1WWTA 3ZDTA 1I4PA 1LQBA 5AZHA 1UWXA 1F52A 3QIJA 2W55A 2PW9A 2VZKB 1CZPA 2WLBA 2KFKA 5GXGB 4HKQA 2ZVNA 4IM3A 1KFYB 2JZ3B 1YX5B 2FCNA 3GB1A 1YN3A 1E0ZA 4A55A 1R4MB 3HUIA 2HTHA 5I4DA 2LGXA 1SIJA 4HRSA 4JPSA 3PZ8A 4B0MA 1OEYJ 1JQ4A 2IZVB 3VAWA 3L17A 1L5PA 2N1VA 4WURA 3AE9B 4BKTA 4N58A 2MBOA 3VTVA 1UGJA 4TKNA 3IBEA 1VZ7A 2D3CA 1G6JA 1WMHB 3RNEC 2BS2B 2L83A 2MBHA 3FILB 1V1OA 1F0ZA 2N7DA 3VRBB 2NBVB 2ZEQA 4MACA 1U4AA 3QHTA 3X0WA 1UF0A 3AE1B 2MSED 4HCNB 3DBRB 5IAAC 4ZRPA 1M94A 1PDXA 1R7SA 1E9MA 1E7PB 2QSDA 2FUHB 3QQ8B 3CMMB 3AEDB 2KWCA 1L0XB 4IWOA 3E56A 1C4CA 3E9SA 3IAS1 1IP9A 1E8ZA 1CK1A 3ZRCA 1E7UA 1GUAB 3U2SC 4FADA 1GJZA 1H4RA 4KZ0A 1XCTL 3WAMA 2H88B 2ZW0A 2PE6B 1YIWA 1QZEA 1Q5WB 1L7YA 4RGTA 1YQBA 2KX0A 1J7CA 4JIOU 5J17A 2PVOD 3PLVA 5D7GA 4FA6A 4JE3B 1C76A 1XO3A 4J3OD 2ON8A 2NS5A 3SD5A 2L3ZA 2K0PA 3N1YC 3ZLZA 2GI9A 4W9GA 2O6VB 4KVGB 3ZVVA 4ZHPA 1WXVA 3OLMD 5CHVC 4P7IA 2IYDB 4FXCA 3VTUA 4HLEA 4WJPA 2E6XA 3RZWC 2KQSA 4H2AA 1P98A 4HCPB 1SE4A 1EO6A 5IOIA 4KIKA 2LJIA 1RM6C 4MSMB 4WH4A 5LXHA 1X1MA 3HM3A 5EE1A 3KQ4A 3C19A 1NVID 2RDHA 2MJEA 3DPDA 4BKGA 2V3PA 3AU5A 2LHEA 5HG2A 1FNWA 2KQ4X 4WAFA 5G5GA 5H8YE 2IO1B 4EOYA 2JYEA 1WYGA 2CHXA 1TY0A 1BXTA 3MHZA 2JF5A 2AL3A 2MBQA 2LGYA 4GLSC 1WY8A 3L13A 2X38A 4HJKA 4LNKA 1STEA 5C2TB 2WS3B 1C1YB 1HTOA 4C7YA 1FO4A 3EECA 4AWJA 3ONSA 3VFKA 4DBGA 1IGDA 4L2YA 2RPQA 1V5TA 3VDZA 2LFIA 2KFKB 2E3TA 4FHKA 2I1KA 5E6JA 1HXYD 1V5OA 4E74A 3Q3MC 4AQ7A 3TUOA 4A90A 1QILA 4IDIA 2BT6A 3N1ZC 3H8HA 2HTME 2RDGA 1B1ZA 4NY0A 3EUB2 3AM9A 2WXNA 4DDGD 3RMKC 3WIMA 2KLCA 5CTRC 2KDMA 1PGAA 1AWDA 2QEJC 2LZ6A 3VHTC 3ZYYX 4BZAA 1WJUA 2KWDA 2JZZA 4RGNA 2V3NA 3PLUA 3T9LA 3RNAC 3A9KB 4W9DA 5D6JB 1YJ1A 2CU1A 2O6VD 4IG7B 2XEWA 1EWCA 2AL6A 2EMSA 3Q8EA 5HHDG 1IYFA 5EE3A 1ZP0B 3QJZA 2KANA 2ONQA 4NJCA 3R66C 4RGMA 1A70A 1MHXA 2V9HA 2WXFA 3MJ5A 4MJSA 3KUCB 1P3QU 2D10A 2V3SA 2ZJDA 4PS7A 2LVQA 4LNOA 3SFEB 2RGFA 2OHFA 2MP2A 4MGZE 2G9HD 3DWGC 3P63A 2WDQB 2BWES 2D5GA 2YEPB 3BK2A 4NAMA 1Y56A 4II2B 2KLGA 3B2FA 4LNFA 2R2OA 1K8RB 1C3TA 2KJRA 3LJ3A 3TCAA 1FFUA 2JT4B 1D6EC 3DVGY 4EKUA 1NI2A 4LDTB 5FKAC 1XXGA 4US9A 1RAXA 5HI1A 4GGQA 1VZ8A 3PTFC 1MFWA 2V1YA 2C7MB 4HPMB 1LXDA 4P16A 1H8CA 1VJKA 1TZ1A 3D32A 1YOVB 3ZJVA 3V05A 4K3CA 3EFUA 3KVFB 1T0RC 4KIKB 4YT0B 4LLGM 4YXDB 1WIAA 3J9CA 5D94A 1QKZA 1WYWB 1L6VA 1GB4A 1GB1A 3ZDMC 2Z0DB 3BIID 2NBUA 3ML9A 1T5XD 5D3IB 5HKHA 2LWPA 1WRIA 3KUZA 5HFYA 5KHQA 2BGFA 1TKEA 2Z59B 3U4EG 2HJ1A 3DOWA 1GPXA 5IP4D 2BB5A 3QWZB 4M8MA 4RM8A 3RNBC 5BYRA 3DWMA 1VZ6A 4NAWA 4LJOB 1C4PA 3ZW3A 3I3TB 3EGRA 4RCOA 2R2QA 1TYGB 5DPWA 1TBEA 3HVDA 1JWSD 2OJRA 3HM6X 3NVYA 1V2YA 5E6PA 2KC2A 2XNAC 4JQWC 3P4RB 1SF0A 2ZCBA 4G3XB 4RMAA 1AW7A 3RYTA 2MWSB 4EEWA 1VDVA 3TJPA 2NR2A 5G2NA 3VVWB 2RMMA 1PGBA 2HD5B 3DBSA 4BOSC 2UU7A 2DAJA 1V1PA 4IC7B 3AECB 1J7AA 3PT2B 2GBKA 3SU8X 1J0GA 4ZHOA 4KGRA 1WZ3A 2GMIC 4XWTA 2N9KA 5LLIA 3LXFA 2M19A 3U52E 3Q8CA 4W9HA 3UGBB 3AULA 3QCAA 1V49A 3ZO5B 2WXGA 2KKCA 3ZNHB 4W9IA 2K22A 3RNFC 1BT0A 4LDTD 2JZPA 1WXSA 4ARCA 2VRRB 2N7EA 4DHZE 4MJSB 4ZYSA 2W3RA 4US8A 2ASQA 1NYQA 1TZOA 1LFDA 2O2VA 4GDLB 1I4QA 3AEBB 2JXXA 2MP2B 4FLHA 2GB1A 3ZJTA 3TL5A 3VR8B 2A4ZA 2LGSA 2PTLA 3NS8A 4G0NB 1IUEA 2MW5A 3ZGZA 1T6BX 1C78A 1ACCA 1JROA 3WCQA 3MTNB 3FKYA 4USAA 1XLPA 2AQ1B 3RZFA 4BKSA 1UGMA 3DDCB 1FNUA 1OQQA 1JRPA 2FUG1 3SHQA 2DYOA 2QMTA 3M3JA 4S17A 3CWIA 2GBNA 3L4PA 1S1QB 1ROEA 2N9XA 2K6DB 2BYTA 1JWBD 3DBHB 4TQ0A 2G4DB 4KDIC 1WXAA 1FCCC 1P9DU 2ZPYA 3VXWA 1WGGA 3RD2A 2LASA 2EKIA 4ANWA 1V80A 2L32A 1KH0A 3VTWA 1KOTA 2M1MA 2BVCA 2LUEA 2NTSA 4W9JA 2JRIB 2OJWA 1D5ZC 2KC1A 3IT4B 2QCZA 3RULA 2PEAA 2RD0A 1A5RA 3QAQA 4DK5A 2WXLA 3S2AA 1JMLA 5C23A 2WDTB 2K8CA 2IO0B 2TSSA 1SJED 3IG3A 1I7HA 4MGKE 4UDUC 2INCC 3AEFB 4XE0A 3SEBA 4YTPB 3O65B 1XLOA 4PS3A 4PT5A 4D2KA 1I4XA 1AYFA 2I2YA 3N32A 2FE8A 2KD0A 4GDKA 4AJWA 5GMVA 1E8XA 2Y5PA 1N5WA 2KNBA 1V1PB 3PGEA 1FEHA 3QA8A 2WXIA 3NVZA 2L0TA 2FCSA 2L8JA 2LD9A 3MJWA 4F1SA 3UIPB 2N9PC 1PUTA 2KX3A 3M62B 2AQ3B 1WH3A 2IBIB 3TEZA 2DZIA 3CF6E 2FIDA 1ZGUB 3TBLD 1YJIA 3WA0A 3IT6B 3PRPB 1JW9D 3KYDD 5JH5C 3HIZA 1EF5A 4OVZA 3W1SA 2NMQA 2KT7A 2M4NA 4XWWA 3SFDB 4NNJB 3CSFA 2KYWA 4HVBA 3KLSX 3AMZA 4NQKE 1TY2A 2DZMA 2BB6A 2N4FA 2MJ3A 3PZDA 2O2VB 3V61A 2NCNA 2KQ7A 3DHGC 4CQNA 4OHJA 3WANA 2L00B 3P4PB 3UQBA 1KLVA 1VD2A 2WXRA 1N60A 4YWGG 5AZGA 3RNGC 4RNAA 4GU2A 1I4HA 1WGYA 1ENFA 3Q6BA 4ITKA 4DHJB 1FXAA 2K39A 3ZNZB 3T3OA 1T0YA 3DBLI 1E90A 2PIAA 3M63B 2BYFA 3RFZB 2VZKD 4IW0A 4NPNA 1WGHA 2GBMA 4W9EA 1EF1A 1XD3B 4CHKA 2XBBC 2JSVX 5G5HA 5E6OA 4BBNC 2VH2A 2MH7A 4TQ1A 3GZNI 4K1RB 1NI3A 3AE5B 5BMGA 1D5MC 2D3AA 1R4NI 4YTNB 1LO5D 5L83A 3Q2AC 3GE3C 3Q69A 4XYCA 1P0RA 3QARA 3AE6B 3ZTDA 1D5XC 2KDFB 1HTQA 1IPGA 1UH6A 4AP4C 2DHZA 2LRUA 1SGHA 3VQIA 3AV8A 1E8WA 3ZNGC 3AEEB 3IVFA 1WR6E 1OQYA 1WX9A
chains in the Genus database with same CATH topology
1VZ8A 3AE2B 1TS2A 4RFBA 1MI0A 1DYQA 3U7ZA 1HZ6A 4P16A 1VJKA 1TS5A 3P42A 2WDRB 1P7FA 3ZJVA 1VLBA 4OZCA 1QQRA 1EWYC 3V05A 4A8XC 1I4GA 2BS3B 2WXHA 2W54A 3FAHA 1E6EB 1JWMD 4KKIA 5BMIA 4HEA1 3TSSA 2MJDA 4YT0B 4LLGM 4YXDB 1CJEA 3AE7B 4P6VF 3J9CA 1QKZA 2LUMA 1L6VA 2XN9C 1GB4A 2Q5WD 5H92C 1YN4A 1GB1A 1TKGA 2QJLA 3BIID 5BYQA 2H89B 1MVKA 3GP7A 1T5XD 5D3IB 4AS1A 1J7BA 4MM3B 1WRIA 5HFYA 1QOGA 3B9JA 2M0AA 1TKEA 1L4ZB 1ET6A 5FR3A 1VRAB 1N5XA 1SE2A 3U4EG 1GPXA 2HDEA 1E10A 1HEZE 2BB5A 1FXIA 1YN5A 2DBYA 5BYSA 3R2TA 2WU5B 1ZDVA 5BYRA 3DWMA 1VZ6A 3NRZA 1C4PA 1RYJA 2OEDA 1OFFA 4OW0A 5MPOA 3EGRA 2CJOA 1SBBB 3BYTB 1TYGB 4RCOA 4KKJA 1K52A 1MPEA 3HVDA 1JWSD 2IDYA 3NVYA 4WQMA 3TEYA 3NVWA 2XNAC 1YJJA 3C8YA 3KWVA 1SF0A 1TS4A 3P4RB 4YTMB 2WU2B 4L23A 2N7JA 1AW7A 1FRRA 1SSNA 3BZDB 1QF6A 1VDVA 2GRIA 4M0WA 2RMMA 1JCKB 1V8CA 3Q8FA 4RF0A 2JU6X 1PGBA 1FFVA 5C3JB 3I9V1 3BVGA 1V1PA 1ZDXA 2J52A 2KN4A 3AECB 1J7AA 4DXGA 4DXFA 2INNE 2KAJA 4KGTA 1MHHE 1UWMA 3W9CB 4YSYB 4TMAB 4A9AA 2WQYB 2MEKA 4ZHOA 2LMCA 1TJEA 2SEBD 2R61A 4KGRA 1TS3A 4XWTA 4NZLB 2N9KA 3LXFA 4ZRQA 1WWTA 2M19A 3U52E 1I4PA 3Q8CA 3KWLA 4LTUA 3BWUD 1EU3A 3BVMA 2WXGA 5BMHA 1UWXA 2JQRB 3VR9B 3MP9A 5EE0A 2K22A 2PW9A 2W55A 1C77A 2VZKB 1CZPA 2WLBA 5GXGB 4HKQA 1DOYA 5AUKA 2JZPA 2Y5CA 3W5UB 3OWEB 1KFYB 3N9YC 1I4RA 3GB1A 3R2IA 1F77A 4ARCA 2BTEA 1SB3C 4HROA 1YN3A 1E0ZA 3RPFC 2AQ2B 4A55A 3HUIA 1KRHA 4ZYSA 1PGXA 1BMLC 2W3RA 4XDDA 4Q2JA 5I4DA 4HKZE 4US8A 1SIJA 2KMMA 4HRSA 1NYQA 1TZOA 4JPSA 1C4AA 1EU4A 5LNK1 2WXOA 3PZ8A 4B0MA 3EA6A 1JQ4A 4GDLB 1I4QA 1IBXA 3I57A 3AEBB 1L5PA 1FM0D 1B9RA 1DOIA 1JWUD 4GDKB 4B0EA 4WURA 2M56B 2GB1A 3AE9B 2LEKA 1YQ3B 3R8BA 3ZJTA 4N58A 3VR8B 2INPE 3IAM1 5TSSA 2SAKA 2PTLA 1CQVA 4DQOC 1UGJA 2CU3A 1IUEA 1TKYA 3P4QB 1T6BX 1VZ7A 3ZGZA 1C78A 3AEAB 1ACCA 1JROA 4OZBA 5AUIA 4O1NA 3PO0A 2L1AA 4ARIA 2BS2B 2L83A 3WCQA 3FILB 1V1OA 3PZ7A 1F0ZA 4USAA 1XLPA 3VRBB 3LB8C 2AQ1B 1Q10A 4MACA 2PKOA 2LHDA 4R3DA 3ZQ4A 1FNUA 1OQQA 1QOAA 3AE1B 1UNSA 2WNMA 1JRPA 2K5PA 2FUG1 2DYOA 2RPVA 1GAQB 4LK0M 2PLPA 2QMTA 4ZRPA 2BBCA 1PDXA 1R7SA 1E9MA 1L0YB 3CWIA 3L4PA 1NEKB 1E7PB 2DYMA 2QSDA 1ROEA 1ZE3D 2LGIA 1L0XB 3AEDB 2W3SA 1YNTE 3ZJUA 3E56A 1C4CA 3E9SA 3IAS1 1CK1A 2BYTA 1M4VA 1JWBD 3U2SC 4TQ0A 3MFGA 1FNVA 3BYYB 1FCCC 1FRDA 1XCTL 4RH6A 2H88B 2ZW0A 2EKIA 2IGGA 4REZA 3GS2A 2L32A 3BK1A 4RGTA 1KH0A 2J4XA 1J7CA 1HA5A 4C56C 4WWMA 2WXJA 2PVOD 5D3DA 5D7GA 2NTSA 4JE3B 1C76A 1XO3A 4J3OD 2ON8A 3IT4B 1D5ZC 1FD6A 2K0PA 3CIRB 1ZUD2 3Q8AA 2YEPF 1SEBD 1K53A 3P4SB 3NZ3A 2WXLA 2GI9A 1K50A 1OQRA 4N59A 1JMLA 2IGDA 2ICIA 2TSSA 1SJED 4JWUC 4ZHPA 2PVGC 1I7HA 3NVVA 4UDUC 4A6QA 3W2DA 3AEFB 4XE0A 3SEBA 4YTPB 2B76B 4FXCA 2E6XA 3HRDD 1XLOA 2QILA 3AE3B 4PT5A 4D2KA 2JX5A 2JYTA 1I4XA 4H2AA 1UUPA 1AYFA 2I2YA 1NENB 2FE8A 1SE4A 2K3UA 2WP9B 1RFKA 1SXTA 4WH4A 2LJIA 1RM6C 1DGJA 1ET9A 5EE1A 3KQ4A 4OZAA 1NVID 2RDHA 2MJEA 2Y5PA 2V0GA 2CJNA 2V3PA 1N5WA 2LHEA 2IJ0A 1V1PB 1BUIC 1FNWA 5HG2A 5FK9C 1FEHA 2KQ4X 4WAFA 5G5GA 3TEXA 2WXIA 2PMVA 1KTKA 3NVZA 5H8YE 1RWSA 2IPKD 2JYEA 1WYGA 2K9XA 1TY0A 1BXTA 2BW2A 3MHZA 4EE2A 2JWUA 2IGHA 4GLSC 1K51A 2X38A 3V3XA 4IOIE 1PUTA 4JX1C 1STEA 5C2TB 2I38A 2WS3B 1WSPA 2AQ3B 4IKGA 3TEZA 4YSXB 4C7YA 1FO4A 3VRAB 1PYWD 3LYYA 3O13A 1N63A 3HVZA 1IGDA 4L2YA 1YJIA 3SR6A 1JALA 2NTTA 3UI3A 3IT6B 1D4BA 2EELA 1JW9D 2AX5A 2LFIA 2E3TA 1ESFA 1XF5L 4OVZA 3W1SA 2NMQA 5E6JA 1HXYD 4AQ7A 2KACA 3ETRA 3TUOA 4A90A 1QILA 4IDIA 2BT6A 1FCLA 4WIPA 4XWWA 3FC4A 3SFDB 3H8HA 5EE9A 3AH7A 2HTME 2RDGA 3KLSX 1B1ZA 1L4DB 3AMZA 3EUB2 1P7EA 1SJHD 3AE8B 3AM9A 1F2RC 1F2RI 1KLUD 1TY2A 2WXNA 2V4IB 2BB6A 4TSSA 4ZOHC 2MJ3A 4KX6B 1IBXB 1HQRD 1JWAD 3P1MA 1NYRA 2KDMA 1PGAA 1KF6B 1AWDA 1WGKA 4CQNA 2QEJC 3AB5A 3ZYYX 4OHJA 1GOZA 4C7ZA 1FMAD 4XDCA 3Q8BA 3P4PB 2KWDA 1XCQL 4RGOS 4RGNA 2V3NA 2ZW1A 2WXRA 3TEWA 1N60A 4YWGG 2ACZB 2QIEB 1DOXA 3MC0B 1EM7A 4RNAA 1C9FA 2DWQA 1N61A 1FIQA 1AN8A 2WXKA 1I4HA 1ENFA 1XEEA 1EWCA 1QOBA 2N0SB 1ZPSA 2W82A 4ITKA 3Q8EA 1QT9A 5HHDG 3BVZA 1FXAA 1HZ5A 5EE3A 3T3NA 1ZP0B 3T3OA 2ONQA 4NJCA 4RGMA 1XLQA 3IXSA 1A70A 1IGCA 1MHXA 2Y3AA 4N6EB 2WXPA 2WXFA 2PIAA 3MJ5A 1QLBB 2JXTA 3NS1A 4RF1A 2Z8LA 4NAWB 4JWSC 3RFZB 2VZKD 4MH8A 4MT5A 1ZXIA 3W5VB 3AEGB 3NUHB 2WXMA 2J53A 3SFEB 5T8IA 1PFDA 1WXQA 2JSVX 2OHFA 4HJGE 1ZOYB 5G5HA 1T3QA 1VR9A 1C79A 2FBWB 2MH7A 4TQ1A 2BS4B 2G9HD 3URYA 1L0VB 3DWGC 2DLBA 3P63A 1NI3A 3AE5B 5BMGA 2WDVB 1D5MC 2L52A 2WDQB 3AN1A 3ABVB 4YSZB 2D5GA 4YTNB 2YEPB 3BK2A 1LO5D 2J42A 3Q69A 1SE3A 1L6UA 4C80A 1XLNA 1YMHE 4L1BA 3AE6B 4NAMA 1Y56A 1D5XC 3B2FA 3AE4B 3FILA 3B2GA 4KGSA 1FFUA 2WXQA 1D6EC 2G1EA 3VQIA 3AV8A 1YQ4B 1QOFA 1N62A 1ZXHA 3AEEB 5FKAC 1XXGA 4US9A 1KLGD 2N9LA 1V97A 5HI1A 5JXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7E A;  5BMH A;  1UWX A;  1F2R C;  1F2R I;  2ON8 A;  1FD6 A;  3MP9 A;  1MI0 A;  2PW9 A;  2K0P A;  1HZ6 A;  1IBX B;  1P7F A;  4OZC A;  1K53 A;  2GI9 A;  2JZP A;  1K50 A;  1PGA A;  2KDM A;  1JML A;  2IGD A;  3GB1 A;  5BMI A;  2KWD A;  1XCQ L;  2ZW1 A;  1QKZ A;  2LUM A;  1PGX A;  1GB4 A;  4HKZ E;  1GB1 A;  1EM7 A;  1C9F A;  1MVK A;  5HFY A;  4D2K A;  1IBX A;  2I2Y A;  5HHD G;  2GB1 A;  1HZ5 A;  4WH4 A;  2ONQ A;  4OZA A;  2PTL A;  1HEZ E;  1IGC A;  1MHX A;  2LHE A;  2JXT A;  5HG2 A;  4OZB A;  2KQ4 X;  2OED A;  3FIL B;  2J53 A;  1K52 A;  1MPE A;  2JSV X;  1Q10 A;  4MAC A;  4HJG E;  2JWU A;  2LHD A;  2IGH A;  4GLS C;  1K51 A;  3V3X A;  4IOI E;  2RPV A;  2PLP A;  2N7J A;  2QMT A;  2I38 A;  5BMG A;  4IKG A;  2RMM A;  2QSD A;  2JU6 X;  1PGB A;  2LGI A;  1YNT E;  1YMH E;  2J52 A;  1IGD A;  2KN4 A;  3UI3 A;  3FIL A;  1D4B A;  2EEL A;  4KGS A;  4KGT A;  1MHH E;  1XF5 L;  2NMQ A;  1FCC C;  1XCT L;  4KGR A;  2KAC A;  2ZW0 A;  2N9K A;  1ZXH A;  2IGG A;  1FCL A;  1KH0 A;  2N9L A;  5HI1 A;  5JXV A; 
#chains in the Genus database with same CATH topology
 4BVU C;  2KDB A;  4E71 A;  1TS2 A;  2LRW A;  3AI5 A;  3K9O B;  4RFB A;  1YX6 B;  3P42 A;  1P7F A;  1WF9 A;  4G11 A;  1QQR A;  1EWY C;  2BS3 B;  3FAH A;  3UQA A;  1WM3 A;  1E6E B;  5BMI A;  4HEA 1;  2MJD A;  3DCG A;  4MGY E;  3BY4 B;  3AE7 B;  4KDL B;  2BF8 B;  1I35 A;  4W9C A;  2JY6 A;  3PSE B;  2C5L C;  1KM7 A;  5BYQ A;  2KTF A;  2H89 B;  3GP7 A;  1WJ6 A;  2BPS A;  3VUY A;  1QOG A;  1WX7 A;  1XQQ A;  3ZTC A;  5D2M B;  3DBH I;  1N5X A;  1SE2 A;  2PJH A;  5EDS A;  1HEZ E;  2KMA A;  1FXI A;  1ZDV A;  1RYJ A;  4BKS D;  4S0R A;  3EHV A;  4OW0 A;  5MPO A;  4DHJ D;  3Q3N C;  1K52 A;  4WQM A;  3UF8 A;  2WHI A;  5J2R A;  4FUL A;  3C8Y A;  3KWV A;  2G4S A;  1FRR A;  1SSN A;  2DYB A;  2KFJ A;  4M0W A;  4M00 A;  3Q8F A;  4RF0 A;  3I9V 1;  4BFR A;  4FN2 A;  3A9J A;  3ML8 A;  2KAJ A;  4KGT A;  1UWM A;  3W9C B;  4YSY B;  4A9A A;  2WQY B;  4EZK A;  2MEK A;  4P1C C;  2LMC A;  1TJE A;  1TS3 A;  3UIO B;  5L95 C;  2BYV E;  4NZL B;  1HE8 A;  3ZKJ C;  3L0W B;  4EUT A;  3KWL A;  2K1F A;  3MC9 A;  3BWU D;  2KJH B;  1EU3 A;  4JLC A;  3VR9 B;  3MP9 A;  1R4M I;  1TGZ B;  4GIV A;  5EE0 A;  2MCN B;  2M8S A;  2KHW B;  2JVC A;  1DOY A;  5AUK A;  1WGD A;  2KDE B;  3PS6 A;  3W5U B;  3OWE B;  2J0J A;  1SB3 C;  2AQ2 B;  4EZL A;  4F7Z A;  1KRH A;  1UZX B;  1PGX A;  4XDD A;  4MGI E;  2ZVO A;  4HKZ E;  2KMM A;  1C4A A;  2WXO A;  1S3S G;  3DHI C;  3VUX A;  2J7Q B;  3I57 A;  4PS8 A;  1B9R A;  2LEK A;  2INP E;  1E7V A;  1J8C A;  4HPP A;  3U7D A;  2SAK A;  1CQV A;  4DQO C;  4HDQ A;  2CU3 A;  1TKY A;  3P4Q B;  3DBR I;  2L0F A;  5AUI A;  2KZR A;  2D3G A;  3PZ7 A;  3LB8 C;  2C7N B;  2PKO A;  2KXJ A;  2LHD A;  1RFA A;  3ZQ4 A;  5IKC M;  1QOA A;  1UNS A;  2WNM A;  1LM8 B;  2K5P A;  3JVZ X;  2RPV A;  3EC8 A;  2IO3 B;  4GSW A;  1GAQ B;  4QAY A;  1D3Z A;  1L0Y B;  3MC8 A;  2WX1 A;  4K3B A;  1E5W A;  3ZJU A;  3A1Q A;  1Q0W B;  3ECI A;  1M4V A;  5KHO A;  2WGS A;  3NJT A;  1FNV A;  3BYY B;  4RH6 A;  4I6N B;  1ZKH A;  3IHP C;  2MHJ A;  4REZ A;  2KO3 A;  3BK1 A;  4ICU A;  2J4X A;  4C56 C;  1UD7 A;  1RLF A;  2WXJ A;  2RSU A;  3L10 B;  3RCZ A;  3I5J C;  1ZUD 2;  3OJ3 A;  2X8X X;  2YEP F;  1K53 A;  2A5U A;  3P4S B;  3EFC A;  3NOB A;  1OQR A;  3T8M A;  4N59 A;  2IGD A;  4X57 B;  3RUI B;  4JWU C;  4MH0 E;  4TUU A;  4EFO A;  4KV2 A;  3HK0 A;  2B76 B;  2XK5 A;  2BYE A;  3HRD D;  2QIL A;  2JYT A;  2LJ5 A;  1CMX B;  1UUP A;  2K3U A;  2WP9 B;  2FCQ A;  1RFK A;  2KK8 A;  1DGJ A;  3PHW B;  1JRU A;  4M0W B;  4OZA A;  1V81 A;  1L2N A;  4GB9 A;  2CJN A;  3GOE A;  4OVU A;  2IJ0 A;  3A9J B;  5DPS A;  2BW2 A;  4MM3 A;  4EE2 A;  2ZZP B;  1SE9 A;  3N30 A;  3V3X A;  4IOI E;  3PRE A;  3OAW A;  4JX1 C;  2ZPN A;  2UYZ B;  4WWN A;  2I38 A;  2N9E B;  1WSP A;  3ZRF A;  3V62 A;  4YSX B;  1Y8R C;  3LYY A;  1GC6 A;  3O13 A;  1TTN A;  4P1B C;  3SR6 A;  3UI3 A;  1D4B A;  2KJ6 A;  3NZS A;  4LNI A;  1GNU A;  2IY1 B;  2CR5 A;  2NPT A;  2B3A A;  2KAC A;  3ETR A;  2JWZ A;  1MG8 A;  2MRP A;  3FC4 A;  3GE8 C;  4M02 A;  3AH7 A;  4PK1 A;  4ACF A;  1SJH D;  3AE8 B;  3UIN B;  3C0R B;  1F2R C;  4E3C A;  1KLU D;  2V4I B;  4TSS A;  4ZOH C;  3QX1 A;  4KX6 B;  3U8Z A;  2MA9 B;  1JWA D;  2DZK A;  2NBW B;  1NYR A;  1KF6 B;  3DHH C;  1WGK A;  4C7Z A;  4LCD E;  1FMA D;  4XDC A;  3Q8B A;  1ZW7 A;  3AU4 A;  2C7H A;  1XCQ L;  4RGO S;  3B08 A;  2MBE A;  2ZW1 A;  3TEW A;  4HXD A;  2ACZ B;  2QIE B;  1DOX A;  3MC0 B;  5DCN A;  1EM7 A;  3DVG X;  2DWQ A;  1N61 A;  1AN8 A;  1FPY A;  2ZCC A;  2J0K A;  2M17 A;  1XEE A;  3DVN V;  3KH0 A;  1QT9 A;  2RDB C;  3BVZ A;  4ZRI A;  4ZRK A;  1HZ5 A;  3APF A;  3LDZ E;  2CHZ A;  3IXS A;  3L08 A;  2Y3A A;  1QLB B;  2JXT A;  4DHZ B;  4NAW B;  4JWS C;  3A1Q B;  3L54 A;  4MT5 A;  3AEG B;  4K7S A;  2PPH A;  2WXM A;  1VCB A;  2J53 A;  5T8I A;  3U30 A;  1PFD A;  1WXQ A;  1MG4 A;  4PYU A;  2EKE C;  1I42 A;  2BS4 B;  3URY A;  1L0V B;  2DLB A;  4A3P A;  1F9J A;  2WDV B;  3PPA A;  3QK0 A;  4ANX A;  2OOB B;  5CHW A;  2GBJ A;  2Y5B B;  2J42 A;  5AZF A;  3M95 A;  1P1A A;  1SE3 A;  4HWI B;  1E8Y A;  3RT3 B;  3ZXR A;  1N6Z A;  4C80 A;  4L1B A;  1TIF A;  4C00 A;  4K7U A;  4B9K A;  4WJQ A;  3JYU A;  3PRZ A;  2KWU B;  1WM2 A;  4I6P A;  5JZE B;  1QOF A;  1N62 A;  1UEL A;  4MDK E;  1ZXH A;  5LXI B;  3R3M A;  4XX5 A;  1KLG D;  1T0S C;  2N9L A;  3X23 A;  4IUM B;  4AUQ C;  3PV1 A;  5CX3 A;  2XK5 B;  4FJY A;  1DYQ A;  3U7Z A;  1HZ6 A;  3CST A;  3B0A A;  2D2Q A;  1TS5 A;  4CO7 A;  2WDR B;  3ZIM A;  4B6W A;  1VLB A;  2IO2 B;  2QDF A;  1I4G A;  2W54 A;  1GG3 A;  2Z0E B;  5BO4 B;  2CKH B;  4KKI A;  4ZYN A;  2DAF A;  2W9N A;  3H7P A;  3ALB A;  2D11 A;  5CHF A;  3DQV A;  2XN9 C;  2Q5W D;  5H92 C;  3A9K A;  1WR1 A;  1TKG A;  2KVZ A;  4DDI D;  1MVK A;  2BWF A;  4GMV A;  4AS1 A;  1J7B A;  1UBQ A;  4MM3 B;  2WX0 A;  2K25 A;  2M0A A;  4FBJ B;  1VRA B;  4RM9 A;  4URK A;  2MBB B;  3QC8 B;  3W1S C;  2HDE A;  3H1U A;  4II3 B;  4KZC A;  5FR6 A;  2WU5 B;  3NG0 A;  3NRZ A;  2BQQ A;  2OED A;  1OFF A;  2KOX A;  3NY5 A;  3BYT B;  1MPE A;  3NVW A;  2NPT B;  1YJJ A;  2G3Q B;  5IN7 A;  4L23 A;  3BZD B;  2GRI A;  4YL8 A;  3KUD B;  1JCK B;  4HDO A;  2JU6 X;  1FFV A;  4FJZ A;  4W9L A;  1GC7 A;  1ZDX A;  2J52 A;  4DXG A;  4DXF A;  4G50 A;  2KTR A;  3WAO A;  1WRD B;  1MHH E;  2K6Q A;  3Q3F A;  2R61 A;  2ZNV B;  3A33 B;  2AWT A;  4ZRQ A;  5IA7 A;  3ZXV A;  4LTU A;  1T0Q C;  1OTR B;  2QHO A;  3BVM A;  5BMH A;  2JQR B;  2KWV B;  1C77 A;  2YLM A;  3H6N A;  3NZU A;  2Y5C A;  3N9Y C;  1I4R A;  3R2I A;  2BTE A;  1F77 A;  4W9K A;  5DPT A;  1TT5 B;  4HRO A;  1UBI A;  3RPF C;  3P2B A;  1BML C;  4Q2J A;  1OEY A;  2HJ8 A;  1F1H A;  5TR5 A;  5J18 A;  1EU4 A;  5LNK 1;  3A4R A;  3EA6 A;  3R7R A;  1IBX A;  2FIF A;  1FM0 D;  1DOI A;  1JWU D;  4GDK B;  4B0E A;  2M56 B;  3R8B A;  1YQ3 B;  4WJO A;  3IAM 1;  5TSS A;  1WE7 A;  1MJD A;  4DWF A;  3AEA B;  4OZB A;  4O1N A;  3PO0 A;  2L1A A;  4ARI A;  3H7S A;  3V6C B;  1Q10 A;  4R3D A;  3JSV A;  2DZJ A;  2PLP A;  3NHE B;  4LK0 M;  1WE6 A;  5E6N A;  3V6E B;  4A20 A;  2BBC A;  1FXT B;  2K8B A;  1NEK B;  2DYM A;  4XZ4 A;  1ZE3 D;  2LGI A;  2W3S A;  1YNT E;  2I1J A;  3JW0 X;  2RR9 A;  3ZUN A;  2L05 A;  3BIN A;  4ZRJ A;  2DEN B;  3MFG A;  1J19 A;  1ISN A;  1FRD A;  1NBF C;  3RNC C;  2IGG A;  3H7P B;  1WX8 A;  3GS2 A;  3RN9 C;  2L76 A;  4NJ7 A;  1HA5 A;  4WWM A;  5D3D A;  2AYO B;  4LNN A;  1Q1O A;  5C1Z A;  1FD6 A;  3K9P B;  2UWQ A;  2N1W A;  3CIR B;  3Q8A A;  3W1Y A;  1SEB D;  2GBR A;  2J0M A;  4NQL B;  3NZ3 A;  1EUV B;  4WQO B;  1K50 A;  1WJ4 A;  4GN1 A;  3VH4 B;  4DXA B;  2ICI A;  1NDD A;  2PVG C;  3NVV A;  4A6Q A;  3W2D A;  2G45 B;  2LVP A;  2IND C;  3AE3 B;  2IY0 B;  4GDL A;  2JX5 A;  2FNJ B;  4F8C B;  2FCM A;  1NEN B;  1KJT A;  5DPR A;  3I63 C;  3WAP A;  4C4V A;  1SXT A;  2BKF A;  1ET9 A;  3PHX B;  2V0G A;  4J6I A;  3TMP B;  2KMC A;  1BUI C;  2D07 B;  5FK9 C;  3TEX A;  2PMV A;  1KTK A;  1RWS A;  2IPK D;  2V4L A;  2KTR B;  1WJN A;  2K9X A;  1Z2M A;  2JWU A;  2IGH A;  1K51 A;  4ASW C;  2VH1 A;  3N20 C;  4IKG A;  3N1X C;  2DX5 B;  3VRA B;  1PYW D;  4MSQ B;  4WAA A;  4FHJ A;  1N63 A;  1WI0 A;  3SDL C;  3HVZ A;  1JAL A;  2NTT A;  4KSK C;  2EEL A;  2AX5 A;  1ESF A;  1XF5 L;  3N3K B;  4IWQ A;  4WWO A;  2KVR A;  4K81 A;  4EZJ A;  3Q14 C;  3AXC A;  4IM0 A;  1FCL A;  1AAR A;  4WIP A;  2D3B A;  5EE9 A;  3H9D A;  1L4D B;  1P7E A;  1V9J A;  3KW5 B;  1F2R I;  2GOW A;  4CYE A;  2K8H A;  1IBX B;  2REX A;  1HQR D;  3P1M A;  3AB5 A;  1GOZ A;  4M8N A;  4IWP A;  4AJY B;  2JPH A;  2LVO A;  5G55 A;  1SIF A;  1WXM A;  2LXC A;  1WZ0 A;  3VH3 B;  3HHM A;  3PVL A;  1C9F A;  1FIQ A;  3VUW A;  2WXK A;  1V86 A;  2JUO A;  1QOB A;  2N0S B;  1ZPS A;  2W82 A;  3JSV B;  2NVU I;  4A3O A;  4B95 A;  3DVN U;  3T3N A;  4BBN F;  1LGR A;  1XLQ A;  1IGC A;  3APC A;  4N6E B;  2WXP A;  4RF1 A;  3WAL A;  3NS1 A;  2Z8L A;  2FAZ A;  4MH8 A;  3W5V B;  1ZXI A;  4LJP B;  3L16 A;  3OG5 A;  3NUH B;  2KDI A;  2MX2 A;  2HE7 A;  4HJG E;  1ZOY B;  3Q3J A;  1T3Q A;  2DNF A;  1VR9 A;  1C79 A;  2FBW B;  4M01 A;  5AEK B;  2C60 A;  3DBL B;  2LGD A;  4KSL C;  2CS4 A;  4XC2 A;  2L52 A;  3AN1 A;  3ABV B;  4YSZ B;  1V6E A;  1L6U A;  2AEH A;  1XLN A;  1YMH E;  1WMH A;  2YVC A;  3AE4 B;  4N9F 4;  3FIL A;  3B2G A;  4KGS A;  2CHW A;  3GZN B;  4ANV A;  3TIX A;  2WXQ A;  1R4N B;  2G1E A;  1YQ4 B;  3R7Q A;  2MQJ A;  5JHA A;  3B1L X;  4WWP A;  1V97 A;  5JXV A;  3AE2 B;  4NJ6 A;  4GXB A;  4BOZ B;  4HPL B;  2M0X A;  1MI0 A;  4MEM A;  4MEL A;  1RRB A;  2JRH A;  2GLS A;  1PQS A;  4OZC A;  5JHB A;  4A8X C;  2WXH A;  4C4V B;  1JWM D;  2LI5 A;  4ZDV A;  4K7W A;  3TSS A;  1CJE A;  4P6V F;  3IFW B;  2LUM A;  4JL9 A;  1YN4 A;  3RI7 C;  2QJL A;  1YD8 U;  1WGR A;  2EMT A;  4HK2 A;  3A4S C;  3B9J A;  1L4Z B;  1ET6 A;  2MLB A;  5FR3 A;  4FJV B;  2O6V A;  4GOC A;  2KN5 A;  4W9F A;  2LXA A;  1E10 A;  4ICV A;  4IM2 A;  1YN5 A;  2DBY A;  5BYS A;  3R2T A;  3KYC D;  4WJN A;  4TV3 A;  1WFY A;  4XGA B;  3OJ4 B;  2CJO A;  1SBB B;  2PE9 A;  4KKJ A;  1XT9 B;  1Z5S B;  2IDY A;  3ZNI D;  3TEY A;  2BKR B;  5IO9 A;  3APD A;  1TS4 A;  4I6L B;  4YTM B;  4OVV A;  2WU2 B;  2N7J A;  4JGH B;  1QF6 A;  1V8C A;  3ENE A;  4AOF A;  2ZNV C;  4BAX A;  5C3J B;  3V60 A;  3BVG A;  3Q3O C;  2KN4 A;  4PYZ A;  1OGW A;  2INN E;  2QC8 A;  2L7R A;  4TMA B;  2C9W B;  2SEB D;  2WYQ A;  4ANU A;  3MHS D;  2WWZ A;  3PRM B;  1WWT A;  3ZDT A;  1I4P A;  1LQB A;  5AZH A;  1UWX A;  1F52 A;  3QIJ A;  2W55 A;  2PW9 A;  2VZK B;  1CZP A;  2WLB A;  2KFK A;  5GXG B;  4HKQ A;  2ZVN A;  4IM3 A;  1KFY B;  2JZ3 B;  1YX5 B;  2FCN A;  3GB1 A;  1YN3 A;  1E0Z A;  4A55 A;  1R4M B;  3HUI A;  2HTH A;  5I4D A;  2LGX A;  1SIJ A;  4HRS A;  4JPS A;  3PZ8 A;  4B0M A;  1OEY J;  1JQ4 A;  2IZV B;  3VAW A;  3L17 A;  1L5P A;  2N1V A;  4WUR A;  3AE9 B;  4BKT A;  4N58 A;  2MBO A;  3VTV A;  1UGJ A;  4TKN A;  3IBE A;  1VZ7 A;  2D3C A;  1G6J A;  1WMH B;  3RNE C;  2BS2 B;  2L83 A;  2MBH A;  3FIL B;  1V1O A;  1F0Z A;  2N7D A;  3VRB B;  2NBV B;  2ZEQ A;  4MAC A;  1U4A A;  3QHT A;  3X0W A;  1UF0 A;  3AE1 B;  2MSE D;  4HCN B;  3DBR B;  5IAA C;  4ZRP A;  1M94 A;  1PDX A;  1R7S A;  1E9M A;  1E7P B;  2QSD A;  2FUH B;  3QQ8 B;  3CMM B;  3AED B;  2KWC A;  1L0X B;  4IWO A;  3E56 A;  1C4C A;  3E9S A;  3IAS 1;  1IP9 A;  1E8Z A;  1CK1 A;  3ZRC A;  1E7U A;  1GUA B;  3U2S C;  4FAD A;  1GJZ A;  1H4R A;  4KZ0 A;  1XCT L;  3WAM A;  2H88 B;  2ZW0 A;  2PE6 B;  1YIW A;  1QZE A;  1Q5W B;  1L7Y A;  4RGT A;  1YQB A;  2KX0 A;  1J7C A;  4JIO U;  5J17 A;  2PVO D;  3PLV A;  5D7G A;  4FA6 A;  4JE3 B;  1C76 A;  1XO3 A;  4J3O D;  2ON8 A;  2NS5 A;  3SD5 A;  2L3Z A;  2K0P A;  3N1Y C;  3ZLZ A;  2GI9 A;  4W9G A;  2O6V B;  4KVG B;  3ZVV A;  4ZHP A;  1WXV A;  3OLM D;  5CHV C;  4P7I A;  2IYD B;  4FXC A;  3VTU A;  4HLE A;  4WJP A;  2E6X A;  3RZW C;  2KQS A;  4H2A A;  1P98 A;  4HCP B;  1SE4 A;  1EO6 A;  5IOI A;  4KIK A;  2LJI A;  1RM6 C;  4MSM B;  4WH4 A;  5LXH A;  1X1M A;  3HM3 A;  5EE1 A;  3KQ4 A;  3C19 A;  1NVI D;  2RDH A;  2MJE A;  3DPD A;  4BKG A;  2V3P A;  3AU5 A;  2LHE A;  5HG2 A;  1FNW A;  2KQ4 X;  4WAF A;  5G5G A;  5H8Y E;  2IO1 B;  4EOY A;  2JYE A;  1WYG A;  2CHX A;  1TY0 A;  1BXT A;  3MHZ A;  2JF5 A;  2AL3 A;  2MBQ A;  2LGY A;  4GLS C;  1WY8 A;  3L13 A;  2X38 A;  4HJK A;  4LNK A;  1STE A;  5C2T B;  2WS3 B;  1C1Y B;  1HTO A;  4C7Y A;  1FO4 A;  3EEC A;  4AWJ A;  3ONS A;  3VFK A;  4DBG A;  1IGD A;  4L2Y A;  2RPQ A;  1V5T A;  3VDZ A;  2LFI A;  2KFK B;  2E3T A;  4FHK A;  2I1K A;  5E6J A;  1HXY D;  1V5O A;  4E74 A;  3Q3M C;  4AQ7 A;  3TUO A;  4A90 A;  1QIL A;  4IDI A;  2BT6 A;  3N1Z C;  3H8H A;  2HTM E;  2RDG A;  1B1Z A;  4NY0 A;  3EUB 2;  3AM9 A;  2WXN A;  4DDG D;  3RMK C;  3WIM A;  2KLC A;  5CTR C;  2KDM A;  1PGA A;  1AWD A;  2QEJ C;  2LZ6 A;  3VHT C;  3ZYY X;  4BZA A;  1WJU A;  2KWD A;  2JZZ A;  4RGN A;  2V3N A;  3PLU A;  3T9L A;  3RNA C;  3A9K B;  4W9D A;  5D6J B;  1YJ1 A;  2CU1 A;  2O6V D;  4IG7 B;  2XEW A;  1EWC A;  2AL6 A;  2EMS A;  3Q8E A;  5HHD G;  1IYF A;  5EE3 A;  1ZP0 B;  3QJZ A;  2KAN A;  2ONQ A;  4NJC A;  3R66 C;  4RGM A;  1A70 A;  1MHX A;  2V9H A;  2WXF A;  3MJ5 A;  4MJS A;  3KUC B;  1P3Q U;  2D10 A;  2V3S A;  2ZJD A;  4PS7 A;  2LVQ A;  4LNO A;  3SFE B;  2RGF A;  2OHF A;  2MP2 A;  4MGZ E;  2G9H D;  3DWG C;  3P63 A;  2WDQ B;  2BWE S;  2D5G A;  2YEP B;  3BK2 A;  4NAM A;  1Y56 A;  4II2 B;  2KLG A;  3B2F A;  4LNF A;  2R2O A;  1K8R B;  1C3T A;  2KJR A;  3LJ3 A;  3TCA A;  1FFU A;  2JT4 B;  1D6E C;  3DVG Y;  4EKU A;  1NI2 A;  4LDT B;  5FKA C;  1XXG A;  4US9 A;  1RAX A;  5HI1 A;  4GGQ A;  1VZ8 A;  3PTF C;  1MFW A;  2V1Y A;  2C7M B;  4HPM B;  1LXD A;  4P16 A;  1H8C A;  1VJK A;  1TZ1 A;  3D32 A;  1YOV B;  3ZJV A;  3V05 A;  4K3C A;  3EFU A;  3KVF B;  1T0R C;  4KIK B;  4YT0 B;  4LLG M;  4YXD B;  1WIA A;  3J9C A;  5D94 A;  1QKZ A;  1WYW B;  1L6V A;  1GB4 A;  1GB1 A;  3ZDM C;  2Z0D B;  3BII D;  2NBU A;  3ML9 A;  1T5X D;  5D3I B;  5HKH A;  2LWP A;  1WRI A;  3KUZ A;  5HFY A;  5KHQ A;  2BGF A;  1TKE A;  2Z59 B;  3U4E G;  2HJ1 A;  3DOW A;  1GPX A;  5IP4 D;  2BB5 A;  3QWZ B;  4M8M A;  4RM8 A;  3RNB C;  5BYR A;  3DWM A;  1VZ6 A;  4NAW A;  4LJO B;  1C4P A;  3ZW3 A;  3I3T B;  3EGR A;  4RCO A;  2R2Q A;  1TYG B;  5DPW A;  1TBE A;  3HVD A;  1JWS D;  2OJR A;  3HM6 X;  3NVY A;  1V2Y A;  5E6P A;  2KC2 A;  2XNA C;  4JQW C;  3P4R B;  1SF0 A;  2ZCB A;  4G3X B;  4RMA A;  1AW7 A;  3RYT A;  2MWS B;  4EEW A;  1VDV A;  3TJP A;  2NR2 A;  5G2N A;  3VVW B;  2RMM A;  1PGB A;  2HD5 B;  3DBS A;  4BOS C;  2UU7 A;  2DAJ A;  1V1P A;  4IC7 B;  3AEC B;  1J7A A;  3PT2 B;  2GBK A;  3SU8 X;  1J0G A;  4ZHO A;  4KGR A;  1WZ3 A;  2GMI C;  4XWT A;  2N9K A;  5LLI A;  3LXF A;  2M19 A;  3U52 E;  3Q8C A;  4W9H A;  3UGB B;  3AUL A;  3QCA A;  1V49 A;  3ZO5 B;  2WXG A;  2KKC A;  3ZNH B;  4W9I A;  2K22 A;  3RNF C;  1BT0 A;  4LDT D;  2JZP A;  1WXS A;  4ARC A;  2VRR B;  2N7E A;  4DHZ E;  4MJS B;  4ZYS A;  2W3R A;  4US8 A;  2ASQ A;  1NYQ A;  1TZO A;  1LFD A;  2O2V A;  4GDL B;  1I4Q A;  3AEB B;  2JXX A;  2MP2 B;  4FLH A;  2GB1 A;  3ZJT A;  3TL5 A;  3VR8 B;  2A4Z A;  2LGS A;  2PTL A;  3NS8 A;  4G0N B;  1IUE A;  2MW5 A;  3ZGZ A;  1T6B X;  1C78 A;  1ACC A;  1JRO A;  3WCQ A;  3MTN B;  3FKY A;  4USA A;  1XLP A;  2AQ1 B;  3RZF A;  4BKS A;  1UGM A;  3DDC B;  1FNU A;  1OQQ A;  1JRP A;  2FUG 1;  3SHQ A;  2DYO A;  2QMT A;  3M3J A;  4S17 A;  3CWI A;  2GBN A;  3L4P A;  1S1Q B;  1ROE A;  2N9X A;  2K6D B;  2BYT A;  1JWB D;  3DBH B;  4TQ0 A;  2G4D B;  4KDI C;  1WXA A;  1FCC C;  1P9D U;  2ZPY A;  3VXW A;  1WGG A;  3RD2 A;  2LAS A;  2EKI A;  4ANW A;  1V80 A;  2L32 A;  1KH0 A;  3VTW A;  1KOT A;  2M1M A;  2BVC A;  2LUE A;  2NTS A;  4W9J A;  2JRI B;  2OJW A;  1D5Z C;  2KC1 A;  3IT4 B;  2QCZ A;  3RUL A;  2PEA A;  2RD0 A;  1A5R A;  3QAQ A;  4DK5 A;  2WXL A;  3S2A A;  1JML A;  5C23 A;  2WDT B;  2K8C A;  2IO0 B;  2TSS A;  1SJE D;  3IG3 A;  1I7H A;  4MGK E;  4UDU C;  2INC C;  3AEF B;  4XE0 A;  3SEB A;  4YTP B;  3O65 B;  1XLO A;  4PS3 A;  4PT5 A;  4D2K A;  1I4X A;  1AYF A;  2I2Y A;  3N32 A;  2FE8 A;  2KD0 A;  4GDK A;  4AJW A;  5GMV A;  1E8X A;  2Y5P A;  1N5W A;  2KNB A;  1V1P B;  3PGE A;  1FEH A;  3QA8 A;  2WXI A;  3NVZ A;  2L0T A;  2FCS A;  2L8J A;  2LD9 A;  3MJW A;  4F1S A;  3UIP B;  2N9P C;  1PUT A;  2KX3 A;  3M62 B;  2AQ3 B;  1WH3 A;  2IBI B;  3TEZ A;  2DZI A;  3CF6 E;  2FID A;  1ZGU B;  3TBL D;  1YJI A;  3WA0 A;  3IT6 B;  3PRP B;  1JW9 D;  3KYD D;  5JH5 C;  3HIZ A;  1EF5 A;  4OVZ A;  3W1S A;  2NMQ A;  2KT7 A;  2M4N A;  4XWW A;  3SFD B;  4NNJ B;  3CSF A;  2KYW A;  4HVB A;  3KLS X;  3AMZ A;  4NQK E;  1TY2 A;  2DZM A;  2BB6 A;  2N4F A;  2MJ3 A;  3PZD A;  2O2V B;  3V61 A;  2NCN A;  2KQ7 A;  3DHG C;  4CQN A;  4OHJ A;  3WAN A;  2L00 B;  3P4P B;  3UQB A;  1KLV A;  1VD2 A;  2WXR A;  1N60 A;  4YWG G;  5AZG A;  3RNG C;  4RNA A;  4GU2 A;  1I4H A;  1WGY A;  1ENF A;  3Q6B A;  4ITK A;  4DHJ B;  1FXA A;  2K39 A;  3ZNZ B;  3T3O A;  1T0Y A;  3DBL I;  1E90 A;  2PIA A;  3M63 B;  2BYF A;  3RFZ B;  2VZK D;  4IW0 A;  4NPN A;  1WGH A;  2GBM A;  4W9E A;  1EF1 A;  1XD3 B;  4CHK A;  2XBB C;  2JSV X;  5G5H A;  5E6O A;  4BBN C;  2VH2 A;  2MH7 A;  4TQ1 A;  3GZN I;  4K1R B;  1NI3 A;  3AE5 B;  5BMG A;  1D5M C;  2D3A A;  1R4N I;  4YTN B;  1LO5 D;  5L83 A;  3Q2A C;  3GE3 C;  3Q69 A;  4XYC A;  1P0R A;  3QAR A;  3AE6 B;  3ZTD A;  1D5X C;  2KDF B;  1HTQ A;  1IPG A;  1UH6 A;  4AP4 C;  2DHZ A;  2LRU A;  1SGH A;  3VQI A;  3AV8 A;  1E8W A;  3ZNG C;  3AEE B;  3IVF A;  1WR6 E;  1OQY A;  1WX9 A; 
#chains in the Genus database with same CATH homology
 1VZ8 A;  3AE2 B;  1TS2 A;  4RFB A;  1MI0 A;  1DYQ A;  3U7Z A;  1HZ6 A;  4P16 A;  1VJK A;  1TS5 A;  3P42 A;  2WDR B;  1P7F A;  3ZJV A;  1VLB A;  4OZC A;  1QQR A;  1EWY C;  3V05 A;  4A8X C;  1I4G A;  2BS3 B;  2WXH A;  2W54 A;  3FAH A;  1E6E B;  1JWM D;  4KKI A;  5BMI A;  4HEA 1;  3TSS A;  2MJD A;  4YT0 B;  4LLG M;  4YXD B;  1CJE A;  3AE7 B;  4P6V F;  3J9C A;  1QKZ A;  2LUM A;  1L6V A;  2XN9 C;  1GB4 A;  2Q5W D;  5H92 C;  1YN4 A;  1GB1 A;  1TKG A;  2QJL A;  3BII D;  5BYQ A;  2H89 B;  1MVK A;  3GP7 A;  1T5X D;  5D3I B;  4AS1 A;  1J7B A;  4MM3 B;  1WRI A;  5HFY A;  1QOG A;  3B9J A;  2M0A A;  1TKE A;  1L4Z B;  1ET6 A;  5FR3 A;  1VRA B;  1N5X A;  1SE2 A;  3U4E G;  1GPX A;  2HDE A;  1E10 A;  1HEZ E;  2BB5 A;  1FXI A;  1YN5 A;  2DBY A;  5BYS A;  3R2T A;  2WU5 B;  1ZDV A;  5BYR A;  3DWM A;  1VZ6 A;  3NRZ A;  1C4P A;  1RYJ A;  2OED A;  1OFF A;  4OW0 A;  5MPO A;  3EGR A;  2CJO A;  1SBB B;  3BYT B;  1TYG B;  4RCO A;  4KKJ A;  1K52 A;  1MPE A;  3HVD A;  1JWS D;  2IDY A;  3NVY A;  4WQM A;  3TEY A;  3NVW A;  2XNA C;  1YJJ A;  3C8Y A;  3KWV A;  1SF0 A;  1TS4 A;  3P4R B;  4YTM B;  2WU2 B;  4L23 A;  2N7J A;  1AW7 A;  1FRR A;  1SSN A;  3BZD B;  1QF6 A;  1VDV A;  2GRI A;  4M0W A;  2RMM A;  1JCK B;  1V8C A;  3Q8F A;  4RF0 A;  2JU6 X;  1PGB A;  1FFV A;  5C3J B;  3I9V 1;  3BVG A;  1V1P A;  1ZDX A;  2J52 A;  2KN4 A;  3AEC B;  1J7A A;  4DXG A;  4DXF A;  2INN E;  2KAJ A;  4KGT A;  1MHH E;  1UWM A;  3W9C B;  4YSY B;  4TMA B;  4A9A A;  2WQY B;  2MEK A;  4ZHO A;  2LMC A;  1TJE A;  2SEB D;  2R61 A;  4KGR A;  1TS3 A;  4XWT A;  4NZL B;  2N9K A;  3LXF A;  4ZRQ A;  1WWT A;  2M19 A;  3U52 E;  1I4P A;  3Q8C A;  3KWL A;  4LTU A;  3BWU D;  1EU3 A;  3BVM A;  2WXG A;  5BMH A;  1UWX A;  2JQR B;  3VR9 B;  3MP9 A;  5EE0 A;  2K22 A;  2PW9 A;  2W55 A;  1C77 A;  2VZK B;  1CZP A;  2WLB A;  5GXG B;  4HKQ A;  1DOY A;  5AUK A;  2JZP A;  2Y5C A;  3W5U B;  3OWE B;  1KFY B;  3N9Y C;  1I4R A;  3GB1 A;  3R2I A;  1F77 A;  4ARC A;  2BTE A;  1SB3 C;  4HRO A;  1YN3 A;  1E0Z A;  3RPF C;  2AQ2 B;  4A55 A;  3HUI A;  1KRH A;  4ZYS A;  1PGX A;  1BML C;  2W3R A;  4XDD A;  4Q2J A;  5I4D A;  4HKZ E;  4US8 A;  1SIJ A;  2KMM A;  4HRS A;  1NYQ A;  1TZO A;  4JPS A;  1C4A A;  1EU4 A;  5LNK 1;  2WXO A;  3PZ8 A;  4B0M A;  3EA6 A;  1JQ4 A;  4GDL B;  1I4Q A;  1IBX A;  3I57 A;  3AEB B;  1L5P A;  1FM0 D;  1B9R A;  1DOI A;  1JWU D;  4GDK B;  4B0E A;  4WUR A;  2M56 B;  2GB1 A;  3AE9 B;  2LEK A;  1YQ3 B;  3R8B A;  3ZJT A;  4N58 A;  3VR8 B;  2INP E;  3IAM 1;  5TSS A;  2SAK A;  2PTL A;  1CQV A;  4DQO C;  1UGJ A;  2CU3 A;  1IUE A;  1TKY A;  3P4Q B;  1T6B X;  1VZ7 A;  3ZGZ A;  1C78 A;  3AEA B;  1ACC A;  1JRO A;  4OZB A;  5AUI A;  4O1N A;  3PO0 A;  2L1A A;  4ARI A;  2BS2 B;  2L83 A;  3WCQ A;  3FIL B;  1V1O A;  3PZ7 A;  1F0Z A;  4USA A;  1XLP A;  3VRB B;  3LB8 C;  2AQ1 B;  1Q10 A;  4MAC A;  2PKO A;  2LHD A;  4R3D A;  3ZQ4 A;  1FNU A;  1OQQ A;  1QOA A;  3AE1 B;  1UNS A;  2WNM A;  1JRP A;  2K5P A;  2FUG 1;  2DYO A;  2RPV A;  1GAQ B;  4LK0 M;  2PLP A;  2QMT A;  4ZRP A;  2BBC A;  1PDX A;  1R7S A;  1E9M A;  1L0Y B;  3CWI A;  3L4P A;  1NEK B;  1E7P B;  2DYM A;  2QSD A;  1ROE A;  1ZE3 D;  2LGI A;  1L0X B;  3AED B;  2W3S A;  1YNT E;  3ZJU A;  3E56 A;  1C4C A;  3E9S A;  3IAS 1;  1CK1 A;  2BYT A;  1M4V A;  1JWB D;  3U2S C;  4TQ0 A;  3MFG A;  1FNV A;  3BYY B;  1FCC C;  1FRD A;  1XCT L;  4RH6 A;  2H88 B;  2ZW0 A;  2EKI A;  2IGG A;  4REZ A;  3GS2 A;  2L32 A;  3BK1 A;  4RGT A;  1KH0 A;  2J4X A;  1J7C A;  1HA5 A;  4C56 C;  4WWM A;  2WXJ A;  2PVO D;  5D3D A;  5D7G A;  2NTS A;  4JE3 B;  1C76 A;  1XO3 A;  4J3O D;  2ON8 A;  3IT4 B;  1D5Z C;  1FD6 A;  2K0P A;  3CIR B;  1ZUD 2;  3Q8A A;  2YEP F;  1SEB D;  1K53 A;  3P4S B;  3NZ3 A;  2WXL A;  2GI9 A;  1K50 A;  1OQR A;  4N59 A;  1JML A;  2IGD A;  2ICI A;  2TSS A;  1SJE D;  4JWU C;  4ZHP A;  2PVG C;  1I7H A;  3NVV A;  4UDU C;  4A6Q A;  3W2D A;  3AEF B;  4XE0 A;  3SEB A;  4YTP B;  2B76 B;  4FXC A;  2E6X A;  3HRD D;  1XLO A;  2QIL A;  3AE3 B;  4PT5 A;  4D2K A;  2JX5 A;  2JYT A;  1I4X A;  4H2A A;  1UUP A;  1AYF A;  2I2Y A;  1NEN B;  2FE8 A;  1SE4 A;  2K3U A;  2WP9 B;  1RFK A;  1SXT A;  4WH4 A;  2LJI A;  1RM6 C;  1DGJ A;  1ET9 A;  5EE1 A;  3KQ4 A;  4OZA A;  1NVI D;  2RDH A;  2MJE A;  2Y5P A;  2V0G A;  2CJN A;  2V3P A;  1N5W A;  2LHE A;  2IJ0 A;  1V1P B;  1BUI C;  1FNW A;  5HG2 A;  5FK9 C;  1FEH A;  2KQ4 X;  4WAF A;  5G5G A;  3TEX A;  2WXI A;  2PMV A;  1KTK A;  3NVZ A;  5H8Y E;  1RWS A;  2IPK D;  2JYE A;  1WYG A;  2K9X A;  1TY0 A;  1BXT A;  2BW2 A;  3MHZ A;  4EE2 A;  2JWU A;  2IGH A;  4GLS C;  1K51 A;  2X38 A;  3V3X A;  4IOI E;  1PUT A;  4JX1 C;  1STE A;  5C2T B;  2I38 A;  2WS3 B;  1WSP A;  2AQ3 B;  4IKG A;  3TEZ A;  4YSX B;  4C7Y A;  1FO4 A;  3VRA B;  1PYW D;  3LYY A;  3O13 A;  1N63 A;  3HVZ A;  1IGD A;  4L2Y A;  1YJI A;  3SR6 A;  1JAL A;  2NTT A;  3UI3 A;  3IT6 B;  1D4B A;  2EEL A;  1JW9 D;  2AX5 A;  2LFI A;  2E3T A;  1ESF A;  1XF5 L;  4OVZ A;  3W1S A;  2NMQ A;  5E6J A;  1HXY D;  4AQ7 A;  2KAC A;  3ETR A;  3TUO A;  4A90 A;  1QIL A;  4IDI A;  2BT6 A;  1FCL A;  4WIP A;  4XWW A;  3FC4 A;  3SFD B;  3H8H A;  5EE9 A;  3AH7 A;  2HTM E;  2RDG A;  3KLS X;  1B1Z A;  1L4D B;  3AMZ A;  3EUB 2;  1P7E A;  1SJH D;  3AE8 B;  3AM9 A;  1F2R C;  1F2R I;  1KLU D;  1TY2 A;  2WXN A;  2V4I B;  2BB6 A;  4TSS A;  4ZOH C;  2MJ3 A;  4KX6 B;  1IBX B;  1HQR D;  1JWA D;  3P1M A;  1NYR A;  2KDM A;  1PGA A;  1KF6 B;  1AWD A;  1WGK A;  4CQN A;  2QEJ C;  3AB5 A;  3ZYY X;  4OHJ A;  1GOZ A;  4C7Z A;  1FMA D;  4XDC A;  3Q8B A;  3P4P B;  2KWD A;  1XCQ L;  4RGO S;  4RGN A;  2V3N A;  2ZW1 A;  2WXR A;  3TEW A;  1N60 A;  4YWG G;  2ACZ B;  2QIE B;  1DOX A;  3MC0 B;  1EM7 A;  4RNA A;  1C9F A;  2DWQ A;  1N61 A;  1FIQ A;  1AN8 A;  2WXK A;  1I4H A;  1ENF A;  1XEE A;  1EWC A;  1QOB A;  2N0S B;  1ZPS A;  2W82 A;  4ITK A;  3Q8E A;  1QT9 A;  5HHD G;  3BVZ A;  1FXA A;  1HZ5 A;  5EE3 A;  3T3N A;  1ZP0 B;  3T3O A;  2ONQ A;  4NJC A;  4RGM A;  1XLQ A;  3IXS A;  1A70 A;  1IGC A;  1MHX A;  2Y3A A;  4N6E B;  2WXP A;  2WXF A;  2PIA A;  3MJ5 A;  1QLB B;  2JXT A;  3NS1 A;  4RF1 A;  2Z8L A;  4NAW B;  4JWS C;  3RFZ B;  2VZK D;  4MH8 A;  4MT5 A;  1ZXI A;  3W5V B;  3AEG B;  3NUH B;  2WXM A;  2J53 A;  3SFE B;  5T8I A;  1PFD A;  1WXQ A;  2JSV X;  2OHF A;  4HJG E;  1ZOY B;  5G5H A;  1T3Q A;  1VR9 A;  1C79 A;  2FBW B;  2MH7 A;  4TQ1 A;  2BS4 B;  2G9H D;  3URY A;  1L0V B;  3DWG C;  2DLB A;  3P63 A;  1NI3 A;  3AE5 B;  5BMG A;  2WDV B;  1D5M C;  2L52 A;  2WDQ B;  3AN1 A;  3ABV B;  4YSZ B;  2D5G A;  4YTN B;  2YEP B;  3BK2 A;  1LO5 D;  2J42 A;  3Q69 A;  1SE3 A;  1L6U A;  4C80 A;  1XLN A;  1YMH E;  4L1B A;  3AE6 B;  4NAM A;  1Y56 A;  1D5X C;  3B2F A;  3AE4 B;  3FIL A;  3B2G A;  4KGS A;  1FFU A;  2WXQ A;  1D6E C;  2G1E A;  3VQI A;  3AV8 A;  1YQ4 B;  1QOF A;  1N62 A;  1ZXH A;  3AEE B;  5FKA C;  1XXG A;  4US9 A;  1KLG D;  2N9L A;  1V97 A;  5HI1 A;  5JXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...