4KHBB

Structure of the spt16d pob3n heterodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
186
structure length
176
Chain Sequence
MAAIESFDHIYLDLSKEPGKCRFAENGLGWKPVGGGETFTLDVSNIGGAQWSRAAGYEVKILQRTSGVIQLDGFQQEDYERLAKIFKNWYSTNLENKEHSLRGWNWGKAEFGKAELTFNVQNRPAFEIPYSEIANTNLAGRNEIAVEFAPGQVKSKKASASRDQLVEIRFYIPGTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Transcription/replication
molecule keywords Uncharacterized protein SPT16D
total genus 33
structure length 176
sequence length 186
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03531 SSrecog Structure-specific recognition protein (SSRP1)
B PF17292 POB3_N POB3-like N-terminal PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khbB01
2.30.29.220 Mainly Beta Roll PH-domain like PH-domain like 4khbB02
3ODXA 3ODOA 1V88A 2ADZA 1XD4A 2HTHB 2Y8FA 1UNRA 1MKEA 1FHXA 1V89A 5DHAB 2D9XA 1U5GA 2DFKA 1ZC3B 4YONA 1WGUA 1DDVA 2CAYA 1AQCA 4D0NB 1MAIA 1DROA 1ZSQA 1KZGA 2JP2A 1WI1A 4CHJA 1MIXA 3AU5A 1EVHA 1X05A 3F5RA 4NSWA 3FSSA 1U5FA 3ODWA 1MK9B 3NSUA 3T06A 2IFSA 2DYNA 5JLJB 1M7EA 5EFXA 2KCJA 2P0DA 2E2XA 2W2XC 4HATB 4HAUB 2P0FA 2GCLA 2LKOA 2UVMA 4C0AA 3P6AA 3M1IB 1BAKA 1UNPA 2LG1A 2X18A 1EGXA 4KHBB 2D2QA 1TQZA 2DA0A 2COCA 4DX90 3SV1A 2M38A 1FGZA 2H7DA 2J0MA 2RUKB 4GMVA 4F7GA 2D11A 4ZRKA 5C5BA 2RLOA 1DDMA 4HB0B 3HW2B 2D10A 2NZ8B 2GCJA 1GC7A 5FI0A 2M14A 2Z0QA 5LONB 3PSCA 4GZUA 3RCPA 3PP2A 2J59M 4K2OA 1J19A 2CY5A 3BINA 1FAOA 2P0HA 5HE0A 3GYPA 2EC1A 4IAPA 1K5GB 1SHCA 4Y94A 1X1FA 4ZRJA 2VKIA 2XQNM 3TFMA 1W1GA 4XWXA 1OMWA 5JP4A 3ZVRA 4HDQA 5FI1A 1XR0B 3CIKA 3ML4A 5J3QA 2H7EA 3X23A 3WYFB 3BJIA 2D9VA 2OQBA 3U7DA 2YRYA 4CHMA 2DN6A 1LB1A 1PLSA 3VOQA 3A98B 2RNRB 4KAXB 5KQ1A 2Q13A 2YF0A 5JHGA 4PQ0A 1BTKA 1I2HA 1QQGA 2Z0PA 4HB2B 5DIFB 5J3YA 2YVCA 4HAVB 1NTYA 1H10A 1Q67A 4MY6A 1DYNA 4EJNA 3KSYA 4A6HA 5C79A 1MIZB 1H4RA 1UPRA 1NU2A 3TVVA 5C5BB 2UZSA 4HB3B 1I7AA 2ELBA 3ULBA 3KRXA 4B6HA 1V61A 3HK0A 1U2BA 5D3WA 3QBVB 4DXAB 2UZRA 4CYEA 1KI1B 1TXDA 2LULA 4TKNA 2D9ZA 1EAZA 4F7UP 5C6RA 1OY2A 1ZC4B 2CRFA 3LJUX 4K81A 1PFJA 2FJLA 2YT0A 4HAWB 4KHOA 2R09A 1SGHA 2DHJA 2RVBB 1DBHA 1GG3A 2QKLA 2VRWB 2ZPYA 4EMOA 2RSGA 1LW3A 2CODA 2J0KA 2DKQA 3DXDA 1KZ7A 3IVFA 1UPQA 1FOEA 2DX5A 3KZ1A 3QWMA 2DX1A 3FM8C 2NMBA 2I5FA 2EMTA 2KGXB 4IFSA 2CY4A 2Y7BA 3KRWA 3FEHA 2YS3A 4HAYB 1MK7B 2LOXA 2L2IA 2K2JA 4KHAA 2YS1A 3WA0A 5KCVA 2D9YA 4YL8A 1W1DA 1Y5OA 1V5PA 2W2WA 5DH9B 4BBKA 1XKEA 2MKRA 3G9WA 2IYBA 1Y19B 2EMSA 2I1KA 1U5DA 4F7HA 4HHVA 2J0JA 4H8SA 1XODA 5D3XA 2V76A 4IOYX 4EKUA 1RRPB 1P6SA 1BWNA 1Z87A 4TYZA 1WVHA 1FHWA 2K00A 4PNKA 1K5DB 4DBBA 4WSFA 1DDWA 4NY0A 1ISNA 3SUZA 3PEGA 3V5WA 1UNQA 3F0WA 5D3VA 1UEFA 2LYDA 1ZVRA 1U27A 4A6FB 3TCAA 1FGYA 2EJ8A 1FB8A 1TJ6A 3ULCA 3A8PA 2N23A 3SO6A 4HDOA 3UZTA 4WVFB 2MDXA 3D8EA 3SYXA 5KQ4A 2R0DA 5J3TA 1NI2A 3PZDA 5HE2A 2I5CA 1P3RA 2LOZA 3QIJA 5D27A 1V5MA 1X86A 5HE1A 2DYQA 5C16A 2D9WA 5GOWB 3D8FA 3CXBB 1E5WA 1ZM0A 1U5EA 1FHOA 4WJ7A 3O96A 4MK0A 2AEHA 3KY9A 1W1HA 4P7IA 2Z0OA 1RJ2A 3D8DA 5D3YA 1X1GA 3DXEA 4KVGB 4Z2NA 3AJ4A 1WGQA 3PVUA 2ELAA 2DHIA 4DX8A 4A5KA 3MPXA 3TO1A 2COFA 5CLLB 1IRSA 1XCGA 4K2PA 1NTVA 5LOPB 2DTCA 2Y8GA 2AL6A 2N0YA 3SNHA 3ZDTA 2COAA 2MWNB 2L1CA 1WG7A 3OANA 2RGNB 5CLQB 2D4QA 3GYOA 3VIAA 4GPTB 5DHFB 1X11A 3MDBC 1V5UA 2P8VA 2ROZB 3A8QA 4HAZB 2DHKA 2GS0A 3HQCA 2DLWA 4GMXB 1QC6A 1U29A 2GJYA 1P5TA 2YS5A 2W2XD 3DXCA 2VSZA 2K2UA 2I1JA 2G35A 5HE3A 5JHHA 4HB4B 5L81A 1BTNA 4K17A 4Z2MB 2KUPA 2DKPA 2ROVA 4MT7A 1WJMA 1PMSA 3PVLA 1XX0A 2BCJA 4GXBA 1WJ1A 3PVWA 5DI9B 1B55A 1EF1A 1N3HA 3U8ZA 2PZ1A 3TW1A 4L6EA 1GC6A 4A6KA 4A6FA 1OQNA 2YT1A 1AWEA 4GN1A 3AU4A 1MPHA 2MFQA 4ZRIA 2HE7A 2OTXA 2YSZA 3PG7A 4HAXB 1M7RA 3P7ZA 1J0WA 2QKMA 3N7CA
chains in the Genus database with same CATH superfamily
3ODXA 3ODOA 1V88A 2ADZA 1XD4A 2HTHB 2Y8FA 1UNRA 1MKEA 1FHXA 1V89A 5DHAB 2D9XA 1U5GA 2DFKA 1ZC3B 4YONA 1WGUA 1DDVA 2CAYA 1AQCA 4D0NB 1MAIA 1DROA 2KIEA 1ZSQA 1KZGA 2JP2A 1WI1A 4CHJA 1MIXA 3AU5A 1EVHA 1X05A 3F5RA 4NSWA 3FSSA 1U5FA 2RRFA 3ODWA 1MK9B 3NSUA 2Z4DA 3T06A 5LG4B 2IFSA 2DYNA 5JLJB 1M7EA 5EFXA 3NWFA 2KCJA 2P0DA 2E2XA 2W2XC 4HATB 4HAUB 2P0FA 2GCLA 2LKOA 2UVMA 4C0AA 3P6AA 1T77A 3M1IB 1BAKA 1UNPA 2LG1A 2X18A 1EGXA 4KHBB 2D2QA 1TQZA 2DA0A 2GUMA 2COCA 4DX90 3SV1A 2M38A 1FGZA 2H7DA 3NWDA 2J0MA 2RUKB 4GMVA 4F7GA 2D11A 4ZRKA 5C5BA 2RLOA 1DDMA 4HB0B 3HW2B 2D10A 2NZ8B 2GCJA 1GC7A 5FI0A 2M14A 2Z0QA 5LONB 3PSCA 4GZUA 3RCPA 3PP2A 2J59M 2K49A 1J19A 4K2OA 4HSIA 4GNKB 2CY5A 3BINA 1FAOA 2P0HA 5HE0A 3GYPA 2Z13A 2EC1A 4IAPA 1K5GB 1SHCA 4Y94A 1X1FA 4ZRJA 4GOUA 2VKIA 2XQNM 3HSAA 3TFMA 1W1GA 4OT1A 1MI1A 4XWXA 1OMWA 5JP4A 3ZVRA 4HDQA 5FI1A 1XR0B 3CIKA 3ML4A 1ZYIA 5J3QA 2H7EA 3X23A 3B77A 3WYFB 3BJIA 2D9VA 2OQBA 2KUQA 3U7DA 2YRYA 4CHMA 2DN6A 1LB1A 1PLSA 3VOQA 3A98B 2RNRB 4KAXB 5KQ1A 2Q13A 3DCXA 2YF0A 4QJ5B 5JHGA 4PQ0A 1BTKA 1I2HA 1QQGA 2Z0PA 4HB2B 5DIFB 5J3YA 2YVCA 4HAVB 1NTYA 1H10A 1Q67A 4MY6A 1DYNA 4EJNA 3U12A 3KSYA 4A6HA 5C79A 1MIZB 1H4RA 1UPRA 1NU2A 3TVVA 5C5BB 2UZSA 4HB3B 1I7AA 2ELBA 3ULBA 3KRXA 4B6HA 1V61A 3HK0A 1U2BA 5D3WA 3QBVB 4DXAB 2UZRA 4CYEA 1KI1B 1TXDA 2LULA 4TKNA 2D9ZA 1EAZA 4F7UP 5C6RA 1OY2A 1ZC4B 2CRFA 3LJUX 4K81A 1PFJA 2FJLA 4L1RA 2YT0A 4HAWB 4KHOA 2FJUB 2R09A 1SGHA 2DHJA 2RVBB 1DBHA 1GG3A 2QKLA 3NWAA 2VRWB 2ZPYA 4EMOA 2RSGA 1LW3A 2CODA 2J0KA 2DKQA 3DXDA 1KZ7A 3IVFA 1FOEA 1UPQA 2DX5A 3KZ1A 3QWMA 2DX1A 3FM8C 2NMBA 2I5FA 2EMTA 2KGXB 4IFSA 2CY4A 2Y7BA 3KRWA 3FEHA 2YS3A 4HAYB 1MK7B 2LOXA 2L2IA 2K8EA 2ZKMX 2K2JA 4KHAA 4OSNA 3HIEA 2YS1A 3WA0A 4CSQA 5KCVA 2D9YA 2NBVA 4YL8A 1W1DA 1Y5OA 1V5PA 2W2WA 5DH9B 4BBKA 1XKEA 2MKRA 3G9WA 3A58A 2IYBA 1Y19B 2EMSA 2I1KA 1U5DA 4F7HA 4HHVA 4QJ4B 2J0JA 4H8SA 1XODA 5D3XA 2V76A 4IOYX 4EKUA 1RRPB 1P6SA 1BWNA 2Z59A 1Z87A 4TYZA 1WVHA 1FHWA 2K00A 4PNKA 1K5DB 4DBBA 4WSFA 1DDWA 4NY0A 1ISNA 3SUZA 3PEGA 4QXAB 3V5WA 3OHMB 1UNQA 3F0WA 5D3VA 1UEFA 2LYDA 1ZVRA 1U27A 4A6FB 3TCAA 1FGYA 2EJ8A 1FB8A 1TJ6A 2KR0A 3ULCA 3A8PA 2N23A 3SO6A 4HDOA 3UZTA 4WVFB 2MDXA 3D8EA 3SYXA 5KQ4A 2R0DA 5J3TA 1NI2A 3NW8A 3PZDA 5HE2A 2I5CA 1P3RA 2LOZA 3QIJA 5D27A 1V5MA 1X86A 5HE1A 2DYQA 5C16A 2D9WA 5GOWB 3D8FA 4D6WA 3CXBB 1E5WA 1ZM0A 1U5EA 1FHOA 4WJ7A 3O96A 4MK0A 2AEHA 3KY9A 1W1HA 4P7IA 2Z0OA 1RJ2A 3D8DA 4KHBA 5M4YB 5D3YA 1X1GA 3DXEA 4KVGB 4Z2NA 3AJ4A 1WGQA 3PVUA 2ELAA 2DHIA 2KIGA 4DX8A 4A5KA 3MPXA 3TO1A 2COFA 5CLLB 1IRSA 1XCGA 4K2PA 1NTVA 5LOPB 2DTCA 2Y8GA 2AL6A 2N0YA 3SNHA 3ZDTA 2COAA 2MWNB 2L1CA 1WG7A 3OANA 2RGNB 2R2YA 5CLQB 2D4QA 3GYOA 3VIAA 4GPTB 5I2MA 5DHFB 1X11A 3MDBC 1V5UA 2P8VA 2ROZB 3A8QA 4HAZB 2DHKA 2GS0A 3HQCA 2DLWA 4GMXB 1QC6A 1U29A 2GJYA 1P5TA 2YS5A 2W2XD 3DXCA 2VSZA 2K2UA 2I1JA 2G35A 5HE3A 5JHHA 4HB4B 5L81A 1BTNA 4K17A 4Z2MB 2KUPA 2DKPA 2ROVA 4MT7A 4QJ3B 1WJMA 1PMSA 5I2SA 2Z14A 3PVLA 1XX0A 2BCJA 2YT2A 4GXBA 1WJ1A 3PVWA 5DI9B 1B55A 1EF1A 1N3HA 3U8ZA 2PZ1A 3TW1A 4L6EA 1GC6A 4A6KA 4A6FA 1OQNA 2YT1A 1AWEA 4GN1A 3FVCA 3AU4A 1MPHA 2MFQA 4ZRIA 4DIXA 2HE7A 2OTXA 2YSZA 3PG7A 1M7RA 3P7ZA 4HAXB 1J0WA 2QKMA 3N7CA 5IRSA
chains in the Genus database with same CATH topology
3ODXA 3ODOA 1V88A 2ADZA 1XD4A 2HTHB 2Y8FA 1UNRA 1MKEA 1FHXA 1V89A 5DHAB 2D9XA 1U5GA 2DFKA 1ZC3B 4YONA 1WGUA 1DDVA 2CAYA 1AQCA 4D0NB 1MAIA 1DROA 2KIEA 1ZSQA 1KZGA 2JP2A 1WI1A 4CHJA 1MIXA 3AU5A 1EVHA 1X05A 3F5RA 4NSWA 3FSSA 1U5FA 3ODWA 2RRFA 1MK9B 3NSUA 2Z4DA 3T06A 5LG4B 2IFSA 2DYNA 5JLJB 1M7EA 5EFXA 3NWFA 2KCJA 2P0DA 2E2XA 2W2XC 4HATB 4HAUB 2P0FA 2GCLA 2LKOA 2UVMA 4C0AA 3P6AA 3M1IB 1BAKA 1UNPA 2LG1A 2X18A 1EGXA 4KHBB 2D2QA 1TQZA 2DA0A 2GUMA 2COCA 4DX90 3SV1A 2M38A 1FGZA 2H7DA 3NWDA 2J0MA 2RUKB 4GMVA 4F7GA 2D11A 4ZRKA 5C5BA 2RLOA 1DDMA 4HB0B 3HW2B 2D10A 2NZ8B 2GCJA 1GC7A 5FI0A 2M14A 2Z0QA 5LONB 3PSCA 4GZUA 3RCPA 3PP2A 2J59M 4K2OA 1J19A 2K49A 4HSIA 4GNKB 2CY5A 3BINA 1FAOA 2P0HA 5HE0A 3GYPA 2Z13A 2EC1A 4IAPA 1K5GB 1SHCA 4Y94A 1X1FA 4ZRJA 4GOUA 2VKIA 2XQNM 3TFMA 1W1GA 4OT1A 4XWXA 1OMWA 5JP4A 3ZVRA 4HDQA 5FI1A 1XR0B 3CIKA 3ML4A 1ZYIA 5J3QA 2H7EA 3X23A 3WYFB 3BJIA 2D9VA 2OQBA 2KUQA 3U7DA 2YRYA 4CHMA 2DN6A 1LB1A 1PLSA 3VOQA 3A98B 2RNRB 4KAXB 5KQ1A 2Q13A 4QJ5B 2YF0A 5JHGA 4PQ0A 1BTKA 1I2HA 1QQGA 2Z0PA 4HB2B 5DIFB 5J3YA 2YVCA 4HAVB 1NTYA 1H10A 1Q67A 4MY6A 1DYNA 4EJNA 3U12A 3KSYA 4A6HA 5C79A 1MIZB 1H4RA 1UPRA 1NU2A 3TVVA 5C5BB 2UZSA 4HB3B 1I7AA 2ELBA 3ULBA 3KRXA 4B6HA 1V61A 3HK0A 1U2BA 5D3WA 3QBVB 4DXAB 2UZRA 4CYEA 1KI1B 1TXDA 2LULA 4TKNA 2D9ZA 1EAZA 4F7UP 5C6RA 1OY2A 1ZC4B 2CRFA 3LJUX 4K81A 1PFJA 2FJLA 4L1RA 2YT0A 4HAWB 4KHOA 2FJUB 2R09A 1SGHA 2DHJA 2RVBB 1DBHA 1GG3A 2QKLA 3NWAA 2VRWB 2ZPYA 4EMOA 2RSGA 1LW3A 2CODA 2J0KA 2DKQA 3DXDA 1KZ7A 3IVFA 1UPQA 1FOEA 2DX5A 3KZ1A 3QWMA 2DX1A 3FM8C 2NMBA 2I5FA 2EMTA 2KGXB 4IFSA 2CY4A 2Y7BA 3KRWA 3FEHA 2YS3A 4HAYB 1MK7B 2LOXA 2L2IA 2K8EA 2ZKMX 2K2JA 4KHAA 4OSNA 3HIEA 2YS1A 3WA0A 4CSQA 5KCVA 2D9YA 2NBVA 4YL8A 1W1DA 1Y5OA 1V5PA 2W2WA 5DH9B 4BBKA 1XKEA 2MKRA 3G9WA 3A58A 2IYBA 1Y19B 2EMSA 2I1KA 1U5DA 4F7HA 4HHVA 4QJ4B 2J0JA 4H8SA 1XODA 5D3XA 2V76A 4IOYX 4EKUA 1RRPB 1P6SA 1BWNA 2Z59A 1Z87A 4TYZA 1WVHA 1FHWA 2K00A 4PNKA 1K5DB 4DBBA 4WSFA 1DDWA 4NY0A 1ISNA 3SUZA 3PEGA 3V5WA 4QXAB 3OHMB 1UNQA 3F0WA 5D3VA 1UEFA 2LYDA 1ZVRA 1U27A 4A6FB 3TCAA 1FGYA 2EJ8A 1FB8A 1TJ6A 2KR0A 3ULCA 3A8PA 2N23A 3SO6A 4HDOA 3UZTA 4WVFB 2MDXA 3D8EA 3SYXA 5KQ4A 2R0DA 5J3TA 1NI2A 3NW8A 3PZDA 5HE2A 2I5CA 1P3RA 2LOZA 3QIJA 5D27A 1V5MA 1X86A 5HE1A 2DYQA 5C16A 2D9WA 5GOWB 3D8FA 4D6WA 3CXBB 1E5WA 1ZM0A 1U5EA 1FHOA 4WJ7A 3O96A 4MK0A 2AEHA 3KY9A 1W1HA 4P7IA 2Z0OA 1RJ2A 3D8DA 4KHBA 5M4YB 5D3YA 1X1GA 3DXEA 4KVGB 4Z2NA 3AJ4A 1WGQA 3PVUA 2ELAA 2DHIA 4DX8A 2KIGA 4A5KA 3MPXA 3TO1A 2COFA 5CLLB 1IRSA 1XCGA 4K2PA 1NTVA 5LOPB 2DTCA 2Y8GA 2AL6A 2N0YA 3SNHA 3ZDTA 2COAA 2MWNB 2L1CA 1WG7A 3OANA 2RGNB 2R2YA 5CLQB 2D4QA 3GYOA 3VIAA 4GPTB 5I2MA 5DHFB 1X11A 3MDBC 1V5UA 2P8VA 2ROZB 3A8QA 4HAZB 2DHKA 2GS0A 3HQCA 2DLWA 4GMXB 1QC6A 1U29A 2GJYA 1P5TA 2YS5A 2W2XD 3DXCA 2VSZA 2K2UA 2I1JA 2G35A 5HE3A 5JHHA 4HB4B 5L81A 1BTNA 4K17A 4Z2MB 2KUPA 2DKPA 2ROVA 4MT7A 4QJ3B 1WJMA 1PMSA 5I2SA 2Z14A 3PVLA 1XX0A 2BCJA 2YT2A 4GXBA 1WJ1A 3PVWA 5DI9B 1B55A 1EF1A 1N3HA 3U8ZA 2PZ1A 3TW1A 4L6EA 1GC6A 4A6KA 4A6FA 1OQNA 2YT1A 1AWEA 4GN1A 3FVCA 3AU4A 1MPHA 2MFQA 4ZRIA 4DIXA 2HE7A 2OTXA 2YSZA 3PG7A 4HAXB 1M7RA 3P7ZA 1J0WA 2QKMA 3N7CA 5IRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODX A;  3ODO A;  1V88 A;  2ADZ A;  1XD4 A;  2HTH B;  2Y8F A;  1UNR A;  1MKE A;  1FHX A;  1V89 A;  5DHA B;  2D9X A;  1U5G A;  2DFK A;  1ZC3 B;  4YON A;  1WGU A;  1DDV A;  2CAY A;  1AQC A;  4D0N B;  1MAI A;  1DRO A;  1ZSQ A;  1KZG A;  2JP2 A;  1WI1 A;  4CHJ A;  1MIX A;  3AU5 A;  1EVH A;  1X05 A;  3F5R A;  4NSW A;  3FSS A;  1U5F A;  3ODW A;  1MK9 B;  3NSU A;  3T06 A;  2IFS A;  2DYN A;  5JLJ B;  1M7E A;  5EFX A;  2KCJ A;  2P0D A;  2E2X A;  2W2X C;  4HAT B;  4HAU B;  2P0F A;  2GCL A;  2LKO A;  2UVM A;  4C0A A;  3P6A A;  3M1I B;  1BAK A;  1UNP A;  2LG1 A;  2X18 A;  1EGX A;  4KHB B;  2D2Q A;  1TQZ A;  2DA0 A;  2COC A;  4DX9 0;  3SV1 A;  2M38 A;  1FGZ A;  2H7D A;  2J0M A;  2RUK B;  4GMV A;  4F7G A;  2D11 A;  4ZRK A;  5C5B A;  2RLO A;  1DDM A;  4HB0 B;  3HW2 B;  2D10 A;  2NZ8 B;  2GCJ A;  1GC7 A;  5FI0 A;  2M14 A;  2Z0Q A;  5LON B;  3PSC A;  4GZU A;  3RCP A;  3PP2 A;  2J59 M;  4K2O A;  1J19 A;  2CY5 A;  3BIN A;  1FAO A;  2P0H A;  5HE0 A;  3GYP A;  2EC1 A;  4IAP A;  1K5G B;  1SHC A;  4Y94 A;  1X1F A;  4ZRJ A;  2VKI A;  2XQN M;  3TFM A;  1W1G A;  4XWX A;  1OMW A;  5JP4 A;  3ZVR A;  4HDQ A;  5FI1 A;  1XR0 B;  3CIK A;  3ML4 A;  5J3Q A;  2H7E A;  3X23 A;  3WYF B;  3BJI A;  2D9V A;  2OQB A;  3U7D A;  2YRY A;  4CHM A;  2DN6 A;  1LB1 A;  1PLS A;  3VOQ A;  3A98 B;  2RNR B;  4KAX B;  5KQ1 A;  2Q13 A;  2YF0 A;  5JHG A;  4PQ0 A;  1BTK A;  1I2H A;  1QQG A;  2Z0P A;  4HB2 B;  5DIF B;  5J3Y A;  2YVC A;  4HAV B;  1NTY A;  1H10 A;  1Q67 A;  4MY6 A;  1DYN A;  4EJN A;  3KSY A;  4A6H A;  5C79 A;  1MIZ B;  1H4R A;  1UPR A;  1NU2 A;  3TVV A;  5C5B B;  2UZS A;  4HB3 B;  1I7A A;  2ELB A;  3ULB A;  3KRX A;  4B6H A;  1V61 A;  3HK0 A;  1U2B A;  5D3W A;  3QBV B;  4DXA B;  2UZR A;  4CYE A;  1KI1 B;  1TXD A;  2LUL A;  4TKN A;  2D9Z A;  1EAZ A;  4F7U P;  5C6R A;  1OY2 A;  1ZC4 B;  2CRF A;  3LJU X;  4K81 A;  1PFJ A;  2FJL A;  2YT0 A;  4HAW B;  4KHO A;  2R09 A;  1SGH A;  2DHJ A;  2RVB B;  1DBH A;  1GG3 A;  2QKL A;  2VRW B;  2ZPY A;  4EMO A;  2RSG A;  1LW3 A;  2COD A;  2J0K A;  2DKQ A;  3DXD A;  1KZ7 A;  3IVF A;  1UPQ A;  1FOE A;  2DX5 A;  3KZ1 A;  3QWM A;  2DX1 A;  3FM8 C;  2NMB A;  2I5F A;  2EMT A;  2KGX B;  4IFS A;  2CY4 A;  2Y7B A;  3KRW A;  3FEH A;  2YS3 A;  4HAY B;  1MK7 B;  2LOX A;  2L2I A;  2K2J A;  4KHA A;  2YS1 A;  3WA0 A;  5KCV A;  2D9Y A;  4YL8 A;  1W1D A;  1Y5O A;  1V5P A;  2W2W A;  5DH9 B;  4BBK A;  1XKE A;  2MKR A;  3G9W A;  2IYB A;  1Y19 B;  2EMS A;  2I1K A;  1U5D A;  4F7H A;  4HHV A;  2J0J A;  4H8S A;  1XOD A;  5D3X A;  2V76 A;  4IOY X;  4EKU A;  1RRP B;  1P6S A;  1BWN A;  1Z87 A;  4TYZ A;  1WVH A;  1FHW A;  2K00 A;  4PNK A;  1K5D B;  4DBB A;  4WSF A;  1DDW A;  4NY0 A;  1ISN A;  3SUZ A;  3PEG A;  3V5W A;  1UNQ A;  3F0W A;  5D3V A;  1UEF A;  2LYD A;  1ZVR A;  1U27 A;  4A6F B;  3TCA A;  1FGY A;  2EJ8 A;  1FB8 A;  1TJ6 A;  3ULC A;  3A8P A;  2N23 A;  3SO6 A;  4HDO A;  3UZT A;  4WVF B;  2MDX A;  3D8E A;  3SYX A;  5KQ4 A;  2R0D A;  5J3T A;  1NI2 A;  3PZD A;  5HE2 A;  2I5C A;  1P3R A;  2LOZ A;  3QIJ A;  5D27 A;  1V5M A;  1X86 A;  5HE1 A;  2DYQ A;  5C16 A;  2D9W A;  5GOW B;  3D8F A;  3CXB B;  1E5W A;  1ZM0 A;  1U5E A;  1FHO A;  4WJ7 A;  3O96 A;  4MK0 A;  2AEH A;  3KY9 A;  1W1H A;  4P7I A;  2Z0O A;  1RJ2 A;  3D8D A;  5D3Y A;  1X1G A;  3DXE A;  4KVG B;  4Z2N A;  3AJ4 A;  1WGQ A;  3PVU A;  2ELA A;  2DHI A;  4DX8 A;  4A5K A;  3MPX A;  3TO1 A;  2COF A;  5CLL B;  1IRS A;  1XCG A;  4K2P A;  1NTV A;  5LOP B;  2DTC A;  2Y8G A;  2AL6 A;  2N0Y A;  3SNH A;  3ZDT A;  2COA A;  2MWN B;  2L1C A;  1WG7 A;  3OAN A;  2RGN B;  5CLQ B;  2D4Q A;  3GYO A;  3VIA A;  4GPT B;  5DHF B;  1X11 A;  3MDB C;  1V5U A;  2P8V A;  2ROZ B;  3A8Q A;  4HAZ B;  2DHK A;  2GS0 A;  3HQC A;  2DLW A;  4GMX B;  1QC6 A;  1U29 A;  2GJY A;  1P5T A;  2YS5 A;  2W2X D;  3DXC A;  2VSZ A;  2K2U A;  2I1J A;  2G35 A;  5HE3 A;  5JHH A;  4HB4 B;  5L81 A;  1BTN A;  4K17 A;  4Z2M B;  2KUP A;  2DKP A;  2ROV A;  4MT7 A;  1WJM A;  1PMS A;  3PVL A;  1XX0 A;  2BCJ A;  4GXB A;  1WJ1 A;  3PVW A;  5DI9 B;  1B55 A;  1EF1 A;  1N3H A;  3U8Z A;  2PZ1 A;  3TW1 A;  4L6E A;  1GC6 A;  4A6K A;  4A6F A;  1OQN A;  2YT1 A;  1AWE A;  4GN1 A;  3AU4 A;  1MPH A;  2MFQ A;  4ZRI A;  2HE7 A;  2OTX A;  2YSZ A;  3PG7 A;  4HAX B;  1M7R A;  3P7Z A;  1J0W A;  2QKM A;  3N7C A; 
#chains in the Genus database with same CATH topology
 3ODX A;  3ODO A;  1V88 A;  2ADZ A;  1XD4 A;  2HTH B;  2Y8F A;  1UNR A;  1MKE A;  1FHX A;  1V89 A;  5DHA B;  2D9X A;  1U5G A;  2DFK A;  1ZC3 B;  4YON A;  1WGU A;  1DDV A;  2CAY A;  1AQC A;  4D0N B;  1MAI A;  1DRO A;  2KIE A;  1ZSQ A;  1KZG A;  2JP2 A;  1WI1 A;  4CHJ A;  1MIX A;  3AU5 A;  1EVH A;  1X05 A;  3F5R A;  4NSW A;  3FSS A;  1U5F A;  2RRF A;  3ODW A;  1MK9 B;  3NSU A;  2Z4D A;  3T06 A;  5LG4 B;  2IFS A;  2DYN A;  5JLJ B;  1M7E A;  5EFX A;  3NWF A;  2KCJ A;  2P0D A;  2E2X A;  2W2X C;  4HAT B;  4HAU B;  2P0F A;  2GCL A;  2LKO A;  2UVM A;  4C0A A;  3P6A A;  1T77 A;  3M1I B;  1BAK A;  1UNP A;  2LG1 A;  2X18 A;  1EGX A;  4KHB B;  2D2Q A;  1TQZ A;  2DA0 A;  2GUM A;  2COC A;  4DX9 0;  3SV1 A;  2M38 A;  1FGZ A;  2H7D A;  3NWD A;  2J0M A;  2RUK B;  4GMV A;  4F7G A;  2D11 A;  4ZRK A;  5C5B A;  2RLO A;  1DDM A;  4HB0 B;  3HW2 B;  2D10 A;  2NZ8 B;  2GCJ A;  1GC7 A;  5FI0 A;  2M14 A;  2Z0Q A;  5LON B;  3PSC A;  4GZU A;  3RCP A;  3PP2 A;  2J59 M;  2K49 A;  1J19 A;  4K2O A;  4HSI A;  4GNK B;  2CY5 A;  3BIN A;  1FAO A;  2P0H A;  5HE0 A;  3GYP A;  2Z13 A;  2EC1 A;  4IAP A;  1K5G B;  1SHC A;  4Y94 A;  1X1F A;  4ZRJ A;  4GOU A;  2VKI A;  2XQN M;  3HSA A;  3TFM A;  1W1G A;  4OT1 A;  1MI1 A;  4XWX A;  1OMW A;  5JP4 A;  3ZVR A;  4HDQ A;  5FI1 A;  1XR0 B;  3CIK A;  3ML4 A;  1ZYI A;  5J3Q A;  2H7E A;  3X23 A;  3B77 A;  3WYF B;  3BJI A;  2D9V A;  2OQB A;  2KUQ A;  3U7D A;  2YRY A;  4CHM A;  2DN6 A;  1LB1 A;  1PLS A;  3VOQ A;  3A98 B;  2RNR B;  4KAX B;  5KQ1 A;  2Q13 A;  3DCX A;  2YF0 A;  4QJ5 B;  5JHG A;  4PQ0 A;  1BTK A;  1I2H A;  1QQG A;  2Z0P A;  4HB2 B;  5DIF B;  5J3Y A;  2YVC A;  4HAV B;  1NTY A;  1H10 A;  1Q67 A;  4MY6 A;  1DYN A;  4EJN A;  3U12 A;  3KSY A;  4A6H A;  5C79 A;  1MIZ B;  1H4R A;  1UPR A;  1NU2 A;  3TVV A;  5C5B B;  2UZS A;  4HB3 B;  1I7A A;  2ELB A;  3ULB A;  3KRX A;  4B6H A;  1V61 A;  3HK0 A;  1U2B A;  5D3W A;  3QBV B;  4DXA B;  2UZR A;  4CYE A;  1KI1 B;  1TXD A;  2LUL A;  4TKN A;  2D9Z A;  1EAZ A;  4F7U P;  5C6R A;  1OY2 A;  1ZC4 B;  2CRF A;  3LJU X;  4K81 A;  1PFJ A;  2FJL A;  4L1R A;  2YT0 A;  4HAW B;  4KHO A;  2FJU B;  2R09 A;  1SGH A;  2DHJ A;  2RVB B;  1DBH A;  1GG3 A;  2QKL A;  3NWA A;  2VRW B;  2ZPY A;  4EMO A;  2RSG A;  1LW3 A;  2COD A;  2J0K A;  2DKQ A;  3DXD A;  1KZ7 A;  3IVF A;  1FOE A;  1UPQ A;  2DX5 A;  3KZ1 A;  3QWM A;  2DX1 A;  3FM8 C;  2NMB A;  2I5F A;  2EMT A;  2KGX B;  4IFS A;  2CY4 A;  2Y7B A;  3KRW A;  3FEH A;  2YS3 A;  4HAY B;  1MK7 B;  2LOX A;  2L2I A;  2K8E A;  2ZKM X;  2K2J A;  4KHA A;  4OSN A;  3HIE A;  2YS1 A;  3WA0 A;  4CSQ A;  5KCV A;  2D9Y A;  2NBV A;  4YL8 A;  1W1D A;  1Y5O A;  1V5P A;  2W2W A;  5DH9 B;  4BBK A;  1XKE A;  2MKR A;  3G9W A;  3A58 A;  2IYB A;  1Y19 B;  2EMS A;  2I1K A;  1U5D A;  4F7H A;  4HHV A;  4QJ4 B;  2J0J A;  4H8S A;  1XOD A;  5D3X A;  2V76 A;  4IOY X;  4EKU A;  1RRP B;  1P6S A;  1BWN A;  2Z59 A;  1Z87 A;  4TYZ A;  1WVH A;  1FHW A;  2K00 A;  4PNK A;  1K5D B;  4DBB A;  4WSF A;  1DDW A;  4NY0 A;  1ISN A;  3SUZ A;  3PEG A;  4QXA B;  3V5W A;  3OHM B;  1UNQ A;  3F0W A;  5D3V A;  1UEF A;  2LYD A;  1ZVR A;  1U27 A;  4A6F B;  3TCA A;  1FGY A;  2EJ8 A;  1FB8 A;  1TJ6 A;  2KR0 A;  3ULC A;  3A8P A;  2N23 A;  3SO6 A;  4HDO A;  3UZT A;  4WVF B;  2MDX A;  3D8E A;  3SYX A;  5KQ4 A;  2R0D A;  5J3T A;  1NI2 A;  3NW8 A;  3PZD A;  5HE2 A;  2I5C A;  1P3R A;  2LOZ A;  3QIJ A;  5D27 A;  1V5M A;  1X86 A;  5HE1 A;  2DYQ A;  5C16 A;  2D9W A;  5GOW B;  3D8F A;  4D6W A;  3CXB B;  1E5W A;  1ZM0 A;  1U5E A;  1FHO A;  4WJ7 A;  3O96 A;  4MK0 A;  2AEH A;  3KY9 A;  1W1H A;  4P7I A;  2Z0O A;  1RJ2 A;  3D8D A;  4KHB A;  5M4Y B;  5D3Y A;  1X1G A;  3DXE A;  4KVG B;  4Z2N A;  3AJ4 A;  1WGQ A;  3PVU A;  2ELA A;  2DHI A;  2KIG A;  4DX8 A;  4A5K A;  3MPX A;  3TO1 A;  2COF A;  5CLL B;  1IRS A;  1XCG A;  4K2P A;  1NTV A;  5LOP B;  2DTC A;  2Y8G A;  2AL6 A;  2N0Y A;  3SNH A;  3ZDT A;  2COA A;  2MWN B;  2L1C A;  1WG7 A;  3OAN A;  2RGN B;  2R2Y A;  5CLQ B;  2D4Q A;  3GYO A;  3VIA A;  4GPT B;  5I2M A;  5DHF B;  1X11 A;  3MDB C;  1V5U A;  2P8V A;  2ROZ B;  3A8Q A;  4HAZ B;  2DHK A;  2GS0 A;  3HQC A;  2DLW A;  4GMX B;  1QC6 A;  1U29 A;  2GJY A;  1P5T A;  2YS5 A;  2W2X D;  3DXC A;  2VSZ A;  2K2U A;  2I1J A;  2G35 A;  5HE3 A;  5JHH A;  4HB4 B;  5L81 A;  1BTN A;  4K17 A;  4Z2M B;  2KUP A;  2DKP A;  2ROV A;  4MT7 A;  4QJ3 B;  1WJM A;  1PMS A;  5I2S A;  2Z14 A;  3PVL A;  1XX0 A;  2BCJ A;  2YT2 A;  4GXB A;  1WJ1 A;  3PVW A;  5DI9 B;  1B55 A;  1EF1 A;  1N3H A;  3U8Z A;  2PZ1 A;  3TW1 A;  4L6E A;  1GC6 A;  4A6K A;  4A6F A;  1OQN A;  2YT1 A;  1AWE A;  4GN1 A;  3FVC A;  3AU4 A;  1MPH A;  2MFQ A;  4ZRI A;  4DIX A;  2HE7 A;  2OTX A;  2YSZ A;  3PG7 A;  1M7R A;  3P7Z A;  4HAX B;  1J0W A;  2QKM A;  3N7C A;  5IRS A; 
#chains in the Genus database with same CATH homology
 3ODX A;  3ODO A;  1V88 A;  2ADZ A;  1XD4 A;  2HTH B;  2Y8F A;  1UNR A;  1MKE A;  1FHX A;  1V89 A;  5DHA B;  2D9X A;  1U5G A;  2DFK A;  1ZC3 B;  4YON A;  1WGU A;  1DDV A;  2CAY A;  1AQC A;  4D0N B;  1MAI A;  1DRO A;  2KIE A;  1ZSQ A;  1KZG A;  2JP2 A;  1WI1 A;  4CHJ A;  1MIX A;  3AU5 A;  1EVH A;  1X05 A;  3F5R A;  4NSW A;  3FSS A;  1U5F A;  3ODW A;  2RRF A;  1MK9 B;  3NSU A;  2Z4D A;  3T06 A;  5LG4 B;  2IFS A;  2DYN A;  5JLJ B;  1M7E A;  5EFX A;  3NWF A;  2KCJ A;  2P0D A;  2E2X A;  2W2X C;  4HAT B;  4HAU B;  2P0F A;  2GCL A;  2LKO A;  2UVM A;  4C0A A;  3P6A A;  3M1I B;  1BAK A;  1UNP A;  2LG1 A;  2X18 A;  1EGX A;  4KHB B;  2D2Q A;  1TQZ A;  2DA0 A;  2GUM A;  2COC A;  4DX9 0;  3SV1 A;  2M38 A;  1FGZ A;  2H7D A;  3NWD A;  2J0M A;  2RUK B;  4GMV A;  4F7G A;  2D11 A;  4ZRK A;  5C5B A;  2RLO A;  1DDM A;  4HB0 B;  3HW2 B;  2D10 A;  2NZ8 B;  2GCJ A;  1GC7 A;  5FI0 A;  2M14 A;  2Z0Q A;  5LON B;  3PSC A;  4GZU A;  3RCP A;  3PP2 A;  2J59 M;  4K2O A;  1J19 A;  2K49 A;  4HSI A;  4GNK B;  2CY5 A;  3BIN A;  1FAO A;  2P0H A;  5HE0 A;  3GYP A;  2Z13 A;  2EC1 A;  4IAP A;  1K5G B;  1SHC A;  4Y94 A;  1X1F A;  4ZRJ A;  4GOU A;  2VKI A;  2XQN M;  3TFM A;  1W1G A;  4OT1 A;  4XWX A;  1OMW A;  5JP4 A;  3ZVR A;  4HDQ A;  5FI1 A;  1XR0 B;  3CIK A;  3ML4 A;  1ZYI A;  5J3Q A;  2H7E A;  3X23 A;  3WYF B;  3BJI A;  2D9V A;  2OQB A;  2KUQ A;  3U7D A;  2YRY A;  4CHM A;  2DN6 A;  1LB1 A;  1PLS A;  3VOQ A;  3A98 B;  2RNR B;  4KAX B;  5KQ1 A;  2Q13 A;  4QJ5 B;  2YF0 A;  5JHG A;  4PQ0 A;  1BTK A;  1I2H A;  1QQG A;  2Z0P A;  4HB2 B;  5DIF B;  5J3Y A;  2YVC A;  4HAV B;  1NTY A;  1H10 A;  1Q67 A;  4MY6 A;  1DYN A;  4EJN A;  3U12 A;  3KSY A;  4A6H A;  5C79 A;  1MIZ B;  1H4R A;  1UPR A;  1NU2 A;  3TVV A;  5C5B B;  2UZS A;  4HB3 B;  1I7A A;  2ELB A;  3ULB A;  3KRX A;  4B6H A;  1V61 A;  3HK0 A;  1U2B A;  5D3W A;  3QBV B;  4DXA B;  2UZR A;  4CYE A;  1KI1 B;  1TXD A;  2LUL A;  4TKN A;  2D9Z A;  1EAZ A;  4F7U P;  5C6R A;  1OY2 A;  1ZC4 B;  2CRF A;  3LJU X;  4K81 A;  1PFJ A;  2FJL A;  4L1R A;  2YT0 A;  4HAW B;  4KHO A;  2FJU B;  2R09 A;  1SGH A;  2DHJ A;  2RVB B;  1DBH A;  1GG3 A;  2QKL A;  3NWA A;  2VRW B;  2ZPY A;  4EMO A;  2RSG A;  1LW3 A;  2COD A;  2J0K A;  2DKQ A;  3DXD A;  1KZ7 A;  3IVF A;  1UPQ A;  1FOE A;  2DX5 A;  3KZ1 A;  3QWM A;  2DX1 A;  3FM8 C;  2NMB A;  2I5F A;  2EMT A;  2KGX B;  4IFS A;  2CY4 A;  2Y7B A;  3KRW A;  3FEH A;  2YS3 A;  4HAY B;  1MK7 B;  2LOX A;  2L2I A;  2K8E A;  2ZKM X;  2K2J A;  4KHA A;  4OSN A;  3HIE A;  2YS1 A;  3WA0 A;  4CSQ A;  5KCV A;  2D9Y A;  2NBV A;  4YL8 A;  1W1D A;  1Y5O A;  1V5P A;  2W2W A;  5DH9 B;  4BBK A;  1XKE A;  2MKR A;  3G9W A;  3A58 A;  2IYB A;  1Y19 B;  2EMS A;  2I1K A;  1U5D A;  4F7H A;  4HHV A;  4QJ4 B;  2J0J A;  4H8S A;  1XOD A;  5D3X A;  2V76 A;  4IOY X;  4EKU A;  1RRP B;  1P6S A;  1BWN A;  2Z59 A;  1Z87 A;  4TYZ A;  1WVH A;  1FHW A;  2K00 A;  4PNK A;  1K5D B;  4DBB A;  4WSF A;  1DDW A;  4NY0 A;  1ISN A;  3SUZ A;  3PEG A;  3V5W A;  4QXA B;  3OHM B;  1UNQ A;  3F0W A;  5D3V A;  1UEF A;  2LYD A;  1ZVR A;  1U27 A;  4A6F B;  3TCA A;  1FGY A;  2EJ8 A;  1FB8 A;  1TJ6 A;  2KR0 A;  3ULC A;  3A8P A;  2N23 A;  3SO6 A;  4HDO A;  3UZT A;  4WVF B;  2MDX A;  3D8E A;  3SYX A;  5KQ4 A;  2R0D A;  5J3T A;  1NI2 A;  3NW8 A;  3PZD A;  5HE2 A;  2I5C A;  1P3R A;  2LOZ A;  3QIJ A;  5D27 A;  1V5M A;  1X86 A;  5HE1 A;  2DYQ A;  5C16 A;  2D9W A;  5GOW B;  3D8F A;  4D6W A;  3CXB B;  1E5W A;  1ZM0 A;  1U5E A;  1FHO A;  4WJ7 A;  3O96 A;  4MK0 A;  2AEH A;  3KY9 A;  1W1H A;  4P7I A;  2Z0O A;  1RJ2 A;  3D8D A;  4KHB A;  5M4Y B;  5D3Y A;  1X1G A;  3DXE A;  4KVG B;  4Z2N A;  3AJ4 A;  1WGQ A;  3PVU A;  2ELA A;  2DHI A;  4DX8 A;  2KIG A;  4A5K A;  3MPX A;  3TO1 A;  2COF A;  5CLL B;  1IRS A;  1XCG A;  4K2P A;  1NTV A;  5LOP B;  2DTC A;  2Y8G A;  2AL6 A;  2N0Y A;  3SNH A;  3ZDT A;  2COA A;  2MWN B;  2L1C A;  1WG7 A;  3OAN A;  2RGN B;  2R2Y A;  5CLQ B;  2D4Q A;  3GYO A;  3VIA A;  4GPT B;  5I2M A;  5DHF B;  1X11 A;  3MDB C;  1V5U A;  2P8V A;  2ROZ B;  3A8Q A;  4HAZ B;  2DHK A;  2GS0 A;  3HQC A;  2DLW A;  4GMX B;  1QC6 A;  1U29 A;  2GJY A;  1P5T A;  2YS5 A;  2W2X D;  3DXC A;  2VSZ A;  2K2U A;  2I1J A;  2G35 A;  5HE3 A;  5JHH A;  4HB4 B;  5L81 A;  1BTN A;  4K17 A;  4Z2M B;  2KUP A;  2DKP A;  2ROV A;  4MT7 A;  4QJ3 B;  1WJM A;  1PMS A;  5I2S A;  2Z14 A;  3PVL A;  1XX0 A;  2BCJ A;  2YT2 A;  4GXB A;  1WJ1 A;  3PVW A;  5DI9 B;  1B55 A;  1EF1 A;  1N3H A;  3U8Z A;  2PZ1 A;  3TW1 A;  4L6E A;  1GC6 A;  4A6K A;  4A6F A;  1OQN A;  2YT1 A;  1AWE A;  4GN1 A;  3FVC A;  3AU4 A;  1MPH A;  2MFQ A;  4ZRI A;  4DIX A;  2HE7 A;  2OTX A;  2YSZ A;  3PG7 A;  4HAX B;  1M7R A;  3P7Z A;  1J0W A;  2QKM A;  3N7C A;  5IRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...