4KH8A

Crystal structure of a lipocalin-like protein (ef0376) from enterococcus faecalis v583 at 1.60 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
311
structure length
311
Chain Sequence
DNPNNLGDLPEYLRSVGIRQDEGLSEKDWAGTRVYDRNGNDLTDENQNLLHAIKFDATTSFYEFFDKETGESTGDEGTFFMTAGITDVSRLVIISETKNYQGVYPLRTLYQDTFTYRQMGKDKNGNDIEVFVENKATSGPVYGRPQPYPNNRPRTLEFTNGRRAMTEQTGQIDVNRQGDEIIGKTSFDGTPQLLWNGTKVVDKDGNDVTSANQNFISLAKFDQDSSKYEFFNLQTGETRGDYGYFKVGNQNKFRAHVSIGTNRYGAVLELTELNDNRFTYTRMGKDNEGNDIQVYVEHEPYQGTFNPEFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (EF0376) from Enterococcus faecalis V583 at 1.60 A resolution
rcsb
molecule keywords hypothetical protein
molecule tags Structural genomics, unknown function
source organism Enterococcus faecalis
total genus 88
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16103 DUF4822 Domain of unknown function (DUF4822)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.540 Mainly Beta Beta Barrel Lipocalin Lipocalin 4kh8A02
2.40.128.540 Mainly Beta Beta Barrel Lipocalin Lipocalin 4kh8A01
4KH8A 4NW4A
chains in the Genus database with same CATH superfamily
1VWNB 3STNA 4TQ2A 1SWEA 2XSTA 1LIBA 1VWOB 3WYPA 3VE2A 3NQ3A 2A5BA 2XKLA 1IKJA 2FWVA 3H3IA 4BX7B 4C5PA 3BRNA 3KVNA 4GDZA 3WJDA 1X71A 4CV7A 3TGAA 3B2KA 3I0AA 4CPIA 1LDOA 2IZDB 4LQZA 1NP4A 3WJFA 3NX2A 2C1SA 2R73A 3D97A 1HN2A 1MX7A 1QFTA 1SWSA 3D96A 4OS8A 5AJBA 4AZOA 4BVMA 1SY3A 2CBRA 3Q6LA 1OBQA 1VWRB 2FLJA 2MO5A 5HZQA 4KCAA 1OEJA 4Z27A 1VWCB 4BX7A 5D4AA 1E02A 4M7MA 4CPEA 2QO5A 4L1NA 1A18A 2OL7A 3BU1A 5D48A 5IO7A 4IB8A 1AB0A 3AKNA 3HTYA 1EUOA 4BQUA 1CBRA 2PY1A 4WHIA 3CKFA 4EKVA 2ASNX 5KIDA 1U17A 1E5PA 1VWLB 4I9RA 4KC8A 5L8NA 3O22A 2RTNB 1G85A 2R56A 4NLIA 3C77X 1JYDA 2BSZA 2PI3O 4NW4A 4IMNA 4YFQA 1JJUA 2L68A 4MVLA 1PEEA 3SZHA 2K23A 1OPAA 3WZNA 1VWBB 1BSQA 3ELXA 1EPAA 3WJGA 1JQPA 2OVEA 1SA8A 2OFRX 1VYFA 2Y3EA 1GX9A 2IZKA 2VFCA 1BRQA 3LV4A 2L5PA 3FR4A 1VWFB 3X00A 4O4XA 4ZCBA 1T8VA 1LFOA 2AT6X 4O3WA 1SXWA 4ZHGA 1DF3A 3UEWA 3HOLA 2OFBA 1GX3A 1H91A 4CDEA 2L67A 2NNDA 1U18A 4HPDA 4YGGA 1S7DA 1SRHA 2ANSA 2DJGA 3PH5A 5H9NA 3U03A 3TGCA 3WZPA 3D95A 3ZI8A 2AL0X 2BS5A 1QQSA 2X8TA 4GJVA 1JJXA 1QY2A 3QKGA 1BBPA 4WFUA 2WEWA 3SAOA 5LKEA 1W6FA 2R74A 2VFBA 4RUNA 1X89A 4OEMA 5HCCC 2BHVA 2ACPX 4OKAA 1B8EA 1VWIB 2RTFB 1SLFB 1SRIA 5HZ6A 3JS1A 1VWEB 5L3YA 4EEJA 1GM6A 1SWLA 2RTMA 2M4LA 1FDQA 2RTKA 2X55A 4HPBA 3U0DA 2X32A 1SWTA 1TVQA 1LF7A 4Y0SA 3ELZA 2ALLX 1VWDB 4YCHA 3VG3A 1ZNHA 2GC9A 3HOEA 3MG5A 4WBKA 4QGVA 1MOYA 3EM0A 1IFCA 5DG4A 3KFHA 3PQSA 5FQ7E 1DFVA 2C4IA 2YG2A 1QY0A 3C78X 4Y59A 3B2IA 1TXLA 1ACDA 1DC9A 1RAVA 4O4SA 4YKMA 2RTIB 1A57A 5F6BA 1QABE 1MDCA 1NQNA 2GTLO 5LJGA 1KQXA 4ML7B 4WFVA 3UEUA 1ZRYA 3EBWA 2N93A 4GGRA 1GT1A 1GKAB 2HYSA 2HZQA 2RTRB 4NV7A 2G79A 3FELA 3QQ2A 1JZUA 3MVFA 1WUBA 2A3FX 2OL8O 3LTWA 1KT3A 2O62A 1MK5A 2QCBA 4UU3A 2CM4A 1YWBA 3P6EA 1VWPB 2JGSA 4MVEA 1ZNKA 2GTLN 3Q34A 3P6DA 4YGHA 5D8JA 5JR8A 1GKAA 1X8QA 2OVAA 2YMSA 2UYWA 3KFFA 3BY0A 4IBAA 3BLGA 4YMYA 1W4TA 2WUTA 3F6ZB 3P6GA 2G5LA 3F8AA 4OELA 4AZPA 3PP6A 4UU2A 5JD2A 2X8SA 3OD9A 1BRPA 2QO6A 4MISA 2A2UA 4TKBA 3VG4A 1LIEA 3CBSA 1N43A 2WR6A 4GGZA 2RTJA 3CWKA 5H8TA 3RDSA 3FENA 1YWDA 5CYBA 2IFBA 1I9HA 2BT9A 1LCWA 4QQ1A 4Z2VA 1ZNDA 4Y5DA 4Y0PA 1E00A 3FMZA 1LDQA 1SWQA 5BVTA 5LJEA 1BJ7A 4LZVA 5HAEA 5K68A 1B4MA 3WJEA 1LIDA 1SWDA 1I78A 4YCEA 3T1DA 3T6LA 3TZSA 1FJ1E 3VGWA 2EU7X 4Z6JA 4CDCA 4QYNA 2C1QA 4EXZA 3PPTA 3STMX 4QRLA 5BVQA 1RXJA 5EEDA 1X8UA 4JO6A 2OFMX 3EBKA 2JU8A 4YH0A 4HPAA 3P6HA 4RUUA 1OBPA 1JJJA 3MX7A 1LELA 2JOZA 5D45A 3RE5A 2JW1A 1SWPA 2KTSA 1N7YA 2LA7A 4GNYA 4A8ZA 3UEVA 1LICA 3VHHA 3ZW1B 4BGFA 2RTGB 3RSWA 5EPQA 4COTA 2AKQA 5LJDA 3FA7A 1N0SA 3MBTA 1IFBA 1XCAA 3O2YA 1I05A 2WQAE 1G74A 1VWKB 2AT3X 1VYGA 3E3CA 3FW4A 4HWMA 3BSZE 4Z28A 3DTQA 1NC9A 3P6FA 1STRB 2L9CA 1MM9A 2AT5X 1TW4A 3FR2A 5HZ8A 3ZW1A 4XMEA 4ES7A 3BU9A 5IRAA 2RCQA 1HMRA 4I6SA 2JU7A 3KFIA 5H9AA 2CBSA 4GETA 2RTLA 2QM9A 1JBHA 3FEPA 4YVBA 2Z4HA 1Y52X 5BVSA 1EW3A 2MM3A 4TNNA 2IZBA 3BDRA 1DZPA 5B10O 3TGBA 3NR3A 1LPJA 3T2WA 3NBXX 3SZIA 1JV4A 3OE3A 2IZCB 2RQ0A 5IO6A 2AVIA 2BC3A 4OS3A 1HQQA 3NADA 2HNXA 4IAXA 5FAZA 5FQ6E 1KZWA 3BS2A 4EFGA 4I3CA 1VYOA 3KFGA 4GNWA 1O1VA 3SLTA 3T2XA 3APVA 3WJCA 2ZAIA 2AH7X 4ZHHA 3DSZA 3VG5A 1LCVA 1SMPI 3PECA 2G7BA 2LBVA 4AZRA 3BX8A 4BBOA 1SWFA 4NNSA 1SLEB 1KT5A 2FR2A 4XMFA 4ID2A 2OY8A 1BM5A 1D2UA 2I5ZO 2KD2A 3FA9A 1I4UA 4JGLA 1EIOA 2A13A 2MHDA 4ON1A 3PK2A 1SWUA 3UEXA 4NYQA 4I60A 2JU3A 2WSJA 1Z24A 1SRGA 3HWEA 4GD9A 4M6SA 1TOWA 1VWHB 5HTDA 1SWHA 5LJKA 2CZUA 2LBAA 1UYOX 2RTEB 2X56A 1STSB 1SY2A 2BS6A 3AEHA 3CKGA 4GZVA 4KT5A 1X8OA 1GX8A 1EALA 3RDMA 2RA6A 1KL5A 2W2FA 3WJBA 1K3BA 4ZGFA 4DQ4A 4O3XB 1ERXA 1PMPA 2OY7A 2NP1A 3B2JA 1L6MA 4ORWA 4PSQA 3S5VA 1DZJA 1S2PA 3BX7A 1DZKA 1AQBA 3FW5A 1OEKA 4GRJA 1N9MA 1VPRA 4ARHA 1SWAA 5KICA 4GU8A 4XMDA 1I06A 2OFAA 4ALOA 3KQ0A 1PBYA 1B0OA 1SWKA 3UAQA 2X4MA 1P6PA 1CBSA 1YWAA 4N7DA 3EC5A 3SLOA 1EPBA 3ZWEA 3RY2A 1N4JA 3WXQA 2IZLB 3K3LA 2RTCB 4GE1A 4U3QA 3D4RA 4QAEA 4IB7A 1AVEA 1KXOA 2KTDA 3FYFA 1KT4A 1VWMB 2CAMA 4YDBA 2OY1O 5HCEC 1LNMA 1HY2A 2RTDB 3PDFA 2OY5O 4ZGUA 3EW2A 1SWBA 3WZQA 2AT8X 2K62A 5B11O 1UZ2X 1BSYA 1SRJA 1IIUA 2RTBB 5HA1A 4TKJA 5DPQA 4U8UO 5B2AO 2IZAA 1SREA 4YKOA 3VPJE 4NP1A 2CM9A 1SWNA 1RBPA 2ZAGA 4FQBB 4AYHA 1RXHA 1AELA 1CJ5A 1AVDA 1OEEA 1SXYA 5B27A 2Z4IA 5HTEA 3APUA 3CMPA 2OVDA 4Z2OA 1QG5A 3HWDA 4JHQA 3U9PC 1IW2A 2F73A 4ZH6A 4BOEA 4U8UN 5B29A 2P8GA 4HFOA 2QOSC 3GE2A 4FBRA 2WWPA 3FDCA 2FGSA 3CR6A 4MVIA 4YFPA 4MVKA 1ZNLA 2X45A 2HZRA 2RD7C 4GGTA 3V8UA 2MJIA 1Y53X 2Q9SA 4HPCA 5F7GA 1EQDA 4BX5B 4ZFXA 2A0AA 5HA0A 2Q2PA 4D6BA 4AZQA 2QMIA 4GK9A 1RSTB 1SWOA 4FBOA 5HZ9A 2AT0X 3WVMA 1HMTA 3VHIA 1TOUA 2QOMA 1GT3A 1SWCA 4CPFA 3APWA 4ZHCA 2A8GA 4R0BA 2OVSA 3ZUOA 2Y3FA 3FLLA 4BX5A 2AF5A 2HKDA 1S44A 3OBLA 4XMHA 3ZW2A 2W2BA 3AKMA 3PQUA 2CZTA 3NPOA 4PJ2A 1MX8A 1LIFA 4U46A 3B2LA 4BX6B 2MF6A 5IO5A 4O3YA 4YGZA 2POAA 2RTAA 4CDFA 4XMGA 3RDXA 1FE3A 2IZFB 2WPUA 3P6CA 4K19A 1PTSA 4LKTA 3FIQA 2FR3A 1VWJB 5HBSA 3RY1A 3NQKA 3SLJA 4ALBA 1CBIA 1QFVA 4LKPA 4XMCA 4B55A 1HXLA 4I3DA 4A1HA 4BX6A 5IXGA 3HK1A 1RSUB 5F2BA 1HMSA 1NQMA 1R0UA 1A2DA 2A5CA 1STPA 4ORRA 3NX1A 1KT6A 1Y55X 4TKHA 2W2AA 2OYBO 2GTFX 1AVGI 4QGWA 4AZMA 4CPHB 4ORYA 4ZHDA 3HWFA 1PBOA 4AZNA 1UYNX 4QZUA 1KFFA 5FFHA 2BLGA 3GAQA 1ZNEA 4GKCA 1KZXA 2I5VO 5CE4A 4ZHFA 1ADLA 4N7CA 5LJCA 2Q2MA 3N91A 1B56A 1U0XA 2ACOA 2JN3A 2FRSA 3D9WA 4IB9A 4CPHA 2RTHB 2FT9A 3TF6A 3PH6A 1HBQA 5HZ5A 1GXAA 4KIIA 4CDDA 2X46A 4YBPA 1OPBA 1HQPA 3C76X 1E2TA 5HWZA 1CBQA 1T0VA 4JNJA 4QZTA 3WOVA 4ORUA 5H9KA 3ZZVA 5FENA 1LUQA 4O9SA 1A3YA 5B5FA 3WBGA 3LHNA 4QNIA 1KGLA 2RTPB 2IZEB 5L8OA 4KH8A 4O49A 4A1YA 4MIRA 1YIVA 3SZJA 2KT4B 4GH7A 1O8VA 5LJHA 4OMWA 1SXUA 2LKKA 3WYQA 1SWJA 1X8NA 2FKGA 3STKA 5K06A 2FHNX 2UZ2A 1QWDA 4IB6A 1SLGB 4FBVA 2IZIA 2RN4A 2X8FA 4QYPA 1JMZA 2Q4NA 5LKFA 3P24A 3CQNA 4KC7A 2HMBA 2AMMX 1KL4A 5D47A 1JYJA 3OJYC 2DJFA 2DM5A 4L3RA 3NQ9A 5AQ6A 5BYPA 1UREA 3B2HA 1G5WA 3VE1A 5B5GA 3AUMO 4O3ZA 1Y9LA 5IRWA 3RKGA 3EW1A 1PM1X 2ZSCA 2G8CO 1CRBA 2Y32A 1GT5A 4YFRA 5AEOA 1W5RA 5H9LA 4IRWA 3S26A 1GT4A 4FGIB 1MUPA 2RCTA 4DCBA 3JQOA 5EDCA 1VWQB 1ML7A 3CBCA 1SRFA 2VDFA 2OF9A 3EMMA 1EI5A 1ICMA 4Z2PA 4O4OA 1RXKA 4O4UA 3S60A 1ALBA 4D6AA 1NP1A 3KZAA 2F09A 1N9YA 3JSQA 1KOIA 3VHMA 4TLJA 4EQAC 1DF8A 2IZJA 5LJBA 4ZR2A 1VWGB 4NLJA 1FEMA 4MEEA 4LZUA 1YUPA 3F9DA 1NDJA 2IZHB 2OL6O 3IFBA 4GUZA 4BCSA 3CQRA 1OSPO 4IMOA 4CK4A 3RE6A 1NBXA 4ZH9A 1HXZA 1WBIA 4ORSA 4I3BA 4U9CA 1FENA 1I04A 1VWAB 3RDUA 1IJ8A 1YP6A 1K24A 1KQWA 3VG6A 1HBPA 1BEBA 4OMXA 5C0NA 4NV8A 1BLRA 5B3MO 4AW8A 5F1EA 5CHKA 1SY0A 4YBUA 4DQ3A 4GDAA 1EXSA 2FHLA 1DZMA 1MVGA 3FIDA 3NP1A 2FS7A 1SWRA 2A2GA 2LFOA 3O19A 1YP7A 5EZ2A 4ZJ0A 5HCDC 2FKJA 2QO4A 3RWXA 3L4RA 5F6ZA 5AJCA 2NNEA 4IABA 4YDAA 1E06A 2NNQA 4IAWA 1JIWI 2E4JA 3HPEA 1XKIA 1Y9TA 3P02A 4ODDA 3VG7A 3EYCA 3RZYA 1DV9A 1GGLA 3ZW0B 1G7NA 1SY1A 2MWHA 4Y0QA 1X8PA 4EDEA 2GTLM 1ICNA 3MM0A 3FA8A 2Q39A 3RDOA 4NYRA 2FS6A 5EEEA 2WEXA 3S5XA 5EDBA 3IA8A 3VG2A 4CSBA 1NGLA 2RTOB 2LB6A 2OZQA 1LCZA 2RTQB 1RLBE 3RDQA 4BJ8A 3ZUIA 3WZOA 3HWGA 1T68X 2GJ5A 4INNA 3ZQ3A 3ZW0A 1SWGA 1ERBA 3I17A 1Y0GA 3PEDA 4QGXA 4A60A 1KT7A 1BWYA 1MEPA 5CSEA 3FEKA 1LKEA 4I9SA 1IKEA 2F01A 2JMBA 2HLVA 5FQ8E 1EIIA 3VU1A 5KHPA 2FTBA 4U8UM 1O1UA 1QY1A 2X34A 4NNTA 4Y0RA 2WQ9A 4OS0A 3RBYA 4TJZA 2G78A 4ORXA 2KW1A 1JMXA 3SOTA 5K67A 1FTPA 2IZGB 1ZNGA 5IRUA 1BSOA 2GH7A 1OBUA 1D3SA 1KL3A 1SLDB 4I95A 4DNEA 4GJSA 1YWCA 1SXXA 3APXA 3FR5A 3G7XA 5F58A 3T6FA 5L8IA 1FELA 2OF8A 3FA6A
chains in the Genus database with same CATH topology
3STNA 4TQ2A 2XSTA 1LIBA 3VE2A 3NQ3A 2XKLA 1IKJA 2FWVA 3H3IA 3BRNA 4GDZA 3WJDA 1X71A 4CV7A 3TGAA 3B2KA 3I0AA 4LQZA 1NP4A 3WJFA 3NX2A 2R73A 3D97A 1HN2A 1MX7A 1QFTA 3D96A 4OS8A 5AJBA 4AZOA 4BVMA 1SY3A 2CBRA 3Q6LA 1OBQA 2FLJA 5HZQA 2MO5A 4KCAA 1OEJA 5D4AA 1E02A 4M7MA 2QO5A 4L1NA 1A18A 3BU1A 5D48A 5IO7A 4IB8A 1AB0A 3AKNA 3HTYA 1EUOA 4BQUA 1CBRA 2PY1A 4WHIA 2ASNX 5KIDA 1U17A 1E5PA 4I9RA 4KC8A 5L8NA 3O22A 1G85A 2R56A 4NLIA 3C77X 1JYDA 4NW4A 4YFQA 4IMNA 2L68A 4MVLA 1PEEA 2K23A 1OPAA 1BSQA 3ELXA 1EPAA 3WJGA 2OVEA 1SA8A 2OFRX 1VYFA 1GX9A 3LV4A 1BRQA 2L5PA 3FR4A 4O4XA 4ZCBA 1T8VA 1LFOA 2AT6X 4O3WA 1SXWA 4ZHGA 1DF3A 3UEWA 3HOLA 1H91A 2L67A 2NNDA 1U18A 4HPDA 4YGGA 1S7DA 3PH5A 2ANSA 5H9NA 3TGCA 3U03A 3ZI8A 3D95A 2AL0X 2BS5A 1QQSA 2X8TA 1JJXA 1QY2A 3QKGA 1BBPA 4WFUA 2WEWA 3SAOA 5LKEA 2R74A 4RUNA 1X89A 5HCCC 2BHVA 2ACPX 1B8EA 5HZ6A 3JS1A 4EEJA 1GM6A 4HPBA 2M4LA 1FDQA 3U0DA 1TVQA 1LF7A 4Y0SA 3ELZA 2ALLX 4YCHA 3VG3A 1ZNHA 2GC9A 3HOEA 4WBKA 4QGVA 3EM0A 1IFCA 5DG4A 3KFHA 3PQSA 5FQ7E 1DFVA 2YG2A 3C78X 1QY0A 4YKMA 3B2IA 1TXLA 1ACDA 1DC9A 4O4SA 1A57A 5F6BA 1QABE 1MDCA 2GTLO 5LJGA 1KQXA 4ML7B 4WFVA 3UEUA 1ZRYA 3EBWA 2N93A 1GT1A 2HZQA 1GKAB 2HYSA 2G79A 3FELA 1JZUA 3MVFA 2A3FX 1KT3A 2O62A 4UU3A 2CM4A 1YWBA 3P6EA 4MVEA 1ZNKA 2GTLN 3P6DA 4YGHA 5D8JA 5JR8A 1GKAA 1X8QA 2OVAA 2YMSA 3KFFA 3BY0A 4IBAA 3BLGA 4YMYA 2WUTA 3F6ZB 3P6GA 3F8AA 4AZPA 3PP6A 4UU2A 2X8SA 3OD9A 1BRPA 2QO6A 4MISA 2A2UA 4TKBA 3VG4A 1LIEA 3CBSA 2WR6A 3CWKA 5H8TA 3FENA 1YWDA 5CYBA 2IFBA 2BT9A 4QQ1A 1ZNDA 4Y0PA 1E00A 3FMZA 5BVTA 5LJEA 1BJ7A 4LZVA 5HAEA 1B4MA 3WJEA 1LIDA 4YCEA 3T1DA 3TZSA 2EU7X 4QYNA 4EXZA 3PPTA 3STMX 4QRLA 5BVQA 5EEDA 1X8UA 2OFMX 3EBKA 2JU8A 4YH0A 4HPAA 3P6HA 4RUUA 1OBPA 1JJJA 3MX7A 2JOZA 5D45A 2JW1A 2KTSA 2LA7A 4GNYA 4A8ZA 3UEVA 1LICA 3ZW1B 3RSWA 5EPQA 2AKQA 5LJDA 3FA7A 1N0SA 3MBTA 1IFBA 1XCAA 3O2YA 1I05A 2WQAE 1G74A 3E3CA 2AT3X 1VYGA 3FW4A 4HWMA 3BSZE 3DTQA 3P6FA 2L9CA 2AT5X 1TW4A 3FR2A 5HZ8A 3ZW1A 4XMEA 4ES7A 3BU9A 2RCQA 1HMRA 4I6SA 2JU7A 3KFIA 5H9AA 2CBSA 4GETA 2QM9A 1JBHA 3FEPA 2Z4HA 5BVSA 1EW3A 2MM3A 4TNNA 3BDRA 1DZPA 3TGBA 3NR3A 1LPJA 3NBXX 1JV4A 3OE3A 2RQ0A 5IO6A 4OS3A 3NADA 2HNXA 4IAXA 5FAZA 5FQ6E 1KZWA 3BS2A 4EFGA 4I3CA 3KFGA 4GNWA 1O1VA 3APVA 3WJCA 2ZAIA 2AH7X 4ZHHA 3DSZA 3VG5A 2LBVA 1SMPI 3PECA 2G7BA 4AZRA 3BX8A 4NNSA 2FR2A 1KT5A 4XMFA 4ID2A 1BM5A 1D2UA 1EIOA 2KD2A 3FA9A 1I4UA 4JGLA 2A13A 2MHDA 4ON1A 3UEXA 4NYQA 2JU3A 2WSJA 1Z24A 3HWEA 4M6SA 1TOWA 5HTDA 5LJKA 2CZUA 2LBAA 1SY2A 2BS6A 4GZVA 4KT5A 1X8OA 1GX8A 1EALA 3WJBA 2RA6A 2W2FA 4ZGFA 4DQ4A 4O3XB 1ERXA 1PMPA 2NP1A 3B2JA 1L6MA 4ORWA 4PSQA 3S5VA 1DZJA 1S2PA 3BX7A 1DZKA 1AQBA 3FW5A 1OEKA 4GRJA 1VPRA 4ARHA 5KICA 4GU8A 4XMDA 1I06A 4ALOA 3KQ0A 3UAQA 1B0OA 1P6PA 1CBSA 1YWAA 4N7DA 1EPBA 3ZWEA 3WXQA 3K3LA 4GE1A 4U3QA 3D4RA 4QAEA 4IB7A 1KXOA 3FYFA 2KTDA 1KT4A 4YDBA 5HCEC 1LNMA 4ZGUA 2AT8X 2K62A 4COTA 1UZ2X 1BSYA 5HA1A 1IIUA 4TKJA 5DPQA 4U8UO 4YKOA 3VPJE 4NP1A 2CM9A 1RBPA 2ZAGA 4FQBB 4AYHA 1AELA 1CJ5A 1OEEA 1SXYA 5B27A 2Z4IA 5HTEA 3APUA 3CMPA 2OVDA 1QG5A 3HWDA 4BOEA 3U9PC 1IW2A 2F73A 4ZH6A 5B29A 4U8UN 2P8GA 4HFOA 2QOSC 3GE2A 4FBRA 2WWPA 3CR6A 4MVIA 4YFPA 4MVKA 1ZNLA 2X45A 2HZRA 2RD7C 3V8UA 2MJIA 2Q9SA 4HPCA 4ZFXA 5F7GA 1EQDA 2A0AA 5HA0A 2Q2PA 4D6BA 4AZQA 2QMIA 4GK9A 4FBOA 5HZ9A 2AT0X 3WVMA 1HMTA 1TOUA 1GT3A 3APWA 4ZHCA 4R0BA 2OVSA 3ZUOA 3FLLA 1S44A 3OBLA 4XMHA 3ZW2A 2W2BA 3AKMA 3PQUA 2CZTA 3NPOA 4PJ2A 1MX8A 1LIFA 3B2LA 5IO5A 4O3YA 4YGZA 2POAA 4XMGA 1FE3A 3P6CA 4K19A 4LKTA 3FIQA 2FR3A 5HBSA 3NQKA 4ALBA 1CBIA 1QFVA 4LKPA 4XMCA 4A1HA 4I3DA 3HK1A 1HMSA 1R0UA 1A2DA 4ORRA 3NX1A 1KT6A 4TKHA 4AZMA 2W2AA 2GTFX 1AVGI 4QGWA 4ORYA 4ZHDA 3HWFA 1PBOA 4AZNA 4QZUA 5FFHA 2BLGA 3GAQA 1ZNEA 4GKCA 1KZXA 5CE4A 4ZHFA 1ADLA 4N7CA 5LJCA 2Q2MA 3N91A 1B56A 1U0XA 2ACOA 2JN3A 2FRSA 4IB9A 2FT9A 3TF6A 3PH6A 1HBQA 5HZ5A 1GXAA 4KIIA 2X46A 4YBPA 1OPBA 1HQPA 3C76X 5HWZA 1CBQA 1T0VA 4QZTA 3WOVA 4ORUA 5H9KA 3ZZVA 5FENA 4O9SA 1A3YA 3WBGA 3LHNA 4QNIA 1KGLA 5L8OA 4KH8A 4O49A 4A1YA 4MIRA 1YIVA 2KT4B 4GH7A 1O8VA 5LJHA 4OMWA 1SXUA 2LKKA 1X8NA 3STKA 5K06A 1QWDA 4IB6A 4FBVA 4QYPA 2RN4A 2X8FA 5LKFA 2Q4NA 3P24A 3CQNA 4KC7A 2HMBA 2AMMX 5D47A 1JYJA 3OJYC 2DM5A 4L3RA 3NQ9A 5AQ6A 5BYPA 1UREA 3B2HA 1G5WA 3VE1A 4O3ZA 1Y9LA 3RKGA 1PM1X 1CRBA 4YFRA 1GT5A 5AEOA 5H9LA 3S26A 1GT4A 4FGIB 1MUPA 2RCTA 3JQOA 5EDCA 1ML7A 3CBCA 3EMMA 1EI5A 1ICMA 4O4OA 4O4UA 3S60A 1ALBA 4D6AA 1NP1A 3KZAA 2F09A 3JSQA 1KOIA 4TLJA 4EQAC 5LJBA 4ZR2A 4NLJA 1FEMA 4LZUA 1YUPA 3F9DA 3IFBA 3CQRA 4IMOA 4CK4A 4ZH9A 4ORSA 4I3BA 4U9CA 1FENA 1I04A 1YP6A 1KQWA 3VG6A 1HBPA 1BEBA 4OMXA 5C0NA 1BLRA 4AW8A 5F1EA 4DQ3A 1SY0A 4YBUA 1EXSA 1DZMA 1MVGA 3NP1A 2FS7A 2A2GA 2LFOA 3O19A 1YP7A 5EZ2A 4ZJ0A 5HCDC 2QO4A 3RWXA 3L4RA 5F6ZA 5AJCA 2NNEA 4IABA 4YDAA 1E06A 2NNQA 4IAWA 1JIWI 2E4JA 4ODDA 1XKIA 1Y9TA 3P02A 3VG7A 3EYCA 3RZYA 1DV9A 1GGLA 3ZW0B 1G7NA 1SY1A 2MWHA 4Y0QA 1X8PA 4EDEA 2GTLM 1ICNA 3FA8A 2Q39A 4NYRA 2FS6A 5EEEA 2WEXA 3S5XA 5EDBA 3IA8A 3VG2A 4CSBA 1NGLA 2LB6A 2OZQA 1RLBE 3ZUIA 3HWGA 1T68X 2GJ5A 4INNA 3ZQ3A 3ZW0A 1ERBA 3I17A 3PEDA 4A60A 4QGXA 1KT7A 1BWYA 3FEKA 1LKEA 4I9SA 1IKEA 2JMBA 1EIIA 2HLVA 5FQ8E 3VU1A 5KHPA 2FTBA 4U8UM 1O1UA 1QY1A 4NNTA 4Y0RA 2WQ9A 4OS0A 3RBYA 4TJZA 2G78A 4ORXA 2KW1A 3SOTA 1FTPA 1ZNGA 1BSOA 1OBUA 1D3SA 4I95A 1YWCA 1SXXA 3APXA 3FR5A 3G7XA 5F58A 5L8IA 1FELA 3FA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KH8 A;  4NW4 A; 
#chains in the Genus database with same CATH topology
 1VWN B;  3STN A;  4TQ2 A;  1SWE A;  2XST A;  1LIB A;  1VWO B;  3WYP A;  3VE2 A;  3NQ3 A;  2A5B A;  2XKL A;  1IKJ A;  2FWV A;  3H3I A;  4BX7 B;  4C5P A;  3BRN A;  3KVN A;  4GDZ A;  3WJD A;  1X71 A;  4CV7 A;  3TGA A;  3B2K A;  3I0A A;  4CPI A;  1LDO A;  2IZD B;  4LQZ A;  1NP4 A;  3WJF A;  3NX2 A;  2C1S A;  2R73 A;  3D97 A;  1HN2 A;  1MX7 A;  1QFT A;  1SWS A;  3D96 A;  4OS8 A;  5AJB A;  4AZO A;  4BVM A;  1SY3 A;  2CBR A;  3Q6L A;  1OBQ A;  1VWR B;  2FLJ A;  2MO5 A;  5HZQ A;  4KCA A;  1OEJ A;  4Z27 A;  1VWC B;  4BX7 A;  5D4A A;  1E02 A;  4M7M A;  4CPE A;  2QO5 A;  4L1N A;  1A18 A;  2OL7 A;  3BU1 A;  5D48 A;  5IO7 A;  4IB8 A;  1AB0 A;  3AKN A;  3HTY A;  1EUO A;  4BQU A;  1CBR A;  2PY1 A;  4WHI A;  3CKF A;  4EKV A;  2ASN X;  5KID A;  1U17 A;  1E5P A;  1VWL B;  4I9R A;  4KC8 A;  5L8N A;  3O22 A;  2RTN B;  1G85 A;  2R56 A;  4NLI A;  3C77 X;  1JYD A;  2BSZ A;  2PI3 O;  4NW4 A;  4IMN A;  4YFQ A;  1JJU A;  2L68 A;  4MVL A;  1PEE A;  3SZH A;  2K23 A;  1OPA A;  3WZN A;  1VWB B;  1BSQ A;  3ELX A;  1EPA A;  3WJG A;  1JQP A;  2OVE A;  1SA8 A;  2OFR X;  1VYF A;  2Y3E A;  1GX9 A;  2IZK A;  2VFC A;  1BRQ A;  3LV4 A;  2L5P A;  3FR4 A;  1VWF B;  3X00 A;  4O4X A;  4ZCB A;  1T8V A;  1LFO A;  2AT6 X;  4O3W A;  1SXW A;  4ZHG A;  1DF3 A;  3UEW A;  3HOL A;  2OFB A;  1GX3 A;  1H91 A;  4CDE A;  2L67 A;  2NND A;  1U18 A;  4HPD A;  4YGG A;  1S7D A;  1SRH A;  2ANS A;  2DJG A;  3PH5 A;  5H9N A;  3U03 A;  3TGC A;  3WZP A;  3D95 A;  3ZI8 A;  2AL0 X;  2BS5 A;  1QQS A;  2X8T A;  4GJV A;  1JJX A;  1QY2 A;  3QKG A;  1BBP A;  4WFU A;  2WEW A;  3SAO A;  5LKE A;  1W6F A;  2R74 A;  2VFB A;  4RUN A;  1X89 A;  4OEM A;  5HCC C;  2BHV A;  2ACP X;  4OKA A;  1B8E A;  1VWI B;  2RTF B;  1SLF B;  1SRI A;  5HZ6 A;  3JS1 A;  1VWE B;  5L3Y A;  4EEJ A;  1GM6 A;  1SWL A;  2RTM A;  2M4L A;  1FDQ A;  2RTK A;  2X55 A;  4HPB A;  3U0D A;  2X32 A;  1SWT A;  1TVQ A;  1LF7 A;  4Y0S A;  3ELZ A;  2ALL X;  1VWD B;  4YCH A;  3VG3 A;  1ZNH A;  2GC9 A;  3HOE A;  3MG5 A;  4WBK A;  4QGV A;  1MOY A;  3EM0 A;  1IFC A;  5DG4 A;  3KFH A;  3PQS A;  5FQ7 E;  1DFV A;  2C4I A;  2YG2 A;  1QY0 A;  3C78 X;  4Y59 A;  3B2I A;  1TXL A;  1ACD A;  1DC9 A;  1RAV A;  4O4S A;  4YKM A;  2RTI B;  1A57 A;  5F6B A;  1QAB E;  1MDC A;  1NQN A;  2GTL O;  5LJG A;  1KQX A;  4ML7 B;  4WFV A;  3UEU A;  1ZRY A;  3EBW A;  2N93 A;  4GGR A;  1GT1 A;  1GKA B;  2HYS A;  2HZQ A;  2RTR B;  4NV7 A;  2G79 A;  3FEL A;  3QQ2 A;  1JZU A;  3MVF A;  1WUB A;  2A3F X;  2OL8 O;  3LTW A;  1KT3 A;  2O62 A;  1MK5 A;  2QCB A;  4UU3 A;  2CM4 A;  1YWB A;  3P6E A;  1VWP B;  2JGS A;  4MVE A;  1ZNK A;  2GTL N;  3Q34 A;  3P6D A;  4YGH A;  5D8J A;  5JR8 A;  1GKA A;  1X8Q A;  2OVA A;  2YMS A;  2UYW A;  3KFF A;  3BY0 A;  4IBA A;  3BLG A;  4YMY A;  1W4T A;  2WUT A;  3F6Z B;  3P6G A;  2G5L A;  3F8A A;  4OEL A;  4AZP A;  3PP6 A;  4UU2 A;  5JD2 A;  2X8S A;  3OD9 A;  1BRP A;  2QO6 A;  4MIS A;  2A2U A;  4TKB A;  3VG4 A;  1LIE A;  3CBS A;  1N43 A;  2WR6 A;  4GGZ A;  2RTJ A;  3CWK A;  5H8T A;  3RDS A;  3FEN A;  1YWD A;  5CYB A;  2IFB A;  1I9H A;  2BT9 A;  1LCW A;  4QQ1 A;  4Z2V A;  1ZND A;  4Y5D A;  4Y0P A;  1E00 A;  3FMZ A;  1LDQ A;  1SWQ A;  5BVT A;  5LJE A;  1BJ7 A;  4LZV A;  5HAE A;  5K68 A;  1B4M A;  3WJE A;  1LID A;  1SWD A;  1I78 A;  4YCE A;  3T1D A;  3T6L A;  3TZS A;  1FJ1 E;  3VGW A;  2EU7 X;  4Z6J A;  4CDC A;  4QYN A;  2C1Q A;  4EXZ A;  3PPT A;  3STM X;  4QRL A;  5BVQ A;  1RXJ A;  5EED A;  1X8U A;  4JO6 A;  2OFM X;  3EBK A;  2JU8 A;  4YH0 A;  4HPA A;  3P6H A;  4RUU A;  1OBP A;  1JJJ A;  3MX7 A;  1LEL A;  2JOZ A;  5D45 A;  3RE5 A;  2JW1 A;  1SWP A;  2KTS A;  1N7Y A;  2LA7 A;  4GNY A;  4A8Z A;  3UEV A;  1LIC A;  3VHH A;  3ZW1 B;  4BGF A;  2RTG B;  3RSW A;  5EPQ A;  4COT A;  2AKQ A;  5LJD A;  3FA7 A;  1N0S A;  3MBT A;  1IFB A;  1XCA A;  3O2Y A;  1I05 A;  2WQA E;  1G74 A;  1VWK B;  2AT3 X;  1VYG A;  3E3C A;  3FW4 A;  4HWM A;  3BSZ E;  4Z28 A;  3DTQ A;  1NC9 A;  3P6F A;  1STR B;  2L9C A;  1MM9 A;  2AT5 X;  1TW4 A;  3FR2 A;  5HZ8 A;  3ZW1 A;  4XME A;  4ES7 A;  3BU9 A;  5IRA A;  2RCQ A;  1HMR A;  4I6S A;  2JU7 A;  3KFI A;  5H9A A;  2CBS A;  4GET A;  2RTL A;  2QM9 A;  1JBH A;  3FEP A;  4YVB A;  2Z4H A;  1Y52 X;  5BVS A;  1EW3 A;  2MM3 A;  4TNN A;  2IZB A;  3BDR A;  1DZP A;  5B10 O;  3TGB A;  3NR3 A;  1LPJ A;  3T2W A;  3NBX X;  3SZI A;  1JV4 A;  3OE3 A;  2IZC B;  2RQ0 A;  5IO6 A;  2AVI A;  2BC3 A;  4OS3 A;  1HQQ A;  3NAD A;  2HNX A;  4IAX A;  5FAZ A;  5FQ6 E;  1KZW A;  3BS2 A;  4EFG A;  4I3C A;  1VYO A;  3KFG A;  4GNW A;  1O1V A;  3SLT A;  3T2X A;  3APV A;  3WJC A;  2ZAI A;  2AH7 X;  4ZHH A;  3DSZ A;  3VG5 A;  1LCV A;  1SMP I;  3PEC A;  2G7B A;  2LBV A;  4AZR A;  3BX8 A;  4BBO A;  1SWF A;  4NNS A;  1SLE B;  1KT5 A;  2FR2 A;  4XMF A;  4ID2 A;  2OY8 A;  1BM5 A;  1D2U A;  2I5Z O;  2KD2 A;  3FA9 A;  1I4U A;  4JGL A;  1EIO A;  2A13 A;  2MHD A;  4ON1 A;  3PK2 A;  1SWU A;  3UEX A;  4NYQ A;  4I60 A;  2JU3 A;  2WSJ A;  1Z24 A;  1SRG A;  3HWE A;  4GD9 A;  4M6S A;  1TOW A;  1VWH B;  5HTD A;  1SWH A;  5LJK A;  2CZU A;  2LBA A;  1UYO X;  2RTE B;  2X56 A;  1STS B;  1SY2 A;  2BS6 A;  3AEH A;  3CKG A;  4GZV A;  4KT5 A;  1X8O A;  1GX8 A;  1EAL A;  3RDM A;  2RA6 A;  1KL5 A;  2W2F A;  3WJB A;  1K3B A;  4ZGF A;  4DQ4 A;  4O3X B;  1ERX A;  1PMP A;  2OY7 A;  2NP1 A;  3B2J A;  1L6M A;  4ORW A;  4PSQ A;  3S5V A;  1DZJ A;  1S2P A;  3BX7 A;  1DZK A;  1AQB A;  3FW5 A;  1OEK A;  4GRJ A;  1N9M A;  1VPR A;  4ARH A;  1SWA A;  5KIC A;  4GU8 A;  4XMD A;  1I06 A;  2OFA A;  4ALO A;  3KQ0 A;  1PBY A;  1B0O A;  1SWK A;  3UAQ A;  2X4M A;  1P6P A;  1CBS A;  1YWA A;  4N7D A;  3EC5 A;  3SLO A;  1EPB A;  3ZWE A;  3RY2 A;  1N4J A;  3WXQ A;  2IZL B;  3K3L A;  2RTC B;  4GE1 A;  4U3Q A;  3D4R A;  4QAE A;  4IB7 A;  1AVE A;  1KXO A;  2KTD A;  3FYF A;  1KT4 A;  1VWM B;  2CAM A;  4YDB A;  2OY1 O;  5HCE C;  1LNM A;  1HY2 A;  2RTD B;  3PDF A;  2OY5 O;  4ZGU A;  3EW2 A;  1SWB A;  3WZQ A;  2AT8 X;  2K62 A;  5B11 O;  1UZ2 X;  1BSY A;  1SRJ A;  1IIU A;  2RTB B;  5HA1 A;  4TKJ A;  5DPQ A;  4U8U O;  5B2A O;  2IZA A;  1SRE A;  4YKO A;  3VPJ E;  4NP1 A;  2CM9 A;  1SWN A;  1RBP A;  2ZAG A;  4FQB B;  4AYH A;  1RXH A;  1AEL A;  1CJ5 A;  1AVD A;  1OEE A;  1SXY A;  5B27 A;  2Z4I A;  5HTE A;  3APU A;  3CMP A;  2OVD A;  4Z2O A;  1QG5 A;  3HWD A;  4JHQ A;  3U9P C;  1IW2 A;  2F73 A;  4ZH6 A;  4BOE A;  4U8U N;  5B29 A;  2P8G A;  4HFO A;  2QOS C;  3GE2 A;  4FBR A;  2WWP A;  3FDC A;  2FGS A;  3CR6 A;  4MVI A;  4YFP A;  4MVK A;  1ZNL A;  2X45 A;  2HZR A;  2RD7 C;  4GGT A;  3V8U A;  2MJI A;  1Y53 X;  2Q9S A;  4HPC A;  5F7G A;  1EQD A;  4BX5 B;  4ZFX A;  2A0A A;  5HA0 A;  2Q2P A;  4D6B A;  4AZQ A;  2QMI A;  4GK9 A;  1RST B;  1SWO A;  4FBO A;  5HZ9 A;  2AT0 X;  3WVM A;  1HMT A;  3VHI A;  1TOU A;  2QOM A;  1GT3 A;  1SWC A;  4CPF A;  3APW A;  4ZHC A;  2A8G A;  4R0B A;  2OVS A;  3ZUO A;  2Y3F A;  3FLL A;  4BX5 A;  2AF5 A;  2HKD A;  1S44 A;  3OBL A;  4XMH A;  3ZW2 A;  2W2B A;  3AKM A;  3PQU A;  2CZT A;  3NPO A;  4PJ2 A;  1MX8 A;  1LIF A;  4U46 A;  3B2L A;  4BX6 B;  2MF6 A;  5IO5 A;  4O3Y A;  4YGZ A;  2POA A;  2RTA A;  4CDF A;  4XMG A;  3RDX A;  1FE3 A;  2IZF B;  2WPU A;  3P6C A;  4K19 A;  1PTS A;  4LKT A;  3FIQ A;  2FR3 A;  1VWJ B;  5HBS A;  3RY1 A;  3NQK A;  3SLJ A;  4ALB A;  1CBI A;  1QFV A;  4LKP A;  4XMC A;  4B55 A;  1HXL A;  4I3D A;  4A1H A;  4BX6 A;  5IXG A;  3HK1 A;  1RSU B;  5F2B A;  1HMS A;  1NQM A;  1R0U A;  1A2D A;  2A5C A;  1STP A;  4ORR A;  3NX1 A;  1KT6 A;  1Y55 X;  4TKH A;  2W2A A;  2OYB O;  2GTF X;  1AVG I;  4QGW A;  4AZM A;  4CPH B;  4ORY A;  4ZHD A;  3HWF A;  1PBO A;  4AZN A;  1UYN X;  4QZU A;  1KFF A;  5FFH A;  2BLG A;  3GAQ A;  1ZNE A;  4GKC A;  1KZX A;  2I5V O;  5CE4 A;  4ZHF A;  1ADL A;  4N7C A;  5LJC A;  2Q2M A;  3N91 A;  1B56 A;  1U0X A;  2ACO A;  2JN3 A;  2FRS A;  3D9W A;  4IB9 A;  4CPH A;  2RTH B;  2FT9 A;  3TF6 A;  3PH6 A;  1HBQ A;  5HZ5 A;  1GXA A;  4KII A;  4CDD A;  2X46 A;  4YBP A;  1OPB A;  1HQP A;  3C76 X;  1E2T A;  5HWZ A;  1CBQ A;  1T0V A;  4JNJ A;  4QZT A;  3WOV A;  4ORU A;  5H9K A;  3ZZV A;  5FEN A;  1LUQ A;  4O9S A;  1A3Y A;  5B5F A;  3WBG A;  3LHN A;  4QNI A;  1KGL A;  2RTP B;  2IZE B;  5L8O A;  4KH8 A;  4O49 A;  4A1Y A;  4MIR A;  1YIV A;  3SZJ A;  2KT4 B;  4GH7 A;  1O8V A;  5LJH A;  4OMW A;  1SXU A;  2LKK A;  3WYQ A;  1SWJ A;  1X8N A;  2FKG A;  3STK A;  5K06 A;  2FHN X;  2UZ2 A;  1QWD A;  4IB6 A;  1SLG B;  4FBV A;  2IZI A;  2RN4 A;  2X8F A;  4QYP A;  1JMZ A;  2Q4N A;  5LKF A;  3P24 A;  3CQN A;  4KC7 A;  2HMB A;  2AMM X;  1KL4 A;  5D47 A;  1JYJ A;  3OJY C;  2DJF A;  2DM5 A;  4L3R A;  3NQ9 A;  5AQ6 A;  5BYP A;  1URE A;  3B2H A;  1G5W A;  3VE1 A;  5B5G A;  3AUM O;  4O3Z A;  1Y9L A;  5IRW A;  3RKG A;  3EW1 A;  1PM1 X;  2ZSC A;  2G8C O;  1CRB A;  2Y32 A;  1GT5 A;  4YFR A;  5AEO A;  1W5R A;  5H9L A;  4IRW A;  3S26 A;  1GT4 A;  4FGI B;  1MUP A;  2RCT A;  4DCB A;  3JQO A;  5EDC A;  1VWQ B;  1ML7 A;  3CBC A;  1SRF A;  2VDF A;  2OF9 A;  3EMM A;  1EI5 A;  1ICM A;  4Z2P A;  4O4O A;  1RXK A;  4O4U A;  3S60 A;  1ALB A;  4D6A A;  1NP1 A;  3KZA A;  2F09 A;  1N9Y A;  3JSQ A;  1KOI A;  3VHM A;  4TLJ A;  4EQA C;  1DF8 A;  2IZJ A;  5LJB A;  4ZR2 A;  1VWG B;  4NLJ A;  1FEM A;  4MEE A;  4LZU A;  1YUP A;  3F9D A;  1NDJ A;  2IZH B;  2OL6 O;  3IFB A;  4GUZ A;  4BCS A;  3CQR A;  1OSP O;  4IMO A;  4CK4 A;  3RE6 A;  1NBX A;  4ZH9 A;  1HXZ A;  1WBI A;  4ORS A;  4I3B A;  4U9C A;  1FEN A;  1I04 A;  1VWA B;  3RDU A;  1IJ8 A;  1YP6 A;  1K24 A;  1KQW A;  3VG6 A;  1HBP A;  1BEB A;  4OMX A;  5C0N A;  4NV8 A;  1BLR A;  5B3M O;  4AW8 A;  5F1E A;  5CHK A;  1SY0 A;  4YBU A;  4DQ3 A;  4GDA A;  1EXS A;  2FHL A;  1DZM A;  1MVG A;  3FID A;  3NP1 A;  2FS7 A;  1SWR A;  2A2G A;  2LFO A;  3O19 A;  1YP7 A;  5EZ2 A;  4ZJ0 A;  5HCD C;  2FKJ A;  2QO4 A;  3RWX A;  3L4R A;  5F6Z A;  5AJC A;  2NNE A;  4IAB A;  4YDA A;  1E06 A;  2NNQ A;  4IAW A;  1JIW I;  2E4J A;  3HPE A;  1XKI A;  1Y9T A;  3P02 A;  4ODD A;  3VG7 A;  3EYC A;  3RZY A;  1DV9 A;  1GGL A;  3ZW0 B;  1G7N A;  1SY1 A;  2MWH A;  4Y0Q A;  1X8P A;  4EDE A;  2GTL M;  1ICN A;  3MM0 A;  3FA8 A;  2Q39 A;  3RDO A;  4NYR A;  2FS6 A;  5EEE A;  2WEX A;  3S5X A;  5EDB A;  3IA8 A;  3VG2 A;  4CSB A;  1NGL A;  2RTO B;  2LB6 A;  2OZQ A;  1LCZ A;  2RTQ B;  1RLB E;  3RDQ A;  4BJ8 A;  3ZUI A;  3WZO A;  3HWG A;  1T68 X;  2GJ5 A;  4INN A;  3ZQ3 A;  3ZW0 A;  1SWG A;  1ERB A;  3I17 A;  1Y0G A;  3PED A;  4QGX A;  4A60 A;  1KT7 A;  1BWY A;  1MEP A;  5CSE A;  3FEK A;  1LKE A;  4I9S A;  1IKE A;  2F01 A;  2JMB A;  2HLV A;  5FQ8 E;  1EII A;  3VU1 A;  5KHP A;  2FTB A;  4U8U M;  1O1U A;  1QY1 A;  2X34 A;  4NNT A;  4Y0R A;  2WQ9 A;  4OS0 A;  3RBY A;  4TJZ A;  2G78 A;  4ORX A;  2KW1 A;  1JMX A;  3SOT A;  5K67 A;  1FTP A;  2IZG B;  1ZNG A;  5IRU A;  1BSO A;  2GH7 A;  1OBU A;  1D3S A;  1KL3 A;  1SLD B;  4I95 A;  4DNE A;  4GJS A;  1YWC A;  1SXX A;  3APX A;  3FR5 A;  3G7X A;  5F58 A;  3T6F A;  5L8I A;  1FEL A;  2OF8 A;  3FA6 A; 
#chains in the Genus database with same CATH homology
 3STN A;  4TQ2 A;  2XST A;  1LIB A;  3VE2 A;  3NQ3 A;  2XKL A;  1IKJ A;  2FWV A;  3H3I A;  3BRN A;  4GDZ A;  3WJD A;  1X71 A;  4CV7 A;  3TGA A;  3B2K A;  3I0A A;  4LQZ A;  1NP4 A;  3WJF A;  3NX2 A;  2R73 A;  3D97 A;  1HN2 A;  1MX7 A;  1QFT A;  3D96 A;  4OS8 A;  5AJB A;  4AZO A;  4BVM A;  1SY3 A;  2CBR A;  3Q6L A;  1OBQ A;  2FLJ A;  5HZQ A;  2MO5 A;  4KCA A;  1OEJ A;  5D4A A;  1E02 A;  4M7M A;  2QO5 A;  4L1N A;  1A18 A;  3BU1 A;  5D48 A;  5IO7 A;  4IB8 A;  1AB0 A;  3AKN A;  3HTY A;  1EUO A;  4BQU A;  1CBR A;  2PY1 A;  4WHI A;  2ASN X;  5KID A;  1U17 A;  1E5P A;  4I9R A;  4KC8 A;  5L8N A;  3O22 A;  1G85 A;  2R56 A;  4NLI A;  3C77 X;  1JYD A;  4NW4 A;  4YFQ A;  4IMN A;  2L68 A;  4MVL A;  1PEE A;  2K23 A;  1OPA A;  1BSQ A;  3ELX A;  1EPA A;  3WJG A;  2OVE A;  1SA8 A;  2OFR X;  1VYF A;  1GX9 A;  3LV4 A;  1BRQ A;  2L5P A;  3FR4 A;  4O4X A;  4ZCB A;  1T8V A;  1LFO A;  2AT6 X;  4O3W A;  1SXW A;  4ZHG A;  1DF3 A;  3UEW A;  3HOL A;  1H91 A;  2L67 A;  2NND A;  1U18 A;  4HPD A;  4YGG A;  1S7D A;  3PH5 A;  2ANS A;  5H9N A;  3TGC A;  3U03 A;  3ZI8 A;  3D95 A;  2AL0 X;  2BS5 A;  1QQS A;  2X8T A;  1JJX A;  1QY2 A;  3QKG A;  1BBP A;  4WFU A;  2WEW A;  3SAO A;  5LKE A;  2R74 A;  4RUN A;  1X89 A;  5HCC C;  2BHV A;  2ACP X;  1B8E A;  5HZ6 A;  3JS1 A;  4EEJ A;  1GM6 A;  4HPB A;  2M4L A;  1FDQ A;  3U0D A;  1TVQ A;  1LF7 A;  4Y0S A;  3ELZ A;  2ALL X;  4YCH A;  3VG3 A;  1ZNH A;  2GC9 A;  3HOE A;  4WBK A;  4QGV A;  3EM0 A;  1IFC A;  5DG4 A;  3KFH A;  3PQS A;  5FQ7 E;  1DFV A;  2YG2 A;  3C78 X;  1QY0 A;  4YKM A;  3B2I A;  1TXL A;  1ACD A;  1DC9 A;  4O4S A;  1A57 A;  5F6B A;  1QAB E;  1MDC A;  2GTL O;  5LJG A;  1KQX A;  4ML7 B;  4WFV A;  3UEU A;  1ZRY A;  3EBW A;  2N93 A;  1GT1 A;  2HZQ A;  1GKA B;  2HYS A;  2G79 A;  3FEL A;  1JZU A;  3MVF A;  2A3F X;  1KT3 A;  2O62 A;  4UU3 A;  2CM4 A;  1YWB A;  3P6E A;  4MVE A;  1ZNK A;  2GTL N;  3P6D A;  4YGH A;  5D8J A;  5JR8 A;  1GKA A;  1X8Q A;  2OVA A;  2YMS A;  3KFF A;  3BY0 A;  4IBA A;  3BLG A;  4YMY A;  2WUT A;  3F6Z B;  3P6G A;  3F8A A;  4AZP A;  3PP6 A;  4UU2 A;  2X8S A;  3OD9 A;  1BRP A;  2QO6 A;  4MIS A;  2A2U A;  4TKB A;  3VG4 A;  1LIE A;  3CBS A;  2WR6 A;  3CWK A;  5H8T A;  3FEN A;  1YWD A;  5CYB A;  2IFB A;  2BT9 A;  4QQ1 A;  1ZND A;  4Y0P A;  1E00 A;  3FMZ A;  5BVT A;  5LJE A;  1BJ7 A;  4LZV A;  5HAE A;  1B4M A;  3WJE A;  1LID A;  4YCE A;  3T1D A;  3TZS A;  2EU7 X;  4QYN A;  4EXZ A;  3PPT A;  3STM X;  4QRL A;  5BVQ A;  5EED A;  1X8U A;  2OFM X;  3EBK A;  2JU8 A;  4YH0 A;  4HPA A;  3P6H A;  4RUU A;  1OBP A;  1JJJ A;  3MX7 A;  2JOZ A;  5D45 A;  2JW1 A;  2KTS A;  2LA7 A;  4GNY A;  4A8Z A;  3UEV A;  1LIC A;  3ZW1 B;  3RSW A;  5EPQ A;  2AKQ A;  5LJD A;  3FA7 A;  1N0S A;  3MBT A;  1IFB A;  1XCA A;  3O2Y A;  1I05 A;  2WQA E;  1G74 A;  3E3C A;  2AT3 X;  1VYG A;  3FW4 A;  4HWM A;  3BSZ E;  3DTQ A;  3P6F A;  2L9C A;  2AT5 X;  1TW4 A;  3FR2 A;  5HZ8 A;  3ZW1 A;  4XME A;  4ES7 A;  3BU9 A;  2RCQ A;  1HMR A;  4I6S A;  2JU7 A;  3KFI A;  5H9A A;  2CBS A;  4GET A;  2QM9 A;  1JBH A;  3FEP A;  2Z4H A;  5BVS A;  1EW3 A;  2MM3 A;  4TNN A;  3BDR A;  1DZP A;  3TGB A;  3NR3 A;  1LPJ A;  3NBX X;  1JV4 A;  3OE3 A;  2RQ0 A;  5IO6 A;  4OS3 A;  3NAD A;  2HNX A;  4IAX A;  5FAZ A;  5FQ6 E;  1KZW A;  3BS2 A;  4EFG A;  4I3C A;  3KFG A;  4GNW A;  1O1V A;  3APV A;  3WJC A;  2ZAI A;  2AH7 X;  4ZHH A;  3DSZ A;  3VG5 A;  2LBV A;  1SMP I;  3PEC A;  2G7B A;  4AZR A;  3BX8 A;  4NNS A;  2FR2 A;  1KT5 A;  4XMF A;  4ID2 A;  1BM5 A;  1D2U A;  1EIO A;  2KD2 A;  3FA9 A;  1I4U A;  4JGL A;  2A13 A;  2MHD A;  4ON1 A;  3UEX A;  4NYQ A;  2JU3 A;  2WSJ A;  1Z24 A;  3HWE A;  4M6S A;  1TOW A;  5HTD A;  5LJK A;  2CZU A;  2LBA A;  1SY2 A;  2BS6 A;  4GZV A;  4KT5 A;  1X8O A;  1GX8 A;  1EAL A;  3WJB A;  2RA6 A;  2W2F A;  4ZGF A;  4DQ4 A;  4O3X B;  1ERX A;  1PMP A;  2NP1 A;  3B2J A;  1L6M A;  4ORW A;  4PSQ A;  3S5V A;  1DZJ A;  1S2P A;  3BX7 A;  1DZK A;  1AQB A;  3FW5 A;  1OEK A;  4GRJ A;  1VPR A;  4ARH A;  5KIC A;  4GU8 A;  4XMD A;  1I06 A;  4ALO A;  3KQ0 A;  3UAQ A;  1B0O A;  1P6P A;  1CBS A;  1YWA A;  4N7D A;  1EPB A;  3ZWE A;  3WXQ A;  3K3L A;  4GE1 A;  4U3Q A;  3D4R A;  4QAE A;  4IB7 A;  1KXO A;  3FYF A;  2KTD A;  1KT4 A;  4YDB A;  5HCE C;  1LNM A;  4ZGU A;  2AT8 X;  2K62 A;  4COT A;  1UZ2 X;  1BSY A;  5HA1 A;  1IIU A;  4TKJ A;  5DPQ A;  4U8U O;  4YKO A;  3VPJ E;  4NP1 A;  2CM9 A;  1RBP A;  2ZAG A;  4FQB B;  4AYH A;  1AEL A;  1CJ5 A;  1OEE A;  1SXY A;  5B27 A;  2Z4I A;  5HTE A;  3APU A;  3CMP A;  2OVD A;  1QG5 A;  3HWD A;  4BOE A;  3U9P C;  1IW2 A;  2F73 A;  4ZH6 A;  5B29 A;  4U8U N;  2P8G A;  4HFO A;  2QOS C;  3GE2 A;  4FBR A;  2WWP A;  3CR6 A;  4MVI A;  4YFP A;  4MVK A;  1ZNL A;  2X45 A;  2HZR A;  2RD7 C;  3V8U A;  2MJI A;  2Q9S A;  4HPC A;  4ZFX A;  5F7G A;  1EQD A;  2A0A A;  5HA0 A;  2Q2P A;  4D6B A;  4AZQ A;  2QMI A;  4GK9 A;  4FBO A;  5HZ9 A;  2AT0 X;  3WVM A;  1HMT A;  1TOU A;  1GT3 A;  3APW A;  4ZHC A;  4R0B A;  2OVS A;  3ZUO A;  3FLL A;  1S44 A;  3OBL A;  4XMH A;  3ZW2 A;  2W2B A;  3AKM A;  3PQU A;  2CZT A;  3NPO A;  4PJ2 A;  1MX8 A;  1LIF A;  3B2L A;  5IO5 A;  4O3Y A;  4YGZ A;  2POA A;  4XMG A;  1FE3 A;  3P6C A;  4K19 A;  4LKT A;  3FIQ A;  2FR3 A;  5HBS A;  3NQK A;  4ALB A;  1CBI A;  1QFV A;  4LKP A;  4XMC A;  4A1H A;  4I3D A;  3HK1 A;  1HMS A;  1R0U A;  1A2D A;  4ORR A;  3NX1 A;  1KT6 A;  4TKH A;  4AZM A;  2W2A A;  2GTF X;  1AVG I;  4QGW A;  4ORY A;  4ZHD A;  3HWF A;  1PBO A;  4AZN A;  4QZU A;  5FFH A;  2BLG A;  3GAQ A;  1ZNE A;  4GKC A;  1KZX A;  5CE4 A;  4ZHF A;  1ADL A;  4N7C A;  5LJC A;  2Q2M A;  3N91 A;  1B56 A;  1U0X A;  2ACO A;  2JN3 A;  2FRS A;  4IB9 A;  2FT9 A;  3TF6 A;  3PH6 A;  1HBQ A;  5HZ5 A;  1GXA A;  4KII A;  2X46 A;  4YBP A;  1OPB A;  1HQP A;  3C76 X;  5HWZ A;  1CBQ A;  1T0V A;  4QZT A;  3WOV A;  4ORU A;  5H9K A;  3ZZV A;  5FEN A;  4O9S A;  1A3Y A;  3WBG A;  3LHN A;  4QNI A;  1KGL A;  5L8O A;  4KH8 A;  4O49 A;  4A1Y A;  4MIR A;  1YIV A;  2KT4 B;  4GH7 A;  1O8V A;  5LJH A;  4OMW A;  1SXU A;  2LKK A;  1X8N A;  3STK A;  5K06 A;  1QWD A;  4IB6 A;  4FBV A;  4QYP A;  2RN4 A;  2X8F A;  5LKF A;  2Q4N A;  3P24 A;  3CQN A;  4KC7 A;  2HMB A;  2AMM X;  5D47 A;  1JYJ A;  3OJY C;  2DM5 A;  4L3R A;  3NQ9 A;  5AQ6 A;  5BYP A;  1URE A;  3B2H A;  1G5W A;  3VE1 A;  4O3Z A;  1Y9L A;  3RKG A;  1PM1 X;  1CRB A;  4YFR A;  1GT5 A;  5AEO A;  5H9L A;  3S26 A;  1GT4 A;  4FGI B;  1MUP A;  2RCT A;  3JQO A;  5EDC A;  1ML7 A;  3CBC A;  3EMM A;  1EI5 A;  1ICM A;  4O4O A;  4O4U A;  3S60 A;  1ALB A;  4D6A A;  1NP1 A;  3KZA A;  2F09 A;  3JSQ A;  1KOI A;  4TLJ A;  4EQA C;  5LJB A;  4ZR2 A;  4NLJ A;  1FEM A;  4LZU A;  1YUP A;  3F9D A;  3IFB A;  3CQR A;  4IMO A;  4CK4 A;  4ZH9 A;  4ORS A;  4I3B A;  4U9C A;  1FEN A;  1I04 A;  1YP6 A;  1KQW A;  3VG6 A;  1HBP A;  1BEB A;  4OMX A;  5C0N A;  1BLR A;  4AW8 A;  5F1E A;  4DQ3 A;  1SY0 A;  4YBU A;  1EXS A;  1DZM A;  1MVG A;  3NP1 A;  2FS7 A;  2A2G A;  2LFO A;  3O19 A;  1YP7 A;  5EZ2 A;  4ZJ0 A;  5HCD C;  2QO4 A;  3RWX A;  3L4R A;  5F6Z A;  5AJC A;  2NNE A;  4IAB A;  4YDA A;  1E06 A;  2NNQ A;  4IAW A;  1JIW I;  2E4J A;  4ODD A;  1XKI A;  1Y9T A;  3P02 A;  3VG7 A;  3EYC A;  3RZY A;  1DV9 A;  1GGL A;  3ZW0 B;  1G7N A;  1SY1 A;  2MWH A;  4Y0Q A;  1X8P A;  4EDE A;  2GTL M;  1ICN A;  3FA8 A;  2Q39 A;  4NYR A;  2FS6 A;  5EEE A;  2WEX A;  3S5X A;  5EDB A;  3IA8 A;  3VG2 A;  4CSB A;  1NGL A;  2LB6 A;  2OZQ A;  1RLB E;  3ZUI A;  3HWG A;  1T68 X;  2GJ5 A;  4INN A;  3ZQ3 A;  3ZW0 A;  1ERB A;  3I17 A;  3PED A;  4A60 A;  4QGX A;  1KT7 A;  1BWY A;  3FEK A;  1LKE A;  4I9S A;  1IKE A;  2JMB A;  1EII A;  2HLV A;  5FQ8 E;  3VU1 A;  5KHP A;  2FTB A;  4U8U M;  1O1U A;  1QY1 A;  4NNT A;  4Y0R A;  2WQ9 A;  4OS0 A;  3RBY A;  4TJZ A;  2G78 A;  4ORX A;  2KW1 A;  3SOT A;  1FTP A;  1ZNG A;  1BSO A;  1OBU A;  1D3S A;  4I95 A;  1YWC A;  1SXX A;  3APX A;  3FR5 A;  3G7X A;  5F58 A;  5L8I A;  1FEL A;  3FA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...