4KHBB

Structure of the spt16d pob3n heterodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
186
structure length
176
Chain Sequence
b'MAAIESFDHIYLDLSKEPGKCRFAENGLGWKPVGGGETFTLDVSNIGGAQWSRAAGYEVKILQRTSGVIQLDGFQQEDYERLAKIFKNWYSTNLENKEHSLRGWNWGKAEFGKAELTFNVQNRPAFEIPYSEIANTNLAGRNEIAVEFAPGQVKSKKASASRDQLVEIRFYIPGTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SPT16D
publication title Structural basis of histone H2A-H2B recognition by the essential chaperone FACT.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Transcription/replication
total genus 33
structure length 176
sequence length 186
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03531 SSrecog Structure-specific recognition protein (SSRP1)
B PF17292 POB3_N POB3-like N-terminal PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4khbB01
2.30.29.220 Mainly Beta Roll PH-domain like PH-domain like 4khbB02
4D0NB 2RVBB 1I2HA 1X86A 3P7ZA 2LOXA 2M38A 4MY6A 1P5TA 4NY0A 1TJ6A 4HB2B 4HDQA 3VIAA 2W2XC 1M7EA 3AU5A 3AJ4A 2IYBA 5D3WA 5JHGA 2P0HA 1BAKA 4CHJA 2N0YA 2K2UA 5GOWB 2D9XA 1MIZB 1IRSA 2OQBA 4Z2NA 2Q13A 4ZRJA 2EMSA 1XKEA 2DHIA 4CHMA 1MK9B 4KHOA 2CAYA 3RCPA 3ULCA 4HHVA 3WA0A 1RRPB 5CLLB 2MFQA 1SHCA 3O96A 3SNHA 1NU2A 2R0DA 2CY5A 1TXDA 5J3QA 4WVFB 1PFJA 2NZ8B 1W1DA 1MIXA 5C6RA 1DBHA 3D8EA 4K17A 3X23A 2I5FA 4GXBA 2GCJA 4A6FA 1B55A 1UNPA 1LB1A 2JP2A 2LOZA 1FAOA 3PSCA 1WGQA 3FEHA 5J3TA 5DHAB 1GG3A 2I5CA 2Z0OA 4EJNA 2XQNM 4MK0A 5C79A 1K5GB 3F5RA 1V5UA 3QIJA 4CYEA 5DHFB 1W1GA 1H10A 1MK7B 3A8PA 1P6SA 2RLOA 1UNQA 4F7UP 2ROVA 1J19A 3UZTA 5D3YA 2OTXA 4A6FB 2COCA 2LYDA 5D27A 2CRFA 1QQGA 1J0WA 4PQ0A 1OY2A 2H7EA 5JP4A 1Q67A 3KSYA 2N23A 4F7HA 5KQ4A 3N7CA 2AL6A 3T06A 2KGXB 1DROA 2VKIA 1BWNA 1WGUA 1SGHA 4KVGB 1U5EA 4P7IA 4GMVA 1P3RA 2ADZA 1U27A 2P0DA 4Y94A 1X05A 2W2XD 4HAZB 1KI1B 1FHOA 1U29A 2Z0PA 2YVCA 1ZC3B 1DDWA 3TCAA 4IOYX 3PG7A 3SV1A 1N3HA 3GYOA 1WJ1A 2HTHB 3TFMA 3U7DA 4YL8A 5J3YA 2EC1A 2DKPA 1GC7A 3SYXA 3LJUX 1Z87A 3ULBA 3FM8C 4Z2MB 4HB0B 2EJ8A 3HW2B 4BBKA 3ZDTA 4HAUB 4H8SA 3PVLA 2D4QA 2I1JA 3A98B 1FHWA 4GN1A 4EMOA 2YSZA 2QKLA 2E2XA 1XX0A 2RGNB 1RJ2A 3ML4A 3NSUA 2W2WA 1V5PA 3ODXA 1Y19B 1KZGA 1U2BA 2LKOA 4HAYB 4B6HA 1WG7A 2RSGA 4TYZA 2H7DA 2P8VA 1NTYA 1FB8A 4KHBB 1DDMA 5HE0A 2D9YA 2DN6A 3SO6A 5KQ1A 1UEFA 2DHJA 2MKRA 4IFSA 1MKEA 3BJIA 2P0FA 3VOQA 2YS1A 3V5WA 1FOEA 3SUZA 2X18A 2YT0A 2VSZA 1DYNA 5D3XA 2UZRA 5JHHA 2QKMA 1V61A 1X1FA 5HE1A 2PZ1A 1NTVA 2DYQA 1AQCA 2K2JA 3DXEA 3D8DA 2D9VA 5C16A 5JLJB 4A6KA 3KRWA 2L1CA 4A5KA 3CXBB 4DX90 2Z0QA 1I7AA 3IVFA 2K00A 4TKNA 4ZRIA 1ZC4B 3CIKA 5DH9B 2D2QA 3HQCA 2YS5A 2ZPYA 2BCJA 2DHKA 1MAIA 2COFA 3G9WA 1EAZA 2AEHA 2ELAA 3PVUA 1M7RA 1QC6A 3QBVB 2Y7BA 2GJYA 3KZ1A 5KCVA 5DIFB 2D11A 2FJLA 2YRYA 3OANA 1ZM0A 2HE7A 2M14A 1DDVA 2UVMA 3DXDA 3WYFB 2YF0A 5HE2A 5FI1A 4XWXA 3KRXA 1EGXA 2V76A 3PEGA 1XODA 4GZUA 2DKQA 4DX8A 5HE3A 4GPTB 2G35A 3BINA 4IAPA 1XD4A 1MPHA 1AWEA 1TQZA 4C0AA 5D3VA 4K81A 1X1GA 1U5FA 4F7GA 2J0JA 3PVWA 2J0MA 4KHAA 4HB4B 1E5WA 1X11A 3DXCA 2DLWA 2J59M 2DYNA 4WSFA 4DBBA 2RNRB 2MDXA 5C5BB 5LOPB 4HB3B 5L81A 1BTKA 1V89A 3MDBC 1GC6A 2KCJA 1OMWA 2J0KA 1WI1A 2LULA 2RUKB 3U8ZA 1LW3A 1NI2A 1PMSA 4HDOA 4DXAB 2D9WA 1K5DB 1FGZA 4HATB 4ZRKA 1UPRA 2D9ZA 2UZSA 1XR0B 2LG1A 3ODOA 2GCLA 2Y8GA 2GS0A 1BTNA 2YT1A 4GMXB 3ODWA 1FGYA 5LONB 3HK0A 3MPXA 4YONA 4PNKA 1OQNA 2EMTA 4HAVB 2DFKA 2R09A 3AU4A 4WJ7A 4MT7A 2NMBA 2DA0A 1XCGA 2MWNB 2L2IA 3P6AA 3M1IB 2VRWB 3PZDA 4HAXB 5CLQB 1W1HA 1ZSQA 1UNRA 2I1KA 1FHXA 4K2OA 3ZVRA 4KAXB 4HAWB 1H4RA 1U5GA 4K2PA 1EF1A 1PLSA 5EFXA 3TVVA 2KUPA 1KZ7A 1U5DA 1ISNA 3KY9A 2CY4A 1EVHA 2ROZB 4L6EA 2DX1A 2ELBA 1UPQA 3D8FA 3TW1A 3GYPA 2CODA 4EKUA 4NSWA 1V5MA 2COAA 2Y8FA 1Y5OA 3F0WA 1WVHA 2DTCA 2IFSA 3QWMA 3PP2A 4A6HA 1V88A 2YS3A 1ZVRA 3A8QA 5DI9B 2D10A 1WJMA 2DX5A 5C5BA 5FI0A 3FSSA 3TO1A
chains in the Genus database with same CATH superfamily
4D0NB 2RVBB 1I2HA 1X86A 3P7ZA 2LOXA 2M38A 4MY6A 1P5TA 4NY0A 1TJ6A 4HB2B 4HDQA 3VIAA 2W2XC 1M7EA 3AU5A 3AJ4A 2IYBA 5D3WA 5JHGA 2P0HA 1BAKA 4CHJA 2N0YA 2K2UA 5GOWB 2D9XA 1MIZB 1IRSA 2OQBA 4Z2NA 2Q13A 4ZRJA 2EMSA 1XKEA 2DHIA 4CHMA 1MK9B 4KHOA 2CAYA 3RCPA 3ULCA 4HHVA 3WA0A 1RRPB 5CLLB 2MFQA 1SHCA 3O96A 3SNHA 1NU2A 2R0DA 2CY5A 1T77A 1TXDA 5J3QA 4WVFB 1PFJA 2NZ8B 1W1DA 1MIXA 5C6RA 1DBHA 3D8EA 4K17A 3X23A 2I5FA 4GXBA 2GCJA 4A6FA 1B55A 1UNPA 1LB1A 2JP2A 2LOZA 1FAOA 3PSCA 1WGQA 3FEHA 5J3TA 5DHAB 1GG3A 2I5CA 2Z0OA 4EJNA 2XQNM 4MK0A 5C79A 1K5GB 3F5RA 5IRSA 1V5UA 3QIJA 4CYEA 5DHFB 1W1GA 1H10A 1MK7B 3A8PA 1P6SA 4DIXA 2RLOA 1UNQA 4F7UP 2ROVA 1J19A 3UZTA 5D3YA 2OTXA 4A6FB 2COCA 2LYDA 5D27A 2CRFA 1QQGA 1J0WA 4PQ0A 1OY2A 2H7EA 5JP4A 2YT2A 1Q67A 3KSYA 2N23A 4F7HA 5KQ4A 3N7CA 2AL6A 3DCXA 3T06A 2KGXB 1DROA 4CSQA 2VKIA 1BWNA 1WGUA 1SGHA 4KVGB 1U5EA 4P7IA 5I2MA 4QJ4B 4GMVA 1P3RA 2ADZA 1U27A 2P0DA 2Z59A 4Y94A 1X05A 2W2XD 4HAZB 1KI1B 1FHOA 3FVCA 1U29A 2Z0PA 2YVCA 1ZC3B 1DDWA 3TCAA 4IOYX 3PG7A 3SV1A 1N3HA 3GYOA 1WJ1A 2HTHB 3TFMA 3U7DA 4YL8A 5J3YA 2EC1A 2ZKMX 2DKPA 1GC7A 3SYXA 3LJUX 2Z13A 1Z87A 3ULBA 3FM8C 4Z2MB 4HB0B 2EJ8A 3HW2B 4BBKA 3ZDTA 4HAUB 4H8SA 2KIEA 3PVLA 2D4QA 2I1JA 3A98B 1FHWA 4GN1A 4EMOA 2YSZA 2QKLA 2E2XA 1XX0A 2RGNB 1RJ2A 3ML4A 3NSUA 2W2WA 1V5PA 3ODXA 1Y19B 1KZGA 1U2BA 2R2YA 2LKOA 2K49A 2GUMA 4HAYB 4B6HA 1WG7A 2RSGA 4TYZA 2H7DA 2P8VA 1NTYA 1FB8A 4KHBB 1DDMA 5HE0A 2D9YA 2DN6A 3SO6A 5KQ1A 1UEFA 2DHJA 2MKRA 4IFSA 4QJ5B 1MKEA 3B77A 4OSNA 3BJIA 2P0FA 4HSIA 3VOQA 2YS1A 3V5WA 1FOEA 3SUZA 2X18A 2YT0A 2VSZA 1DYNA 5D3XA 2UZRA 5JHHA 2QKMA 3A58A 4D6WA 1V61A 4GNKB 1X1FA 5HE1A 2PZ1A 5LG4B 1NTVA 2DYQA 1AQCA 2K2JA 3DXEA 3D8DA 2D9VA 5C16A 5JLJB 4A6KA 3KRWA 2L1CA 4A5KA 3CXBB 4DX90 2Z0QA 1I7AA 3IVFA 2K00A 3NWAA 4TKNA 4ZRIA 1ZC4B 3CIKA 5DH9B 2D2QA 3HQCA 2YS5A 2ZPYA 2BCJA 2K8EA 2DHKA 1MAIA 2COFA 3G9WA 1EAZA 2AEHA 2ELAA 3PVUA 1M7RA 2KR0A 1QC6A 3QBVB 2Y7BA 3HIEA 2GJYA 3KZ1A 5KCVA 5DIFB 2D11A 2FJLA 2YRYA 3OANA 1ZM0A 2HE7A 2M14A 1DDVA 2UVMA 3DXDA 3WYFB 2YF0A 5HE2A 5FI1A 4XWXA 3KRXA 2Z14A 1EGXA 2V76A 3PEGA 4GOUA 1XODA 4GZUA 2DKQA 4DX8A 5HE3A 4GPTB 2G35A 3BINA 4IAPA 4L1RA 2KIGA 1XD4A 1MPHA 1AWEA 1TQZA 4C0AA 5D3VA 4K81A 1X1GA 1U5FA 4F7GA 1ZYIA 2J0JA 3PVWA 4KHBA 2J0MA 4KHAA 3NW8A 4HB4B 1E5WA 1X11A 4QJ3B 3DXCA 2DLWA 2J59M 2DYNA 5I2SA 4WSFA 4DBBA 2RNRB 2MDXA 5C5BB 5LOPB 4HB3B 5L81A 1BTKA 1V89A 3MDBC 1GC6A 2KCJA 1OMWA 2J0KA 1WI1A 2LULA 2RUKB 3U8ZA 1LW3A 1NI2A 1PMSA 4HDOA 4DXAB 2D9WA 1K5DB 1FGZA 4HATB 2KUQA 3OHMB 4ZRKA 1UPRA 2D9ZA 2UZSA 1XR0B 2LG1A 3ODOA 2GCLA 3NWFA 2Y8GA 2GS0A 1BTNA 2YT1A 4GMXB 4OT1A 2Z4DA 3ODWA 1FGYA 5LONB 3HK0A 3MPXA 4YONA 4PNKA 3NWDA 1OQNA 2EMTA 4QXAB 4HAVB 2DFKA 2R09A 3AU4A 4WJ7A 4MT7A 2NMBA 2DA0A 2FJUB 1XCGA 2MWNB 2L2IA 3P6AA 3M1IB 2VRWB 3PZDA 4HAXB 5CLQB 1W1HA 3U12A 1ZSQA 1UNRA 2I1KA 1FHXA 1MI1A 4K2OA 3ZVRA 4KAXB 4HAWB 1H4RA 1U5GA 4K2PA 2NBVA 1EF1A 1PLSA 5EFXA 3TVVA 2KUPA 1KZ7A 1U5DA 1ISNA 3KY9A 2CY4A 1EVHA 2ROZB 4L6EA 2DX1A 3HSAA 2ELBA 1UPQA 5M4YB 3D8FA 3TW1A 3GYPA 2CODA 4EKUA 4NSWA 1V5MA 2COAA 2Y8FA 1Y5OA 3F0WA 1WVHA 2DTCA 2IFSA 3QWMA 3PP2A 4A6HA 1V88A 2YS3A 1ZVRA 3A8QA 2RRFA 5DI9B 2D10A 1WJMA 2DX5A 5C5BA 5FI0A 3FSSA 3TO1A
chains in the Genus database with same CATH topology
4D0NB 2RVBB 1I2HA 1X86A 3P7ZA 2LOXA 2M38A 4MY6A 1P5TA 4NY0A 1TJ6A 4HB2B 4HDQA 3VIAA 2W2XC 1M7EA 3AU5A 3AJ4A 2IYBA 5D3WA 5JHGA 2P0HA 1BAKA 4CHJA 2N0YA 2K2UA 5GOWB 2D9XA 1MIZB 1IRSA 2OQBA 4Z2NA 2Q13A 4ZRJA 2EMSA 1XKEA 2DHIA 4CHMA 1MK9B 4KHOA 2CAYA 3RCPA 3ULCA 4HHVA 3WA0A 1RRPB 5CLLB 2MFQA 1SHCA 3O96A 3SNHA 1NU2A 2R0DA 2CY5A 1TXDA 5J3QA 4WVFB 1PFJA 2NZ8B 1W1DA 1MIXA 5C6RA 1DBHA 3D8EA 4K17A 3X23A 2I5FA 4GXBA 2GCJA 4A6FA 1B55A 1UNPA 1LB1A 2JP2A 2LOZA 1FAOA 3PSCA 1WGQA 3FEHA 5J3TA 5DHAB 1GG3A 2I5CA 2Z0OA 4EJNA 2XQNM 4MK0A 5C79A 1K5GB 3F5RA 5IRSA 1V5UA 3QIJA 4CYEA 5DHFB 1W1GA 1H10A 1MK7B 3A8PA 1P6SA 4DIXA 2RLOA 1UNQA 4F7UP 2ROVA 1J19A 3UZTA 5D3YA 2OTXA 4A6FB 2COCA 2LYDA 5D27A 2CRFA 1QQGA 1J0WA 4PQ0A 1OY2A 2H7EA 5JP4A 2YT2A 1Q67A 3KSYA 2N23A 4F7HA 5KQ4A 3N7CA 2AL6A 3T06A 2KGXB 1DROA 4CSQA 2VKIA 1BWNA 1WGUA 1SGHA 4KVGB 1U5EA 4P7IA 5I2MA 4QJ4B 4GMVA 1P3RA 2ADZA 1U27A 2P0DA 2Z59A 4Y94A 1X05A 2W2XD 4HAZB 1KI1B 1FHOA 3FVCA 1U29A 2Z0PA 2YVCA 1ZC3B 1DDWA 3TCAA 4IOYX 3PG7A 3SV1A 1N3HA 3GYOA 1WJ1A 2HTHB 3TFMA 3U7DA 4YL8A 5J3YA 2EC1A 2ZKMX 2DKPA 1GC7A 3SYXA 3LJUX 2Z13A 1Z87A 3ULBA 3FM8C 4Z2MB 4HB0B 2EJ8A 3HW2B 4BBKA 3ZDTA 4HAUB 4H8SA 2KIEA 3PVLA 2D4QA 2I1JA 3A98B 1FHWA 4GN1A 4EMOA 2YSZA 2QKLA 2E2XA 1XX0A 2RGNB 1RJ2A 3ML4A 3NSUA 2W2WA 1V5PA 3ODXA 1Y19B 1KZGA 1U2BA 2R2YA 2LKOA 2K49A 2GUMA 4HAYB 4B6HA 1WG7A 2RSGA 4TYZA 2H7DA 2P8VA 1NTYA 1FB8A 4KHBB 1DDMA 5HE0A 2D9YA 2DN6A 3SO6A 5KQ1A 1UEFA 2DHJA 2MKRA 4IFSA 4QJ5B 1MKEA 4OSNA 3BJIA 2P0FA 4HSIA 3VOQA 2YS1A 3V5WA 1FOEA 3SUZA 2X18A 2YT0A 2VSZA 1DYNA 5D3XA 2UZRA 5JHHA 2QKMA 3A58A 4D6WA 1V61A 4GNKB 1X1FA 5HE1A 2PZ1A 5LG4B 1NTVA 2DYQA 1AQCA 2K2JA 3DXEA 3D8DA 2D9VA 5C16A 5JLJB 4A6KA 3KRWA 2L1CA 4A5KA 3CXBB 4DX90 2Z0QA 1I7AA 3IVFA 2K00A 4TKNA 4ZRIA 3NWAA 1ZC4B 3CIKA 5DH9B 2D2QA 3HQCA 2YS5A 2ZPYA 2BCJA 2K8EA 2DHKA 1MAIA 2COFA 3G9WA 1EAZA 2AEHA 2ELAA 3PVUA 1M7RA 2KR0A 1QC6A 3QBVB 2Y7BA 3HIEA 2GJYA 3KZ1A 5KCVA 5DIFB 2D11A 2FJLA 2YRYA 3OANA 1ZM0A 2HE7A 2M14A 1DDVA 2UVMA 3DXDA 3WYFB 2YF0A 5HE2A 5FI1A 4XWXA 3KRXA 2Z14A 1EGXA 2V76A 3PEGA 4GOUA 1XODA 4GZUA 2DKQA 4DX8A 5HE3A 4GPTB 2G35A 3BINA 4IAPA 4L1RA 2KIGA 1XD4A 1MPHA 1AWEA 1TQZA 4C0AA 5D3VA 4K81A 1X1GA 1U5FA 4F7GA 1ZYIA 2J0JA 3PVWA 4KHBA 2J0MA 4KHAA 3NW8A 4HB4B 1E5WA 1X11A 4QJ3B 3DXCA 2DLWA 2J59M 2DYNA 5I2SA 4WSFA 4DBBA 2RNRB 2MDXA 5C5BB 5LOPB 4HB3B 5L81A 1BTKA 1V89A 3MDBC 1GC6A 2KCJA 1OMWA 2J0KA 1WI1A 2LULA 2RUKB 3U8ZA 1LW3A 1NI2A 1PMSA 4HDOA 4DXAB 2D9WA 1K5DB 1FGZA 4HATB 2KUQA 3OHMB 4ZRKA 1UPRA 2D9ZA 2UZSA 1XR0B 2LG1A 3ODOA 2GCLA 3NWFA 2Y8GA 2GS0A 1BTNA 2YT1A 4GMXB 4OT1A 3ODWA 2Z4DA 1FGYA 5LONB 3HK0A 3MPXA 4YONA 4PNKA 3NWDA 1OQNA 2EMTA 4QXAB 4HAVB 2DFKA 2R09A 3AU4A 4WJ7A 4MT7A 2NMBA 2DA0A 2FJUB 1XCGA 2MWNB 2L2IA 3P6AA 3M1IB 2VRWB 3PZDA 4HAXB 5CLQB 1W1HA 3U12A 1ZSQA 1UNRA 2I1KA 1FHXA 4K2OA 3ZVRA 4KAXB 4HAWB 1H4RA 1U5GA 4K2PA 2NBVA 1EF1A 1PLSA 5EFXA 3TVVA 2KUPA 1KZ7A 1U5DA 1ISNA 3KY9A 2CY4A 1EVHA 2ROZB 4L6EA 2DX1A 2ELBA 1UPQA 5M4YB 3D8FA 3TW1A 3GYPA 2CODA 4EKUA 4NSWA 1V5MA 2COAA 2Y8FA 1Y5OA 3F0WA 1WVHA 2DTCA 2IFSA 3QWMA 3PP2A 4A6HA 1V88A 2YS3A 1ZVRA 3A8QA 2RRFA 5DI9B 2D10A 1WJMA 2DX5A 5C5BA 5FI0A 3FSSA 3TO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0N B;  2RVB B;  1I2H A;  1X86 A;  3P7Z A;  2LOX A;  2M38 A;  4MY6 A;  1P5T A;  4NY0 A;  1TJ6 A;  4HB2 B;  4HDQ A;  3VIA A;  2W2X C;  1M7E A;  3AU5 A;  3AJ4 A;  2IYB A;  5D3W A;  5JHG A;  2P0H A;  1BAK A;  4CHJ A;  2N0Y A;  2K2U A;  5GOW B;  2D9X A;  1MIZ B;  1IRS A;  2OQB A;  4Z2N A;  2Q13 A;  4ZRJ A;  2EMS A;  1XKE A;  2DHI A;  4CHM A;  1MK9 B;  4KHO A;  2CAY A;  3RCP A;  3ULC A;  4HHV A;  3WA0 A;  1RRP B;  5CLL B;  2MFQ A;  1SHC A;  3O96 A;  3SNH A;  1NU2 A;  2R0D A;  2CY5 A;  1TXD A;  5J3Q A;  4WVF B;  1PFJ A;  2NZ8 B;  1W1D A;  1MIX A;  5C6R A;  1DBH A;  3D8E A;  4K17 A;  3X23 A;  2I5F A;  4GXB A;  2GCJ A;  4A6F A;  1B55 A;  1UNP A;  1LB1 A;  2JP2 A;  2LOZ A;  1FAO A;  3PSC A;  1WGQ A;  3FEH A;  5J3T A;  5DHA B;  1GG3 A;  2I5C A;  2Z0O A;  4EJN A;  2XQN M;  4MK0 A;  5C79 A;  1K5G B;  3F5R A;  1V5U A;  3QIJ A;  4CYE A;  5DHF B;  1W1G A;  1H10 A;  1MK7 B;  3A8P A;  1P6S A;  2RLO A;  1UNQ A;  4F7U P;  2ROV A;  1J19 A;  3UZT A;  5D3Y A;  2OTX A;  4A6F B;  2COC A;  2LYD A;  5D27 A;  2CRF A;  1QQG A;  1J0W A;  4PQ0 A;  1OY2 A;  2H7E A;  5JP4 A;  1Q67 A;  3KSY A;  2N23 A;  4F7H A;  5KQ4 A;  3N7C A;  2AL6 A;  3T06 A;  2KGX B;  1DRO A;  2VKI A;  1BWN A;  1WGU A;  1SGH A;  4KVG B;  1U5E A;  4P7I A;  4GMV A;  1P3R A;  2ADZ A;  1U27 A;  2P0D A;  4Y94 A;  1X05 A;  2W2X D;  4HAZ B;  1KI1 B;  1FHO A;  1U29 A;  2Z0P A;  2YVC A;  1ZC3 B;  1DDW A;  3TCA A;  4IOY X;  3PG7 A;  3SV1 A;  1N3H A;  3GYO A;  1WJ1 A;  2HTH B;  3TFM A;  3U7D A;  4YL8 A;  5J3Y A;  2EC1 A;  2DKP A;  1GC7 A;  3SYX A;  3LJU X;  1Z87 A;  3ULB A;  3FM8 C;  4Z2M B;  4HB0 B;  2EJ8 A;  3HW2 B;  4BBK A;  3ZDT A;  4HAU B;  4H8S A;  3PVL A;  2D4Q A;  2I1J A;  3A98 B;  1FHW A;  4GN1 A;  4EMO A;  2YSZ A;  2QKL A;  2E2X A;  1XX0 A;  2RGN B;  1RJ2 A;  3ML4 A;  3NSU A;  2W2W A;  1V5P A;  3ODX A;  1Y19 B;  1KZG A;  1U2B A;  2LKO A;  4HAY B;  4B6H A;  1WG7 A;  2RSG A;  4TYZ A;  2H7D A;  2P8V A;  1NTY A;  1FB8 A;  4KHB B;  1DDM A;  5HE0 A;  2D9Y A;  2DN6 A;  3SO6 A;  5KQ1 A;  1UEF A;  2DHJ A;  2MKR A;  4IFS A;  1MKE A;  3BJI A;  2P0F A;  3VOQ A;  2YS1 A;  3V5W A;  1FOE A;  3SUZ A;  2X18 A;  2YT0 A;  2VSZ A;  1DYN A;  5D3X A;  2UZR A;  5JHH A;  2QKM A;  1V61 A;  1X1F A;  5HE1 A;  2PZ1 A;  1NTV A;  2DYQ A;  1AQC A;  2K2J A;  3DXE A;  3D8D A;  2D9V A;  5C16 A;  5JLJ B;  4A6K A;  3KRW A;  2L1C A;  4A5K A;  3CXB B;  4DX9 0;  2Z0Q A;  1I7A A;  3IVF A;  2K00 A;  4TKN A;  4ZRI A;  1ZC4 B;  3CIK A;  5DH9 B;  2D2Q A;  3HQC A;  2YS5 A;  2ZPY A;  2BCJ A;  2DHK A;  1MAI A;  2COF A;  3G9W A;  1EAZ A;  2AEH A;  2ELA A;  3PVU A;  1M7R A;  1QC6 A;  3QBV B;  2Y7B A;  2GJY A;  3KZ1 A;  5KCV A;  5DIF B;  2D11 A;  2FJL A;  2YRY A;  3OAN A;  1ZM0 A;  2HE7 A;  2M14 A;  1DDV A;  2UVM A;  3DXD A;  3WYF B;  2YF0 A;  5HE2 A;  5FI1 A;  4XWX A;  3KRX A;  1EGX A;  2V76 A;  3PEG A;  1XOD A;  4GZU A;  2DKQ A;  4DX8 A;  5HE3 A;  4GPT B;  2G35 A;  3BIN A;  4IAP A;  1XD4 A;  1MPH A;  1AWE A;  1TQZ A;  4C0A A;  5D3V A;  4K81 A;  1X1G A;  1U5F A;  4F7G A;  2J0J A;  3PVW A;  2J0M A;  4KHA A;  4HB4 B;  1E5W A;  1X11 A;  3DXC A;  2DLW A;  2J59 M;  2DYN A;  4WSF A;  4DBB A;  2RNR B;  2MDX A;  5C5B B;  5LOP B;  4HB3 B;  5L81 A;  1BTK A;  1V89 A;  3MDB C;  1GC6 A;  2KCJ A;  1OMW A;  2J0K A;  1WI1 A;  2LUL A;  2RUK B;  3U8Z A;  1LW3 A;  1NI2 A;  1PMS A;  4HDO A;  4DXA B;  2D9W A;  1K5D B;  1FGZ A;  4HAT B;  4ZRK A;  1UPR A;  2D9Z A;  2UZS A;  1XR0 B;  2LG1 A;  3ODO A;  2GCL A;  2Y8G A;  2GS0 A;  1BTN A;  2YT1 A;  4GMX B;  3ODW A;  1FGY A;  5LON B;  3HK0 A;  3MPX A;  4YON A;  4PNK A;  1OQN A;  2EMT A;  4HAV B;  2DFK A;  2R09 A;  3AU4 A;  4WJ7 A;  4MT7 A;  2NMB A;  2DA0 A;  1XCG A;  2MWN B;  2L2I A;  3P6A A;  3M1I B;  2VRW B;  3PZD A;  4HAX B;  5CLQ B;  1W1H A;  1ZSQ A;  1UNR A;  2I1K A;  1FHX A;  4K2O A;  3ZVR A;  4KAX B;  4HAW B;  1H4R A;  1U5G A;  4K2P A;  1EF1 A;  1PLS A;  5EFX A;  3TVV A;  2KUP A;  1KZ7 A;  1U5D A;  1ISN A;  3KY9 A;  2CY4 A;  1EVH A;  2ROZ B;  4L6E A;  2DX1 A;  2ELB A;  1UPQ A;  3D8F A;  3TW1 A;  3GYP A;  2COD A;  4EKU A;  4NSW A;  1V5M A;  2COA A;  2Y8F A;  1Y5O A;  3F0W A;  1WVH A;  2DTC A;  2IFS A;  3QWM A;  3PP2 A;  4A6H A;  1V88 A;  2YS3 A;  1ZVR A;  3A8Q A;  5DI9 B;  2D10 A;  1WJM A;  2DX5 A;  5C5B A;  5FI0 A;  3FSS A;  3TO1 A; 
#chains in the Genus database with same CATH topology
 4D0N B;  2RVB B;  1I2H A;  1X86 A;  3P7Z A;  2LOX A;  2M38 A;  4MY6 A;  1P5T A;  4NY0 A;  1TJ6 A;  4HB2 B;  4HDQ A;  3VIA A;  2W2X C;  1M7E A;  3AU5 A;  3AJ4 A;  2IYB A;  5D3W A;  5JHG A;  2P0H A;  1BAK A;  4CHJ A;  2N0Y A;  2K2U A;  5GOW B;  2D9X A;  1MIZ B;  1IRS A;  2OQB A;  4Z2N A;  2Q13 A;  4ZRJ A;  2EMS A;  1XKE A;  2DHI A;  4CHM A;  1MK9 B;  4KHO A;  2CAY A;  3RCP A;  3ULC A;  4HHV A;  3WA0 A;  1RRP B;  5CLL B;  2MFQ A;  1SHC A;  3O96 A;  3SNH A;  1NU2 A;  2R0D A;  2CY5 A;  1T77 A;  1TXD A;  5J3Q A;  4WVF B;  1PFJ A;  2NZ8 B;  1W1D A;  1MIX A;  5C6R A;  1DBH A;  3D8E A;  4K17 A;  3X23 A;  2I5F A;  4GXB A;  2GCJ A;  4A6F A;  1B55 A;  1UNP A;  1LB1 A;  2JP2 A;  2LOZ A;  1FAO A;  3PSC A;  1WGQ A;  3FEH A;  5J3T A;  5DHA B;  1GG3 A;  2I5C A;  2Z0O A;  4EJN A;  2XQN M;  4MK0 A;  5C79 A;  1K5G B;  3F5R A;  5IRS A;  1V5U A;  3QIJ A;  4CYE A;  5DHF B;  1W1G A;  1H10 A;  1MK7 B;  3A8P A;  1P6S A;  4DIX A;  2RLO A;  1UNQ A;  4F7U P;  2ROV A;  1J19 A;  3UZT A;  5D3Y A;  2OTX A;  4A6F B;  2COC A;  2LYD A;  5D27 A;  2CRF A;  1QQG A;  1J0W A;  4PQ0 A;  1OY2 A;  2H7E A;  5JP4 A;  2YT2 A;  1Q67 A;  3KSY A;  2N23 A;  4F7H A;  5KQ4 A;  3N7C A;  2AL6 A;  3DCX A;  3T06 A;  2KGX B;  1DRO A;  4CSQ A;  2VKI A;  1BWN A;  1WGU A;  1SGH A;  4KVG B;  1U5E A;  4P7I A;  5I2M A;  4QJ4 B;  4GMV A;  1P3R A;  2ADZ A;  1U27 A;  2P0D A;  2Z59 A;  4Y94 A;  1X05 A;  2W2X D;  4HAZ B;  1KI1 B;  1FHO A;  3FVC A;  1U29 A;  2Z0P A;  2YVC A;  1ZC3 B;  1DDW A;  3TCA A;  4IOY X;  3PG7 A;  3SV1 A;  1N3H A;  3GYO A;  1WJ1 A;  2HTH B;  3TFM A;  3U7D A;  4YL8 A;  5J3Y A;  2EC1 A;  2ZKM X;  2DKP A;  1GC7 A;  3SYX A;  3LJU X;  2Z13 A;  1Z87 A;  3ULB A;  3FM8 C;  4Z2M B;  4HB0 B;  2EJ8 A;  3HW2 B;  4BBK A;  3ZDT A;  4HAU B;  4H8S A;  2KIE A;  3PVL A;  2D4Q A;  2I1J A;  3A98 B;  1FHW A;  4GN1 A;  4EMO A;  2YSZ A;  2QKL A;  2E2X A;  1XX0 A;  2RGN B;  1RJ2 A;  3ML4 A;  3NSU A;  2W2W A;  1V5P A;  3ODX A;  1Y19 B;  1KZG A;  1U2B A;  2R2Y A;  2LKO A;  2K49 A;  2GUM A;  4HAY B;  4B6H A;  1WG7 A;  2RSG A;  4TYZ A;  2H7D A;  2P8V A;  1NTY A;  1FB8 A;  4KHB B;  1DDM A;  5HE0 A;  2D9Y A;  2DN6 A;  3SO6 A;  5KQ1 A;  1UEF A;  2DHJ A;  2MKR A;  4IFS A;  4QJ5 B;  1MKE A;  3B77 A;  4OSN A;  3BJI A;  2P0F A;  4HSI A;  3VOQ A;  2YS1 A;  3V5W A;  1FOE A;  3SUZ A;  2X18 A;  2YT0 A;  2VSZ A;  1DYN A;  5D3X A;  2UZR A;  5JHH A;  2QKM A;  3A58 A;  4D6W A;  1V61 A;  4GNK B;  1X1F A;  5HE1 A;  2PZ1 A;  5LG4 B;  1NTV A;  2DYQ A;  1AQC A;  2K2J A;  3DXE A;  3D8D A;  2D9V A;  5C16 A;  5JLJ B;  4A6K A;  3KRW A;  2L1C A;  4A5K A;  3CXB B;  4DX9 0;  2Z0Q A;  1I7A A;  3IVF A;  2K00 A;  3NWA A;  4TKN A;  4ZRI A;  1ZC4 B;  3CIK A;  5DH9 B;  2D2Q A;  3HQC A;  2YS5 A;  2ZPY A;  2BCJ A;  2K8E A;  2DHK A;  1MAI A;  2COF A;  3G9W A;  1EAZ A;  2AEH A;  2ELA A;  3PVU A;  1M7R A;  2KR0 A;  1QC6 A;  3QBV B;  2Y7B A;  3HIE A;  2GJY A;  3KZ1 A;  5KCV A;  5DIF B;  2D11 A;  2FJL A;  2YRY A;  3OAN A;  1ZM0 A;  2HE7 A;  2M14 A;  1DDV A;  2UVM A;  3DXD A;  3WYF B;  2YF0 A;  5HE2 A;  5FI1 A;  4XWX A;  3KRX A;  2Z14 A;  1EGX A;  2V76 A;  3PEG A;  4GOU A;  1XOD A;  4GZU A;  2DKQ A;  4DX8 A;  5HE3 A;  4GPT B;  2G35 A;  3BIN A;  4IAP A;  4L1R A;  2KIG A;  1XD4 A;  1MPH A;  1AWE A;  1TQZ A;  4C0A A;  5D3V A;  4K81 A;  1X1G A;  1U5F A;  4F7G A;  1ZYI A;  2J0J A;  3PVW A;  4KHB A;  2J0M A;  4KHA A;  3NW8 A;  4HB4 B;  1E5W A;  1X11 A;  4QJ3 B;  3DXC A;  2DLW A;  2J59 M;  2DYN A;  5I2S A;  4WSF A;  4DBB A;  2RNR B;  2MDX A;  5C5B B;  5LOP B;  4HB3 B;  5L81 A;  1BTK A;  1V89 A;  3MDB C;  1GC6 A;  2KCJ A;  1OMW A;  2J0K A;  1WI1 A;  2LUL A;  2RUK B;  3U8Z A;  1LW3 A;  1NI2 A;  1PMS A;  4HDO A;  4DXA B;  2D9W A;  1K5D B;  1FGZ A;  4HAT B;  2KUQ A;  3OHM B;  4ZRK A;  1UPR A;  2D9Z A;  2UZS A;  1XR0 B;  2LG1 A;  3ODO A;  2GCL A;  3NWF A;  2Y8G A;  2GS0 A;  1BTN A;  2YT1 A;  4GMX B;  4OT1 A;  2Z4D A;  3ODW A;  1FGY A;  5LON B;  3HK0 A;  3MPX A;  4YON A;  4PNK A;  3NWD A;  1OQN A;  2EMT A;  4QXA B;  4HAV B;  2DFK A;  2R09 A;  3AU4 A;  4WJ7 A;  4MT7 A;  2NMB A;  2DA0 A;  2FJU B;  1XCG A;  2MWN B;  2L2I A;  3P6A A;  3M1I B;  2VRW B;  3PZD A;  4HAX B;  5CLQ B;  1W1H A;  3U12 A;  1ZSQ A;  1UNR A;  2I1K A;  1FHX A;  1MI1 A;  4K2O A;  3ZVR A;  4KAX B;  4HAW B;  1H4R A;  1U5G A;  4K2P A;  2NBV A;  1EF1 A;  1PLS A;  5EFX A;  3TVV A;  2KUP A;  1KZ7 A;  1U5D A;  1ISN A;  3KY9 A;  2CY4 A;  1EVH A;  2ROZ B;  4L6E A;  2DX1 A;  3HSA A;  2ELB A;  1UPQ A;  5M4Y B;  3D8F A;  3TW1 A;  3GYP A;  2COD A;  4EKU A;  4NSW A;  1V5M A;  2COA A;  2Y8F A;  1Y5O A;  3F0W A;  1WVH A;  2DTC A;  2IFS A;  3QWM A;  3PP2 A;  4A6H A;  1V88 A;  2YS3 A;  1ZVR A;  3A8Q A;  2RRF A;  5DI9 B;  2D10 A;  1WJM A;  2DX5 A;  5C5B A;  5FI0 A;  3FSS A;  3TO1 A; 
#chains in the Genus database with same CATH homology
 4D0N B;  2RVB B;  1I2H A;  1X86 A;  3P7Z A;  2LOX A;  2M38 A;  4MY6 A;  1P5T A;  4NY0 A;  1TJ6 A;  4HB2 B;  4HDQ A;  3VIA A;  2W2X C;  1M7E A;  3AU5 A;  3AJ4 A;  2IYB A;  5D3W A;  5JHG A;  2P0H A;  1BAK A;  4CHJ A;  2N0Y A;  2K2U A;  5GOW B;  2D9X A;  1MIZ B;  1IRS A;  2OQB A;  4Z2N A;  2Q13 A;  4ZRJ A;  2EMS A;  1XKE A;  2DHI A;  4CHM A;  1MK9 B;  4KHO A;  2CAY A;  3RCP A;  3ULC A;  4HHV A;  3WA0 A;  1RRP B;  5CLL B;  2MFQ A;  1SHC A;  3O96 A;  3SNH A;  1NU2 A;  2R0D A;  2CY5 A;  1TXD A;  5J3Q A;  4WVF B;  1PFJ A;  2NZ8 B;  1W1D A;  1MIX A;  5C6R A;  1DBH A;  3D8E A;  4K17 A;  3X23 A;  2I5F A;  4GXB A;  2GCJ A;  4A6F A;  1B55 A;  1UNP A;  1LB1 A;  2JP2 A;  2LOZ A;  1FAO A;  3PSC A;  1WGQ A;  3FEH A;  5J3T A;  5DHA B;  1GG3 A;  2I5C A;  2Z0O A;  4EJN A;  2XQN M;  4MK0 A;  5C79 A;  1K5G B;  3F5R A;  5IRS A;  1V5U A;  3QIJ A;  4CYE A;  5DHF B;  1W1G A;  1H10 A;  1MK7 B;  3A8P A;  1P6S A;  4DIX A;  2RLO A;  1UNQ A;  4F7U P;  2ROV A;  1J19 A;  3UZT A;  5D3Y A;  2OTX A;  4A6F B;  2COC A;  2LYD A;  5D27 A;  2CRF A;  1QQG A;  1J0W A;  4PQ0 A;  1OY2 A;  2H7E A;  5JP4 A;  2YT2 A;  1Q67 A;  3KSY A;  2N23 A;  4F7H A;  5KQ4 A;  3N7C A;  2AL6 A;  3T06 A;  2KGX B;  1DRO A;  4CSQ A;  2VKI A;  1BWN A;  1WGU A;  1SGH A;  4KVG B;  1U5E A;  4P7I A;  5I2M A;  4QJ4 B;  4GMV A;  1P3R A;  2ADZ A;  1U27 A;  2P0D A;  2Z59 A;  4Y94 A;  1X05 A;  2W2X D;  4HAZ B;  1KI1 B;  1FHO A;  3FVC A;  1U29 A;  2Z0P A;  2YVC A;  1ZC3 B;  1DDW A;  3TCA A;  4IOY X;  3PG7 A;  3SV1 A;  1N3H A;  3GYO A;  1WJ1 A;  2HTH B;  3TFM A;  3U7D A;  4YL8 A;  5J3Y A;  2EC1 A;  2ZKM X;  2DKP A;  1GC7 A;  3SYX A;  3LJU X;  2Z13 A;  1Z87 A;  3ULB A;  3FM8 C;  4Z2M B;  4HB0 B;  2EJ8 A;  3HW2 B;  4BBK A;  3ZDT A;  4HAU B;  4H8S A;  2KIE A;  3PVL A;  2D4Q A;  2I1J A;  3A98 B;  1FHW A;  4GN1 A;  4EMO A;  2YSZ A;  2QKL A;  2E2X A;  1XX0 A;  2RGN B;  1RJ2 A;  3ML4 A;  3NSU A;  2W2W A;  1V5P A;  3ODX A;  1Y19 B;  1KZG A;  1U2B A;  2R2Y A;  2LKO A;  2K49 A;  2GUM A;  4HAY B;  4B6H A;  1WG7 A;  2RSG A;  4TYZ A;  2H7D A;  2P8V A;  1NTY A;  1FB8 A;  4KHB B;  1DDM A;  5HE0 A;  2D9Y A;  2DN6 A;  3SO6 A;  5KQ1 A;  1UEF A;  2DHJ A;  2MKR A;  4IFS A;  4QJ5 B;  1MKE A;  4OSN A;  3BJI A;  2P0F A;  4HSI A;  3VOQ A;  2YS1 A;  3V5W A;  1FOE A;  3SUZ A;  2X18 A;  2YT0 A;  2VSZ A;  1DYN A;  5D3X A;  2UZR A;  5JHH A;  2QKM A;  3A58 A;  4D6W A;  1V61 A;  4GNK B;  1X1F A;  5HE1 A;  2PZ1 A;  5LG4 B;  1NTV A;  2DYQ A;  1AQC A;  2K2J A;  3DXE A;  3D8D A;  2D9V A;  5C16 A;  5JLJ B;  4A6K A;  3KRW A;  2L1C A;  4A5K A;  3CXB B;  4DX9 0;  2Z0Q A;  1I7A A;  3IVF A;  2K00 A;  4TKN A;  4ZRI A;  3NWA A;  1ZC4 B;  3CIK A;  5DH9 B;  2D2Q A;  3HQC A;  2YS5 A;  2ZPY A;  2BCJ A;  2K8E A;  2DHK A;  1MAI A;  2COF A;  3G9W A;  1EAZ A;  2AEH A;  2ELA A;  3PVU A;  1M7R A;  2KR0 A;  1QC6 A;  3QBV B;  2Y7B A;  3HIE A;  2GJY A;  3KZ1 A;  5KCV A;  5DIF B;  2D11 A;  2FJL A;  2YRY A;  3OAN A;  1ZM0 A;  2HE7 A;  2M14 A;  1DDV A;  2UVM A;  3DXD A;  3WYF B;  2YF0 A;  5HE2 A;  5FI1 A;  4XWX A;  3KRX A;  2Z14 A;  1EGX A;  2V76 A;  3PEG A;  4GOU A;  1XOD A;  4GZU A;  2DKQ A;  4DX8 A;  5HE3 A;  4GPT B;  2G35 A;  3BIN A;  4IAP A;  4L1R A;  2KIG A;  1XD4 A;  1MPH A;  1AWE A;  1TQZ A;  4C0A A;  5D3V A;  4K81 A;  1X1G A;  1U5F A;  4F7G A;  1ZYI A;  2J0J A;  3PVW A;  4KHB A;  2J0M A;  4KHA A;  3NW8 A;  4HB4 B;  1E5W A;  1X11 A;  4QJ3 B;  3DXC A;  2DLW A;  2J59 M;  2DYN A;  5I2S A;  4WSF A;  4DBB A;  2RNR B;  2MDX A;  5C5B B;  5LOP B;  4HB3 B;  5L81 A;  1BTK A;  1V89 A;  3MDB C;  1GC6 A;  2KCJ A;  1OMW A;  2J0K A;  1WI1 A;  2LUL A;  2RUK B;  3U8Z A;  1LW3 A;  1NI2 A;  1PMS A;  4HDO A;  4DXA B;  2D9W A;  1K5D B;  1FGZ A;  4HAT B;  2KUQ A;  3OHM B;  4ZRK A;  1UPR A;  2D9Z A;  2UZS A;  1XR0 B;  2LG1 A;  3ODO A;  2GCL A;  3NWF A;  2Y8G A;  2GS0 A;  1BTN A;  2YT1 A;  4GMX B;  4OT1 A;  3ODW A;  2Z4D A;  1FGY A;  5LON B;  3HK0 A;  3MPX A;  4YON A;  4PNK A;  3NWD A;  1OQN A;  2EMT A;  4QXA B;  4HAV B;  2DFK A;  2R09 A;  3AU4 A;  4WJ7 A;  4MT7 A;  2NMB A;  2DA0 A;  2FJU B;  1XCG A;  2MWN B;  2L2I A;  3P6A A;  3M1I B;  2VRW B;  3PZD A;  4HAX B;  5CLQ B;  1W1H A;  3U12 A;  1ZSQ A;  1UNR A;  2I1K A;  1FHX A;  4K2O A;  3ZVR A;  4KAX B;  4HAW B;  1H4R A;  1U5G A;  4K2P A;  2NBV A;  1EF1 A;  1PLS A;  5EFX A;  3TVV A;  2KUP A;  1KZ7 A;  1U5D A;  1ISN A;  3KY9 A;  2CY4 A;  1EVH A;  2ROZ B;  4L6E A;  2DX1 A;  2ELB A;  1UPQ A;  5M4Y B;  3D8F A;  3TW1 A;  3GYP A;  2COD A;  4EKU A;  4NSW A;  1V5M A;  2COA A;  2Y8F A;  1Y5O A;  3F0W A;  1WVH A;  2DTC A;  2IFS A;  3QWM A;  3PP2 A;  4A6H A;  1V88 A;  2YS3 A;  1ZVR A;  3A8Q A;  2RRF A;  5DI9 B;  2D10 A;  1WJM A;  2DX5 A;  5C5B A;  5FI0 A;  3FSS A;  3TO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...