4KHBB

Structure of the spt16d pob3n heterodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
186
structure length
176
Chain Sequence
MAAIESFDHIYLDLSKEPGKCRFAENGLGWKPVGGGETFTLDVSNIGGAQWSRAAGYEVKILQRTSGVIQLDGFQQEDYERLAKIFKNWYSTNLENKEHSLRGWNWGKAEFGKAELTFNVQNRPAFEIPYSEIANTNLAGRNEIAVEFAPGQVKSKKASASRDQLVEIRFYIPGTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Transcription/replication
molecule keywords Uncharacterized protein SPT16D
total genus 33
structure length 176
sequence length 186
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03531 SSrecog Structure-specific recognition protein (SSRP1)
B PF17292 POB3_N POB3-like N-terminal PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khbB01
2.30.29.220 Mainly Beta Roll PH-domain like PH-domain like 4khbB02
1UPQA 4EKUA 4WVFB 1EAZA 2Y8FA 5HE1A 1GC6A 4TKNA 5D3VA 2P0DA 2D11A 4GMVA 4DX8A 2MWNB 4HB3B 1GG3A 2I1KA 2EC1A 4A5KA 5DHFB 1MIXA 4K2OA 2I1JA 2YVCA 4CYEA 3QBVB 1ZVRA 5C6RA 1M7EA 2N23A 1EVHA 2LOZA 3ODWA 5GOWB 3ML4A 3KRXA 3TO1A 2NZ8B 4HAXB 4Y94A 1XR0B 2D9WA 1W1HA 1MK7B 5C5BB 3PVUA 1NTVA 1V61A 1P6SA 3ODOA 5FI1A 2G35A 1ZC3B 4HAWB 1UPRA 1X05A 4NY0A 1FB8A 2MKRA 5C79A 1OQNA 4IFSA 5DHAB 1QC6A 4D0NB 4ZRJA 2HE7A 1KI1B 3N7CA 4MK0A 2CY5A 1X86A 4DX90 4HDQA 2COAA 4YL8A 4WJ7A 2COCA 2ROVA 5J3YA 1X11A 4HAZB 2QKMA 4KAXB 3WYFB 1U27A 1UNPA 1XKEA 2GCJA 4P7IA 4XWXA 1V5PA 4ZRIA 3V5WA 2YSZA 2YT0A 1N3HA 4HB4B 2D9YA 2I5CA 1WG7A 2D10A 2YRYA 1W1DA 3FEHA 5LONB 1U5DA 4HB0B 2CAYA 4A6FB 1LB1A 4GMXB 1V5UA 2DA0A 1FAOA 2Q13A 5J3TA 3QWMA 1FHXA 5D3WA 3DXCA 3SNHA 3ODXA 1PMSA 2ADZA 2LKOA 4HDOA 2W2WA 2QKLA 3SUZA 5KQ4A 2ZPYA 5KQ1A 1WGQA 4K2PA 1ZC4B 1SHCA 4BBKA 2DHIA 3U8ZA 1H10A 2ELAA 3AU4A 1BTNA 2J0KA 1W1GA 1ZM0A 2E2XA 2D9XA 2YS1A 3U7DA 5D3XA 3G9WA 2EMSA 3TCAA 2Z0OA 4GPTB 3TFMA 1UNRA 5DIFB 2I5FA 4Z2NA 2RSGA 1NU2A 1U5EA 1MPHA 1UNQA 1WGUA 3RCPA 4DXAB 5C5BA 3SYXA 2ELBA 1FHWA 3BJIA 5HE3A 1WVHA 5J3QA 2RVBB 3KRWA 2EMTA 2GS0A 1Q67A 1J19A 2Y8GA 2D9VA 1H4RA 3ULCA 1MIZB 1PLSA 4F7GA 4A6FA 2D4QA 1X1GA 3AJ4A 1DDWA 2YS3A 4KVGB 3D8FA 5D3YA 1V88A 4EJNA 3HW2B 2X18A 3VIAA 2DKPA 4TYZA 4A6HA 1M7RA 2AL6A 2DYQA 2VSZA 1K5DB 2AEHA 1RRPB 1Y19B 2MFQA 2W2XD 3A8PA 2BCJA 2UVMA 5DH9B 2GJYA 1ZSQA 1NTYA 1XX0A 3M1IB 1K5GB 2DX1A 4F7UP 2L1CA 1AQCA 3VOQA 1SGHA 5LOPB 3UZTA 3PZDA 1QQGA 5CLQB 2P8VA 2OQBA 2YF0A 1EGXA 4WSFA 2LULA 3F5RA 5L81A 1XCGA 1P3RA 4CHJA 3KY9A 2KUPA 2P0HA 1DROA 1GC7A 2W2XC 5KCVA 1RJ2A 1EF1A 2OTXA 3LJUX 4K17A 3KZ1A 3PSCA 4CHMA 4B6HA 3A98B 1ISNA 1FHOA 1LW3A 2K00A 3O96A 3FSSA 5HE0A 1P5TA 4KHBB 4HHVA 2RUKB 1DDVA 2JP2A 5JLJB 4PQ0A 2EJ8A 1BTKA 2KGXB 1BWNA 3KSYA 5CLLB 2DX5A 3AU5A 2GCLA 5C16A 3GYOA 2XQNM 4KHOA 4HAVB 2DN6A 2YT1A 1KZGA 4PNKA 4H8SA 2L2IA 1NI2A 2RNRB 5HE2A 5D27A 1WJ1A 2NMBA 2J0JA 4A6KA 3PP2A 3CIKA 2IFSA 1KZ7A 2KCJA 2M38A 1BAKA 2RGNB 4GZUA 2DHKA 2R0DA 2Z0PA 1FGYA 2LYDA 2ROZB 2M14A 3HQCA 1TXDA 4KHAA 4GXBA 1PFJA 3NSUA 3PVWA 2DYNA 2H7DA 3GYPA 2IYBA 4MY6A 3TW1A 1MKEA 3T06A 1U5GA 1DBHA 2D9ZA 1MK9B 4GN1A 2DTCA 1U29A 4HATB 2CY4A 5JHHA 3MPXA 1J0WA 3MDBC 3IVFA 3ZVRA 3D8DA 1OMWA 3HK0A 4NSWA 3PG7A 3D8EA 3P6AA 5JP4A 2UZSA 3OANA 1AWEA 5DI9B 3PEGA 3WA0A 5FI0A 2VKIA 3SO6A 2CRFA 1I2HA 2Z0QA 2V76A 4HAUB 1WJMA 2COFA 2DFKA 3F0WA 2LOXA 2LG1A 3SV1A 2P0FA 3ULBA 1E5WA 2J0MA 4EMOA 1DYNA 1B55A 3TVVA 1WI1A 1OY2A 2RLOA 1IRSA 3ZDTA 2FJLA 2J59M 4ZRKA 3P7ZA 1TQZA 2CODA 2DHJA 2N0YA 1U5FA 1V89A 4C0AA 2VRWB 2YS5A 4L6EA 4Z2MB 4F7HA 1U2BA 4YONA 2D2QA 1Z87A 4DBBA 2H7EA 4K81A 2Y7BA 3DXEA 2MDXA 4IAPA 4IOYX 3PVLA 1X1FA 3A8QA 1XD4A 5JHGA 1UEFA 2PZ1A 1MAIA 1Y5OA 3FM8C 2DLWA 3BINA 4HAYB 2K2UA 1I7AA 2DKQA 1DDMA 3QIJA 1FGZA 1FOEA 5EFXA 4MT7A 2K2JA 2R09A 2HTHB 1V5MA 1TJ6A 1XODA 3X23A 3CXBB 4HB2B 3DXDA 2UZRA
chains in the Genus database with same CATH superfamily
1UPQA 4EKUA 3HSAA 3NW8A 4WVFB 1EAZA 2Y8FA 5HE1A 1GC6A 4TKNA 5D3VA 2P0DA 2D11A 4GMVA 4DX8A 2MWNB 4HB3B 1GG3A 2I1KA 2GUMA 1MI1A 2EC1A 4A5KA 5DHFB 1MIXA 4K2OA 2I1JA 2YVCA 5M4YB 4CYEA 3QBVB 1ZVRA 4OT1A 5C6RA 1M7EA 2N23A 1EVHA 2LOZA 4QXAB 3ODWA 5GOWB 3ML4A 3KRXA 3TO1A 2NZ8B 2KIGA 4HAXB 4Y94A 1XR0B 2D9WA 1W1HA 1MK7B 5C5BB 3PVUA 1NTVA 1V61A 2Z13A 1P6SA 3ODOA 5FI1A 2G35A 1ZC3B 4HAWB 1UPRA 1X05A 4NY0A 1FB8A 2MKRA 5C79A 1OQNA 4IFSA 5DHAB 1QC6A 4D0NB 4ZRJA 2HE7A 1KI1B 2Z14A 3N7CA 4MK0A 2CY5A 1X86A 4DX90 4HDQA 2COAA 4YL8A 4WJ7A 2COCA 3B77A 2Z59A 2KR0A 2ROVA 5J3YA 1X11A 4HAZB 2QKMA 4KAXB 3WYFB 1U27A 1UNPA 1XKEA 2GCJA 4P7IA 4XWXA 1V5PA 4ZRIA 3V5WA 2YSZA 2YT0A 1N3HA 4HB4B 2D9YA 2I5CA 1WG7A 2D10A 2YRYA 1W1DA 3FEHA 5LONB 1U5DA 4KHBA 5LG4B 4HB0B 2CAYA 4A6FB 1LB1A 4GMXB 1V5UA 2DA0A 1FAOA 2Q13A 5I2MA 2KUQA 5J3TA 3QWMA 3OHMB 1FHXA 5D3WA 3DXCA 3SNHA 3ODXA 1PMSA 2ADZA 2LKOA 4HDOA 2W2WA 2QKLA 3SUZA 5KQ4A 2ZPYA 5KQ1A 1WGQA 4K2PA 1ZC4B 1SHCA 4BBKA 1ZYIA 2FJUB 2DHIA 3U8ZA 1H10A 2ELAA 3AU4A 1BTNA 2J0KA 4CSQA 1W1GA 1ZM0A 2E2XA 2D9XA 2YS1A 3U7DA 5D3XA 3G9WA 2EMSA 3TCAA 2Z0OA 4GPTB 3TFMA 1UNRA 5DIFB 2I5FA 4Z2NA 2RSGA 1NU2A 1U5EA 1MPHA 1UNQA 1WGUA 3RCPA 4DXAB 5C5BA 3SYXA 2ELBA 1FHWA 3BJIA 5HE3A 1WVHA 5J3QA 2RVBB 3KRWA 2EMTA 2GS0A 1Q67A 1J19A 1T77A 3DCXA 3A58A 2Y8GA 2D9VA 1H4RA 3ULCA 1MIZB 1PLSA 4F7GA 4A6FA 2D4QA 1X1GA 3AJ4A 1DDWA 2YS3A 3NWDA 4KVGB 3D8FA 5D3YA 1V88A 4EJNA 3HW2B 2X18A 3VIAA 2DKPA 4TYZA 4A6HA 1M7RA 2AL6A 2DYQA 2VSZA 1K5DB 2AEHA 1RRPB 1Y19B 2MFQA 3FVCA 2NBVA 2W2XD 3A8PA 3U12A 2BCJA 2UVMA 5DH9B 2GJYA 1ZSQA 4QJ3B 3HIEA 1NTYA 1XX0A 3M1IB 1K5GB 2DX1A 4F7UP 2L1CA 1AQCA 3VOQA 1SGHA 5LOPB 3UZTA 3PZDA 4GOUA 1QQGA 5CLQB 4QJ4B 2P8VA 2OQBA 2YF0A 1EGXA 4WSFA 3NWAA 2LULA 3F5RA 5L81A 1XCGA 1P3RA 4CHJA 5IRSA 3KY9A 2KUPA 2P0HA 2ZKMX 1DROA 1GC7A 2W2XC 5KCVA 1RJ2A 1EF1A 2OTXA 3LJUX 4K17A 3KZ1A 3PSCA 5I2SA 4CHMA 4B6HA 3A98B 1ISNA 4OSNA 1LW3A 4L1RA 2K00A 1FHOA 3O96A 3FSSA 5HE0A 1P5TA 4KHBB 4HHVA 2RUKB 1DDVA 2JP2A 5JLJB 4PQ0A 2EJ8A 1BTKA 2KGXB 1BWNA 3KSYA 5CLLB 2DX5A 2Z4DA 3AU5A 2GCLA 5C16A 3GYOA 2XQNM 4KHOA 4HAVB 2DN6A 2YT1A 1KZGA 4PNKA 4H8SA 2L2IA 1NI2A 2RNRB 5HE2A 2YT2A 5D27A 1WJ1A 2NMBA 2J0JA 4A6KA 3PP2A 3CIKA 2IFSA 1KZ7A 2KCJA 2M38A 1BAKA 2RGNB 4GZUA 2DHKA 2R0DA 2Z0PA 1FGYA 2LYDA 2ROZB 2M14A 3HQCA 1TXDA 4KHAA 4GXBA 1PFJA 3NSUA 3PVWA 2DYNA 2H7DA 2KIEA 2R2YA 3GYPA 2IYBA 4MY6A 3TW1A 1MKEA 3T06A 1U5GA 4GNKB 1DBHA 2D9ZA 1MK9B 4GN1A 2DTCA 1U29A 4HSIA 4HATB 2CY4A 5JHHA 3MPXA 1J0WA 3MDBC 2K49A 3IVFA 3ZVRA 3D8DA 1OMWA 3HK0A 4NSWA 3PG7A 3D8EA 3P6AA 5JP4A 2UZSA 3OANA 1AWEA 5DI9B 3NWFA 3PEGA 3WA0A 5FI0A 2VKIA 3SO6A 2CRFA 1I2HA 2Z0QA 2V76A 4HAUB 1WJMA 2COFA 4DIXA 2DFKA 3F0WA 2LOXA 2LG1A 3SV1A 2P0FA 3ULBA 1E5WA 2J0MA 4EMOA 1DYNA 4QJ5B 1B55A 3TVVA 1WI1A 1OY2A 2RLOA 1IRSA 3ZDTA 2FJLA 2J59M 2RRFA 4ZRKA 3P7ZA 1TQZA 2CODA 2DHJA 2N0YA 1U5FA 1V89A 4C0AA 2VRWB 2YS5A 4L6EA 4Z2MB 4F7HA 1U2BA 4YONA 2D2QA 1Z87A 4DBBA 2H7EA 4K81A 2Y7BA 3DXEA 2MDXA 4IAPA 4IOYX 3PVLA 1X1FA 3A8QA 1XD4A 5JHGA 1UEFA 2PZ1A 1MAIA 1Y5OA 3FM8C 2DLWA 3BINA 2K2UA 1I7AA 4HAYB 2DKQA 1DDMA 3QIJA 1FGZA 1FOEA 5EFXA 4MT7A 4D6WA 2K2JA 2R09A 2HTHB 2K8EA 1V5MA 1TJ6A 1XODA 3X23A 3CXBB 4HB2B 3DXDA 2UZRA
chains in the Genus database with same CATH topology
1UPQA 4EKUA 4WVFB 3NW8A 1EAZA 2Y8FA 5HE1A 1GC6A 4TKNA 5D3VA 2P0DA 2D11A 4GMVA 4DX8A 2MWNB 4HB3B 1GG3A 2I1KA 2GUMA 2EC1A 4A5KA 5DHFB 1MIXA 4K2OA 2I1JA 2YVCA 5M4YB 4CYEA 3QBVB 1ZVRA 4OT1A 5C6RA 1M7EA 2N23A 1EVHA 2LOZA 4QXAB 3ODWA 5GOWB 3ML4A 3KRXA 3TO1A 2NZ8B 2KIGA 4HAXB 4Y94A 1XR0B 2D9WA 1W1HA 1MK7B 5C5BB 3PVUA 1NTVA 1V61A 2Z13A 1P6SA 3ODOA 5FI1A 2G35A 1ZC3B 4HAWB 1UPRA 1X05A 4NY0A 1FB8A 2MKRA 5C79A 1OQNA 4IFSA 5DHAB 1QC6A 4D0NB 4ZRJA 2HE7A 1KI1B 3N7CA 2Z14A 4MK0A 2CY5A 1X86A 4DX90 4HDQA 2COAA 4YL8A 4WJ7A 2COCA 2Z59A 2KR0A 2ROVA 5J3YA 1X11A 4HAZB 2QKMA 4KAXB 3WYFB 1U27A 1UNPA 1XKEA 2GCJA 4P7IA 4XWXA 1V5PA 4ZRIA 3V5WA 2YSZA 2YT0A 1N3HA 4HB4B 2D9YA 2I5CA 1WG7A 2D10A 2YRYA 1W1DA 3FEHA 5LONB 1U5DA 4KHBA 5LG4B 4HB0B 2CAYA 4A6FB 1LB1A 4GMXB 1V5UA 2DA0A 1FAOA 2Q13A 5I2MA 2KUQA 5J3TA 3QWMA 3OHMB 1FHXA 5D3WA 3DXCA 3SNHA 3ODXA 1PMSA 2ADZA 2LKOA 4HDOA 2W2WA 2QKLA 3SUZA 5KQ4A 2ZPYA 5KQ1A 1WGQA 4K2PA 1ZC4B 1SHCA 4BBKA 1ZYIA 2FJUB 2DHIA 3U8ZA 1H10A 2ELAA 3AU4A 1BTNA 2J0KA 4CSQA 1W1GA 1ZM0A 2E2XA 2D9XA 2YS1A 3U7DA 5D3XA 3G9WA 2EMSA 3TCAA 2Z0OA 4GPTB 3TFMA 1UNRA 5DIFB 2I5FA 4Z2NA 2RSGA 1NU2A 1U5EA 1MPHA 1UNQA 1WGUA 3RCPA 4DXAB 5C5BA 3SYXA 2ELBA 1FHWA 3BJIA 5HE3A 1WVHA 5J3QA 2RVBB 3KRWA 2EMTA 2GS0A 1Q67A 1J19A 3A58A 2Y8GA 2D9VA 1H4RA 3ULCA 1MIZB 1PLSA 4F7GA 4A6FA 2D4QA 1X1GA 3AJ4A 1DDWA 2YS3A 3NWDA 4KVGB 3D8FA 5D3YA 1V88A 4EJNA 3HW2B 2X18A 3VIAA 2DKPA 4TYZA 4A6HA 1M7RA 2AL6A 2DYQA 2VSZA 1K5DB 2AEHA 1RRPB 1Y19B 2MFQA 3FVCA 2NBVA 2W2XD 3A8PA 3U12A 2BCJA 2UVMA 5DH9B 2GJYA 1ZSQA 4QJ3B 3HIEA 1NTYA 1XX0A 3M1IB 1K5GB 2DX1A 4F7UP 2L1CA 1AQCA 3VOQA 1SGHA 5LOPB 3UZTA 3PZDA 4GOUA 1QQGA 5CLQB 4QJ4B 2P8VA 2OQBA 2YF0A 1EGXA 4WSFA 3NWAA 2LULA 3F5RA 5L81A 1XCGA 1P3RA 4CHJA 5IRSA 3KY9A 2KUPA 2P0HA 2ZKMX 1DROA 1GC7A 2W2XC 5KCVA 1RJ2A 1EF1A 2OTXA 3LJUX 4K17A 3KZ1A 3PSCA 5I2SA 4CHMA 4B6HA 3A98B 1ISNA 1FHOA 1LW3A 4L1RA 2K00A 4OSNA 3O96A 3FSSA 5HE0A 1P5TA 4KHBB 4HHVA 2RUKB 1DDVA 2JP2A 5JLJB 4PQ0A 2EJ8A 1BTKA 2KGXB 1BWNA 3KSYA 5CLLB 2DX5A 2Z4DA 3AU5A 2GCLA 5C16A 3GYOA 2XQNM 4KHOA 4HAVB 2DN6A 2YT1A 1KZGA 4PNKA 4H8SA 2L2IA 1NI2A 2RNRB 5HE2A 2YT2A 5D27A 1WJ1A 2NMBA 2J0JA 4A6KA 3PP2A 3CIKA 2IFSA 1KZ7A 2KCJA 2M38A 1BAKA 2RGNB 4GZUA 2DHKA 2R0DA 2Z0PA 1FGYA 2LYDA 2ROZB 2M14A 3HQCA 1TXDA 4KHAA 4GXBA 1PFJA 3NSUA 3PVWA 2DYNA 2H7DA 2KIEA 2R2YA 3GYPA 2IYBA 4MY6A 3TW1A 1MKEA 3T06A 1U5GA 4GNKB 1DBHA 2D9ZA 1MK9B 4GN1A 2DTCA 1U29A 4HSIA 4HATB 2CY4A 5JHHA 3MPXA 1J0WA 3MDBC 2K49A 3IVFA 3ZVRA 3D8DA 1OMWA 3HK0A 4NSWA 3PG7A 3D8EA 3P6AA 5JP4A 2UZSA 3OANA 1AWEA 5DI9B 3NWFA 3PEGA 3WA0A 5FI0A 2VKIA 3SO6A 2CRFA 1I2HA 2Z0QA 2V76A 4HAUB 1WJMA 2COFA 4DIXA 2DFKA 3F0WA 2LOXA 2LG1A 3SV1A 2P0FA 3ULBA 1E5WA 2J0MA 4EMOA 1DYNA 4QJ5B 1B55A 3TVVA 1WI1A 1OY2A 2RLOA 1IRSA 3ZDTA 2FJLA 2J59M 2RRFA 4ZRKA 3P7ZA 1TQZA 2CODA 2DHJA 2N0YA 1U5FA 1V89A 4C0AA 2VRWB 2YS5A 4L6EA 4Z2MB 4F7HA 1U2BA 4YONA 2D2QA 1Z87A 4DBBA 2H7EA 4K81A 2Y7BA 3DXEA 2MDXA 4IAPA 4IOYX 3PVLA 1X1FA 3A8QA 1XD4A 5JHGA 1UEFA 2PZ1A 1MAIA 1Y5OA 3FM8C 2DLWA 3BINA 4HAYB 2K2UA 1I7AA 2DKQA 1DDMA 3QIJA 1FGZA 1FOEA 5EFXA 4MT7A 4D6WA 2K2JA 2R09A 2HTHB 2K8EA 1V5MA 1TJ6A 1XODA 3X23A 3CXBB 4HB2B 3DXDA 2UZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPQ A;  4EKU A;  4WVF B;  1EAZ A;  2Y8F A;  5HE1 A;  1GC6 A;  4TKN A;  5D3V A;  2P0D A;  2D11 A;  4GMV A;  4DX8 A;  2MWN B;  4HB3 B;  1GG3 A;  2I1K A;  2EC1 A;  4A5K A;  5DHF B;  1MIX A;  4K2O A;  2I1J A;  2YVC A;  4CYE A;  3QBV B;  1ZVR A;  5C6R A;  1M7E A;  2N23 A;  1EVH A;  2LOZ A;  3ODW A;  5GOW B;  3ML4 A;  3KRX A;  3TO1 A;  2NZ8 B;  4HAX B;  4Y94 A;  1XR0 B;  2D9W A;  1W1H A;  1MK7 B;  5C5B B;  3PVU A;  1NTV A;  1V61 A;  1P6S A;  3ODO A;  5FI1 A;  2G35 A;  1ZC3 B;  4HAW B;  1UPR A;  1X05 A;  4NY0 A;  1FB8 A;  2MKR A;  5C79 A;  1OQN A;  4IFS A;  5DHA B;  1QC6 A;  4D0N B;  4ZRJ A;  2HE7 A;  1KI1 B;  3N7C A;  4MK0 A;  2CY5 A;  1X86 A;  4DX9 0;  4HDQ A;  2COA A;  4YL8 A;  4WJ7 A;  2COC A;  2ROV A;  5J3Y A;  1X11 A;  4HAZ B;  2QKM A;  4KAX B;  3WYF B;  1U27 A;  1UNP A;  1XKE A;  2GCJ A;  4P7I A;  4XWX A;  1V5P A;  4ZRI A;  3V5W A;  2YSZ A;  2YT0 A;  1N3H A;  4HB4 B;  2D9Y A;  2I5C A;  1WG7 A;  2D10 A;  2YRY A;  1W1D A;  3FEH A;  5LON B;  1U5D A;  4HB0 B;  2CAY A;  4A6F B;  1LB1 A;  4GMX B;  1V5U A;  2DA0 A;  1FAO A;  2Q13 A;  5J3T A;  3QWM A;  1FHX A;  5D3W A;  3DXC A;  3SNH A;  3ODX A;  1PMS A;  2ADZ A;  2LKO A;  4HDO A;  2W2W A;  2QKL A;  3SUZ A;  5KQ4 A;  2ZPY A;  5KQ1 A;  1WGQ A;  4K2P A;  1ZC4 B;  1SHC A;  4BBK A;  2DHI A;  3U8Z A;  1H10 A;  2ELA A;  3AU4 A;  1BTN A;  2J0K A;  1W1G A;  1ZM0 A;  2E2X A;  2D9X A;  2YS1 A;  3U7D A;  5D3X A;  3G9W A;  2EMS A;  3TCA A;  2Z0O A;  4GPT B;  3TFM A;  1UNR A;  5DIF B;  2I5F A;  4Z2N A;  2RSG A;  1NU2 A;  1U5E A;  1MPH A;  1UNQ A;  1WGU A;  3RCP A;  4DXA B;  5C5B A;  3SYX A;  2ELB A;  1FHW A;  3BJI A;  5HE3 A;  1WVH A;  5J3Q A;  2RVB B;  3KRW A;  2EMT A;  2GS0 A;  1Q67 A;  1J19 A;  2Y8G A;  2D9V A;  1H4R A;  3ULC A;  1MIZ B;  1PLS A;  4F7G A;  4A6F A;  2D4Q A;  1X1G A;  3AJ4 A;  1DDW A;  2YS3 A;  4KVG B;  3D8F A;  5D3Y A;  1V88 A;  4EJN A;  3HW2 B;  2X18 A;  3VIA A;  2DKP A;  4TYZ A;  4A6H A;  1M7R A;  2AL6 A;  2DYQ A;  2VSZ A;  1K5D B;  2AEH A;  1RRP B;  1Y19 B;  2MFQ A;  2W2X D;  3A8P A;  2BCJ A;  2UVM A;  5DH9 B;  2GJY A;  1ZSQ A;  1NTY A;  1XX0 A;  3M1I B;  1K5G B;  2DX1 A;  4F7U P;  2L1C A;  1AQC A;  3VOQ A;  1SGH A;  5LOP B;  3UZT A;  3PZD A;  1QQG A;  5CLQ B;  2P8V A;  2OQB A;  2YF0 A;  1EGX A;  4WSF A;  2LUL A;  3F5R A;  5L81 A;  1XCG A;  1P3R A;  4CHJ A;  3KY9 A;  2KUP A;  2P0H A;  1DRO A;  1GC7 A;  2W2X C;  5KCV A;  1RJ2 A;  1EF1 A;  2OTX A;  3LJU X;  4K17 A;  3KZ1 A;  3PSC A;  4CHM A;  4B6H A;  3A98 B;  1ISN A;  1FHO A;  1LW3 A;  2K00 A;  3O96 A;  3FSS A;  5HE0 A;  1P5T A;  4KHB B;  4HHV A;  2RUK B;  1DDV A;  2JP2 A;  5JLJ B;  4PQ0 A;  2EJ8 A;  1BTK A;  2KGX B;  1BWN A;  3KSY A;  5CLL B;  2DX5 A;  3AU5 A;  2GCL A;  5C16 A;  3GYO A;  2XQN M;  4KHO A;  4HAV B;  2DN6 A;  2YT1 A;  1KZG A;  4PNK A;  4H8S A;  2L2I A;  1NI2 A;  2RNR B;  5HE2 A;  5D27 A;  1WJ1 A;  2NMB A;  2J0J A;  4A6K A;  3PP2 A;  3CIK A;  2IFS A;  1KZ7 A;  2KCJ A;  2M38 A;  1BAK A;  2RGN B;  4GZU A;  2DHK A;  2R0D A;  2Z0P A;  1FGY A;  2LYD A;  2ROZ B;  2M14 A;  3HQC A;  1TXD A;  4KHA A;  4GXB A;  1PFJ A;  3NSU A;  3PVW A;  2DYN A;  2H7D A;  3GYP A;  2IYB A;  4MY6 A;  3TW1 A;  1MKE A;  3T06 A;  1U5G A;  1DBH A;  2D9Z A;  1MK9 B;  4GN1 A;  2DTC A;  1U29 A;  4HAT B;  2CY4 A;  5JHH A;  3MPX A;  1J0W A;  3MDB C;  3IVF A;  3ZVR A;  3D8D A;  1OMW A;  3HK0 A;  4NSW A;  3PG7 A;  3D8E A;  3P6A A;  5JP4 A;  2UZS A;  3OAN A;  1AWE A;  5DI9 B;  3PEG A;  3WA0 A;  5FI0 A;  2VKI A;  3SO6 A;  2CRF A;  1I2H A;  2Z0Q A;  2V76 A;  4HAU B;  1WJM A;  2COF A;  2DFK A;  3F0W A;  2LOX A;  2LG1 A;  3SV1 A;  2P0F A;  3ULB A;  1E5W A;  2J0M A;  4EMO A;  1DYN A;  1B55 A;  3TVV A;  1WI1 A;  1OY2 A;  2RLO A;  1IRS A;  3ZDT A;  2FJL A;  2J59 M;  4ZRK A;  3P7Z A;  1TQZ A;  2COD A;  2DHJ A;  2N0Y A;  1U5F A;  1V89 A;  4C0A A;  2VRW B;  2YS5 A;  4L6E A;  4Z2M B;  4F7H A;  1U2B A;  4YON A;  2D2Q A;  1Z87 A;  4DBB A;  2H7E A;  4K81 A;  2Y7B A;  3DXE A;  2MDX A;  4IAP A;  4IOY X;  3PVL A;  1X1F A;  3A8Q A;  1XD4 A;  5JHG A;  1UEF A;  2PZ1 A;  1MAI A;  1Y5O A;  3FM8 C;  2DLW A;  3BIN A;  4HAY B;  2K2U A;  1I7A A;  2DKQ A;  1DDM A;  3QIJ A;  1FGZ A;  1FOE A;  5EFX A;  4MT7 A;  2K2J A;  2R09 A;  2HTH B;  1V5M A;  1TJ6 A;  1XOD A;  3X23 A;  3CXB B;  4HB2 B;  3DXD A;  2UZR A; 
#chains in the Genus database with same CATH topology
 1UPQ A;  4EKU A;  3HSA A;  3NW8 A;  4WVF B;  1EAZ A;  2Y8F A;  5HE1 A;  1GC6 A;  4TKN A;  5D3V A;  2P0D A;  2D11 A;  4GMV A;  4DX8 A;  2MWN B;  4HB3 B;  1GG3 A;  2I1K A;  2GUM A;  1MI1 A;  2EC1 A;  4A5K A;  5DHF B;  1MIX A;  4K2O A;  2I1J A;  2YVC A;  5M4Y B;  4CYE A;  3QBV B;  1ZVR A;  4OT1 A;  5C6R A;  1M7E A;  2N23 A;  1EVH A;  2LOZ A;  4QXA B;  3ODW A;  5GOW B;  3ML4 A;  3KRX A;  3TO1 A;  2NZ8 B;  2KIG A;  4HAX B;  4Y94 A;  1XR0 B;  2D9W A;  1W1H A;  1MK7 B;  5C5B B;  3PVU A;  1NTV A;  1V61 A;  2Z13 A;  1P6S A;  3ODO A;  5FI1 A;  2G35 A;  1ZC3 B;  4HAW B;  1UPR A;  1X05 A;  4NY0 A;  1FB8 A;  2MKR A;  5C79 A;  1OQN A;  4IFS A;  5DHA B;  1QC6 A;  4D0N B;  4ZRJ A;  2HE7 A;  1KI1 B;  2Z14 A;  3N7C A;  4MK0 A;  2CY5 A;  1X86 A;  4DX9 0;  4HDQ A;  2COA A;  4YL8 A;  4WJ7 A;  2COC A;  3B77 A;  2Z59 A;  2KR0 A;  2ROV A;  5J3Y A;  1X11 A;  4HAZ B;  2QKM A;  4KAX B;  3WYF B;  1U27 A;  1UNP A;  1XKE A;  2GCJ A;  4P7I A;  4XWX A;  1V5P A;  4ZRI A;  3V5W A;  2YSZ A;  2YT0 A;  1N3H A;  4HB4 B;  2D9Y A;  2I5C A;  1WG7 A;  2D10 A;  2YRY A;  1W1D A;  3FEH A;  5LON B;  1U5D A;  4KHB A;  5LG4 B;  4HB0 B;  2CAY A;  4A6F B;  1LB1 A;  4GMX B;  1V5U A;  2DA0 A;  1FAO A;  2Q13 A;  5I2M A;  2KUQ A;  5J3T A;  3QWM A;  3OHM B;  1FHX A;  5D3W A;  3DXC A;  3SNH A;  3ODX A;  1PMS A;  2ADZ A;  2LKO A;  4HDO A;  2W2W A;  2QKL A;  3SUZ A;  5KQ4 A;  2ZPY A;  5KQ1 A;  1WGQ A;  4K2P A;  1ZC4 B;  1SHC A;  4BBK A;  1ZYI A;  2FJU B;  2DHI A;  3U8Z A;  1H10 A;  2ELA A;  3AU4 A;  1BTN A;  2J0K A;  4CSQ A;  1W1G A;  1ZM0 A;  2E2X A;  2D9X A;  2YS1 A;  3U7D A;  5D3X A;  3G9W A;  2EMS A;  3TCA A;  2Z0O A;  4GPT B;  3TFM A;  1UNR A;  5DIF B;  2I5F A;  4Z2N A;  2RSG A;  1NU2 A;  1U5E A;  1MPH A;  1UNQ A;  1WGU A;  3RCP A;  4DXA B;  5C5B A;  3SYX A;  2ELB A;  1FHW A;  3BJI A;  5HE3 A;  1WVH A;  5J3Q A;  2RVB B;  3KRW A;  2EMT A;  2GS0 A;  1Q67 A;  1J19 A;  1T77 A;  3DCX A;  3A58 A;  2Y8G A;  2D9V A;  1H4R A;  3ULC A;  1MIZ B;  1PLS A;  4F7G A;  4A6F A;  2D4Q A;  1X1G A;  3AJ4 A;  1DDW A;  2YS3 A;  3NWD A;  4KVG B;  3D8F A;  5D3Y A;  1V88 A;  4EJN A;  3HW2 B;  2X18 A;  3VIA A;  2DKP A;  4TYZ A;  4A6H A;  1M7R A;  2AL6 A;  2DYQ A;  2VSZ A;  1K5D B;  2AEH A;  1RRP B;  1Y19 B;  2MFQ A;  3FVC A;  2NBV A;  2W2X D;  3A8P A;  3U12 A;  2BCJ A;  2UVM A;  5DH9 B;  2GJY A;  1ZSQ A;  4QJ3 B;  3HIE A;  1NTY A;  1XX0 A;  3M1I B;  1K5G B;  2DX1 A;  4F7U P;  2L1C A;  1AQC A;  3VOQ A;  1SGH A;  5LOP B;  3UZT A;  3PZD A;  4GOU A;  1QQG A;  5CLQ B;  4QJ4 B;  2P8V A;  2OQB A;  2YF0 A;  1EGX A;  4WSF A;  3NWA A;  2LUL A;  3F5R A;  5L81 A;  1XCG A;  1P3R A;  4CHJ A;  5IRS A;  3KY9 A;  2KUP A;  2P0H A;  2ZKM X;  1DRO A;  1GC7 A;  2W2X C;  5KCV A;  1RJ2 A;  1EF1 A;  2OTX A;  3LJU X;  4K17 A;  3KZ1 A;  3PSC A;  5I2S A;  4CHM A;  4B6H A;  3A98 B;  1ISN A;  4OSN A;  1LW3 A;  4L1R A;  2K00 A;  1FHO A;  3O96 A;  3FSS A;  5HE0 A;  1P5T A;  4KHB B;  4HHV A;  2RUK B;  1DDV A;  2JP2 A;  5JLJ B;  4PQ0 A;  2EJ8 A;  1BTK A;  2KGX B;  1BWN A;  3KSY A;  5CLL B;  2DX5 A;  2Z4D A;  3AU5 A;  2GCL A;  5C16 A;  3GYO A;  2XQN M;  4KHO A;  4HAV B;  2DN6 A;  2YT1 A;  1KZG A;  4PNK A;  4H8S A;  2L2I A;  1NI2 A;  2RNR B;  5HE2 A;  2YT2 A;  5D27 A;  1WJ1 A;  2NMB A;  2J0J A;  4A6K A;  3PP2 A;  3CIK A;  2IFS A;  1KZ7 A;  2KCJ A;  2M38 A;  1BAK A;  2RGN B;  4GZU A;  2DHK A;  2R0D A;  2Z0P A;  1FGY A;  2LYD A;  2ROZ B;  2M14 A;  3HQC A;  1TXD A;  4KHA A;  4GXB A;  1PFJ A;  3NSU A;  3PVW A;  2DYN A;  2H7D A;  2KIE A;  2R2Y A;  3GYP A;  2IYB A;  4MY6 A;  3TW1 A;  1MKE A;  3T06 A;  1U5G A;  4GNK B;  1DBH A;  2D9Z A;  1MK9 B;  4GN1 A;  2DTC A;  1U29 A;  4HSI A;  4HAT B;  2CY4 A;  5JHH A;  3MPX A;  1J0W A;  3MDB C;  2K49 A;  3IVF A;  3ZVR A;  3D8D A;  1OMW A;  3HK0 A;  4NSW A;  3PG7 A;  3D8E A;  3P6A A;  5JP4 A;  2UZS A;  3OAN A;  1AWE A;  5DI9 B;  3NWF A;  3PEG A;  3WA0 A;  5FI0 A;  2VKI A;  3SO6 A;  2CRF A;  1I2H A;  2Z0Q A;  2V76 A;  4HAU B;  1WJM A;  2COF A;  4DIX A;  2DFK A;  3F0W A;  2LOX A;  2LG1 A;  3SV1 A;  2P0F A;  3ULB A;  1E5W A;  2J0M A;  4EMO A;  1DYN A;  4QJ5 B;  1B55 A;  3TVV A;  1WI1 A;  1OY2 A;  2RLO A;  1IRS A;  3ZDT A;  2FJL A;  2J59 M;  2RRF A;  4ZRK A;  3P7Z A;  1TQZ A;  2COD A;  2DHJ A;  2N0Y A;  1U5F A;  1V89 A;  4C0A A;  2VRW B;  2YS5 A;  4L6E A;  4Z2M B;  4F7H A;  1U2B A;  4YON A;  2D2Q A;  1Z87 A;  4DBB A;  2H7E A;  4K81 A;  2Y7B A;  3DXE A;  2MDX A;  4IAP A;  4IOY X;  3PVL A;  1X1F A;  3A8Q A;  1XD4 A;  5JHG A;  1UEF A;  2PZ1 A;  1MAI A;  1Y5O A;  3FM8 C;  2DLW A;  3BIN A;  2K2U A;  1I7A A;  4HAY B;  2DKQ A;  1DDM A;  3QIJ A;  1FGZ A;  1FOE A;  5EFX A;  4MT7 A;  4D6W A;  2K2J A;  2R09 A;  2HTH B;  2K8E A;  1V5M A;  1TJ6 A;  1XOD A;  3X23 A;  3CXB B;  4HB2 B;  3DXD A;  2UZR A; 
#chains in the Genus database with same CATH homology
 1UPQ A;  4EKU A;  4WVF B;  3NW8 A;  1EAZ A;  2Y8F A;  5HE1 A;  1GC6 A;  4TKN A;  5D3V A;  2P0D A;  2D11 A;  4GMV A;  4DX8 A;  2MWN B;  4HB3 B;  1GG3 A;  2I1K A;  2GUM A;  2EC1 A;  4A5K A;  5DHF B;  1MIX A;  4K2O A;  2I1J A;  2YVC A;  5M4Y B;  4CYE A;  3QBV B;  1ZVR A;  4OT1 A;  5C6R A;  1M7E A;  2N23 A;  1EVH A;  2LOZ A;  4QXA B;  3ODW A;  5GOW B;  3ML4 A;  3KRX A;  3TO1 A;  2NZ8 B;  2KIG A;  4HAX B;  4Y94 A;  1XR0 B;  2D9W A;  1W1H A;  1MK7 B;  5C5B B;  3PVU A;  1NTV A;  1V61 A;  2Z13 A;  1P6S A;  3ODO A;  5FI1 A;  2G35 A;  1ZC3 B;  4HAW B;  1UPR A;  1X05 A;  4NY0 A;  1FB8 A;  2MKR A;  5C79 A;  1OQN A;  4IFS A;  5DHA B;  1QC6 A;  4D0N B;  4ZRJ A;  2HE7 A;  1KI1 B;  3N7C A;  2Z14 A;  4MK0 A;  2CY5 A;  1X86 A;  4DX9 0;  4HDQ A;  2COA A;  4YL8 A;  4WJ7 A;  2COC A;  2Z59 A;  2KR0 A;  2ROV A;  5J3Y A;  1X11 A;  4HAZ B;  2QKM A;  4KAX B;  3WYF B;  1U27 A;  1UNP A;  1XKE A;  2GCJ A;  4P7I A;  4XWX A;  1V5P A;  4ZRI A;  3V5W A;  2YSZ A;  2YT0 A;  1N3H A;  4HB4 B;  2D9Y A;  2I5C A;  1WG7 A;  2D10 A;  2YRY A;  1W1D A;  3FEH A;  5LON B;  1U5D A;  4KHB A;  5LG4 B;  4HB0 B;  2CAY A;  4A6F B;  1LB1 A;  4GMX B;  1V5U A;  2DA0 A;  1FAO A;  2Q13 A;  5I2M A;  2KUQ A;  5J3T A;  3QWM A;  3OHM B;  1FHX A;  5D3W A;  3DXC A;  3SNH A;  3ODX A;  1PMS A;  2ADZ A;  2LKO A;  4HDO A;  2W2W A;  2QKL A;  3SUZ A;  5KQ4 A;  2ZPY A;  5KQ1 A;  1WGQ A;  4K2P A;  1ZC4 B;  1SHC A;  4BBK A;  1ZYI A;  2FJU B;  2DHI A;  3U8Z A;  1H10 A;  2ELA A;  3AU4 A;  1BTN A;  2J0K A;  4CSQ A;  1W1G A;  1ZM0 A;  2E2X A;  2D9X A;  2YS1 A;  3U7D A;  5D3X A;  3G9W A;  2EMS A;  3TCA A;  2Z0O A;  4GPT B;  3TFM A;  1UNR A;  5DIF B;  2I5F A;  4Z2N A;  2RSG A;  1NU2 A;  1U5E A;  1MPH A;  1UNQ A;  1WGU A;  3RCP A;  4DXA B;  5C5B A;  3SYX A;  2ELB A;  1FHW A;  3BJI A;  5HE3 A;  1WVH A;  5J3Q A;  2RVB B;  3KRW A;  2EMT A;  2GS0 A;  1Q67 A;  1J19 A;  3A58 A;  2Y8G A;  2D9V A;  1H4R A;  3ULC A;  1MIZ B;  1PLS A;  4F7G A;  4A6F A;  2D4Q A;  1X1G A;  3AJ4 A;  1DDW A;  2YS3 A;  3NWD A;  4KVG B;  3D8F A;  5D3Y A;  1V88 A;  4EJN A;  3HW2 B;  2X18 A;  3VIA A;  2DKP A;  4TYZ A;  4A6H A;  1M7R A;  2AL6 A;  2DYQ A;  2VSZ A;  1K5D B;  2AEH A;  1RRP B;  1Y19 B;  2MFQ A;  3FVC A;  2NBV A;  2W2X D;  3A8P A;  3U12 A;  2BCJ A;  2UVM A;  5DH9 B;  2GJY A;  1ZSQ A;  4QJ3 B;  3HIE A;  1NTY A;  1XX0 A;  3M1I B;  1K5G B;  2DX1 A;  4F7U P;  2L1C A;  1AQC A;  3VOQ A;  1SGH A;  5LOP B;  3UZT A;  3PZD A;  4GOU A;  1QQG A;  5CLQ B;  4QJ4 B;  2P8V A;  2OQB A;  2YF0 A;  1EGX A;  4WSF A;  3NWA A;  2LUL A;  3F5R A;  5L81 A;  1XCG A;  1P3R A;  4CHJ A;  5IRS A;  3KY9 A;  2KUP A;  2P0H A;  2ZKM X;  1DRO A;  1GC7 A;  2W2X C;  5KCV A;  1RJ2 A;  1EF1 A;  2OTX A;  3LJU X;  4K17 A;  3KZ1 A;  3PSC A;  5I2S A;  4CHM A;  4B6H A;  3A98 B;  1ISN A;  1FHO A;  1LW3 A;  4L1R A;  2K00 A;  4OSN A;  3O96 A;  3FSS A;  5HE0 A;  1P5T A;  4KHB B;  4HHV A;  2RUK B;  1DDV A;  2JP2 A;  5JLJ B;  4PQ0 A;  2EJ8 A;  1BTK A;  2KGX B;  1BWN A;  3KSY A;  5CLL B;  2DX5 A;  2Z4D A;  3AU5 A;  2GCL A;  5C16 A;  3GYO A;  2XQN M;  4KHO A;  4HAV B;  2DN6 A;  2YT1 A;  1KZG A;  4PNK A;  4H8S A;  2L2I A;  1NI2 A;  2RNR B;  5HE2 A;  2YT2 A;  5D27 A;  1WJ1 A;  2NMB A;  2J0J A;  4A6K A;  3PP2 A;  3CIK A;  2IFS A;  1KZ7 A;  2KCJ A;  2M38 A;  1BAK A;  2RGN B;  4GZU A;  2DHK A;  2R0D A;  2Z0P A;  1FGY A;  2LYD A;  2ROZ B;  2M14 A;  3HQC A;  1TXD A;  4KHA A;  4GXB A;  1PFJ A;  3NSU A;  3PVW A;  2DYN A;  2H7D A;  2KIE A;  2R2Y A;  3GYP A;  2IYB A;  4MY6 A;  3TW1 A;  1MKE A;  3T06 A;  1U5G A;  4GNK B;  1DBH A;  2D9Z A;  1MK9 B;  4GN1 A;  2DTC A;  1U29 A;  4HSI A;  4HAT B;  2CY4 A;  5JHH A;  3MPX A;  1J0W A;  3MDB C;  2K49 A;  3IVF A;  3ZVR A;  3D8D A;  1OMW A;  3HK0 A;  4NSW A;  3PG7 A;  3D8E A;  3P6A A;  5JP4 A;  2UZS A;  3OAN A;  1AWE A;  5DI9 B;  3NWF A;  3PEG A;  3WA0 A;  5FI0 A;  2VKI A;  3SO6 A;  2CRF A;  1I2H A;  2Z0Q A;  2V76 A;  4HAU B;  1WJM A;  2COF A;  4DIX A;  2DFK A;  3F0W A;  2LOX A;  2LG1 A;  3SV1 A;  2P0F A;  3ULB A;  1E5W A;  2J0M A;  4EMO A;  1DYN A;  4QJ5 B;  1B55 A;  3TVV A;  1WI1 A;  1OY2 A;  2RLO A;  1IRS A;  3ZDT A;  2FJL A;  2J59 M;  2RRF A;  4ZRK A;  3P7Z A;  1TQZ A;  2COD A;  2DHJ A;  2N0Y A;  1U5F A;  1V89 A;  4C0A A;  2VRW B;  2YS5 A;  4L6E A;  4Z2M B;  4F7H A;  1U2B A;  4YON A;  2D2Q A;  1Z87 A;  4DBB A;  2H7E A;  4K81 A;  2Y7B A;  3DXE A;  2MDX A;  4IAP A;  4IOY X;  3PVL A;  1X1F A;  3A8Q A;  1XD4 A;  5JHG A;  1UEF A;  2PZ1 A;  1MAI A;  1Y5O A;  3FM8 C;  2DLW A;  3BIN A;  4HAY B;  2K2U A;  1I7A A;  2DKQ A;  1DDM A;  3QIJ A;  1FGZ A;  1FOE A;  5EFX A;  4MT7 A;  4D6W A;  2K2J A;  2R09 A;  2HTH B;  2K8E A;  1V5M A;  1TJ6 A;  1XOD A;  3X23 A;  3CXB B;  4HB2 B;  3DXD A;  2UZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...