4KHBB

Structure of the spt16d pob3n heterodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
186
structure length
176
Chain Sequence
MAAIESFDHIYLDLSKEPGKCRFAENGLGWKPVGGGETFTLDVSNIGGAQWSRAAGYEVKILQRTSGVIQLDGFQQEDYERLAKIFKNWYSTNLENKEHSLRGWNWGKAEFGKAELTFNVQNRPAFEIPYSEIANTNLAGRNEIAVEFAPGQVKSKKASASRDQLVEIRFYIPGTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SPT16D
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Transcription/replication
total genus 33
structure length 176
sequence length 186
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03531 SSrecog Structure-specific recognition protein (SSRP1)
B PF17292 POB3_N POB3-like N-terminal PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khbB01
2.30.29.220 Mainly Beta Roll PH-domain like PH-domain like 4khbB02
1DBHA 1DYNA 4A5KA 1V89A 1BWNA 2DKQA 1V5MA 4F7HA 1XX0A 2XQNM 2W2WA 2MFQA 1XR0B 3ODOA 3PVUA 4F7UP 2W2XD 2YS5A 2R0DA 2D2QA 3QWMA 1Q67A 2RSGA 2COFA 2W2XC 4L6EA 2DKPA 2N0YA 4Z2MB 1WJMA 5LONB 2DN6A 4DX8A 1DDVA 1OMWA 5D3YA 3ZDTA 1U5EA 4GMXB 3D8EA 3KSYA 3QBVB 2P0FA 5C6RA 4A6FA 3ULCA 2KCJA 1FHOA 3PP2A 1WGUA 2EC1A 2RUKB 1EAZA 3TCAA 2YF0A 4MT7A 4K81A 3BJIA 4CHMA 2UZSA 2CAYA 1V61A 1ZVRA 1PLSA 3CXBB 1MK7B 2Z0PA 2DHIA 3TO1A 4HDOA 1GC7A 2DHKA 4KHAA 2I1KA 1ZC4B 1UNRA 5J3TA 4K2PA 2YVCA 3LJUX 4WVFB 2I5FA 2IYBA 2M38A 5JHGA 4Z2NA 2Y8GA 3KY9A 4A6KA 2KGXB 3SUZA 2D11A 1KZ7A 1GC6A 1UNPA 1UPRA 2UVMA 3SNHA 4CHJA 4YL8A 1ZC3B 1P6SA 2I5CA 1IRSA 5CLQB 5KQ4A 2ZPYA 2QKLA 5HE0A 3QIJA 4HAUB 3ZVRA 1BAKA 4XWXA 4HDQA 5FI1A 1FGZA 3X23A 2ELAA 2KUPA 1EF1A 2LG1A 1M7EA 2LOZA 2NZ8B 1DROA 5DH9B 5DI9B 2DX5A 1MAIA 5HE3A 1V5PA 1WVHA 1XD4A 2H7DA 2FJLA 1X1GA 2DYNA 3D8FA 3PSCA 2EMTA 2YT0A 3SO6A 5C16A 1FHXA 3V5WA 3A8QA 1W1HA 4WSFA 3RCPA 1J0WA 2VKIA 1DDWA 1W1DA 2RNRB 3KRXA 5KCVA 4GZUA 3U8ZA 1X86A 4HATB 1WG7A 1BTNA 2I1JA 1J19A 4HAXB 3SV1A 4GPTB 1U27A 4GXBA 4EJNA 1X05A 4EKUA 2AEHA 4ZRIA 1DDMA 4HB2B 2N23A 2HE7A 2M14A 4HB4B 1EGXA 2DHJA 3FEHA 1FGYA 1K5GB 2CRFA 4TYZA 3PEGA 1UNQA 1AQCA 3TVVA 2L1CA 2AL6A 2R09A 2L2IA 2X18A 3PG7A 4HAYB 2Y7BA 1ZSQA 1V5UA 3A8PA 4IOYX 2COCA 3KZ1A 2MDXA 4KVGB 5JP4A 3D8DA 3HK0A 3MDBC 2YSZA 1Y19B 3N7CA 5CLLB 1KZGA 5C5BA 1NI2A 1OQNA 3WA0A 4DXAB 5DHFB 5JLJB 2EJ8A 4NY0A 2D9YA 1Z87A 2GJYA 3WYFB 1FAOA 1MK9B 4HB0B 1MIXA 1PMSA 4B6HA 3GYOA 2BCJA 2J0MA 1GG3A 2YS3A 4KAXB 4ZRJA 3AU4A 1N3HA 2EMSA 2LYDA 2D4QA 3PVLA 1UPQA 2GCJA 3MPXA 1U29A 2CY4A 3DXDA 4IAPA 3ULBA 2ROVA 2J0KA 4HAVB 2K2UA 4MY6A 3BINA 1WGQA 2YS1A 4K17A 3OANA 1MKEA 3CIKA 3GYPA 1SHCA 2MWNB 2Y8FA 2DYQA 2JP2A 2VRWB 1MPHA 4P7IA 5FI0A 3ODWA 4HAZB 5DHAB 3FSSA 2PZ1A 4GMVA 4Y94A 3HQCA 5DIFB 2Q13A 1TXDA 1H4RA 5L81A 5D3XA 3F5RA 4IFSA 3T06A 1XCGA 3VOQA 3HW2B 5J3QA 1BTKA 2DA0A 4A6FB 1KI1B 1FB8A 2G35A 3FM8C 1K5DB 3AJ4A 5D3VA 3U7DA 2DTCA 2LKOA 4NSWA 5J3YA 4HHVA 1ISNA 1QQGA 1RJ2A 1U5FA 2HTHB 3P6AA 2P8VA 3AU5A 1FOEA 2VSZA 4EMOA 2COAA 2V76A 2LOXA 4CYEA 5LOPB 4PNKA 3A98B 2ELBA 4MK0A 4DX90 2CY5A 3TW1A 1Y5OA 3O96A 1MIZB 2H7EA 3PZDA 1U5GA 1UEFA 1H10A 2DFKA 3ML4A 1RRPB 3DXEA 1I7AA 2LULA 1XKEA 2ADZA 2D9XA 3IVFA 1X11A 2Z0QA 1NU2A 1TJ6A 1P3RA 1TQZA 1FHWA 4ZRKA 2D9WA 2OTXA 5KQ1A 4WJ7A 1U2BA 1WI1A 2J59M 4GN1A 3SYXA 2P0HA 4PQ0A 3P7ZA 1P5TA 2YRYA 5HE1A 2GS0A 1NTYA 3ODXA 4A6HA 2OQBA 2GCLA 1WJ1A 5HE2A 5EFXA 2QKMA 1LW3A 1SGHA 2RVBB 4DBBA 4C0AA 5D27A 4H8SA 1U5DA 2D10A 4KHOA 3M1IB 1I2HA 1M7RA 2NMBA 5D3WA 1LB1A 3DXCA 2D9VA 1B55A 2P0DA 3PVWA 5GOWB 3F0WA 4TKNA 3KRWA 1EVHA 2DLWA 4HAWB 2CODA 2E2XA 1OY2A 3UZTA 4D0NB 2Z0OA 2D9ZA 1ZM0A 2ROZB 1NTVA 4BBKA 2RGNB 1X1FA 2DX1A 2RLOA 2MKRA 3G9WA 1W1GA 2UZRA 4HB3B 1E5WA 1PFJA 2K00A 3TFMA 3NSUA 2K2JA 2J0JA 1QC6A 5JHHA 2IFSA 4K2OA 3VIAA 4F7GA 1AWEA 2YT1A 5C79A 4YONA 5C5BB 1XODA 4KHBB 1V88A
chains in the Genus database with same CATH superfamily
1DBHA 4L1RA 1DYNA 4A5KA 1V89A 4QJ4B 1BWNA 5IRSA 2DKQA 1V5MA 4F7HA 3NWAA 1XX0A 2XQNM 2W2WA 2MFQA 1XR0B 3ODOA 3PVUA 4F7UP 2W2XD 2YS5A 2R0DA 2D2QA 3QWMA 1Q67A 2RSGA 2COFA 2W2XC 4L6EA 2DKPA 2N0YA 4Z2MB 1WJMA 5LONB 2DN6A 4DX8A 1DDVA 1OMWA 5D3YA 3ZDTA 3HIEA 1U5EA 4GMXB 3D8EA 3KSYA 3QBVB 2P0FA 5C6RA 4A6FA 3ULCA 2KCJA 1FHOA 3PP2A 1WGUA 3NWDA 2EC1A 2RUKB 1EAZA 3NWFA 3TCAA 2YF0A 4MT7A 4K81A 2KR0A 4HSIA 3BJIA 4CHMA 2UZSA 2CAYA 1V61A 1ZVRA 4GOUA 1PLSA 3CXBB 1MK7B 2Z0PA 3NW8A 2DHIA 5M4YB 3TO1A 4HDOA 1GC7A 2DHKA 4KHAA 2I1KA 1ZC4B 1UNRA 5J3TA 4K2PA 2YVCA 3LJUX 4OT1A 4WVFB 2I5FA 4OSNA 2IYBA 2M38A 5JHGA 4Z2NA 2Y8GA 3KY9A 4A6KA 2KGXB 3SUZA 2D11A 1KZ7A 1GC6A 1UNPA 1UPRA 2UVMA 3SNHA 4CHJA 2Z14A 4YL8A 1ZC3B 1P6SA 2I5CA 1IRSA 5CLQB 5KQ4A 2ZPYA 2QKLA 5HE0A 3QIJA 4HAUB 3ZVRA 1BAKA 4XWXA 4HDQA 5FI1A 1FGZA 3X23A 2ELAA 2KUPA 1EF1A 2LG1A 1M7EA 2LOZA 2NZ8B 1DROA 5DH9B 5DI9B 2DX5A 1MAIA 5HE3A 1V5PA 1WVHA 1XD4A 4QJ3B 1MI1A 2H7DA 2FJLA 2Z59A 1X1GA 2DYNA 3D8FA 3PSCA 2EMTA 2YT0A 3SO6A 5C16A 1FHXA 3V5WA 3A8QA 1W1HA 4WSFA 3RCPA 1J0WA 2VKIA 1DDWA 1W1DA 2RNRB 3KRXA 5KCVA 4GZUA 3U8ZA 1X86A 4HATB 1WG7A 1BTNA 2I1JA 1J19A 4HAXB 3SV1A 4GPTB 1U27A 4GXBA 4EJNA 1X05A 4EKUA 2AEHA 4ZRIA 1DDMA 4HB2B 2N23A 2HE7A 2M14A 4HB4B 1EGXA 2DHJA 1ZYIA 3FEHA 1FGYA 1K5GB 2CRFA 4TYZA 3PEGA 1UNQA 1AQCA 3TVVA 2L1CA 2AL6A 2R09A 2L2IA 2X18A 3PG7A 3FVCA 4HAYB 2Y7BA 1ZSQA 1V5UA 3A8PA 4IOYX 2COCA 3KZ1A 2MDXA 2K49A 4KVGB 5JP4A 2KIGA 3D8DA 3HK0A 3MDBC 2YSZA 1Y19B 3B77A 3N7CA 5CLLB 1KZGA 5C5BA 1NI2A 1OQNA 3WA0A 4KHBA 4DXAB 5DHFB 5JLJB 2EJ8A 4NY0A 2D9YA 1Z87A 2GJYA 3WYFB 1FAOA 1MK9B 4HB0B 1MIXA 1PMSA 4B6HA 3GYOA 2BCJA 2J0MA 1GG3A 5LG4B 2YS3A 2Z13A 4KAXB 4ZRJA 3AU4A 1N3HA 2EMSA 2LYDA 2D4QA 3PVLA 1UPQA 2GCJA 3MPXA 1U29A 2CY4A 3DXDA 4IAPA 3ULBA 2ROVA 2J0KA 4HAVB 2K2UA 4MY6A 3BINA 1WGQA 2YS1A 4K17A 3OANA 1MKEA 3CIKA 3GYPA 1SHCA 2MWNB 2Y8FA 2DYQA 2JP2A 2VRWB 1MPHA 4P7IA 5FI0A 3ODWA 2YT2A 4HAZB 5DHAB 3FSSA 2PZ1A 4GMVA 4GNKB 3HQCA 4Y94A 5DIFB 2Q13A 2NBVA 1TXDA 5I2MA 1H4RA 5L81A 5D3XA 4QXAB 3F5RA 4IFSA 3T06A 1XCGA 3VOQA 3HW2B 5J3QA 1BTKA 4CSQA 2DA0A 4A6FB 1KI1B 1FB8A 2G35A 3FM8C 3U12A 1K5DB 3AJ4A 5D3VA 3U7DA 2DTCA 2LKOA 4NSWA 5J3YA 4HHVA 1ISNA 1QQGA 1RJ2A 1U5FA 2HTHB 3P6AA 2P8VA 3AU5A 1FOEA 2GUMA 2VSZA 4EMOA 2COAA 2V76A 2LOXA 4CYEA 5LOPB 4PNKA 3A98B 2ELBA 4DIXA 4MK0A 4DX90 2CY5A 3TW1A 1Y5OA 3O96A 1MIZB 2H7EA 3PZDA 2KUQA 1U5GA 1UEFA 1H10A 2DFKA 3ML4A 2K8EA 1RRPB 3DXEA 1I7AA 1T77A 2LULA 1XKEA 2ADZA 2D9XA 2Z0QA 1X11A 1NU2A 3IVFA 1TJ6A 1P3RA 1TQZA 1FHWA 4ZRKA 2D9WA 2OTXA 5KQ1A 4WJ7A 1U2BA 1WI1A 2J59M 4GN1A 3SYXA 2P0HA 4PQ0A 3P7ZA 1P5TA 2YRYA 5HE1A 2GS0A 1NTYA 3ODXA 2ZKMX 4A6HA 2OQBA 2GCLA 2Z4DA 3OHMB 1WJ1A 5HE2A 5EFXA 2QKMA 1LW3A 1SGHA 4D6WA 2RVBB 2FJUB 3A58A 4DBBA 4C0AA 5D27A 4H8SA 1U5DA 2D10A 4KHOA 3M1IB 5I2SA 3DCXA 1I2HA 1M7RA 2NMBA 5D3WA 1LB1A 3DXCA 2D9VA 1B55A 2P0DA 3PVWA 5GOWB 3F0WA 4TKNA 3KRWA 2R2YA 1EVHA 2DLWA 4HAWB 2CODA 2E2XA 1OY2A 3UZTA 4D0NB 2Z0OA 2D9ZA 1ZM0A 2KIEA 2ROZB 1NTVA 2RRFA 4BBKA 2RGNB 1X1FA 2DX1A 2RLOA 2MKRA 3G9WA 1W1GA 2UZRA 4HB3B 1E5WA 1PFJA 2K00A 3TFMA 3NSUA 2K2JA 2J0JA 1QC6A 4QJ5B 5JHHA 3HSAA 2IFSA 4K2OA 3VIAA 4F7GA 1AWEA 2YT1A 5C79A 4YONA 5C5BB 1XODA 4KHBB 1V88A
chains in the Genus database with same CATH topology
1DBHA 4L1RA 1DYNA 4A5KA 1V89A 4QJ4B 1BWNA 5IRSA 2DKQA 1V5MA 4F7HA 3NWAA 1XX0A 2XQNM 2W2WA 2MFQA 1XR0B 3ODOA 3PVUA 4F7UP 2W2XD 2YS5A 2R0DA 2D2QA 3QWMA 1Q67A 2RSGA 2COFA 2W2XC 4L6EA 2DKPA 2N0YA 4Z2MB 1WJMA 5LONB 2DN6A 4DX8A 1DDVA 1OMWA 5D3YA 3ZDTA 3HIEA 1U5EA 4GMXB 3D8EA 3KSYA 3QBVB 2P0FA 5C6RA 4A6FA 3ULCA 2KCJA 1FHOA 3PP2A 1WGUA 3NWDA 2EC1A 2RUKB 1EAZA 3NWFA 3TCAA 2YF0A 4MT7A 4K81A 2KR0A 4HSIA 3BJIA 4CHMA 2UZSA 2CAYA 1V61A 1ZVRA 4GOUA 1PLSA 3CXBB 1MK7B 2Z0PA 3NW8A 2DHIA 5M4YB 3TO1A 4HDOA 1GC7A 2DHKA 4KHAA 2I1KA 1ZC4B 1UNRA 5J3TA 4K2PA 2YVCA 3LJUX 4WVFB 4OT1A 2I5FA 4OSNA 2IYBA 2M38A 5JHGA 4Z2NA 2Y8GA 3KY9A 4A6KA 2KGXB 3SUZA 2D11A 1KZ7A 1GC6A 1UNPA 1UPRA 2UVMA 3SNHA 4CHJA 2Z14A 4YL8A 1ZC3B 1P6SA 2I5CA 1IRSA 5CLQB 5KQ4A 2ZPYA 2QKLA 5HE0A 3QIJA 4HAUB 3ZVRA 1BAKA 4XWXA 4HDQA 5FI1A 1FGZA 3X23A 2ELAA 2KUPA 1EF1A 2LG1A 1M7EA 2LOZA 2NZ8B 1DROA 5DH9B 5DI9B 2DX5A 1MAIA 5HE3A 1V5PA 1WVHA 1XD4A 4QJ3B 2H7DA 2FJLA 2Z59A 1X1GA 2DYNA 3D8FA 3PSCA 2EMTA 2YT0A 3SO6A 5C16A 1FHXA 3V5WA 3A8QA 1W1HA 4WSFA 3RCPA 1J0WA 2VKIA 1DDWA 1W1DA 2RNRB 3KRXA 5KCVA 4GZUA 3U8ZA 1X86A 4HATB 1WG7A 1BTNA 2I1JA 1J19A 4HAXB 3SV1A 4GPTB 1U27A 4GXBA 4EJNA 1X05A 4EKUA 2AEHA 4ZRIA 1DDMA 4HB2B 2N23A 2HE7A 2M14A 4HB4B 1EGXA 2DHJA 3FEHA 1ZYIA 1FGYA 1K5GB 2CRFA 4TYZA 3PEGA 1UNQA 1AQCA 3TVVA 2L1CA 2AL6A 2R09A 2L2IA 2X18A 3PG7A 4HAYB 3FVCA 2Y7BA 1ZSQA 1V5UA 3A8PA 4IOYX 2COCA 3KZ1A 2MDXA 2K49A 4KVGB 5JP4A 2KIGA 3D8DA 3HK0A 3MDBC 2YSZA 1Y19B 3N7CA 5CLLB 1KZGA 5C5BA 1NI2A 1OQNA 3WA0A 4DXAB 4KHBA 5DHFB 5JLJB 2EJ8A 4NY0A 2D9YA 1Z87A 2GJYA 3WYFB 1FAOA 1MK9B 4HB0B 1MIXA 1PMSA 4B6HA 3GYOA 2BCJA 2J0MA 1GG3A 5LG4B 2YS3A 2Z13A 4KAXB 4ZRJA 3AU4A 1N3HA 2EMSA 2LYDA 2D4QA 3PVLA 1UPQA 2GCJA 3MPXA 1U29A 2CY4A 3DXDA 4IAPA 3ULBA 2ROVA 2J0KA 4HAVB 2K2UA 4MY6A 3BINA 1WGQA 2YS1A 4K17A 3OANA 1MKEA 3CIKA 3GYPA 1SHCA 2MWNB 2Y8FA 2DYQA 2JP2A 2VRWB 1MPHA 4P7IA 5FI0A 3ODWA 2YT2A 4HAZB 5DHAB 3FSSA 2PZ1A 4GMVA 4Y94A 3HQCA 4GNKB 5DIFB 2Q13A 2NBVA 1TXDA 5I2MA 1H4RA 5L81A 5D3XA 4QXAB 3F5RA 4IFSA 3T06A 1XCGA 3VOQA 3HW2B 5J3QA 1BTKA 4CSQA 2DA0A 4A6FB 1KI1B 1FB8A 2G35A 3FM8C 3U12A 1K5DB 3AJ4A 5D3VA 3U7DA 2DTCA 2LKOA 4NSWA 5J3YA 4HHVA 1ISNA 1QQGA 1RJ2A 1U5FA 2HTHB 3P6AA 2P8VA 3AU5A 1FOEA 2GUMA 2VSZA 4EMOA 2COAA 2V76A 2LOXA 4CYEA 5LOPB 4PNKA 3A98B 2ELBA 4DIXA 4MK0A 4DX90 2CY5A 3TW1A 1Y5OA 3O96A 1MIZB 2H7EA 3PZDA 2KUQA 1U5GA 1UEFA 1H10A 2DFKA 3ML4A 2K8EA 1RRPB 3DXEA 1I7AA 2LULA 1XKEA 2ADZA 2D9XA 3IVFA 1X11A 2Z0QA 1NU2A 1TJ6A 1P3RA 1TQZA 1FHWA 4ZRKA 2D9WA 2OTXA 5KQ1A 4WJ7A 1U2BA 1WI1A 2J59M 4GN1A 3SYXA 2P0HA 4PQ0A 3P7ZA 1P5TA 2YRYA 5HE1A 2GS0A 1NTYA 3ODXA 2ZKMX 4A6HA 2OQBA 2GCLA 2Z4DA 3OHMB 1WJ1A 5HE2A 5EFXA 2QKMA 1LW3A 1SGHA 4D6WA 2RVBB 4DBBA 2FJUB 3A58A 4C0AA 5D27A 4H8SA 1U5DA 2D10A 4KHOA 3M1IB 5I2SA 1I2HA 1M7RA 2NMBA 5D3WA 1LB1A 3DXCA 2D9VA 1B55A 2P0DA 3PVWA 5GOWB 3F0WA 4TKNA 3KRWA 2R2YA 1EVHA 2DLWA 4HAWB 2CODA 2E2XA 1OY2A 3UZTA 4D0NB 2Z0OA 2D9ZA 1ZM0A 2ROZB 2KIEA 1NTVA 4BBKA 2RRFA 2RGNB 1X1FA 2DX1A 2RLOA 2MKRA 3G9WA 1W1GA 2UZRA 4HB3B 1E5WA 1PFJA 2K00A 3TFMA 3NSUA 2K2JA 2J0JA 1QC6A 4QJ5B 5JHHA 2IFSA 4K2OA 3VIAA 4F7GA 1AWEA 2YT1A 5C79A 4YONA 5C5BB 1XODA 4KHBB 1V88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBH A;  1DYN A;  4A5K A;  1V89 A;  1BWN A;  2DKQ A;  1V5M A;  4F7H A;  1XX0 A;  2XQN M;  2W2W A;  2MFQ A;  1XR0 B;  3ODO A;  3PVU A;  4F7U P;  2W2X D;  2YS5 A;  2R0D A;  2D2Q A;  3QWM A;  1Q67 A;  2RSG A;  2COF A;  2W2X C;  4L6E A;  2DKP A;  2N0Y A;  4Z2M B;  1WJM A;  5LON B;  2DN6 A;  4DX8 A;  1DDV A;  1OMW A;  5D3Y A;  3ZDT A;  1U5E A;  4GMX B;  3D8E A;  3KSY A;  3QBV B;  2P0F A;  5C6R A;  4A6F A;  3ULC A;  2KCJ A;  1FHO A;  3PP2 A;  1WGU A;  2EC1 A;  2RUK B;  1EAZ A;  3TCA A;  2YF0 A;  4MT7 A;  4K81 A;  3BJI A;  4CHM A;  2UZS A;  2CAY A;  1V61 A;  1ZVR A;  1PLS A;  3CXB B;  1MK7 B;  2Z0P A;  2DHI A;  3TO1 A;  4HDO A;  1GC7 A;  2DHK A;  4KHA A;  2I1K A;  1ZC4 B;  1UNR A;  5J3T A;  4K2P A;  2YVC A;  3LJU X;  4WVF B;  2I5F A;  2IYB A;  2M38 A;  5JHG A;  4Z2N A;  2Y8G A;  3KY9 A;  4A6K A;  2KGX B;  3SUZ A;  2D11 A;  1KZ7 A;  1GC6 A;  1UNP A;  1UPR A;  2UVM A;  3SNH A;  4CHJ A;  4YL8 A;  1ZC3 B;  1P6S A;  2I5C A;  1IRS A;  5CLQ B;  5KQ4 A;  2ZPY A;  2QKL A;  5HE0 A;  3QIJ A;  4HAU B;  3ZVR A;  1BAK A;  4XWX A;  4HDQ A;  5FI1 A;  1FGZ A;  3X23 A;  2ELA A;  2KUP A;  1EF1 A;  2LG1 A;  1M7E A;  2LOZ A;  2NZ8 B;  1DRO A;  5DH9 B;  5DI9 B;  2DX5 A;  1MAI A;  5HE3 A;  1V5P A;  1WVH A;  1XD4 A;  2H7D A;  2FJL A;  1X1G A;  2DYN A;  3D8F A;  3PSC A;  2EMT A;  2YT0 A;  3SO6 A;  5C16 A;  1FHX A;  3V5W A;  3A8Q A;  1W1H A;  4WSF A;  3RCP A;  1J0W A;  2VKI A;  1DDW A;  1W1D A;  2RNR B;  3KRX A;  5KCV A;  4GZU A;  3U8Z A;  1X86 A;  4HAT B;  1WG7 A;  1BTN A;  2I1J A;  1J19 A;  4HAX B;  3SV1 A;  4GPT B;  1U27 A;  4GXB A;  4EJN A;  1X05 A;  4EKU A;  2AEH A;  4ZRI A;  1DDM A;  4HB2 B;  2N23 A;  2HE7 A;  2M14 A;  4HB4 B;  1EGX A;  2DHJ A;  3FEH A;  1FGY A;  1K5G B;  2CRF A;  4TYZ A;  3PEG A;  1UNQ A;  1AQC A;  3TVV A;  2L1C A;  2AL6 A;  2R09 A;  2L2I A;  2X18 A;  3PG7 A;  4HAY B;  2Y7B A;  1ZSQ A;  1V5U A;  3A8P A;  4IOY X;  2COC A;  3KZ1 A;  2MDX A;  4KVG B;  5JP4 A;  3D8D A;  3HK0 A;  3MDB C;  2YSZ A;  1Y19 B;  3N7C A;  5CLL B;  1KZG A;  5C5B A;  1NI2 A;  1OQN A;  3WA0 A;  4DXA B;  5DHF B;  5JLJ B;  2EJ8 A;  4NY0 A;  2D9Y A;  1Z87 A;  2GJY A;  3WYF B;  1FAO A;  1MK9 B;  4HB0 B;  1MIX A;  1PMS A;  4B6H A;  3GYO A;  2BCJ A;  2J0M A;  1GG3 A;  2YS3 A;  4KAX B;  4ZRJ A;  3AU4 A;  1N3H A;  2EMS A;  2LYD A;  2D4Q A;  3PVL A;  1UPQ A;  2GCJ A;  3MPX A;  1U29 A;  2CY4 A;  3DXD A;  4IAP A;  3ULB A;  2ROV A;  2J0K A;  4HAV B;  2K2U A;  4MY6 A;  3BIN A;  1WGQ A;  2YS1 A;  4K17 A;  3OAN A;  1MKE A;  3CIK A;  3GYP A;  1SHC A;  2MWN B;  2Y8F A;  2DYQ A;  2JP2 A;  2VRW B;  1MPH A;  4P7I A;  5FI0 A;  3ODW A;  4HAZ B;  5DHA B;  3FSS A;  2PZ1 A;  4GMV A;  4Y94 A;  3HQC A;  5DIF B;  2Q13 A;  1TXD A;  1H4R A;  5L81 A;  5D3X A;  3F5R A;  4IFS A;  3T06 A;  1XCG A;  3VOQ A;  3HW2 B;  5J3Q A;  1BTK A;  2DA0 A;  4A6F B;  1KI1 B;  1FB8 A;  2G35 A;  3FM8 C;  1K5D B;  3AJ4 A;  5D3V A;  3U7D A;  2DTC A;  2LKO A;  4NSW A;  5J3Y A;  4HHV A;  1ISN A;  1QQG A;  1RJ2 A;  1U5F A;  2HTH B;  3P6A A;  2P8V A;  3AU5 A;  1FOE A;  2VSZ A;  4EMO A;  2COA A;  2V76 A;  2LOX A;  4CYE A;  5LOP B;  4PNK A;  3A98 B;  2ELB A;  4MK0 A;  4DX9 0;  2CY5 A;  3TW1 A;  1Y5O A;  3O96 A;  1MIZ B;  2H7E A;  3PZD A;  1U5G A;  1UEF A;  1H10 A;  2DFK A;  3ML4 A;  1RRP B;  3DXE A;  1I7A A;  2LUL A;  1XKE A;  2ADZ A;  2D9X A;  3IVF A;  1X11 A;  2Z0Q A;  1NU2 A;  1TJ6 A;  1P3R A;  1TQZ A;  1FHW A;  4ZRK A;  2D9W A;  2OTX A;  5KQ1 A;  4WJ7 A;  1U2B A;  1WI1 A;  2J59 M;  4GN1 A;  3SYX A;  2P0H A;  4PQ0 A;  3P7Z A;  1P5T A;  2YRY A;  5HE1 A;  2GS0 A;  1NTY A;  3ODX A;  4A6H A;  2OQB A;  2GCL A;  1WJ1 A;  5HE2 A;  5EFX A;  2QKM A;  1LW3 A;  1SGH A;  2RVB B;  4DBB A;  4C0A A;  5D27 A;  4H8S A;  1U5D A;  2D10 A;  4KHO A;  3M1I B;  1I2H A;  1M7R A;  2NMB A;  5D3W A;  1LB1 A;  3DXC A;  2D9V A;  1B55 A;  2P0D A;  3PVW A;  5GOW B;  3F0W A;  4TKN A;  3KRW A;  1EVH A;  2DLW A;  4HAW B;  2COD A;  2E2X A;  1OY2 A;  3UZT A;  4D0N B;  2Z0O A;  2D9Z A;  1ZM0 A;  2ROZ B;  1NTV A;  4BBK A;  2RGN B;  1X1F A;  2DX1 A;  2RLO A;  2MKR A;  3G9W A;  1W1G A;  2UZR A;  4HB3 B;  1E5W A;  1PFJ A;  2K00 A;  3TFM A;  3NSU A;  2K2J A;  2J0J A;  1QC6 A;  5JHH A;  2IFS A;  4K2O A;  3VIA A;  4F7G A;  1AWE A;  2YT1 A;  5C79 A;  4YON A;  5C5B B;  1XOD A;  4KHB B;  1V88 A; 
#chains in the Genus database with same CATH topology
 1DBH A;  4L1R A;  1DYN A;  4A5K A;  1V89 A;  4QJ4 B;  1BWN A;  5IRS A;  2DKQ A;  1V5M A;  4F7H A;  3NWA A;  1XX0 A;  2XQN M;  2W2W A;  2MFQ A;  1XR0 B;  3ODO A;  3PVU A;  4F7U P;  2W2X D;  2YS5 A;  2R0D A;  2D2Q A;  3QWM A;  1Q67 A;  2RSG A;  2COF A;  2W2X C;  4L6E A;  2DKP A;  2N0Y A;  4Z2M B;  1WJM A;  5LON B;  2DN6 A;  4DX8 A;  1DDV A;  1OMW A;  5D3Y A;  3ZDT A;  3HIE A;  1U5E A;  4GMX B;  3D8E A;  3KSY A;  3QBV B;  2P0F A;  5C6R A;  4A6F A;  3ULC A;  2KCJ A;  1FHO A;  3PP2 A;  1WGU A;  3NWD A;  2EC1 A;  2RUK B;  1EAZ A;  3NWF A;  3TCA A;  2YF0 A;  4MT7 A;  4K81 A;  2KR0 A;  4HSI A;  3BJI A;  4CHM A;  2UZS A;  2CAY A;  1V61 A;  1ZVR A;  4GOU A;  1PLS A;  3CXB B;  1MK7 B;  2Z0P A;  3NW8 A;  2DHI A;  5M4Y B;  3TO1 A;  4HDO A;  1GC7 A;  2DHK A;  4KHA A;  2I1K A;  1ZC4 B;  1UNR A;  5J3T A;  4K2P A;  2YVC A;  3LJU X;  4OT1 A;  4WVF B;  2I5F A;  4OSN A;  2IYB A;  2M38 A;  5JHG A;  4Z2N A;  2Y8G A;  3KY9 A;  4A6K A;  2KGX B;  3SUZ A;  2D11 A;  1KZ7 A;  1GC6 A;  1UNP A;  1UPR A;  2UVM A;  3SNH A;  4CHJ A;  2Z14 A;  4YL8 A;  1ZC3 B;  1P6S A;  2I5C A;  1IRS A;  5CLQ B;  5KQ4 A;  2ZPY A;  2QKL A;  5HE0 A;  3QIJ A;  4HAU B;  3ZVR A;  1BAK A;  4XWX A;  4HDQ A;  5FI1 A;  1FGZ A;  3X23 A;  2ELA A;  2KUP A;  1EF1 A;  2LG1 A;  1M7E A;  2LOZ A;  2NZ8 B;  1DRO A;  5DH9 B;  5DI9 B;  2DX5 A;  1MAI A;  5HE3 A;  1V5P A;  1WVH A;  1XD4 A;  4QJ3 B;  1MI1 A;  2H7D A;  2FJL A;  2Z59 A;  1X1G A;  2DYN A;  3D8F A;  3PSC A;  2EMT A;  2YT0 A;  3SO6 A;  5C16 A;  1FHX A;  3V5W A;  3A8Q A;  1W1H A;  4WSF A;  3RCP A;  1J0W A;  2VKI A;  1DDW A;  1W1D A;  2RNR B;  3KRX A;  5KCV A;  4GZU A;  3U8Z A;  1X86 A;  4HAT B;  1WG7 A;  1BTN A;  2I1J A;  1J19 A;  4HAX B;  3SV1 A;  4GPT B;  1U27 A;  4GXB A;  4EJN A;  1X05 A;  4EKU A;  2AEH A;  4ZRI A;  1DDM A;  4HB2 B;  2N23 A;  2HE7 A;  2M14 A;  4HB4 B;  1EGX A;  2DHJ A;  1ZYI A;  3FEH A;  1FGY A;  1K5G B;  2CRF A;  4TYZ A;  3PEG A;  1UNQ A;  1AQC A;  3TVV A;  2L1C A;  2AL6 A;  2R09 A;  2L2I A;  2X18 A;  3PG7 A;  3FVC A;  4HAY B;  2Y7B A;  1ZSQ A;  1V5U A;  3A8P A;  4IOY X;  2COC A;  3KZ1 A;  2MDX A;  2K49 A;  4KVG B;  5JP4 A;  2KIG A;  3D8D A;  3HK0 A;  3MDB C;  2YSZ A;  1Y19 B;  3B77 A;  3N7C A;  5CLL B;  1KZG A;  5C5B A;  1NI2 A;  1OQN A;  3WA0 A;  4KHB A;  4DXA B;  5DHF B;  5JLJ B;  2EJ8 A;  4NY0 A;  2D9Y A;  1Z87 A;  2GJY A;  3WYF B;  1FAO A;  1MK9 B;  4HB0 B;  1MIX A;  1PMS A;  4B6H A;  3GYO A;  2BCJ A;  2J0M A;  1GG3 A;  5LG4 B;  2YS3 A;  2Z13 A;  4KAX B;  4ZRJ A;  3AU4 A;  1N3H A;  2EMS A;  2LYD A;  2D4Q A;  3PVL A;  1UPQ A;  2GCJ A;  3MPX A;  1U29 A;  2CY4 A;  3DXD A;  4IAP A;  3ULB A;  2ROV A;  2J0K A;  4HAV B;  2K2U A;  4MY6 A;  3BIN A;  1WGQ A;  2YS1 A;  4K17 A;  3OAN A;  1MKE A;  3CIK A;  3GYP A;  1SHC A;  2MWN B;  2Y8F A;  2DYQ A;  2JP2 A;  2VRW B;  1MPH A;  4P7I A;  5FI0 A;  3ODW A;  2YT2 A;  4HAZ B;  5DHA B;  3FSS A;  2PZ1 A;  4GMV A;  4GNK B;  3HQC A;  4Y94 A;  5DIF B;  2Q13 A;  2NBV A;  1TXD A;  5I2M A;  1H4R A;  5L81 A;  5D3X A;  4QXA B;  3F5R A;  4IFS A;  3T06 A;  1XCG A;  3VOQ A;  3HW2 B;  5J3Q A;  1BTK A;  4CSQ A;  2DA0 A;  4A6F B;  1KI1 B;  1FB8 A;  2G35 A;  3FM8 C;  3U12 A;  1K5D B;  3AJ4 A;  5D3V A;  3U7D A;  2DTC A;  2LKO A;  4NSW A;  5J3Y A;  4HHV A;  1ISN A;  1QQG A;  1RJ2 A;  1U5F A;  2HTH B;  3P6A A;  2P8V A;  3AU5 A;  1FOE A;  2GUM A;  2VSZ A;  4EMO A;  2COA A;  2V76 A;  2LOX A;  4CYE A;  5LOP B;  4PNK A;  3A98 B;  2ELB A;  4DIX A;  4MK0 A;  4DX9 0;  2CY5 A;  3TW1 A;  1Y5O A;  3O96 A;  1MIZ B;  2H7E A;  3PZD A;  2KUQ A;  1U5G A;  1UEF A;  1H10 A;  2DFK A;  3ML4 A;  2K8E A;  1RRP B;  3DXE A;  1I7A A;  1T77 A;  2LUL A;  1XKE A;  2ADZ A;  2D9X A;  2Z0Q A;  1X11 A;  1NU2 A;  3IVF A;  1TJ6 A;  1P3R A;  1TQZ A;  1FHW A;  4ZRK A;  2D9W A;  2OTX A;  5KQ1 A;  4WJ7 A;  1U2B A;  1WI1 A;  2J59 M;  4GN1 A;  3SYX A;  2P0H A;  4PQ0 A;  3P7Z A;  1P5T A;  2YRY A;  5HE1 A;  2GS0 A;  1NTY A;  3ODX A;  2ZKM X;  4A6H A;  2OQB A;  2GCL A;  2Z4D A;  3OHM B;  1WJ1 A;  5HE2 A;  5EFX A;  2QKM A;  1LW3 A;  1SGH A;  4D6W A;  2RVB B;  2FJU B;  3A58 A;  4DBB A;  4C0A A;  5D27 A;  4H8S A;  1U5D A;  2D10 A;  4KHO A;  3M1I B;  5I2S A;  3DCX A;  1I2H A;  1M7R A;  2NMB A;  5D3W A;  1LB1 A;  3DXC A;  2D9V A;  1B55 A;  2P0D A;  3PVW A;  5GOW B;  3F0W A;  4TKN A;  3KRW A;  2R2Y A;  1EVH A;  2DLW A;  4HAW B;  2COD A;  2E2X A;  1OY2 A;  3UZT A;  4D0N B;  2Z0O A;  2D9Z A;  1ZM0 A;  2KIE A;  2ROZ B;  1NTV A;  2RRF A;  4BBK A;  2RGN B;  1X1F A;  2DX1 A;  2RLO A;  2MKR A;  3G9W A;  1W1G A;  2UZR A;  4HB3 B;  1E5W A;  1PFJ A;  2K00 A;  3TFM A;  3NSU A;  2K2J A;  2J0J A;  1QC6 A;  4QJ5 B;  5JHH A;  3HSA A;  2IFS A;  4K2O A;  3VIA A;  4F7G A;  1AWE A;  2YT1 A;  5C79 A;  4YON A;  5C5B B;  1XOD A;  4KHB B;  1V88 A; 
#chains in the Genus database with same CATH homology
 1DBH A;  4L1R A;  1DYN A;  4A5K A;  1V89 A;  4QJ4 B;  1BWN A;  5IRS A;  2DKQ A;  1V5M A;  4F7H A;  3NWA A;  1XX0 A;  2XQN M;  2W2W A;  2MFQ A;  1XR0 B;  3ODO A;  3PVU A;  4F7U P;  2W2X D;  2YS5 A;  2R0D A;  2D2Q A;  3QWM A;  1Q67 A;  2RSG A;  2COF A;  2W2X C;  4L6E A;  2DKP A;  2N0Y A;  4Z2M B;  1WJM A;  5LON B;  2DN6 A;  4DX8 A;  1DDV A;  1OMW A;  5D3Y A;  3ZDT A;  3HIE A;  1U5E A;  4GMX B;  3D8E A;  3KSY A;  3QBV B;  2P0F A;  5C6R A;  4A6F A;  3ULC A;  2KCJ A;  1FHO A;  3PP2 A;  1WGU A;  3NWD A;  2EC1 A;  2RUK B;  1EAZ A;  3NWF A;  3TCA A;  2YF0 A;  4MT7 A;  4K81 A;  2KR0 A;  4HSI A;  3BJI A;  4CHM A;  2UZS A;  2CAY A;  1V61 A;  1ZVR A;  4GOU A;  1PLS A;  3CXB B;  1MK7 B;  2Z0P A;  3NW8 A;  2DHI A;  5M4Y B;  3TO1 A;  4HDO A;  1GC7 A;  2DHK A;  4KHA A;  2I1K A;  1ZC4 B;  1UNR A;  5J3T A;  4K2P A;  2YVC A;  3LJU X;  4WVF B;  4OT1 A;  2I5F A;  4OSN A;  2IYB A;  2M38 A;  5JHG A;  4Z2N A;  2Y8G A;  3KY9 A;  4A6K A;  2KGX B;  3SUZ A;  2D11 A;  1KZ7 A;  1GC6 A;  1UNP A;  1UPR A;  2UVM A;  3SNH A;  4CHJ A;  2Z14 A;  4YL8 A;  1ZC3 B;  1P6S A;  2I5C A;  1IRS A;  5CLQ B;  5KQ4 A;  2ZPY A;  2QKL A;  5HE0 A;  3QIJ A;  4HAU B;  3ZVR A;  1BAK A;  4XWX A;  4HDQ A;  5FI1 A;  1FGZ A;  3X23 A;  2ELA A;  2KUP A;  1EF1 A;  2LG1 A;  1M7E A;  2LOZ A;  2NZ8 B;  1DRO A;  5DH9 B;  5DI9 B;  2DX5 A;  1MAI A;  5HE3 A;  1V5P A;  1WVH A;  1XD4 A;  4QJ3 B;  2H7D A;  2FJL A;  2Z59 A;  1X1G A;  2DYN A;  3D8F A;  3PSC A;  2EMT A;  2YT0 A;  3SO6 A;  5C16 A;  1FHX A;  3V5W A;  3A8Q A;  1W1H A;  4WSF A;  3RCP A;  1J0W A;  2VKI A;  1DDW A;  1W1D A;  2RNR B;  3KRX A;  5KCV A;  4GZU A;  3U8Z A;  1X86 A;  4HAT B;  1WG7 A;  1BTN A;  2I1J A;  1J19 A;  4HAX B;  3SV1 A;  4GPT B;  1U27 A;  4GXB A;  4EJN A;  1X05 A;  4EKU A;  2AEH A;  4ZRI A;  1DDM A;  4HB2 B;  2N23 A;  2HE7 A;  2M14 A;  4HB4 B;  1EGX A;  2DHJ A;  3FEH A;  1ZYI A;  1FGY A;  1K5G B;  2CRF A;  4TYZ A;  3PEG A;  1UNQ A;  1AQC A;  3TVV A;  2L1C A;  2AL6 A;  2R09 A;  2L2I A;  2X18 A;  3PG7 A;  4HAY B;  3FVC A;  2Y7B A;  1ZSQ A;  1V5U A;  3A8P A;  4IOY X;  2COC A;  3KZ1 A;  2MDX A;  2K49 A;  4KVG B;  5JP4 A;  2KIG A;  3D8D A;  3HK0 A;  3MDB C;  2YSZ A;  1Y19 B;  3N7C A;  5CLL B;  1KZG A;  5C5B A;  1NI2 A;  1OQN A;  3WA0 A;  4DXA B;  4KHB A;  5DHF B;  5JLJ B;  2EJ8 A;  4NY0 A;  2D9Y A;  1Z87 A;  2GJY A;  3WYF B;  1FAO A;  1MK9 B;  4HB0 B;  1MIX A;  1PMS A;  4B6H A;  3GYO A;  2BCJ A;  2J0M A;  1GG3 A;  5LG4 B;  2YS3 A;  2Z13 A;  4KAX B;  4ZRJ A;  3AU4 A;  1N3H A;  2EMS A;  2LYD A;  2D4Q A;  3PVL A;  1UPQ A;  2GCJ A;  3MPX A;  1U29 A;  2CY4 A;  3DXD A;  4IAP A;  3ULB A;  2ROV A;  2J0K A;  4HAV B;  2K2U A;  4MY6 A;  3BIN A;  1WGQ A;  2YS1 A;  4K17 A;  3OAN A;  1MKE A;  3CIK A;  3GYP A;  1SHC A;  2MWN B;  2Y8F A;  2DYQ A;  2JP2 A;  2VRW B;  1MPH A;  4P7I A;  5FI0 A;  3ODW A;  2YT2 A;  4HAZ B;  5DHA B;  3FSS A;  2PZ1 A;  4GMV A;  4Y94 A;  3HQC A;  4GNK B;  5DIF B;  2Q13 A;  2NBV A;  1TXD A;  5I2M A;  1H4R A;  5L81 A;  5D3X A;  4QXA B;  3F5R A;  4IFS A;  3T06 A;  1XCG A;  3VOQ A;  3HW2 B;  5J3Q A;  1BTK A;  4CSQ A;  2DA0 A;  4A6F B;  1KI1 B;  1FB8 A;  2G35 A;  3FM8 C;  3U12 A;  1K5D B;  3AJ4 A;  5D3V A;  3U7D A;  2DTC A;  2LKO A;  4NSW A;  5J3Y A;  4HHV A;  1ISN A;  1QQG A;  1RJ2 A;  1U5F A;  2HTH B;  3P6A A;  2P8V A;  3AU5 A;  1FOE A;  2GUM A;  2VSZ A;  4EMO A;  2COA A;  2V76 A;  2LOX A;  4CYE A;  5LOP B;  4PNK A;  3A98 B;  2ELB A;  4DIX A;  4MK0 A;  4DX9 0;  2CY5 A;  3TW1 A;  1Y5O A;  3O96 A;  1MIZ B;  2H7E A;  3PZD A;  2KUQ A;  1U5G A;  1UEF A;  1H10 A;  2DFK A;  3ML4 A;  2K8E A;  1RRP B;  3DXE A;  1I7A A;  2LUL A;  1XKE A;  2ADZ A;  2D9X A;  3IVF A;  1X11 A;  2Z0Q A;  1NU2 A;  1TJ6 A;  1P3R A;  1TQZ A;  1FHW A;  4ZRK A;  2D9W A;  2OTX A;  5KQ1 A;  4WJ7 A;  1U2B A;  1WI1 A;  2J59 M;  4GN1 A;  3SYX A;  2P0H A;  4PQ0 A;  3P7Z A;  1P5T A;  2YRY A;  5HE1 A;  2GS0 A;  1NTY A;  3ODX A;  2ZKM X;  4A6H A;  2OQB A;  2GCL A;  2Z4D A;  3OHM B;  1WJ1 A;  5HE2 A;  5EFX A;  2QKM A;  1LW3 A;  1SGH A;  4D6W A;  2RVB B;  4DBB A;  2FJU B;  3A58 A;  4C0A A;  5D27 A;  4H8S A;  1U5D A;  2D10 A;  4KHO A;  3M1I B;  5I2S A;  1I2H A;  1M7R A;  2NMB A;  5D3W A;  1LB1 A;  3DXC A;  2D9V A;  1B55 A;  2P0D A;  3PVW A;  5GOW B;  3F0W A;  4TKN A;  3KRW A;  2R2Y A;  1EVH A;  2DLW A;  4HAW B;  2COD A;  2E2X A;  1OY2 A;  3UZT A;  4D0N B;  2Z0O A;  2D9Z A;  1ZM0 A;  2ROZ B;  2KIE A;  1NTV A;  4BBK A;  2RRF A;  2RGN B;  1X1F A;  2DX1 A;  2RLO A;  2MKR A;  3G9W A;  1W1G A;  2UZR A;  4HB3 B;  1E5W A;  1PFJ A;  2K00 A;  3TFM A;  3NSU A;  2K2J A;  2J0J A;  1QC6 A;  4QJ5 B;  5JHH A;  2IFS A;  4K2O A;  3VIA A;  4F7G A;  1AWE A;  2YT1 A;  5C79 A;  4YON A;  5C5B B;  1XOD A;  4KHB B;  1V88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...