4KHPD

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 64
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4khpD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4khpD02
4X64D 4X66D 2UXBD 4LF6D 1HNZD 2UUAD 1C06A 4JI5D 1H3EA 1C05A 2UUBD 2ZM6D 4LF5D 4B3RD 4DV2D 4DR2D 4YHHD 4DV0D 4DV7D 4JI8D 4JI7D 5IWAD 4DV6D 4LF4D 5BR8D 1P9KA 4KHPD 4LGTA 1HNXD 1I94D 4LFCD 1XMOD 1IBKD 4NXND 4YY3D 4B3TD 4DV5D 2K6PA 4K0KD 4LF7D 4DR6D 4DV3D 2VQED 3T1HD 2UXCD 4JI4D 1IBMD 4DR4D 4DR5D 2VQFD 4LF8D 1N36D 2JANA 1XNQD 1JH3A 1KSLA 4X65D 1XMQD 4LFAD 1HR0D 4JYAD 4JI3D 1FKAD 3T1YD 4JI0D 1N34D 2E5LD 1KSKA 4GKKD 3HP7A 4DUYD 4OX9D 4AQYD 1VIOA 4X62D 2KTLA 2HHHD 2UXDD 4DV4D 5LMUD 4OUDA 4LF9D 4DUZD 4GKJD 2UU9D 2F4VD 1N32D 2ISTA 4JI2D 4LFBD 4JV5D 4DR1D 5LMND 3KBGA 1HNWD 3DH3A 1KSVA 4B3MD 3OTOD 1DM9A 1XNRD 4JI1D 1FJGD 4DR3D 1J5ED 4B3SD 4JI6D 4NXMD 1H3FA 1N33D 2UUCD 4DR7D 4DV1D 1IBLD
chains in the Genus database with same CATH superfamily
1Y8QB 4X64D 4X66D 2UXBD 4LF6D 1HNZD 2UUAD 1C06A 4JI5D 1H3EA 1C05A 2UUBD 3J81E 2LQ7A 2ZM6D 4LF5D 5LL6S 5FLXE 4B3RD 4DV2D 4DR2D 4YHHD 4DV0D 4DV7D 4JI8D 4JI7D 5IWAD 4DV6D 4LF4D 5BR8D 1P9KA 4KHPD 3FN1A 4LGTA 1HNXD 1I94D 3JAME 5FQ2B 4LFCD 1XMOD 1IBKD 3CMMA 4NXND 4YY3D 4B3TD 4DV5D 2K6PA 2NVUB 4K0KD 4LF7D 4DR6D 4DV3D 2VQED 3T1HD 2UXCD 4JI4D 1IBMD 4DR4D 4DR5D 2VQFD 4LF8D 1N36D 2JANA 1XNQD 1JH3A 1KSLA 3KYDB 4X65D 1XMQD 4LFAD 1HR0D 4JYAD 4JI3D 1FKAD 3T1YD 5KNLA 3J80E 4JI0D 1N34D 2E5LD 1KSKA 4GKKD 3HP7A 4DUYD 4OX9D 5IT9E 4NNJA 4AQYD 2ZTBA 1VIOA 2L3NA 4X62D 2KTLA 2HHHD 3KYCB 2UXDD 4DV4D 4W5VB 5LMUD 4II2A 4OUDA 4LF9D 4DUZD 4GKJD 2UU9D 2F4VD 1N32D 2ISTA 4JI2D 4LFBD 4JV5D 4DR1D 1Y8RB 5LMND 3KBGA 1HNWD 3DH3A 1KSVA 4B3MD 2I1SA 3OTOD 1DM9A 1XNRD 3ONHA 5A2QE 4JI1D 1FJGD 4DR3D 1J5ED 4B3SD 4JI6D 4NXMD 3ONGA 1H3FA 3J7AF 1Y8XB 1N33D 2UUCD 4DR7D 4DV1D 1IBLD 4II3A
chains in the Genus database with same CATH topology
4X64D 4X66D 2UXBD 4LF6D 1HNZD 2UUAD 1C06A 4JI5D 1H3EA 1C05A 2UUBD 2ZM6D 4LF5D 4B3RD 4DV2D 4DR2D 4YHHD 4DV0D 4DV7D 4JI8D 4JI7D 5IWAD 4DV6D 4LF4D 5BR8D 1P9KA 4KHPD 4LGTA 1HNXD 1I94D 4LFCD 1XMOD 1IBKD 4NXND 4YY3D 4B3TD 4DV5D 2K6PA 4K0KD 4LF7D 4DR6D 4DV3D 2VQED 3T1HD 2UXCD 4JI4D 1IBMD 4DR4D 4DR5D 2VQFD 4LF8D 1N36D 2JANA 1XNQD 1JH3A 1KSLA 4X65D 1XMQD 4LFAD 1HR0D 4JYAD 4JI3D 1FKAD 3T1YD 4JI0D 1N34D 2E5LD 1KSKA 4GKKD 3HP7A 4DUYD 4OX9D 4AQYD 1VIOA 2L3NA 4X62D 2KTLA 2HHHD 2UXDD 4DV4D 5LMUD 4OUDA 4LF9D 4DUZD 4GKJD 2UU9D 2F4VD 1N32D 2ISTA 4JI2D 4LFBD 4JV5D 4DR1D 5LMND 3KBGA 1HNWD 3DH3A 1KSVA 4B3MD 3OTOD 1DM9A 1XNRD 4JI1D 1FJGD 4DR3D 1J5ED 4B3SD 4JI6D 4NXMD 1H3FA 1N33D 2UUCD 4DR7D 4DV1D 1IBLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 D;  4X66 D;  2UXB D;  4LF6 D;  1HNZ D;  2UUA D;  1C06 A;  4JI5 D;  1H3E A;  1C05 A;  2UUB D;  2ZM6 D;  4LF5 D;  4B3R D;  4DV2 D;  4DR2 D;  4YHH D;  4DV0 D;  4DV7 D;  4JI8 D;  4JI7 D;  5IWA D;  4DV6 D;  4LF4 D;  5BR8 D;  1P9K A;  4KHP D;  4LGT A;  1HNX D;  1I94 D;  4LFC D;  1XMO D;  1IBK D;  4NXN D;  4YY3 D;  4B3T D;  4DV5 D;  2K6P A;  4K0K D;  4LF7 D;  4DR6 D;  4DV3 D;  2VQE D;  3T1H D;  2UXC D;  4JI4 D;  1IBM D;  4DR4 D;  4DR5 D;  2VQF D;  4LF8 D;  1N36 D;  2JAN A;  1XNQ D;  1JH3 A;  1KSL A;  4X65 D;  1XMQ D;  4LFA D;  1HR0 D;  4JYA D;  4JI3 D;  1FKA D;  3T1Y D;  4JI0 D;  1N34 D;  2E5L D;  1KSK A;  4GKK D;  3HP7 A;  4DUY D;  4OX9 D;  4AQY D;  1VIO A;  4X62 D;  2KTL A;  2HHH D;  2UXD D;  4DV4 D;  5LMU D;  4OUD A;  4LF9 D;  4DUZ D;  4GKJ D;  2UU9 D;  2F4V D;  1N32 D;  2IST A;  4JI2 D;  4LFB D;  4JV5 D;  4DR1 D;  5LMN D;  3KBG A;  1HNW D;  3DH3 A;  1KSV A;  4B3M D;  3OTO D;  1DM9 A;  1XNR D;  4JI1 D;  1FJG D;  4DR3 D;  1J5E D;  4B3S D;  4JI6 D;  4NXM D;  1H3F A;  1N33 D;  2UUC D;  4DR7 D;  4DV1 D;  1IBL D; 
#chains in the Genus database with same CATH topology
 1Y8Q B;  4X64 D;  4X66 D;  2UXB D;  4LF6 D;  1HNZ D;  2UUA D;  1C06 A;  4JI5 D;  1H3E A;  1C05 A;  2UUB D;  3J81 E;  2LQ7 A;  2ZM6 D;  4LF5 D;  5LL6 S;  5FLX E;  4B3R D;  4DV2 D;  4DR2 D;  4YHH D;  4DV0 D;  4DV7 D;  4JI8 D;  4JI7 D;  5IWA D;  4DV6 D;  4LF4 D;  5BR8 D;  1P9K A;  4KHP D;  3FN1 A;  4LGT A;  1HNX D;  1I94 D;  3JAM E;  5FQ2 B;  4LFC D;  1XMO D;  1IBK D;  3CMM A;  4NXN D;  4YY3 D;  4B3T D;  4DV5 D;  2K6P A;  2NVU B;  4K0K D;  4LF7 D;  4DR6 D;  4DV3 D;  2VQE D;  3T1H D;  2UXC D;  4JI4 D;  1IBM D;  4DR4 D;  4DR5 D;  2VQF D;  4LF8 D;  1N36 D;  2JAN A;  1XNQ D;  1JH3 A;  1KSL A;  3KYD B;  4X65 D;  1XMQ D;  4LFA D;  1HR0 D;  4JYA D;  4JI3 D;  1FKA D;  3T1Y D;  5KNL A;  3J80 E;  4JI0 D;  1N34 D;  2E5L D;  1KSK A;  4GKK D;  3HP7 A;  4DUY D;  4OX9 D;  5IT9 E;  4NNJ A;  4AQY D;  2ZTB A;  1VIO A;  2L3N A;  4X62 D;  2KTL A;  2HHH D;  3KYC B;  2UXD D;  4DV4 D;  4W5V B;  5LMU D;  4II2 A;  4OUD A;  4LF9 D;  4DUZ D;  4GKJ D;  2UU9 D;  2F4V D;  1N32 D;  2IST A;  4JI2 D;  4LFB D;  4JV5 D;  4DR1 D;  1Y8R B;  5LMN D;  3KBG A;  1HNW D;  3DH3 A;  1KSV A;  4B3M D;  2I1S A;  3OTO D;  1DM9 A;  1XNR D;  3ONH A;  5A2Q E;  4JI1 D;  1FJG D;  4DR3 D;  1J5E D;  4B3S D;  4JI6 D;  4NXM D;  3ONG A;  1H3F A;  3J7A F;  1Y8X B;  1N33 D;  2UUC D;  4DR7 D;  4DV1 D;  1IBL D;  4II3 A; 
#chains in the Genus database with same CATH homology
 4X64 D;  4X66 D;  2UXB D;  4LF6 D;  1HNZ D;  2UUA D;  1C06 A;  4JI5 D;  1H3E A;  1C05 A;  2UUB D;  2ZM6 D;  4LF5 D;  4B3R D;  4DV2 D;  4DR2 D;  4YHH D;  4DV0 D;  4DV7 D;  4JI8 D;  4JI7 D;  5IWA D;  4DV6 D;  4LF4 D;  5BR8 D;  1P9K A;  4KHP D;  4LGT A;  1HNX D;  1I94 D;  4LFC D;  1XMO D;  1IBK D;  4NXN D;  4YY3 D;  4B3T D;  4DV5 D;  2K6P A;  4K0K D;  4LF7 D;  4DR6 D;  4DV3 D;  2VQE D;  3T1H D;  2UXC D;  4JI4 D;  1IBM D;  4DR4 D;  4DR5 D;  2VQF D;  4LF8 D;  1N36 D;  2JAN A;  1XNQ D;  1JH3 A;  1KSL A;  4X65 D;  1XMQ D;  4LFA D;  1HR0 D;  4JYA D;  4JI3 D;  1FKA D;  3T1Y D;  4JI0 D;  1N34 D;  2E5L D;  1KSK A;  4GKK D;  3HP7 A;  4DUY D;  4OX9 D;  4AQY D;  1VIO A;  2L3N A;  4X62 D;  2KTL A;  2HHH D;  2UXD D;  4DV4 D;  5LMU D;  4OUD A;  4LF9 D;  4DUZ D;  4GKJ D;  2UU9 D;  2F4V D;  1N32 D;  2IST A;  4JI2 D;  4LFB D;  4JV5 D;  4DR1 D;  5LMN D;  3KBG A;  1HNW D;  3DH3 A;  1KSV A;  4B3M D;  3OTO D;  1DM9 A;  1XNR D;  4JI1 D;  1FJG D;  4DR3 D;  1J5E D;  4B3S D;  4JI6 D;  4NXM D;  1H3F A;  1N33 D;  2UUC D;  4DR7 D;  4DV1 D;  1IBL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...