4KHAB

Structural basis of histone h2a-h2b recognition by the essential chaperone fact
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
b'AGRAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spt16M-Histone H2B 1.1 chimera
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Chaperone/nuclear protein
total genus 28
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4khaB00
4ZUXB 4X23A 3C1CB 3UTAD 5B0YA 4H9RB 4KUDA 3MVDA 3UTAC 1P3MA 4NE5A 5B2ID 3X1VC 3AZGC 4Z5TC 5B2IC 3MGQB 3REJC 5AY8D 5CPKD 3VH5A 5FUGA 1ID3D 4DRBA 3KXBA 1P3BC 4XUJC 3AFAB 1M19B 3REKD 4LD9D 2YFVB 4QLCD 1P3GD 3REKC 5B33D 3AZMB 4H9PB 3REJA 4WNNB 5B33C 5AV8B 5JA4A 1P3AD 3B6GB 4KGCB 3UTAA 2IO5B 3X1VA 3W97D 5B40C 3AZGA 4Z5TA 5B2IA 3W96D 1P3OD 5C3IC 1P3BA 2BYMB 3TU4B 2BYKA 3AZEB 3AZIC 1EQZC 4ZBJB 3C1BC 3REKA 4LD9A 1M18C 4QLCA 1P3GA 2AROD 5B0ZB 5B33A 3WA9C 5AV5D 2AROC 3LZ1D 5GSUC 5AV5C 5F99B 3WTPE 3UTBB 3AZKC 3LZ1C 2NZDD 3UT9C 5AVBB 4AWLC 1P3OA 2CV5D 3VH6A 5CPID 3LELB 4YM6B 3AZIA 1P3PD 1HQ3D 1EQZA 4G91C 3C1BA 1P3PC 2PYOB 3AV1B 4DRAA 3W98B 3WA9A 1AOID 1P3FC 5E5AC 2AROA 1AOIC 5GSUA 5AV5A 4J8XC 4J8WD 4H9QA 1N1JA 3AZKA 3LZ1A 4J8VC 3AZLD 5GT3D 3UT9A 4NE3A 2NZDA 3AZLC 1F66D 4CSRB 5AY8B 4WZSB 4H9OB 5CPKB 3WAAC 1ID3B 5AVCC 2CWEA 2F8NH 1P3PA 2RVQC 5BS7C 4R8PD 4H9SC 1AOIA 5B1MC 5CPJB 4WU9D 3VH5T 3B0BA 4J8XA 1KU5A 1P3AB 5GT0B 1P3LC 4WU9C 3NQJB 4KHAB 4J8UC 3MGRD 3AN2D 3LJAC 3W97B 3AZLA 2NQBD 3X1SD 3WAAA 3W96B 3X1SC 5BT1D 3AZFD 3MGSC 3REID 5AV6B 5BS7A 3AZFC 4H9SA 1KX4D 1JFIA 4WU8B 2F8NA 1KX4C 1M19C 1KX3D 1ZLAD 1BH9A 1KX3C 5B1LD 1P3LA 1ZLAC 1R4VA 4WU9A 2F8NG 4NFTA 2HUEB 4CAYA 1KX5D 5BNVB 3AN2A 5B31C 1KX5C 3X1SA 3WTPC 3AZJD 1S32C 2CV5B 3MGSA 3AZJC 3AZFA 5CPIB 3KXBD 3B0CT 1HQ3B 2HIOB 4UUZA 3AZND 1ULYA 3TU4C 2JSSA 1KX4A 3B0DB 3AZNC 5KDMA 1KX3A 1ZLAA 2FJ7B 4J8WB 3VH6T 5B2JB 5G49B 5B31A 3REHC 3X1VD 1KX5A 3R45A 5GT3B 3KUYC 4Z5TD 3AZGD 1P3IB 3NQUA 1F66B 3WTPA 1TZYB 1S32A 5BO0A 4JJNB 3AZJA 1P3BD 4XUJD 3W99C 3B6FB 4R8PB 3AZNA 3X1TC 3O62C 1HTAA 5JRGD 2PYOC 1WWIA 1BH8A 5JRGC 4XZQB 3MNNC 3REHA 2L5AA 5B40D 3KUYA 3MGRB 1M1AD 5B32B 2NQBB 1M1AC 3A6NB 1H3OB 5B24C 3AYWD 3REIB 3W99A 3AZID 4XUJA 3AYWC 3KWQC 3X1TA 1EQZD 3C1BD 3O62A 4Z66C 1M18D 1P3KD 3WA9D 3LZ0B 5JRGA 1P3KC 5B1LB 3MNNA 5GSUD 4EO5B 5CP6C 4X23B 3AZKD 5B40A 5B0YB 4KUDB 5BNXA 3MVDB 3UT9D 1P3MB 1M1AA 5GXQD 3VH5W 5GXQC 4G92C 5FUGB 4H9NA 5B24A 3AYWA 3KWQA 3WKJD 3KXBB 3MGPC 5DNMD 4Z66A 3WKJC 4HGAC 5DNMC 1P3FD 3V9RA 1M18A 5E5AD 1P3KA 1B6WA 3REJB 4J8XD 1U35D 5JA4B 5CP6A 4J8VD 1U35C 1P34D 3UTAB 3X1VB 4YS3C 3AZHD 3AZGB 1P34C 4Z5TB 1B67A 5B2IB 5DNNC 5GXQA 3AZHC 3X1UD 3WAAD 1Q9CA 3X1UC 5AV9D 5AVCD 5AV9C 3MGPA 2RVQD 1P3BB 1TAFA 2BYKB 3WKJA 5DNMA 2YFWA 2HIOC 3REKB 1P3FA 5B1MD 2F8ND 5E5AA 4LD9B 4QLCB 3B0DC 1P3GB 5B33B 1P3LD 1U35A 3RELD 4J8UD 3AV2C 3LJAD 4J8VA 4YS3A 2FJ7C 1A7WA 3C1CD 3RELC 1P34A 5DNNA 3AZHA 4ZUXC 3C1CC 3X1UA 5C3IB 1P3OB 3VH6W 5AV9A 5AVCA 1TZYC 4E45A 3MGSD 3MGQC 3AZIB 1EQZB 3AFAD 3C1BB 1M19D 3AFAC 3WA9B 5B1MA 2AROB 3AZMD 3AV2A 5GSUB 5AV5B 3AZMC 3RELA 4J8UA 4H9QB 1N1JB 5B31D 4XZQC 3LZ1B 3LJAA 3AZKB 5AV8C 4ZUXA 3C1CA 3B6GC 3UT9B 4KGCC 4H9RA 2NZDB 2IO5C 4AWLB 3WTPD 4WV4B 1S32D 3MGQA 4G91B 1P3PB 3TU4D 2F8NK 3KSYA 3AFAA 3AZEC 1M19A 2YFVA 1AOIB 4ZBJC 5B0ZD 5CHLB 4J8XB 4H9PA 3AZMA 4WNNA 3REHD 5B0ZC 5AV8A 3B6GA 3KUYD 4KGCA 3AZLB 4EO5C 5F99C 3UTBC 5B31G 3WAAB 5AVBC 3W99D 3LELD 4YM6D 3X1TD 2BYMA 3TU4A 3LELC 3O62D 4YM6C 3AZEA 1JFIB 2F8NB 2PYOD 3AV1C 1BH9B 3W98C 3MNND 1P3LB 5B0ZA 4WU9B 4CAYB 5F99A 3UTBA 3AN2B 3X1SB 5AVBA 5B24D 4M6BA 3MGSB 5AY8C 5CPKC 3AZFB 3KWQD 1ID3C 3LELA 4YM6A 4Z2MH 4Z66D 4UUZB 1KX4B 5KDMB 2LY8A 2PYOA 1WWSA 3AV1A 1KX3B 3W98A 1ZLAB 4LD9C 5CPJD 4QLCC 5CP6D 1P3GC 5GT0D 5CPJC 5B31B 1P3AC 5GT0C 3R45B 1KX5B 3NQUB 3W97C 3WTPB 1S32B 5BO0B 4CSRA 5AY8A 5CPKA 4H9OA 3AZJB 3W96C 1P3OC 3MGPD 1ID3A 5AV6D 5AV6C 3AZNB 4WU8D 4WU8C 1BH8B 4Z2MG 5CPJA 3REHB 4YS3D 1P3AA 5GT0A 3KUYB 3NQJA 2HUEC 4KHAA 5DNND 3W97A 2NZDC 3W96A 3W99B 2CV5C 4XUJB 5AV6A 3X1TB 5CPIC 2HIOD 3O62B 1HQ3C 4WU8A 5JRGB 3MNNB 3AV2D 2FJ7D 3B0CW 5B40B 5B2JD 4ZUXD 5BNXB 4NE6A 4J8WC 1M1AB 5BNVA 5B2JC 1P3ID 5GT3C 1P3IC 3MGQD 1TZYD 1F66C 4H9NB 5B24B 4JJND 2CV5A 3AYWB 3KWQB 4JJNC 5CPIA 4Z66B 3B6FD 1HQ3A 2HIOA 1M18B 3V9RB 1P3KB 3B6FC 4R8PC 5CP6B 2FJ7A 4XZQD 5AV8D 3B6GD 4KGCD 4J8WA 5B2JA 5G49A 5GT3A 5GXQB 5B32D 3MGRC 4G92B 3AN2C 1P3IA 1F66A 3A6ND 5B32C 2NQBC 1TZYA 3A6NC 4JJNA 3MGPB 5BT1C 1TAFB 3WKJB 4HGAB 5DNMB 3REIC 3AZED 3B6FA 2YFWB 4R8PA 1P3FB 5E5AB 3LZ0D 3LZ0C 1U35B 4XZQA 4J8VB 4YS3B 5B1LC 4X23D 1P34B 4KUDD 5F99D 5B0YD 3UTBD 5DNNB 1BFMA 3AZHB 3MVDD 4X23C 3MGRA 1P3MD 4KUDC 5B0YC 5B32A 3X1UB 3MVDC 5AVBD 1P3MC 2NQBA 3A6NA 1H3OA 5B32G 5AV9B 5AVCB 1F1EA 4E44A 3REIA 3KXBC 3AV1D 5B1MB 3W98D 3LZ0A 3REJD 3AV2B 5B1LA 3RELB 4J8UB 3LJAB
chains in the Genus database with same CATH superfamily
4ZUXB 4X23A 3C1CB 3UTAD 5B0YA 4H9RB 4KUDA 3MVDA 3UTAC 1P3MA 4NE5A 5B2ID 3X1VC 3AZGC 4Z5TC 5B2IC 3MGQB 3REJC 5AY8D 5CPKD 3AL0C 3VH5A 5FUGA 1ID3D 2DQNC 4DRBA 3KXBA 1P3BC 4XUJC 3AFAB 3EPHA 1M19B 3REKD 4LD9D 2YFVB 2Y2HA 4QLCD 1P3GD 3REKC 5B33D 3AZMB 4H9PB 3REJA 4WNNB 5B33C 5AV8B 5JA4A 1P3AD 3B6GB 4KGCB 3UTAA 2IO5B 3X1VA 3W97D 5B40C 3AZGA 4Z5TA 5B2IA 3W96D 1P3OD 5C3IC 1P3BA 2BYMB 3TU4B 2BYKA 3AZEB 1T3UA 3AZIC 1EQZC 4ZBJB 3C1BC 3REKA 2ZY5A 4LD9A 1M18C 4QLCA 1P3GA 2AROD 5B0ZB 5B33A 3WA9C 5AV5D 2AROC 3LZ1D 5GSUC 5AV5C 5F99B 3WTPE 3UTBB 3AZKC 3LZ1C 2NZDD 3UT9C 5AVBB 4AWLC 1P3OA 2Y2JA 2CV5D 4WJ3C 3VH6A 5CPID 3LELB 4YM6B 3AZIA 1P3PD 1HQ3D 1EQZA 4G91C 3C1BA 1P3PC 2PYOB 2Y2IA 3AV1B 4DRAA 3W98B 3WA9A 2Y2QA 1AOID 1P3FC 5E5AC 2AROA 1AOIC 5GSUA 5AV5A 4J8XC 4J8WD 4H9QA 1N1JA 3AZKA 3LZ1A 4J8VC 3AZLD 5GT3D 3UT9A 2JCHA 4NE3A 2NZDA 3AZLC 1F66D 4CSRB 5AY8B 4WZSB 4H9OB 5CPKB 3WAAC 1ID3B 5AVCC 2CWEA 1PZRA 2F8NH 1P3PA 2RVQC 5BS7C 4R8PD 4H9SC 1AOIA 5B1MC 5CPJB 4WU9D 3VH5T 2Y2PA 3B0BA 4J8XA 1KU5A 1P3AB 5GT0B 1P3LC 4WU9C 3NQJB 4KHAB 4J8UC 3MGRD 3AN2D 3LJAC 3W97B 3AZLA 2NQBD 3X1SD 3WAAA 3W96B 3X1SC 2ZY3A 5BT1D 3AZFD 3MGSC 3REID 5AV6B 5BS7A 3AZFC 4H9SA 1KX4D 2Y2LA 4WU8B 1JFIA 2F8NA 1KX4C 1M19C 1KX3D 1ZLAD 1BH9A 1KX3C 5B1LD 1P3LA 1ZLAC 1R4VA 4WU9A 2F8NG 4NFTA 2HUEB 4CAYA 1KX5D 5BNVB 3AN2A 5B31C 1KX5C 3X1SA 3WTPC 3AZJD 1S32C 2CV5B 3MGSA 3AZJC 3AZFA 5CPIB 3KXBD 3B0CT 1HQ3B 2HIOB 4UUZA 3AZND 1ULYA 3TU4C 2JSSA 1KX4A 3B0DB 3AZNC 5KDMA 1KX3A 1ZLAA 2FJ7B 4J8WB 3VH6T 5B2JB 5G49B 5B31A 3EPLA 3REHC 3X1VD 3A1KA 1KX5A 3R45A 5GT3B 3KUYC 4Z5TD 2G5HC 3AZGD 1P3IB 3NQUA 1F66B 3WTPA 3F6TA 1TZYB 1S32A 5BO0A 4JJNB 3AZJA 1P3BD 4XUJD 3W99C 3B6FB 4R8PB 3AZNA 3X1TC 3O62C 1HTAA 5JRGD 2PYOC 1WWIA 1BH8A 2G5IC 5JRGC 4XZQB 3MNNC 3REHA 2L5AA 5B40D 3KUYA 3MGRB 2ZM5A 1M1AD 2XD5A 5B32B 2NQBB 1M1AC 3A6NB 1H3OB 5B24C 3AYWD 2F2AC 2ZY4A 3REIB 3W99A 3AZID 4XUJA 3AYWC 3KWQC 3EPJA 3X1TA 1EQZD 3C1BD 3O62A 4Z66C 1M18D 1P3KD 3WA9D 3LZ0B 5JRGA 1P3KC 5B1LB 3MNNA 5GSUD 4EO5B 5CP6C 4X23B 3AZKD 5B40A 5B0YB 4KUDB 5BNXA 3MVDB 3UT9D 1P3MB 1M1AA 5GXQD 1W2EA 3VH5W 5GXQC 4G92C 5FUGB 4H9NA 5B24A 2BG1A 3AYWA 3KWQA 3WKJD 3KXBB 3MGPC 5DNMD 4Z66A 3WKJC 3P5JB 4HGAC 5DNMC 1P3FD 3V9RA 1M18A 5E5AD 1P3KA 1B6WA 3REJB 4J8XD 1U35D 5JA4B 5CP6A 4J8VD 1U35C 1P34D 3UTAB 3X1VB 4YS3C 3AZHD 3AZGB 1P34C 4Z5TB 1B67A 4UPKA 5DNNC 5B2IB 5GXQA 2Y2NA 3X1UD 3A1IA 3EPKA 3AZHC 3WAAD 1Q9CA 3EG5B 3X1UC 5AV9D 5AVCD 5AV9C 3MGPA 2RVQD 1P3BB 1TAFA 2BYKB 3WKJA 5DNMA 2YFWA 2HIOC 3REKB 1P3FA 5B1MD 2F8ND 5E5AA 4LD9B 4QLCB 3B0DC 1P3GB 5B33B 1P3LD 1U35A 3RELD 4J8UD 3AV2C 3LJAD 4J8VA 4YS3A 2FJ7C 1A7WA 3C1CD 3RELC 1P34A 5DNNA 3AZHA 4ZUXC 3C1CC 3X1UA 5C3IB 1P3OB 3VH6W 5AV9A 5AVCA 1TZYC 4E45A 3MGSD 3MGQC 3AZIB 2J8PA 1EQZB 3AFAD 3C1BB 1M19D 3AFAC 3WA9B 5B1MA 2AROB 3AZMD 3AV2A 5GSUB 5AV5B 3AZMC 3RELA 4J8UA 4H9QB 1N1JB 5B31D 4XZQC 3LZ1B 3LJAA 3AZKB 5AV8C 4ZUXA 3C1CA 3B6GC 1Z2CB 3UT9B 4H9RA 4KGCC 2NZDB 2IO5C 4AWLB 3H0LC 4WV4B 3WTPD 1S32D 3MGQA 4G91B 1P3PB 3TU4D 2F8NK 3KFUG 3KSYA 3AFAA 2JE5A 3AZEC 1M19A 2YFVA 1AOIB 3IP4C 4ZBJC 5B0ZD 5CHLB 4J8XB 4H9PA 3AZMA 4WNNA 3REHD 5B0ZC 5AV8A 3B6GA 3KUYD 4KGCA 3AZLB 2ZY2A 4EO5C 5F99C 3UTBC 5B31G 3WAAB 5AVBC 3W99D 3LELD 4YM6D 3FDDA 3X1TD 2BYMA 3TU4A 3LELC 3O62D 4YM6C 3AZEA 1JFIB 2F8NB 2PYOD 3AV1C 1BH9B 3W98C 3MNND 1P3LB 5B0ZA 4WU9B 4CAYB 5F99A 3UTBA 3AN2B 2Y2MA 3X1SB 3H0MC 5AVBA 2DF4C 5B24D 4M6BA 3MGSB 2RIQA 5AY8C 5CPKC 3AZFB 2Y2GA 3KWQD 1ID3C 3LELA 4YM6A 4Z2MH 4Z66D 4UUZB 1KX4B 5KDMB 2LY8A 2W8SA 2PYOA 1WWSA 3AV1A 1KX3B 3W98A 1ZLAB 4LD9C 5CPJD 4QLCC 5CP6D 1P3GC 5GT0D 5CPJC 5B31B 1P3AC 5GT0C 3R45B 1KX5B 3NQUB 3W97C 3WTPB 1S32B 5BO0B 4CSRA 2UWXA 5AY8A 5CPKA 4H9OA 3AZJB 3W96C 1P3OC 3MGPD 1ID3A 5AV6D 5AV6C 3AZNB 4WU8D 4WU8C 1BH8B 4Z2MG 5CPJA 3REHB 4YS3D 1P3AA 5GT0A 3KUYB 3NQJA 2HUEC 4KHAA 5DNND 3W97A 2NZDC 3W96A 3W99B 2CV5C 4XUJB 5AV6A 3X1TB 5CPIC 2HIOD 3O62B 1HQ3C 4WU8A 5JRGB 3MNNB 3AV2D 2FJ7D 3B0CW 2Y2OA 5B40B 5B2JD 4ZUXD 5BNXB 4NE6A 4J8WC 4DQYB 5BNVA 5B2JC 1P3ID 1M1AB 5GT3C 1P3IC 3MGQD 1TZYD 1F66C 4H9NB 5B24B 4JJND 2CV5A 3AYWB 3KWQB 4JJNC 5CPIA 4Z66B 3B6FD 1HQ3A 2HIOA 1M18B 3V9RB 1P3KB 3B6FC 4R8PC 3H0RC 5CP6B 2FJ7A 4XZQD 2Y2KA 5AV8D 3B6GD 4KGCD 4J8WA 5B2JA 5G49A 5GT3A 5GXQB 5B32D 3MGRC 4G92B 3AN2C 1P3IA 1F66A 3A6ND 5B32C 2NQBC 1TZYA 3A6NC 4JJNA 3MGPB 5BT1C 2FFFB 1TAFB 3WKJB 4HGAB 5DNMB 3REIC 3AZED 3B6FA 2YFWB 4R8PA 1P3FB 5E5AB 2XD1A 3LZ0D 3LZ0C 1U35B 4XZQA 4J8VB 4YS3B 5B1LC 4X23D 1P34B 4KUDD 5F99D 5B0YD 3UTBD 5DNNB 1BFMA 3AZHB 3MVDD 4X23C 3MGRA 1P3MD 4KUDC 5B0YC 5B32A 3X1UB 3MVDC 5AVBD 1P3MC 2NQBA 3A6NA 1H3OA 5B32G 5AV9B 5AVCB 1F1EA 2VQRA 4E44A 3REIA 3KXBC 3AV1D 5B1MB 3W98D 3LZ0A 3REJD 3AV2B 5B1LA 3RELB 4J8UB 3LJAB
chains in the Genus database with same CATH topology
4ZUXB 4X23A 3C1CB 3UTAD 5B0YA 4H9RB 4KUDA 3MVDA 3UTAC 1P3MA 4NE5A 5B2ID 3X1VC 3AZGC 4Z5TC 5B2IC 3MGQB 3REJC 5AY8D 5CPKD 3AL0C 3VH5A 5FUGA 1ID3D 2DQNC 4DRBA 3KXBA 1P3BC 4XUJC 3AFAB 3EPHA 1M19B 3REKD 4LD9D 2YFVB 2Y2HA 4QLCD 1P3GD 3REKC 5B33D 3AZMB 4H9PB 3REJA 4WNNB 5B33C 5AV8B 5JA4A 1P3AD 3B6GB 4KGCB 3UTAA 2IO5B 3X1VA 3W97D 5B40C 3AZGA 4Z5TA 5B2IA 3W96D 1P3OD 5C3IC 1P3BA 2BYMB 3TU4B 2BYKA 3AZEB 1T3UA 3AZIC 1EQZC 4ZBJB 3C1BC 3REKA 2ZY5A 4LD9A 1M18C 4QLCA 1P3GA 2AROD 5B0ZB 5B33A 3WA9C 5AV5D 2AROC 3LZ1D 5GSUC 5AV5C 5F99B 3WTPE 3UTBB 3AZKC 3LZ1C 2NZDD 3UT9C 5AVBB 4AWLC 1P3OA 2Y2JA 2CV5D 4WJ3C 3VH6A 5CPID 3LELB 4YM6B 3AZIA 1P3PD 1HQ3D 1EQZA 4G91C 3C1BA 1P3PC 2PYOB 2Y2IA 3AV1B 4DRAA 3W98B 3WA9A 2Y2QA 1AOID 1P3FC 5E5AC 2AROA 1AOIC 5GSUA 5AV5A 4J8XC 4J8WD 4H9QA 1N1JA 3AZKA 3LZ1A 4J8VC 3AZLD 5GT3D 3UT9A 2JCHA 4NE3A 2NZDA 3AZLC 1F66D 4CSRB 5AY8B 4WZSB 4H9OB 5CPKB 3WAAC 1ID3B 5AVCC 2CWEA 1PZRA 2F8NH 1P3PA 2RVQC 5BS7C 4R8PD 4H9SC 1AOIA 5B1MC 5CPJB 4WU9D 3VH5T 2Y2PA 3B0BA 4J8XA 1KU5A 1P3AB 5GT0B 1P3LC 4WU9C 3NQJB 4KHAB 4J8UC 3MGRD 3AN2D 3LJAC 3W97B 3AZLA 2NQBD 3X1SD 3WAAA 3W96B 3X1SC 2ZY3A 5BT1D 3AZFD 3MGSC 3REID 5AV6B 5BS7A 3AZFC 4H9SA 1KX4D 2Y2LA 4WU8B 1JFIA 2F8NA 1KX4C 1M19C 1KX3D 1ZLAD 1BH9A 1KX3C 5B1LD 1P3LA 1ZLAC 1R4VA 4WU9A 2F8NG 4NFTA 2HUEB 4CAYA 1KX5D 5BNVB 3AN2A 5B31C 1KX5C 3X1SA 3WTPC 3AZJD 1S32C 2CV5B 3MGSA 3AZJC 3AZFA 5CPIB 3KXBD 3B0CT 1HQ3B 2HIOB 4UUZA 3AZND 1ULYA 3TU4C 2JSSA 1KX4A 3B0DB 3AZNC 5KDMA 1KX3A 1ZLAA 2FJ7B 4J8WB 3VH6T 5B2JB 5G49B 5B31A 3EPLA 3REHC 3X1VD 3A1KA 1KX5A 3R45A 5GT3B 3KUYC 4Z5TD 2G5HC 3AZGD 1P3IB 3NQUA 1F66B 3WTPA 3F6TA 1TZYB 1S32A 5BO0A 4JJNB 3AZJA 1P3BD 4XUJD 3W99C 3B6FB 4R8PB 3AZNA 3X1TC 3O62C 1HTAA 5JRGD 2PYOC 1WWIA 1BH8A 2G5IC 5JRGC 4XZQB 3MNNC 3REHA 2L5AA 5B40D 3KUYA 3MGRB 2ZM5A 1M1AD 2XD5A 5B32B 2NQBB 1M1AC 3A6NB 1H3OB 5B24C 3AYWD 2F2AC 2ZY4A 3REIB 3W99A 3AZID 4XUJA 3AYWC 3KWQC 3EPJA 3X1TA 1EQZD 3C1BD 3O62A 4Z66C 1M18D 1P3KD 3WA9D 3LZ0B 5JRGA 1P3KC 5B1LB 3MNNA 5GSUD 4EO5B 5CP6C 4X23B 3AZKD 5B40A 5B0YB 4KUDB 5BNXA 3MVDB 3UT9D 1P3MB 1M1AA 5GXQD 1W2EA 3VH5W 5GXQC 4G92C 5FUGB 4H9NA 5B24A 2BG1A 3AYWA 3KWQA 3WKJD 3KXBB 3MGPC 5DNMD 4Z66A 3WKJC 3P5JB 4HGAC 5DNMC 1P3FD 3V9RA 1M18A 5E5AD 1P3KA 1B6WA 3REJB 4J8XD 1U35D 5JA4B 5CP6A 4J8VD 1U35C 1P34D 3UTAB 3X1VB 4YS3C 3AZHD 3AZGB 1P34C 4Z5TB 1B67A 4UPKA 5DNNC 5B2IB 5GXQA 2Y2NA 3X1UD 3A1IA 3EPKA 3AZHC 3WAAD 1Q9CA 3EG5B 3X1UC 5AV9D 5AVCD 5AV9C 3MGPA 2RVQD 1P3BB 1TAFA 2BYKB 3WKJA 5DNMA 2YFWA 2HIOC 3REKB 1P3FA 5B1MD 2F8ND 5E5AA 4LD9B 4QLCB 3B0DC 1P3GB 5B33B 1P3LD 1U35A 3RELD 4J8UD 3AV2C 3LJAD 4J8VA 4YS3A 2FJ7C 1A7WA 3C1CD 3RELC 1P34A 5DNNA 3AZHA 4ZUXC 3C1CC 3X1UA 5C3IB 1P3OB 3VH6W 5AV9A 5AVCA 1TZYC 4E45A 3MGSD 3MGQC 3AZIB 2J8PA 1EQZB 3AFAD 3C1BB 1M19D 3AFAC 3WA9B 5B1MA 2AROB 3AZMD 3AV2A 5GSUB 5AV5B 3AZMC 3RELA 4J8UA 4H9QB 1N1JB 5B31D 4XZQC 3LZ1B 3LJAA 3AZKB 5AV8C 4ZUXA 3C1CA 3B6GC 1Z2CB 3UT9B 4H9RA 4KGCC 2NZDB 2IO5C 4AWLB 3H0LC 4WV4B 3WTPD 1S32D 3MGQA 4G91B 1P3PB 3TU4D 2F8NK 3KFUG 3KSYA 3AFAA 2JE5A 3AZEC 1M19A 2YFVA 1AOIB 3IP4C 4ZBJC 5B0ZD 5CHLB 4J8XB 4H9PA 3AZMA 4WNNA 3REHD 5B0ZC 5AV8A 3B6GA 3KUYD 4KGCA 3AZLB 2ZY2A 4EO5C 5F99C 3UTBC 5B31G 3WAAB 5AVBC 3W99D 3LELD 4YM6D 3FDDA 3X1TD 2BYMA 3TU4A 3LELC 3O62D 4YM6C 3AZEA 1JFIB 2F8NB 2PYOD 3AV1C 1BH9B 3W98C 3MNND 1P3LB 5B0ZA 4WU9B 4CAYB 5F99A 3UTBA 3AN2B 2Y2MA 3X1SB 3H0MC 5AVBA 2DF4C 5B24D 4M6BA 3MGSB 2RIQA 5AY8C 5CPKC 3AZFB 2Y2GA 3KWQD 1ID3C 3LELA 4YM6A 4Z2MH 4Z66D 4UUZB 1KX4B 5KDMB 2LY8A 2W8SA 2PYOA 1WWSA 3AV1A 1KX3B 3W98A 1ZLAB 4LD9C 5CPJD 4QLCC 5CP6D 1P3GC 5GT0D 5CPJC 5B31B 1P3AC 5GT0C 3R45B 1KX5B 3NQUB 3W97C 3WTPB 1S32B 5BO0B 4CSRA 2UWXA 5AY8A 5CPKA 4H9OA 3AZJB 3W96C 1P3OC 3MGPD 1ID3A 5AV6D 5AV6C 3AZNB 4WU8D 4WU8C 1BH8B 4Z2MG 5CPJA 3REHB 4YS3D 1P3AA 5GT0A 3KUYB 3NQJA 2HUEC 4KHAA 5DNND 3W97A 2NZDC 3W96A 3W99B 2CV5C 4XUJB 5AV6A 3X1TB 5CPIC 2HIOD 3O62B 1HQ3C 4WU8A 5JRGB 3MNNB 3AV2D 2FJ7D 3B0CW 2Y2OA 5B40B 5B2JD 4ZUXD 5BNXB 4NE6A 4J8WC 4DQYB 5BNVA 5B2JC 1P3ID 1M1AB 5GT3C 1P3IC 3MGQD 1TZYD 1F66C 4H9NB 5B24B 4JJND 2CV5A 3AYWB 3KWQB 4JJNC 5CPIA 4Z66B 3B6FD 1HQ3A 2HIOA 1M18B 3V9RB 1P3KB 3B6FC 4R8PC 3H0RC 5CP6B 2FJ7A 4XZQD 2Y2KA 5AV8D 3B6GD 4KGCD 4J8WA 5B2JA 5G49A 5GT3A 5GXQB 5B32D 3MGRC 4G92B 3AN2C 1P3IA 1F66A 3A6ND 5B32C 2NQBC 1TZYA 3A6NC 4JJNA 3MGPB 5BT1C 2FFFB 1TAFB 3WKJB 4HGAB 5DNMB 3REIC 3AZED 3B6FA 2YFWB 4R8PA 1P3FB 5E5AB 2XD1A 3LZ0D 3LZ0C 1U35B 4XZQA 4J8VB 4YS3B 5B1LC 4X23D 1P34B 4KUDD 5F99D 5B0YD 3UTBD 5DNNB 1BFMA 3AZHB 3MVDD 4X23C 3MGRA 1P3MD 4KUDC 5B0YC 5B32A 3X1UB 3MVDC 5AVBD 1P3MC 2NQBA 3A6NA 1H3OA 5B32G 5AV9B 5AVCB 1F1EA 2VQRA 4E44A 3REIA 3KXBC 3AV1D 5B1MB 3W98D 3LZ0A 3REJD 3AV2B 5B1LA 3RELB 4J8UB 3LJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX B;  4X23 A;  3C1C B;  3UTA D;  5B0Y A;  4H9R B;  4KUD A;  3MVD A;  3UTA C;  1P3M A;  4NE5 A;  5B2I D;  3X1V C;  3AZG C;  4Z5T C;  5B2I C;  3MGQ B;  3REJ C;  5AY8 D;  5CPK D;  3VH5 A;  5FUG A;  1ID3 D;  4DRB A;  3KXB A;  1P3B C;  4XUJ C;  3AFA B;  1M19 B;  3REK D;  4LD9 D;  2YFV B;  4QLC D;  1P3G D;  3REK C;  5B33 D;  3AZM B;  4H9P B;  3REJ A;  4WNN B;  5B33 C;  5AV8 B;  5JA4 A;  1P3A D;  3B6G B;  4KGC B;  3UTA A;  2IO5 B;  3X1V A;  3W97 D;  5B40 C;  3AZG A;  4Z5T A;  5B2I A;  3W96 D;  1P3O D;  5C3I C;  1P3B A;  2BYM B;  3TU4 B;  2BYK A;  3AZE B;  3AZI C;  1EQZ C;  4ZBJ B;  3C1B C;  3REK A;  4LD9 A;  1M18 C;  4QLC A;  1P3G A;  2ARO D;  5B0Z B;  5B33 A;  3WA9 C;  5AV5 D;  2ARO C;  3LZ1 D;  5GSU C;  5AV5 C;  5F99 B;  3WTP E;  3UTB B;  3AZK C;  3LZ1 C;  2NZD D;  3UT9 C;  5AVB B;  4AWL C;  1P3O A;  2CV5 D;  3VH6 A;  5CPI D;  3LEL B;  4YM6 B;  3AZI A;  1P3P D;  1HQ3 D;  1EQZ A;  4G91 C;  3C1B A;  1P3P C;  2PYO B;  3AV1 B;  4DRA A;  3W98 B;  3WA9 A;  1AOI D;  1P3F C;  5E5A C;  2ARO A;  1AOI C;  5GSU A;  5AV5 A;  4J8X C;  4J8W D;  4H9Q A;  1N1J A;  3AZK A;  3LZ1 A;  4J8V C;  3AZL D;  5GT3 D;  3UT9 A;  4NE3 A;  2NZD A;  3AZL C;  1F66 D;  4CSR B;  5AY8 B;  4WZS B;  4H9O B;  5CPK B;  3WAA C;  1ID3 B;  5AVC C;  2CWE A;  2F8N H;  1P3P A;  2RVQ C;  5BS7 C;  4R8P D;  4H9S C;  1AOI A;  5B1M C;  5CPJ B;  4WU9 D;  3VH5 T;  3B0B A;  4J8X A;  1KU5 A;  1P3A B;  5GT0 B;  1P3L C;  4WU9 C;  3NQJ B;  4KHA B;  4J8U C;  3MGR D;  3AN2 D;  3LJA C;  3W97 B;  3AZL A;  2NQB D;  3X1S D;  3WAA A;  3W96 B;  3X1S C;  5BT1 D;  3AZF D;  3MGS C;  3REI D;  5AV6 B;  5BS7 A;  3AZF C;  4H9S A;  1KX4 D;  1JFI A;  4WU8 B;  2F8N A;  1KX4 C;  1M19 C;  1KX3 D;  1ZLA D;  1BH9 A;  1KX3 C;  5B1L D;  1P3L A;  1ZLA C;  1R4V A;  4WU9 A;  2F8N G;  4NFT A;  2HUE B;  4CAY A;  1KX5 D;  5BNV B;  3AN2 A;  5B31 C;  1KX5 C;  3X1S A;  3WTP C;  3AZJ D;  1S32 C;  2CV5 B;  3MGS A;  3AZJ C;  3AZF A;  5CPI B;  3KXB D;  3B0C T;  1HQ3 B;  2HIO B;  4UUZ A;  3AZN D;  1ULY A;  3TU4 C;  2JSS A;  1KX4 A;  3B0D B;  3AZN C;  5KDM A;  1KX3 A;  1ZLA A;  2FJ7 B;  4J8W B;  3VH6 T;  5B2J B;  5G49 B;  5B31 A;  3REH C;  3X1V D;  1KX5 A;  3R45 A;  5GT3 B;  3KUY C;  4Z5T D;  3AZG D;  1P3I B;  3NQU A;  1F66 B;  3WTP A;  1TZY B;  1S32 A;  5BO0 A;  4JJN B;  3AZJ A;  1P3B D;  4XUJ D;  3W99 C;  3B6F B;  4R8P B;  3AZN A;  3X1T C;  3O62 C;  1HTA A;  5JRG D;  2PYO C;  1WWI A;  1BH8 A;  5JRG C;  4XZQ B;  3MNN C;  3REH A;  2L5A A;  5B40 D;  3KUY A;  3MGR B;  1M1A D;  5B32 B;  2NQB B;  1M1A C;  3A6N B;  1H3O B;  5B24 C;  3AYW D;  3REI B;  3W99 A;  3AZI D;  4XUJ A;  3AYW C;  3KWQ C;  3X1T A;  1EQZ D;  3C1B D;  3O62 A;  4Z66 C;  1M18 D;  1P3K D;  3WA9 D;  3LZ0 B;  5JRG A;  1P3K C;  5B1L B;  3MNN A;  5GSU D;  4EO5 B;  5CP6 C;  4X23 B;  3AZK D;  5B40 A;  5B0Y B;  4KUD B;  5BNX A;  3MVD B;  3UT9 D;  1P3M B;  1M1A A;  5GXQ D;  3VH5 W;  5GXQ C;  4G92 C;  5FUG B;  4H9N A;  5B24 A;  3AYW A;  3KWQ A;  3WKJ D;  3KXB B;  3MGP C;  5DNM D;  4Z66 A;  3WKJ C;  4HGA C;  5DNM C;  1P3F D;  3V9R A;  1M18 A;  5E5A D;  1P3K A;  1B6W A;  3REJ B;  4J8X D;  1U35 D;  5JA4 B;  5CP6 A;  4J8V D;  1U35 C;  1P34 D;  3UTA B;  3X1V B;  4YS3 C;  3AZH D;  3AZG B;  1P34 C;  4Z5T B;  1B67 A;  5B2I B;  5DNN C;  5GXQ A;  3AZH C;  3X1U D;  3WAA D;  1Q9C A;  3X1U C;  5AV9 D;  5AVC D;  5AV9 C;  3MGP A;  2RVQ D;  1P3B B;  1TAF A;  2BYK B;  3WKJ A;  5DNM A;  2YFW A;  2HIO C;  3REK B;  1P3F A;  5B1M D;  2F8N D;  5E5A A;  4LD9 B;  4QLC B;  3B0D C;  1P3G B;  5B33 B;  1P3L D;  1U35 A;  3REL D;  4J8U D;  3AV2 C;  3LJA D;  4J8V A;  4YS3 A;  2FJ7 C;  1A7W A;  3C1C D;  3REL C;  1P34 A;  5DNN A;  3AZH A;  4ZUX C;  3C1C C;  3X1U A;  5C3I B;  1P3O B;  3VH6 W;  5AV9 A;  5AVC A;  1TZY C;  4E45 A;  3MGS D;  3MGQ C;  3AZI B;  1EQZ B;  3AFA D;  3C1B B;  1M19 D;  3AFA C;  3WA9 B;  5B1M A;  2ARO B;  3AZM D;  3AV2 A;  5GSU B;  5AV5 B;  3AZM C;  3REL A;  4J8U A;  4H9Q B;  1N1J B;  5B31 D;  4XZQ C;  3LZ1 B;  3LJA A;  3AZK B;  5AV8 C;  4ZUX A;  3C1C A;  3B6G C;  3UT9 B;  4KGC C;  4H9R A;  2NZD B;  2IO5 C;  4AWL B;  3WTP D;  4WV4 B;  1S32 D;  3MGQ A;  4G91 B;  1P3P B;  3TU4 D;  2F8N K;  3KSY A;  3AFA A;  3AZE C;  1M19 A;  2YFV A;  1AOI B;  4ZBJ C;  5B0Z D;  5CHL B;  4J8X B;  4H9P A;  3AZM A;  4WNN A;  3REH D;  5B0Z C;  5AV8 A;  3B6G A;  3KUY D;  4KGC A;  3AZL B;  4EO5 C;  5F99 C;  3UTB C;  5B31 G;  3WAA B;  5AVB C;  3W99 D;  3LEL D;  4YM6 D;  3X1T D;  2BYM A;  3TU4 A;  3LEL C;  3O62 D;  4YM6 C;  3AZE A;  1JFI B;  2F8N B;  2PYO D;  3AV1 C;  1BH9 B;  3W98 C;  3MNN D;  1P3L B;  5B0Z A;  4WU9 B;  4CAY B;  5F99 A;  3UTB A;  3AN2 B;  3X1S B;  5AVB A;  5B24 D;  4M6B A;  3MGS B;  5AY8 C;  5CPK C;  3AZF B;  3KWQ D;  1ID3 C;  3LEL A;  4YM6 A;  4Z2M H;  4Z66 D;  4UUZ B;  1KX4 B;  5KDM B;  2LY8 A;  2PYO A;  1WWS A;  3AV1 A;  1KX3 B;  3W98 A;  1ZLA B;  4LD9 C;  5CPJ D;  4QLC C;  5CP6 D;  1P3G C;  5GT0 D;  5CPJ C;  5B31 B;  1P3A C;  5GT0 C;  3R45 B;  1KX5 B;  3NQU B;  3W97 C;  3WTP B;  1S32 B;  5BO0 B;  4CSR A;  5AY8 A;  5CPK A;  4H9O A;  3AZJ B;  3W96 C;  1P3O C;  3MGP D;  1ID3 A;  5AV6 D;  5AV6 C;  3AZN B;  4WU8 D;  4WU8 C;  1BH8 B;  4Z2M G;  5CPJ A;  3REH B;  4YS3 D;  1P3A A;  5GT0 A;  3KUY B;  3NQJ A;  2HUE C;  4KHA A;  5DNN D;  3W97 A;  2NZD C;  3W96 A;  3W99 B;  2CV5 C;  4XUJ B;  5AV6 A;  3X1T B;  5CPI C;  2HIO D;  3O62 B;  1HQ3 C;  4WU8 A;  5JRG B;  3MNN B;  3AV2 D;  2FJ7 D;  3B0C W;  5B40 B;  5B2J D;  4ZUX D;  5BNX B;  4NE6 A;  4J8W C;  1M1A B;  5BNV A;  5B2J C;  1P3I D;  5GT3 C;  1P3I C;  3MGQ D;  1TZY D;  1F66 C;  4H9N B;  5B24 B;  4JJN D;  2CV5 A;  3AYW B;  3KWQ B;  4JJN C;  5CPI A;  4Z66 B;  3B6F D;  1HQ3 A;  2HIO A;  1M18 B;  3V9R B;  1P3K B;  3B6F C;  4R8P C;  5CP6 B;  2FJ7 A;  4XZQ D;  5AV8 D;  3B6G D;  4KGC D;  4J8W A;  5B2J A;  5G49 A;  5GT3 A;  5GXQ B;  5B32 D;  3MGR C;  4G92 B;  3AN2 C;  1P3I A;  1F66 A;  3A6N D;  5B32 C;  2NQB C;  1TZY A;  3A6N C;  4JJN A;  3MGP B;  5BT1 C;  1TAF B;  3WKJ B;  4HGA B;  5DNM B;  3REI C;  3AZE D;  3B6F A;  2YFW B;  4R8P A;  1P3F B;  5E5A B;  3LZ0 D;  3LZ0 C;  1U35 B;  4XZQ A;  4J8V B;  4YS3 B;  5B1L C;  4X23 D;  1P34 B;  4KUD D;  5F99 D;  5B0Y D;  3UTB D;  5DNN B;  1BFM A;  3AZH B;  3MVD D;  4X23 C;  3MGR A;  1P3M D;  4KUD C;  5B0Y C;  5B32 A;  3X1U B;  3MVD C;  5AVB D;  1P3M C;  2NQB A;  3A6N A;  1H3O A;  5B32 G;  5AV9 B;  5AVC B;  1F1E A;  4E44 A;  3REI A;  3KXB C;  3AV1 D;  5B1M B;  3W98 D;  3LZ0 A;  3REJ D;  3AV2 B;  5B1L A;  3REL B;  4J8U B;  3LJA B; 
#chains in the Genus database with same CATH topology
 4ZUX B;  4X23 A;  3C1C B;  3UTA D;  5B0Y A;  4H9R B;  4KUD A;  3MVD A;  3UTA C;  1P3M A;  4NE5 A;  5B2I D;  3X1V C;  3AZG C;  4Z5T C;  5B2I C;  3MGQ B;  3REJ C;  5AY8 D;  5CPK D;  3AL0 C;  3VH5 A;  5FUG A;  1ID3 D;  2DQN C;  4DRB A;  3KXB A;  1P3B C;  4XUJ C;  3AFA B;  3EPH A;  1M19 B;  3REK D;  4LD9 D;  2YFV B;  2Y2H A;  4QLC D;  1P3G D;  3REK C;  5B33 D;  3AZM B;  4H9P B;  3REJ A;  4WNN B;  5B33 C;  5AV8 B;  5JA4 A;  1P3A D;  3B6G B;  4KGC B;  3UTA A;  2IO5 B;  3X1V A;  3W97 D;  5B40 C;  3AZG A;  4Z5T A;  5B2I A;  3W96 D;  1P3O D;  5C3I C;  1P3B A;  2BYM B;  3TU4 B;  2BYK A;  3AZE B;  1T3U A;  3AZI C;  1EQZ C;  4ZBJ B;  3C1B C;  3REK A;  2ZY5 A;  4LD9 A;  1M18 C;  4QLC A;  1P3G A;  2ARO D;  5B0Z B;  5B33 A;  3WA9 C;  5AV5 D;  2ARO C;  3LZ1 D;  5GSU C;  5AV5 C;  5F99 B;  3WTP E;  3UTB B;  3AZK C;  3LZ1 C;  2NZD D;  3UT9 C;  5AVB B;  4AWL C;  1P3O A;  2Y2J A;  2CV5 D;  4WJ3 C;  3VH6 A;  5CPI D;  3LEL B;  4YM6 B;  3AZI A;  1P3P D;  1HQ3 D;  1EQZ A;  4G91 C;  3C1B A;  1P3P C;  2PYO B;  2Y2I A;  3AV1 B;  4DRA A;  3W98 B;  3WA9 A;  2Y2Q A;  1AOI D;  1P3F C;  5E5A C;  2ARO A;  1AOI C;  5GSU A;  5AV5 A;  4J8X C;  4J8W D;  4H9Q A;  1N1J A;  3AZK A;  3LZ1 A;  4J8V C;  3AZL D;  5GT3 D;  3UT9 A;  2JCH A;  4NE3 A;  2NZD A;  3AZL C;  1F66 D;  4CSR B;  5AY8 B;  4WZS B;  4H9O B;  5CPK B;  3WAA C;  1ID3 B;  5AVC C;  2CWE A;  1PZR A;  2F8N H;  1P3P A;  2RVQ C;  5BS7 C;  4R8P D;  4H9S C;  1AOI A;  5B1M C;  5CPJ B;  4WU9 D;  3VH5 T;  2Y2P A;  3B0B A;  4J8X A;  1KU5 A;  1P3A B;  5GT0 B;  1P3L C;  4WU9 C;  3NQJ B;  4KHA B;  4J8U C;  3MGR D;  3AN2 D;  3LJA C;  3W97 B;  3AZL A;  2NQB D;  3X1S D;  3WAA A;  3W96 B;  3X1S C;  2ZY3 A;  5BT1 D;  3AZF D;  3MGS C;  3REI D;  5AV6 B;  5BS7 A;  3AZF C;  4H9S A;  1KX4 D;  2Y2L A;  4WU8 B;  1JFI A;  2F8N A;  1KX4 C;  1M19 C;  1KX3 D;  1ZLA D;  1BH9 A;  1KX3 C;  5B1L D;  1P3L A;  1ZLA C;  1R4V A;  4WU9 A;  2F8N G;  4NFT A;  2HUE B;  4CAY A;  1KX5 D;  5BNV B;  3AN2 A;  5B31 C;  1KX5 C;  3X1S A;  3WTP C;  3AZJ D;  1S32 C;  2CV5 B;  3MGS A;  3AZJ C;  3AZF A;  5CPI B;  3KXB D;  3B0C T;  1HQ3 B;  2HIO B;  4UUZ A;  3AZN D;  1ULY A;  3TU4 C;  2JSS A;  1KX4 A;  3B0D B;  3AZN C;  5KDM A;  1KX3 A;  1ZLA A;  2FJ7 B;  4J8W B;  3VH6 T;  5B2J B;  5G49 B;  5B31 A;  3EPL A;  3REH C;  3X1V D;  3A1K A;  1KX5 A;  3R45 A;  5GT3 B;  3KUY C;  4Z5T D;  2G5H C;  3AZG D;  1P3I B;  3NQU A;  1F66 B;  3WTP A;  3F6T A;  1TZY B;  1S32 A;  5BO0 A;  4JJN B;  3AZJ A;  1P3B D;  4XUJ D;  3W99 C;  3B6F B;  4R8P B;  3AZN A;  3X1T C;  3O62 C;  1HTA A;  5JRG D;  2PYO C;  1WWI A;  1BH8 A;  2G5I C;  5JRG C;  4XZQ B;  3MNN C;  3REH A;  2L5A A;  5B40 D;  3KUY A;  3MGR B;  2ZM5 A;  1M1A D;  2XD5 A;  5B32 B;  2NQB B;  1M1A C;  3A6N B;  1H3O B;  5B24 C;  3AYW D;  2F2A C;  2ZY4 A;  3REI B;  3W99 A;  3AZI D;  4XUJ A;  3AYW C;  3KWQ C;  3EPJ A;  3X1T A;  1EQZ D;  3C1B D;  3O62 A;  4Z66 C;  1M18 D;  1P3K D;  3WA9 D;  3LZ0 B;  5JRG A;  1P3K C;  5B1L B;  3MNN A;  5GSU D;  4EO5 B;  5CP6 C;  4X23 B;  3AZK D;  5B40 A;  5B0Y B;  4KUD B;  5BNX A;  3MVD B;  3UT9 D;  1P3M B;  1M1A A;  5GXQ D;  1W2E A;  3VH5 W;  5GXQ C;  4G92 C;  5FUG B;  4H9N A;  5B24 A;  2BG1 A;  3AYW A;  3KWQ A;  3WKJ D;  3KXB B;  3MGP C;  5DNM D;  4Z66 A;  3WKJ C;  3P5J B;  4HGA C;  5DNM C;  1P3F D;  3V9R A;  1M18 A;  5E5A D;  1P3K A;  1B6W A;  3REJ B;  4J8X D;  1U35 D;  5JA4 B;  5CP6 A;  4J8V D;  1U35 C;  1P34 D;  3UTA B;  3X1V B;  4YS3 C;  3AZH D;  3AZG B;  1P34 C;  4Z5T B;  1B67 A;  4UPK A;  5DNN C;  5B2I B;  5GXQ A;  2Y2N A;  3X1U D;  3A1I A;  3EPK A;  3AZH C;  3WAA D;  1Q9C A;  3EG5 B;  3X1U C;  5AV9 D;  5AVC D;  5AV9 C;  3MGP A;  2RVQ D;  1P3B B;  1TAF A;  2BYK B;  3WKJ A;  5DNM A;  2YFW A;  2HIO C;  3REK B;  1P3F A;  5B1M D;  2F8N D;  5E5A A;  4LD9 B;  4QLC B;  3B0D C;  1P3G B;  5B33 B;  1P3L D;  1U35 A;  3REL D;  4J8U D;  3AV2 C;  3LJA D;  4J8V A;  4YS3 A;  2FJ7 C;  1A7W A;  3C1C D;  3REL C;  1P34 A;  5DNN A;  3AZH A;  4ZUX C;  3C1C C;  3X1U A;  5C3I B;  1P3O B;  3VH6 W;  5AV9 A;  5AVC A;  1TZY C;  4E45 A;  3MGS D;  3MGQ C;  3AZI B;  2J8P A;  1EQZ B;  3AFA D;  3C1B B;  1M19 D;  3AFA C;  3WA9 B;  5B1M A;  2ARO B;  3AZM D;  3AV2 A;  5GSU B;  5AV5 B;  3AZM C;  3REL A;  4J8U A;  4H9Q B;  1N1J B;  5B31 D;  4XZQ C;  3LZ1 B;  3LJA A;  3AZK B;  5AV8 C;  4ZUX A;  3C1C A;  3B6G C;  1Z2C B;  3UT9 B;  4H9R A;  4KGC C;  2NZD B;  2IO5 C;  4AWL B;  3H0L C;  4WV4 B;  3WTP D;  1S32 D;  3MGQ A;  4G91 B;  1P3P B;  3TU4 D;  2F8N K;  3KFU G;  3KSY A;  3AFA A;  2JE5 A;  3AZE C;  1M19 A;  2YFV A;  1AOI B;  3IP4 C;  4ZBJ C;  5B0Z D;  5CHL B;  4J8X B;  4H9P A;  3AZM A;  4WNN A;  3REH D;  5B0Z C;  5AV8 A;  3B6G A;  3KUY D;  4KGC A;  3AZL B;  2ZY2 A;  4EO5 C;  5F99 C;  3UTB C;  5B31 G;  3WAA B;  5AVB C;  3W99 D;  3LEL D;  4YM6 D;  3FDD A;  3X1T D;  2BYM A;  3TU4 A;  3LEL C;  3O62 D;  4YM6 C;  3AZE A;  1JFI B;  2F8N B;  2PYO D;  3AV1 C;  1BH9 B;  3W98 C;  3MNN D;  1P3L B;  5B0Z A;  4WU9 B;  4CAY B;  5F99 A;  3UTB A;  3AN2 B;  2Y2M A;  3X1S B;  3H0M C;  5AVB A;  2DF4 C;  5B24 D;  4M6B A;  3MGS B;  2RIQ A;  5AY8 C;  5CPK C;  3AZF B;  2Y2G A;  3KWQ D;  1ID3 C;  3LEL A;  4YM6 A;  4Z2M H;  4Z66 D;  4UUZ B;  1KX4 B;  5KDM B;  2LY8 A;  2W8S A;  2PYO A;  1WWS A;  3AV1 A;  1KX3 B;  3W98 A;  1ZLA B;  4LD9 C;  5CPJ D;  4QLC C;  5CP6 D;  1P3G C;  5GT0 D;  5CPJ C;  5B31 B;  1P3A C;  5GT0 C;  3R45 B;  1KX5 B;  3NQU B;  3W97 C;  3WTP B;  1S32 B;  5BO0 B;  4CSR A;  2UWX A;  5AY8 A;  5CPK A;  4H9O A;  3AZJ B;  3W96 C;  1P3O C;  3MGP D;  1ID3 A;  5AV6 D;  5AV6 C;  3AZN B;  4WU8 D;  4WU8 C;  1BH8 B;  4Z2M G;  5CPJ A;  3REH B;  4YS3 D;  1P3A A;  5GT0 A;  3KUY B;  3NQJ A;  2HUE C;  4KHA A;  5DNN D;  3W97 A;  2NZD C;  3W96 A;  3W99 B;  2CV5 C;  4XUJ B;  5AV6 A;  3X1T B;  5CPI C;  2HIO D;  3O62 B;  1HQ3 C;  4WU8 A;  5JRG B;  3MNN B;  3AV2 D;  2FJ7 D;  3B0C W;  2Y2O A;  5B40 B;  5B2J D;  4ZUX D;  5BNX B;  4NE6 A;  4J8W C;  4DQY B;  5BNV A;  5B2J C;  1P3I D;  1M1A B;  5GT3 C;  1P3I C;  3MGQ D;  1TZY D;  1F66 C;  4H9N B;  5B24 B;  4JJN D;  2CV5 A;  3AYW B;  3KWQ B;  4JJN C;  5CPI A;  4Z66 B;  3B6F D;  1HQ3 A;  2HIO A;  1M18 B;  3V9R B;  1P3K B;  3B6F C;  4R8P C;  3H0R C;  5CP6 B;  2FJ7 A;  4XZQ D;  2Y2K A;  5AV8 D;  3B6G D;  4KGC D;  4J8W A;  5B2J A;  5G49 A;  5GT3 A;  5GXQ B;  5B32 D;  3MGR C;  4G92 B;  3AN2 C;  1P3I A;  1F66 A;  3A6N D;  5B32 C;  2NQB C;  1TZY A;  3A6N C;  4JJN A;  3MGP B;  5BT1 C;  2FFF B;  1TAF B;  3WKJ B;  4HGA B;  5DNM B;  3REI C;  3AZE D;  3B6F A;  2YFW B;  4R8P A;  1P3F B;  5E5A B;  2XD1 A;  3LZ0 D;  3LZ0 C;  1U35 B;  4XZQ A;  4J8V B;  4YS3 B;  5B1L C;  4X23 D;  1P34 B;  4KUD D;  5F99 D;  5B0Y D;  3UTB D;  5DNN B;  1BFM A;  3AZH B;  3MVD D;  4X23 C;  3MGR A;  1P3M D;  4KUD C;  5B0Y C;  5B32 A;  3X1U B;  3MVD C;  5AVB D;  1P3M C;  2NQB A;  3A6N A;  1H3O A;  5B32 G;  5AV9 B;  5AVC B;  1F1E A;  2VQR A;  4E44 A;  3REI A;  3KXB C;  3AV1 D;  5B1M B;  3W98 D;  3LZ0 A;  3REJ D;  3AV2 B;  5B1L A;  3REL B;  4J8U B;  3LJA B; 
#chains in the Genus database with same CATH homology
 4ZUX B;  4X23 A;  3C1C B;  3UTA D;  5B0Y A;  4H9R B;  4KUD A;  3MVD A;  3UTA C;  1P3M A;  4NE5 A;  5B2I D;  3X1V C;  3AZG C;  4Z5T C;  5B2I C;  3MGQ B;  3REJ C;  5AY8 D;  5CPK D;  3AL0 C;  3VH5 A;  5FUG A;  1ID3 D;  2DQN C;  4DRB A;  3KXB A;  1P3B C;  4XUJ C;  3AFA B;  3EPH A;  1M19 B;  3REK D;  4LD9 D;  2YFV B;  2Y2H A;  4QLC D;  1P3G D;  3REK C;  5B33 D;  3AZM B;  4H9P B;  3REJ A;  4WNN B;  5B33 C;  5AV8 B;  5JA4 A;  1P3A D;  3B6G B;  4KGC B;  3UTA A;  2IO5 B;  3X1V A;  3W97 D;  5B40 C;  3AZG A;  4Z5T A;  5B2I A;  3W96 D;  1P3O D;  5C3I C;  1P3B A;  2BYM B;  3TU4 B;  2BYK A;  3AZE B;  1T3U A;  3AZI C;  1EQZ C;  4ZBJ B;  3C1B C;  3REK A;  2ZY5 A;  4LD9 A;  1M18 C;  4QLC A;  1P3G A;  2ARO D;  5B0Z B;  5B33 A;  3WA9 C;  5AV5 D;  2ARO C;  3LZ1 D;  5GSU C;  5AV5 C;  5F99 B;  3WTP E;  3UTB B;  3AZK C;  3LZ1 C;  2NZD D;  3UT9 C;  5AVB B;  4AWL C;  1P3O A;  2Y2J A;  2CV5 D;  4WJ3 C;  3VH6 A;  5CPI D;  3LEL B;  4YM6 B;  3AZI A;  1P3P D;  1HQ3 D;  1EQZ A;  4G91 C;  3C1B A;  1P3P C;  2PYO B;  2Y2I A;  3AV1 B;  4DRA A;  3W98 B;  3WA9 A;  2Y2Q A;  1AOI D;  1P3F C;  5E5A C;  2ARO A;  1AOI C;  5GSU A;  5AV5 A;  4J8X C;  4J8W D;  4H9Q A;  1N1J A;  3AZK A;  3LZ1 A;  4J8V C;  3AZL D;  5GT3 D;  3UT9 A;  2JCH A;  4NE3 A;  2NZD A;  3AZL C;  1F66 D;  4CSR B;  5AY8 B;  4WZS B;  4H9O B;  5CPK B;  3WAA C;  1ID3 B;  5AVC C;  2CWE A;  1PZR A;  2F8N H;  1P3P A;  2RVQ C;  5BS7 C;  4R8P D;  4H9S C;  1AOI A;  5B1M C;  5CPJ B;  4WU9 D;  3VH5 T;  2Y2P A;  3B0B A;  4J8X A;  1KU5 A;  1P3A B;  5GT0 B;  1P3L C;  4WU9 C;  3NQJ B;  4KHA B;  4J8U C;  3MGR D;  3AN2 D;  3LJA C;  3W97 B;  3AZL A;  2NQB D;  3X1S D;  3WAA A;  3W96 B;  3X1S C;  2ZY3 A;  5BT1 D;  3AZF D;  3MGS C;  3REI D;  5AV6 B;  5BS7 A;  3AZF C;  4H9S A;  1KX4 D;  2Y2L A;  4WU8 B;  1JFI A;  2F8N A;  1KX4 C;  1M19 C;  1KX3 D;  1ZLA D;  1BH9 A;  1KX3 C;  5B1L D;  1P3L A;  1ZLA C;  1R4V A;  4WU9 A;  2F8N G;  4NFT A;  2HUE B;  4CAY A;  1KX5 D;  5BNV B;  3AN2 A;  5B31 C;  1KX5 C;  3X1S A;  3WTP C;  3AZJ D;  1S32 C;  2CV5 B;  3MGS A;  3AZJ C;  3AZF A;  5CPI B;  3KXB D;  3B0C T;  1HQ3 B;  2HIO B;  4UUZ A;  3AZN D;  1ULY A;  3TU4 C;  2JSS A;  1KX4 A;  3B0D B;  3AZN C;  5KDM A;  1KX3 A;  1ZLA A;  2FJ7 B;  4J8W B;  3VH6 T;  5B2J B;  5G49 B;  5B31 A;  3EPL A;  3REH C;  3X1V D;  3A1K A;  1KX5 A;  3R45 A;  5GT3 B;  3KUY C;  4Z5T D;  2G5H C;  3AZG D;  1P3I B;  3NQU A;  1F66 B;  3WTP A;  3F6T A;  1TZY B;  1S32 A;  5BO0 A;  4JJN B;  3AZJ A;  1P3B D;  4XUJ D;  3W99 C;  3B6F B;  4R8P B;  3AZN A;  3X1T C;  3O62 C;  1HTA A;  5JRG D;  2PYO C;  1WWI A;  1BH8 A;  2G5I C;  5JRG C;  4XZQ B;  3MNN C;  3REH A;  2L5A A;  5B40 D;  3KUY A;  3MGR B;  2ZM5 A;  1M1A D;  2XD5 A;  5B32 B;  2NQB B;  1M1A C;  3A6N B;  1H3O B;  5B24 C;  3AYW D;  2F2A C;  2ZY4 A;  3REI B;  3W99 A;  3AZI D;  4XUJ A;  3AYW C;  3KWQ C;  3EPJ A;  3X1T A;  1EQZ D;  3C1B D;  3O62 A;  4Z66 C;  1M18 D;  1P3K D;  3WA9 D;  3LZ0 B;  5JRG A;  1P3K C;  5B1L B;  3MNN A;  5GSU D;  4EO5 B;  5CP6 C;  4X23 B;  3AZK D;  5B40 A;  5B0Y B;  4KUD B;  5BNX A;  3MVD B;  3UT9 D;  1P3M B;  1M1A A;  5GXQ D;  1W2E A;  3VH5 W;  5GXQ C;  4G92 C;  5FUG B;  4H9N A;  5B24 A;  2BG1 A;  3AYW A;  3KWQ A;  3WKJ D;  3KXB B;  3MGP C;  5DNM D;  4Z66 A;  3WKJ C;  3P5J B;  4HGA C;  5DNM C;  1P3F D;  3V9R A;  1M18 A;  5E5A D;  1P3K A;  1B6W A;  3REJ B;  4J8X D;  1U35 D;  5JA4 B;  5CP6 A;  4J8V D;  1U35 C;  1P34 D;  3UTA B;  3X1V B;  4YS3 C;  3AZH D;  3AZG B;  1P34 C;  4Z5T B;  1B67 A;  4UPK A;  5DNN C;  5B2I B;  5GXQ A;  2Y2N A;  3X1U D;  3A1I A;  3EPK A;  3AZH C;  3WAA D;  1Q9C A;  3EG5 B;  3X1U C;  5AV9 D;  5AVC D;  5AV9 C;  3MGP A;  2RVQ D;  1P3B B;  1TAF A;  2BYK B;  3WKJ A;  5DNM A;  2YFW A;  2HIO C;  3REK B;  1P3F A;  5B1M D;  2F8N D;  5E5A A;  4LD9 B;  4QLC B;  3B0D C;  1P3G B;  5B33 B;  1P3L D;  1U35 A;  3REL D;  4J8U D;  3AV2 C;  3LJA D;  4J8V A;  4YS3 A;  2FJ7 C;  1A7W A;  3C1C D;  3REL C;  1P34 A;  5DNN A;  3AZH A;  4ZUX C;  3C1C C;  3X1U A;  5C3I B;  1P3O B;  3VH6 W;  5AV9 A;  5AVC A;  1TZY C;  4E45 A;  3MGS D;  3MGQ C;  3AZI B;  2J8P A;  1EQZ B;  3AFA D;  3C1B B;  1M19 D;  3AFA C;  3WA9 B;  5B1M A;  2ARO B;  3AZM D;  3AV2 A;  5GSU B;  5AV5 B;  3AZM C;  3REL A;  4J8U A;  4H9Q B;  1N1J B;  5B31 D;  4XZQ C;  3LZ1 B;  3LJA A;  3AZK B;  5AV8 C;  4ZUX A;  3C1C A;  3B6G C;  1Z2C B;  3UT9 B;  4H9R A;  4KGC C;  2NZD B;  2IO5 C;  4AWL B;  3H0L C;  4WV4 B;  3WTP D;  1S32 D;  3MGQ A;  4G91 B;  1P3P B;  3TU4 D;  2F8N K;  3KFU G;  3KSY A;  3AFA A;  2JE5 A;  3AZE C;  1M19 A;  2YFV A;  1AOI B;  3IP4 C;  4ZBJ C;  5B0Z D;  5CHL B;  4J8X B;  4H9P A;  3AZM A;  4WNN A;  3REH D;  5B0Z C;  5AV8 A;  3B6G A;  3KUY D;  4KGC A;  3AZL B;  2ZY2 A;  4EO5 C;  5F99 C;  3UTB C;  5B31 G;  3WAA B;  5AVB C;  3W99 D;  3LEL D;  4YM6 D;  3FDD A;  3X1T D;  2BYM A;  3TU4 A;  3LEL C;  3O62 D;  4YM6 C;  3AZE A;  1JFI B;  2F8N B;  2PYO D;  3AV1 C;  1BH9 B;  3W98 C;  3MNN D;  1P3L B;  5B0Z A;  4WU9 B;  4CAY B;  5F99 A;  3UTB A;  3AN2 B;  2Y2M A;  3X1S B;  3H0M C;  5AVB A;  2DF4 C;  5B24 D;  4M6B A;  3MGS B;  2RIQ A;  5AY8 C;  5CPK C;  3AZF B;  2Y2G A;  3KWQ D;  1ID3 C;  3LEL A;  4YM6 A;  4Z2M H;  4Z66 D;  4UUZ B;  1KX4 B;  5KDM B;  2LY8 A;  2W8S A;  2PYO A;  1WWS A;  3AV1 A;  1KX3 B;  3W98 A;  1ZLA B;  4LD9 C;  5CPJ D;  4QLC C;  5CP6 D;  1P3G C;  5GT0 D;  5CPJ C;  5B31 B;  1P3A C;  5GT0 C;  3R45 B;  1KX5 B;  3NQU B;  3W97 C;  3WTP B;  1S32 B;  5BO0 B;  4CSR A;  2UWX A;  5AY8 A;  5CPK A;  4H9O A;  3AZJ B;  3W96 C;  1P3O C;  3MGP D;  1ID3 A;  5AV6 D;  5AV6 C;  3AZN B;  4WU8 D;  4WU8 C;  1BH8 B;  4Z2M G;  5CPJ A;  3REH B;  4YS3 D;  1P3A A;  5GT0 A;  3KUY B;  3NQJ A;  2HUE C;  4KHA A;  5DNN D;  3W97 A;  2NZD C;  3W96 A;  3W99 B;  2CV5 C;  4XUJ B;  5AV6 A;  3X1T B;  5CPI C;  2HIO D;  3O62 B;  1HQ3 C;  4WU8 A;  5JRG B;  3MNN B;  3AV2 D;  2FJ7 D;  3B0C W;  2Y2O A;  5B40 B;  5B2J D;  4ZUX D;  5BNX B;  4NE6 A;  4J8W C;  4DQY B;  5BNV A;  5B2J C;  1P3I D;  1M1A B;  5GT3 C;  1P3I C;  3MGQ D;  1TZY D;  1F66 C;  4H9N B;  5B24 B;  4JJN D;  2CV5 A;  3AYW B;  3KWQ B;  4JJN C;  5CPI A;  4Z66 B;  3B6F D;  1HQ3 A;  2HIO A;  1M18 B;  3V9R B;  1P3K B;  3B6F C;  4R8P C;  3H0R C;  5CP6 B;  2FJ7 A;  4XZQ D;  2Y2K A;  5AV8 D;  3B6G D;  4KGC D;  4J8W A;  5B2J A;  5G49 A;  5GT3 A;  5GXQ B;  5B32 D;  3MGR C;  4G92 B;  3AN2 C;  1P3I A;  1F66 A;  3A6N D;  5B32 C;  2NQB C;  1TZY A;  3A6N C;  4JJN A;  3MGP B;  5BT1 C;  2FFF B;  1TAF B;  3WKJ B;  4HGA B;  5DNM B;  3REI C;  3AZE D;  3B6F A;  2YFW B;  4R8P A;  1P3F B;  5E5A B;  2XD1 A;  3LZ0 D;  3LZ0 C;  1U35 B;  4XZQ A;  4J8V B;  4YS3 B;  5B1L C;  4X23 D;  1P34 B;  4KUD D;  5F99 D;  5B0Y D;  3UTB D;  5DNN B;  1BFM A;  3AZH B;  3MVD D;  4X23 C;  3MGR A;  1P3M D;  4KUD C;  5B0Y C;  5B32 A;  3X1U B;  3MVD C;  5AVB D;  1P3M C;  2NQB A;  3A6N A;  1H3O A;  5B32 G;  5AV9 B;  5AVC B;  1F1E A;  2VQR A;  4E44 A;  3REI A;  3KXB C;  3AV1 D;  5B1M B;  3W98 D;  3LZ0 A;  3REJ D;  3AV2 B;  5B1L A;  3REL B;  4J8U B;  3LJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...