4KHVA

Crystal structure of staphylococcal nuclease variant delta+phs v23s at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTSKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23S at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khvA00
1A2UA 2F0HA 3OSOA 2KQ3A 1A2TA 3MXPA 5KIXA 3BDLA 3OMCA 1KDBA 1U9RA 5J39A 3MZ5A 5CV8A 3C1FA 2F0IA 2WACA 2F0EA 5J22A 2EYFA 3HEJA 3QOLA 1ENAA 5KEEA 4LAAA 2EYMA 2F0PA 3HZXA 4IZ8A 4RKBA 1EZ6A 5C5MA 5DEHA 3SK6A 5HURA 3LX0A 4NMZA 2PYKA 4QMGA 5EKLA 3NK9A 1SYBA 2PZUA 4B9WA 1STAA 3SXHA 4YIJA 2LKVA 4HMIA 1KDAA 3P1HA 4PMCA 4ZQ3A 1EY7A 5IOCA 3BDCA 1SNQA 1EQVA 1JOKA 2QDBA 4ZUJA 3TP8A 5C3WA 2EXZA 4ID6A 5ISRA 1F2YA 1II3A 5JOBA 5KYIA 2F0JA 3D8GA 2F0UA 3E5SA 1EYAA 1ENCA 4KTAA 1STBA 4ME5A 4KJNA 4ODGA 2HQEA 5I6WA 4TRDA 3SR1A 5IGDA 4K5WA 2F3VA 2EY6A 2F0TA 1TR5A 2M00A 1F2ZA 3ERQA 4NKLA 1JORA 3MVVA 5NUCA 2EYOA 2OXPA 3D4WA 4E6IA 5CC4A 4G57A 5IODA 2F0LA 3NQTA 3OWFA 3T16A 4NP5A 1KABA 4K2KA 1KDCA 5C4ZA 5I9PA 4KY5A 2EY5A 1SNCA 1EY5A 1EY4A 2F0MA 4K14A 3SK4A 1TQOA 5I9OA 3NXWA 4MIUA 2F0QA 2SNSA 4K5VA 5C4HA 1STYA 1STNA 2F0VA 5KRUA 5DAUA 2F0GA 4B9XA 4PNYA 3TP6A 1A3TA 4KY6A 1EYDA 2F0KA 3SHLA 3C1EA 1IHZA 1KAAA 4S3SA 2ENBA 1SYGA 5CV5A 2EYHA 5KGUA 5C5LA 1F2MA 3MHBA 1NSNS 5F2DA 3QB3A 4R8NA 5JAVA 1SYEA 1SYCA 1SNDA 3EROA 3S9WA 1EY6A 4KD3A 5E3FA 5CGKA 1SYDA 4DF7A 2PW5A 1JOOA 2KHSA 3EJIA 3P75A 2F0DA 4EQPA 5CR3A 1RKNA 4QF4A 5EKKA 5IGFA 2RKSA 1SYFA 3U9OA 2EYJA 4EVOA 2PW7A 2RBMA 3NHHA 4EQOA 4IUNA 1SNMA 4WORA 5C3XA 5IGCA 5HGTA 2EY2A 3NUCA 3SK8A 5I6YA 1A3VA 2F0WA 5J1ZA 4EQNA 4HMJA 5K5PA 3PMFA 5IGEA 3QOJA 2F3WA 5E1FA 1TT2A 1NUCA 3D6CA 4DU9A 1A3UA 2EY1A 4QB4A 5IGBA 1AEXA 1EY8A 2SOBA 4OL7A 1STHA 4DFAA 4ZUIA 5C6AA 1JOQA 4K8IA 4I65A 4J1MA 4N9PA 2F0FA 4KY7A 5KYLA 2PZWA 2EYLA 1EY9A 4K8JA 5CV9A 4IALA 3ITPA 3OMGA 3RUZA 2RDFA 2OEOA 4DGZA 2EYPA 2NUCA 2O4XA 2SNMA 2F0NA 3EVQA 4J6HA 4K2LA 4WRDA 5CV4A 3MEHA 3SK5A 4F8MA 3V2TA 5M9OA 3TMEA 1EY0A 4KJOA 1SNPA 3R3OA 4K5XA 3DMUA 5CV7A 3TP5A 4PMBA 2F0OA 4HTHA 3H6MA 4KD4A 3D4DA 5EGTA 4KHVA 1EYCA 4H7BA 2PZTA 5CV6A 2PQEA 4K6DA 1EZ8A 2OF1A 3NP8A 4KV6A 4NDXA 1SNOA 3T13A 3TP7A 5IGGA 1STGA 5IIFA 3VA5A 4F7XA 2F0SA 4N9TA 4RKLA 3DHQA
chains in the Genus database with same CATH superfamily
1SEBD 1DYQA 3MXPA 3KDFB 2JA6B 3GTOB 1EIFA 3K5NA 2WACA 2F0EA 4XQQA 5GAGC 3KUPA 1NTGA 2DJFC 2PQAA 4KN7C 4DR3Q 4RKBA 2JA7B 1AH9A 3VA7A 3I4MH 1H9KA 3KF8B 3Q22A 2SDFA 1C4QA 2NVQH 2D2CC 1A0IA 1PA6A 1HFGA 4QMGA 1TU2B 2OTJA 2R92H 2E2HB 4G7OC 1ET6A 2KECA 4X65L 2KBNA 2ZJRA 4A93H 2DJGC 2QEJC 1K28A 1PXUA 4A3EB 1B50A 4KTAA 1EEFD 1ZYRD 2H5XA 2D0PA 4PZ7A 5C0XJ 3H09A 4JI1Q 2HCIA 5IGDA 1PYBA 2A6ED 3LWUA 3NE5B 5D3IB 3C3LA 5CC4A 1HTPA 2E76C 1SE4A 2VL6A 2KVMA 1XNRL 4K2KA 2L5TA 4A3CG 1KQSA 3G48A 3J81c 4DV2Q 1VQ7A 4A3DH 5TSSA 3TBIB 1TWGH 2PNHA 3KLSA 1JWSD 5FLXc 5M5YB 2PNRC 2WINB 3QWNA 1UWVA 3T1HQ 4ABNA 1N9WA 4BBSG 2Z6KA 3Q0AA 2FHTA 3H0GB 4V0BA 4IFDG 2D5DA 1WCMB 2B2YC 4A3BG 1R4PB 1O7IA 3BJUA 4UY8C 4LF6Q 2PW5A 4RHSA 4Y7NH 4OHJA 2UUBQ 1HZ9A 1DM0B 4WORA 1PRTD 3SK8A 2FMMA 1R9TB 2JA9A 4CDFC 1HNWL 2UUCL 1CKOA 1VQGA 4APVA 2IHFA 3NPPA 4OL7A 3JAMi 3I2ZA 1NE3A 3VR4A 4N9PA 1K8AC 3CRLC 1AFPA 3K0YA 3R93A 4KKSA 1GJXA 3HOZB 2VQEL 1V8QA 3HP3A 4XYOA 4IUUA 1W6KA 4GLVB 3S15B 3TMEA 1K83H 4DAPA 1ESRA 3DMUA 1EWCA 4J8QA 5ELFA 3RNUA 4OEMB 1U0LA 1G91A 1L1OC 2WAQG 3M9BA 2Q8IB 1Y14B 1BVSA 2ZXOA 1X56A 2L12A 3OMCA 1U9RA 3IKJA 3NTKA 1LTBD 5DNFA 4X62L 1QOHA 4IO9A 1S72A 2JEAI 4ULLA 2Z4IA 5LL6X 1E2VA 1RCVD 2B2TC 4H02A 1VQDA 4BBRB 2E2JH 2K5HA 1I50B 4A3GB 1VCIA 4A3FB 2A19A 2LKVA 1YHBA 4LF4L 1CA6A 1JOKA 1IYVA 3L2PA 1S5BD 3KBGA 1STBA 4JI4Q 1QE6A 2B2VA 4DV5Q 2N8NA 3SR1A 2WB1G 4NKLA 4DV7Q 3CPFA 1KRTA 3HOVG 4JI6L 4AYBE 2BE5C 2E5LL 1XXGA 2ZXRA 5IYCG 2EJMA 4NXNL 1ET9A 3BG3A 1EU3A 2D0OA 4C3HH 4HR7B 2MNAA 1AN8A 1XPOA 1IYUA 1MI2A 2K50A 1HQRD 1IBLL 2F0KA 3SHLA 2K4KA 3S1RH 2X6GA 2BH2A 1OXSC 3NBHB 1RTOA 5DLQE 3DUZA 1GHJA 1ZXTA 2B2WC 3TEHB 3JAME 1VDZA 4EX5A 3A54A 1FJGL 1G8ZD 2C9OA 3UDXA 2DUDA 3GTGH 4FDBA 2KHSA 1CKNA 2Y0SB 4HSPA 5T1GA 1YJNA 5EKKA 2Z0SA 1S4ZA 1MJCA 4NW2A 1UEAB 2PW7A 2RBMA 5C3XA 5IGCA 1VQOA 1SNMA 2EY2A 2GN5A 5M5WH 2K5WA 3C2PA 3FRPB 2XRSD 1GOZA 1EY9A 3S14H 1BQQT 3F2DA 2NVQB 3IL8A 2FXQA 4JI2L 2A69C 3LNNA 5BN4A 2TMPA 2R92B 1X3FA 1EY0A 1SN8A 1E2ZA 3TSSA 4LFCQ 1BDOA 4A93B 2UXBL 3EIVA 4K6DA 4GLAC 3DM1A 4KKTA 4F87A 1HH2P 3BDLA 3R8BA 3MZ5A 2F0IA 1VQKA 1YNJD 4DR7L 1G2SA 3RZDH 1PYWD 2CKZB 5DEHA 5HURA 2AWNA 4OXPA 2CFMA 4NMZA 2PYKA 4A3DB 1TWAB 4GKKL 1LM0A 3VYUA 3OTOQ 3W3AA 1TWGB 4H0LC 2MGSA 2EXZA 4BY1G 3CQZB 4ILWA 1TWFH 1II3A 2IL8A 3A8JE 3X3MA 1ENCA 2L11A 4H13C 2QKIC 1N33L 4ZKCB 3MVVA 2JA7G 3DWPA 4DPGA 2K75A 3CP0A 4OELB 1JJGA 2F1MA 5E4XA 3VYTA 4Y7NB 1BXTA 1UE6A 1A63A 3WOEA 5C4XH 1VQMA 3MXGA 1V1OA 3ER0A 4PNYA 4LF7L 3NQIA 4A3EG 4RFBA 2I5MX 5FK9C 5KGUA 1NJIC 4X65Q 4IOAA 2J0TD 1A8VA 1U4RA 1SYEA 2B2YA 3NSWA 5C3EG 4QIWB 4P75A 2H4OA 2CW0D 2RQXA 3CCSA 1SYFA 4C1NI 3BZDB 1Q1BA 3GV3A 3Q6SA 4A3KH 1CT1D 1FR3A 2SOBA 3H94A 3U50C 1Y8NB 3CCEA 3H0GG 2E75C 3RLFA 5JVH3 1SFOH 1OXXK 4GNXB 1TWCH 3MXNA 3JAMc 1G291 4HSVA 4B3TL 4L8JA 2QF7A 2R93G 1HA5A 2VQFL 5M9OA 3NBIA 4NXML 1SNPA 1V1PB 4JI7Q 3H91A 4DV0L 4KHVA 2PQEA 1JT8A 2JSOA 3K81C 1L1OA 3ND9A 4JOIC 5EQ0A 3VA5A 3F2BA 5M3MH 3KLSX 1A2UA 1ZYRC 2XWBB 1I94L 3S24A 5CV8A 1UAPA 4QQBX 2A6EC 2RCFA 4AIMA 2JA5G 2EQSA 1MKHA 2F0PA 1DCZA 4B08A 2UUCQ 1F9PA 1FGBD 2VUMH 4LMQD 2LMCB 2Q2HA 1N8RC 4C3HB 3P1HA 5A2QE 4A76A 1SLJA 2QDLA 5FJ8G 1KLUD 1F2YA 5KYIA 3S1RB 2FJ2A 5FLMG 1KNEA 1MJEA 5LMUQ 1FD7D 4DAYB 3ZYYX 1IL8A 1TS5A 3I4NG 4BY7B 1VF5C 4BBRG 5EPKA 3S2HH 3JAML 2F0LA 4J15A 3GTGB 4NP5A 1KABA 4A3GG 3HOWH 3AFQA 3D3RA 4A3FG 2A5HA 4JPBW 1CZWA 1MHWC 3GO5A 5I2XA 5I9OA 2PO4A 3F1ZA 1KNAA 1PH1A 1YIJA 5M5WB 4DV3L 2D62A 2WV6D 1VQBA 4FXKC 2H1EA 3ZJYC 5JJLA 5J3BA 1KAAA 1Y1WH 2ENBA 2F52A 4RHRA 3J81j 2Z8LA 2EDGA 2B2WA 1E1OA 3S14B 1JWMD 4DAMA 1X3GA 1O7ZA 4GS3A 2A1AA 1IXRA 1LABA 2VNUD 5IGFA 4O1NA 3ULLA 3T1YQ 2E5LQ 3RMHA 1A3VA 2NYZD 2IJ0A 5K5PA 1KLGD 4FF3A 3PUYA 3R2TA 1XNQL 3D6CA 1A3UA 1M4VA 4K8IA 4I65A 2MO1A 4UHVA 3J7YW 1XYIA 4X66L 1HNZL 1PTOC 2R7ZH 3IFDA 1N36Q 1FVIA 1CA5A 3EVQA 2Y0SG 1WD0A 4OO1I 5JPNC 2K01A 4K5XA 2MQHA 4KD4A 4CKEA 2CH4W 1TWFB 5IIFA 1PH3A 3LGJA 1NNXA 4OWWB 4KLKA 1KDBA 2F4VQ 3GTQH 1PFNA 1Y8OB 2I07B 3K7UC 3L9AX 3HGBA 1ENFA 2K5NA 4KHPL 4YWMA 1KTKA 1LT3D 1EIHA 4LW1A 1LT5D 3BZKA 1I3QH 4JI8Q 1TWHH 1B70B 5IYDG 4LF5Q 3PIP3 3SXHA 4DAVA 1B53A 4IPCA 5COYA 1PYSB 3NTHA 3IRBA 3S16H 3OW7A 1Y1VH 4DR1L 3PF5A 1UE1A 1VQHA 3OWEB 3A74A 2UXBQ 2G9DA 4X3UA 2OXPA 4AYBB 3DM3A 5IODA 3T56B 3NQTA 3OWFA 4JI3L 4TQUS 4HAEA 4A3DG 1AZPA 3S1QH 1QVFA 1GUNA 4DR7Q 1PH6A 1N32Q 4B3MQ 1Q8IA 1VQEA 1EYGA 4DR5L 2K28A 2MPMA 3K5LA 4A3KB 2K6AA 2YTXA 1WTXA 1C48A 1HCZA 2N78A 3VR3A 1TWCB 3PO2G 4QL5A 2KENA 3T4AC 2Q2TA 4KD3A 2K5DA 4YCWA 5EPJA 5KNDA 1H9RA 1SYDA 1ICFB 2KOLA 1O7LA 1JOOA 3O13A 3P20A 2I5LX 5IE8A 2KCMA 1LT6D 1VS0A 1Q46A 1YNND 4IUNA 3ULPA 4ZKBB 1LUZA 4UDUC 4O42A 5M3MB 2QILA 5IGEA 1JJCB 1PTOH 3K6OA 1JOQA 1D7QA 1YNJC 1I4XA 2OQ0A 3OIPA 2AUKA 4MN3A 1B8AA 2RDFA 2B63B 1Z6HA 1DGSA 4U673 1WVLA 4WRDA 1LV9A 4Q0FA 2VUMB 3GV6A 4YHHL 4KK7A 2HCCA 3FP9A 2IX1A 5A2QL 4L63B 4M1UB 3S2DH 1N34L 2CQAA 3I4OA 4JOIA 2YU9H 2ZTDA 4N8X1 5CR3A 2HIVA 5IP7H 5CYUA 1F77A 3FPUB 4FXDA 1LTAD 3G71A 1D2BA 1E24A 1F9SA 4XXEA 4P74A 2KCTA 1GD7A 1D6EC 1EZ6A 1DZ1A 3M3YH 1XTCD 5IYBH 4DXFA 3SVMA 4LJZC 2BCOA 1SYBA 3GP7A 1DD2A 2K7VA 4HMIA 4OX9L 1EY7A 3E6ZX 4LUVA 5IOCA 1PFSA 4DV6L 1PLFA 4B3TQ 1QZHA 2UUAL 1SROA 3HKZE 4ID6A 2IT1A 1VQFA 4PV1C 4C3IH 1CSQA 3K7AH 3NWSA 3D8GA 3KBXA 1EQRA 5CMDA 4RCOA 4OO1G 3HOYB 3ERQA 3AYHB 5K36H 1KL9A 1XPUA 2CW0C 1K9MC 2EY5A 2VS1A 4XDXA 4CHTB 1VQLA 5ELDA 1RDPD 4LF9L 4RG1A 5C4HA 1HUNA 4GOPB 5C44H 2F0GA 4B9XA 2WP8J 2RHQB 4ZAIA 4BY7G 2KEEA 1GUGA 1BR9A 5C5LA 4HIDA 3MHBA 1WYDA 1DJRD 1BBWA 5I2YA 4R8NA 2R7ZB 1SYCA 2J4XA 1HRJA 3D6WA 4DF7A 3ND8A 3MFYA 1PDQA 3S1MH 1A6XA 4X3TA 1TKWB 2YTYA 1DOKA 4EVOA 3I73A 2WKCA 1JCKB 1JWUD 1BKBA 2UXCL 2ID0A 1EUJA 4DU9A 5KIXA 1AEXA 2K33A 5C6AA 1Y69U 1EWHA 2RCNA 5BR8Q 1CFMA 2PZWA 5CV9A 1PFBA 3M4YA 4IJHA 2ZJQA 4DV1Q 4DGZA 1LTGD 3HOUG 1I3QB 3JC66 3H3VC 3MEHA 1QUQA 5M3FG 2SEBD 3L7ZC 1HXYD 1WD1A 4B3RL 1SSOA 1VF7A 1E22A 5EGTA 3H6MA 2NVXB 1FGUA 4H7BA 5DAUA 2PZTA 1KAWA 3NP8A 4AH6A 3CCUA 1RL2A 4HJ9A 1Y1VB 2A73B 2PQAB 2CHBD 4QUCA 1IYJB 2K05A 4YY3L 4C56C 1M8AA 3HEJA 2LSSA 3HZXA 2FFKB 1YJ9A 2A8VA 3PO3G 3G6JB 3NK9A 4FVMA 5KNBA 4X66Q 4RGOS 1ICWA 3KF6A 4JK1C 4DR2Q 2I0QA 2NTTA 4DR6L 2EPBA 2ALYB 4TKOB 1EQTA 4QUFA 2EJGC 4LFAQ 3RR5A 4AQYL 2N55A 1EU4A 1S5FD 2IHEA 4DR4L 3U58A 2ICEC 3TS2A 4TRDA 4NB3A 4IUPA 5JEAH 3NBHA 5CBAE 2JQOA 1H9MA 2JA8G 1GO3E 3Q8DA 2XVSA 4C3JH 4RWSC 3M4OH 2NVTH 3TRZA 1EY4A 2N49A 4K14A 5IT9E 1JMCA 3NXWA 2SNSA 4KHPQ 2ICIA 1VQ9A 1EOVA 3HOXG 3OIQA 4A3LG 2WAQE 1PTOB 2L1BA 2JEBI 1BCPC 1QZGA 2HIXA 3FMCA 1B4OA 4HCSA 1IBML 2AKWB 4XIGS 4DV4L 4AYBG 4IOCA 3OOCA 4IPHA 1ZKOA 3PUZA 4DR1Q 2EJFC 3W2DA 1YBYA 4YCUA 1RKNA 4QF4A 2KUMA 5A35A 1XWEA 4B3SL 4GKJQ 3S2DB 4JI3Q 5C0XH 3TN2A 2O5IC 1X65A 4CGYB 4A4IA 1TY2A 4A3JB 4POGA 3H3VH 2WB1E 1C0AA 1G2TA 1STEA 4UP8A 4JG2A 2YV5A 1S5CD 1SXTA 2NUCA 1J5EL 2MFIA 5FO9B 3EA6A 1SBBB 2DY8A 5AJ3L 4KJOA 3M4QA 1WTWA 4P2CB 2F0OA 2N88A 1I4GA 1QJOA 3N52A 4HIOA 2Q2IA 3K7AB 1CK1A 1H9SA 1XMQL 1XPRA 3HFZB 2QGQA 1B9NA 4ZCKA 4A3MG 4ZYSA 1T5XD 4LAAA 2B63G 2PMZE 1B9MA 1PZID 2VB3X 4DUYL 3I4MB 1K0SA 2OCEA 3I70A 4A3CH 1HR0L 5JJIA 2AHOB 1STAA 1K8OA 3D0FA 3K5MA 4DUZL 3PIPA 2WFWA 5C44B 1G6ZA 2X6LA 3I56A 4PG3A 2ZM6Q 4LWCA 1SE2A 5JOBA 4YHHQ 3I4LA 1LYLA 3EQLC 1SE3A 4BBSH 4GZYC 2EY6A 2NTSA 1SRUA 2DY7A 4IFDH 1WFQA 4A3BH 3T16A 4BXXG 1QNUA 3MWYW 2G9HD 4HIKA 1YNNC 2K14A 2IW3A 4HCEA 2ES2A 1E1TA 2V1CC 1STNA 5LMNL 3A7AB 5KRUA 1MGSA 1K8GA 3ICEA 3MTSA 3RZOH 1UE5A 4JV5L 1A3TA 1EYDA 2RSOA 2IWHA 3K58A 1PH4A 4JW0A 4OX9Q 5ELEA 2JA6G 4X64L 3HOYG 2K32A 1GUSA 3KYHC 2M2LA 4H44C 3EROA 1EY6A 3I90A 2R61A 3PCOB 4CJ0B 3AMUA 1Q90A 4N8FA 1D5XC 5IT9c 2QA4A 2KEDA 4UAIA 5M5XH 1HA6A 4JBJA 2RHSB 3NHHA 3NUCA 1YEZA 4OIKA 2DNCA 2ZXPA 1L0YB 2IX3A 2HHHL 1D1IA 2L0CA 4RMFA 2YYZA 1OO9B 1JC7A 4J1MA 2MO0A 4DK0A 4LUOA 2VZAA 1TVXA 4JI5L 2LY7A 5AFWA 4Z9CB 2UXDL 5JJKA 1FNUA 1K83B 3GTPH 1LO5D 2KCNA 4BS9A 1HNXL 3SGIA 3EBEA 4JVZA 2ATWA 4ZLTF 5IGGA 1XNRQ 1I4RA 2E2DC 2F0SA 1O7YA 4F7XA 4RKLA 2ASBA 4K0KL 1MIUA 1VQ5A 3QOLA 3MA2B 1RF2D 2K04A 1WCMG 2XN9C 3HOVH 2HDLA 2E2JB 2B29A 1HHVA 1XX8A 3M4OB 2NVTB 2BDNA 5IYCH 5ELCA 4B9WA 2AQ2B 1YHQA 5IT9L 2QEXA 1D5ZC 2HQLA 3SEBA 2NN6G 2UU9L 1JJ2A 3CCLA 3HKZB 3CRKC 1I6VC 2KCCA 1PVOA 1X3EA 1HJPA 3NWTA 3CU7A 2F0UA 2CVRA 1ILPA 2K5VA 1OXUA 4UPAA 2HQEA 1TR5A 4FNFA 1PFMA 1S40A 1QVCA 3HOZG 4WFN3 3CKIB 3HG9A 3GTKH 1HNWQ 4Y52H 1KDCA 4I7AA 4CJ1B 4MNOA 4YY3Q 1L2FA 3GTJH 1S5ED 4MIUA 2F4IA 4RA8A 2VQEQ 1U4MA 3CD6A 5T1IA 4KY6A 4GN3B 3J7ZC 3CC7A 4LNQA 2XWJB 1F2MA 1JQYD 3PGZA 3QB3A 4LF8L 3URYA 3U4ZA 1AE3A 1E2WA 3KLRA 4DR4Q 4KKUA 2IY5B 4MZ9A 4CBVA 4RGMA 1WOCA 4X62Q 3K5OA 3PUVA 3BDOA 3HS0C 1EQQA 4JI1L 2JXMB 1PRTC 5HGTA 3SDZA 2JN4A 3A5ZB 3DXJC 4MTNA 3IFTA 1X55A 2F3WA 2RA4A 3MXNB 3AEVA 2NVYH 3KFUA 4LFBL 2AWOA 4DV2L 2GVAA 2BA1A 4LF4Q 4JBMA 2OEOA 2SNMA 1D5MC 1PTOF 4OWXB 5CV4A 1M1KC 3EN2A 1IBMQ 3FHWA 1L1OB 5GADC 3T1HL 4K6LA 1QVGA 4JI6Q 1H95A 4IPGA 3GDEA 1WTOA 4BY1H 4LF6L 3D4RA 2R7DA 4NXNQ 4A3JG 4DNIA 1A2TA 2MUYA 3A7LA 3U4VA 1P8LA 5EAYA 1LTSD 3A8KE 1RIPA 3C1FA 4PZ6A 2RDGA 3GTOH 3I3CA 3RLOA 1AP0A 3QO2A 4DK3C 2JA7H 3RZDB 2OT2A 1NY4A 1IBLQ 2Z1CA 1SMYD 1OTCA 1NR2A 1B3QA 1QILA 1CI3M 1BCPB 3QG1A 4EGVA 2AMCB 3RZOB 1FJGQ 5ISRA 1J5EQ 1WTRA 3E5SA 1LLRD 2LS01 2F03A 1BBUA 2L4NA 1LT4D 1G6PA 1EEID 1SJED 3I4MG 3NENA 1MSGA 3B6YA 2EIFA 5C3EH 5EKIA 5C4ZA 5IY0A 2R92G 4IUVA 1D1KA 1EY5A 5C4XB 5M5XB 1U4PA 3I7FA 1U5KA 1KC8C 4FO2A 2F0VA 3S17H 4A93G 2WAQB 2E74C 4JI2Q 4YWKA 3C1EA 2K52A 1Q82C 4DUZQ 2Z4HA 1GKHA 1CHPD 3H0GH 3RLNA 1LTLA 3VYSA 2XGTA 4A3IH 1SNDA 1X9NA 5CGKA 2I5HA 4CDEC 1B2TA 3I55A 2Q8TA 2R93H 2K1BA 3GTPB 1RJTA 3AU7A 4JI4L 3ULJA 3CCMA 4DV5L 3OHXC 4EQOA 4HJ5A 4DV7L 1R9TH 2Q8RE 5ELNA 1EIGA 3UE1A 1TT2A 3ONAB 2GA4B 3J7A5 4GKKQ 2AQ1B 1STHA 1GVPA 4ZUIA 4X3KA 1FL0A 1SFOB 2RDHA 2WB1B 1GUTA 3M4PA 3HOVB 3A56A 3CMEA 2JA5H 4JBKA 4L5SA 4U68A 1ILQA 1VMCA 1ESFA 1LTTD 3WDNA 1WTQA 1N33Q 1HZAA 1LTRD 3W1BA 1SDFA 4HTHA 5FJ8H 1EZ8A 3W5OA 5FLXE 4FF4A 1D8LA 3DHQA 4R9WA 1AW7A 2F0HA 3RN5A 2EE1A 4TVAB 4LUZA 4KHZA 2BA0A 3I4NH 2I46A 3CHBD 1ASZA 1ENAA 2PMZB 2EYMA 2R7FA 4BBRH 4LF7Q 3KDFA 4RH6A 2XTIA 1TIID 3LX0A 3CC4A 1K3RA 1EFWA 2XRQD 5IP9H 1KD1C 3GTJB 4A3FH 3FKIH 3BVMA 4DK1A 3QR8A 3KF8A 2EOTA 3BS1A 1KIXA 2UXDQ 4XQNA 5EPLA 2R6GA 2N3SA 4KJNA 4ODGA 3CPWA 3CCRA 3NEMA 1BNZA 4LFCL 5D65A 3S2HB 4WJ3M 4IPDA 3D31A 1CUKA 1C9OA 4KY5A 3HOWB 2MP1A 1CQFA 1WJJA 2R3ZA 4DK6C 2ZTCA 4K5VA 2KHIA 4X6AH 4DA2A 3GQBA 5FO8B 3TS0A 3CAMA 1MSHA 4OONA 2NZOA 2NVYB 2VQFQ 4NXMQ 5G3LF 1Y1WB 4RGTA 3OTOL 2IPKD 4DV0Q 4IUTA 3DWQA 3GTMH 1Q7YC 1WI5A 1TY0A 5GROA 5KNCA 1VQ6A 5JEAJ 4GN5A 3EJIA 3E0EA 1I94Q 1SJHD 2QCPX 2EZVA 2RKSA 4CJ2C 4C3HG 1V43A 1Q3LA 1IW7D 1UE7A 1Z7TA 1QNKA 2A74C 4BY1B 3LWEA 5HY6A 1PHJA 5E1FA 5IGBA 2EY1A 1YITA 5LL6S 2IX0A 3K0XA 1LTID 3STBD 4K8JA 1YZ6A 4Q5VA 3EFXD 4R4QA 2EYPA 2QW7A 1C7YA 4J6HA 4K2LA 3SK5A 3UE0A 1MD2D 4GNXC 3VDYA 5IYDH 4LF8Q 1AE2A 3V05A 2WKDA 3TP7A 1A15A 2PI2E 2KQ3A 2FMCA 1M90C 2GVBA 3GTQB 1NMGA 1DOLA 3NTIA 5C4JH 3GD7A 3MC0B 2LXKA 4DV3Q 5C3EB 3CC2A 2L15A 1GUOA 4LFBQ 1VQAA 1TWAH 1TWHB 1ONLA 1B44D 4YIJA 1KRSA 1KDAA 3S17B 5C3WA 3S16B 3BYTB 2FINB 3CQZH 4BA2I 2AQ3B 1CTMA 4FF2A 1GUWA 3J80i 4BA1I 3E0JA 3CCVA 2DN8A 2Z6BA 2OQKA 1P16A 2F3VA 4K5WA 1PH2A 4A3IB 4JI7L 1E3PA 1F2ZA 4A75A 3J7AF 1HUMA 3PO2H 4MTKA 3KOJA 3AB9A 3W1GA 4JI0L 1IKLA 5IWAL 1XNQQ 1PRTB 2R93B 1XMOL 3S1QB 1RODA 3DWAA 2HT1A 1HNZQ 4RAUC 3MAQA 2ZJPA 2JJQA 3CCQA 5FKAC 4PQXA 4IQZA 4QJFA 4C2MH 2EYHA 1DONA 1BCPF 2JA5B 1FNWA 3TZDA 4OWTB 5E3FA 5H1SE 4XYQA 3E3XA 4V190 3J81L 4IFDJ 3CF5A 5LMUL 4EQPA 3OYYA 1W2BA 1LACA 2PPBC 5C4XG 3S1NH 4DNTB 3E9IA 1B7YB 5FLXL 1I4QA 1TS3A 3DEPA 1EY8A 1YJWA 3Q23A 4DXGA 1IL2A 5E4WC 3TDQA 3I4NB 4JYAL 1H9JA 1QUQB 1PTOD 1B1ZA 3VR5A 3F2CA 2X69A 1SMYC 1K0RA 3G6EA 2B39A 2J7ZA 3V2TA 3FKIB 3PQIA 4MHEA 4CDDC 5ELOA 1G51A 3F2UA 4KMUC 3KJOA 5D14A 1SNOA 2HD3A 2YU9B 4A3KG 2L55A 1CQVA 2NN6I 4RCNA 4QY7A 2O5JC 1V1QA 5J22A 2EYFA 3J80E 5KEEA 4OO1H 4DR5Q 5C5MA 3T1YL 3KF6B 3M3YB 3SK6A 3BU2A 4QCLA 2PZUA 1J8IA 1IKMA 1Q12A 1YHAA 4R4IA 3BDCA 4TSSA 1JE5A 3OPOA 4C3IB 1IBKL 5M3MG 1N36L 1SE8A 1S3OA 1L0XB 2CWPA 2A6HD 4F88A 1HZCA 1XJVA 2TSSA 3FDTA 1EYAA 4BWGB 4BY7H 4I7ZC 4HIMA 1RD9D 3GTMB 2ZTEA 1I6HH 1JORA 1EIYB 4E6IA 2AUJD 3KJPA 3MXUA 1J9OA 1FNVA 2VUMG 1WTPA 1F2LA 3I91A 2F4VL 2RVLA 3SK4A 3C46A 5CBEE 1HQMC 1SMXA 1STYA 1JR0D 2V4DA 3FEWX 2PCFB 3A0JA 5DM73 1IZ6A 1VQ8A 1HTLD 3T51B 1E7ZA 4JI8L 4LF5L 2B2UC 4UP9A 1B3AA 5F2DA 1X6OA 4HEDA 4GLXA 4IN3A 1N34Q 3PUWA 3HOWG 1BOSA 3HOUH 1PH9A 1X54A 3S1MB 2OWOA 5M3FH 1RTNA 5E7NA 2CH4A 4WJ4A 2EXDA 3PSIA 1KXLA 3PIO3 2YTVA 1Y1WG 1NUCA 1EOTA 4QB4A 3M7GA 1U4LA 2G5DA 1PH7A 1YVCA 5C4JB 3VYRA 4O0AA 4DV6Q 4FYDA 2F0FA 1X32A 1CKNB 1TS4A 2UUAQ 4B3ML 1N32L 4QGUA 2K03A 4KI0A 3TQYA 1K73C 3PO3H 4GNXA 3TZUA 2A68D 1K8MA 1H9SB 3UDFA 3D4DA 3K80C 1EYCA 1NBWA 3TP8A 4HN7A 2OF1A 1PV4A 1STGA 1V1PA 4N9TA 4O2DA 3ERSX 1OXVA 5BN5A 1VQPA 4L5RC 4JCVE 4LF9Q 1JB3A 3VR6A 1MBYA 1JB7A 2R7ZG 3PO2B 1RHPA 2JA8H 2O2LD 1NCVA 5I4DA 4G4KA 2JE6I 1W3SA 5EKLA 4EQ5A 2LXJA 3T53B 3FPPA 1EQVA 2KA7A 5DM63 3HOXH 2BH8A 4A3LH 1DOMA 2Z9HA 4ME5A 4UP7A 4C2MB 1Q81C 3J7AV 2XIWA 1BO0A 2CQOA 3J80c 2M00A 1KHIA 4HJ7A 1DXMA 1NAPA 2EYOA 2P5ZX 2PI2A 4JC0A 5NUCA 4IURA 4DAYA 4POFA 1WTVA 1I4HA 2M9VA 2UXCQ 3A8IE 5I9PA 2NB0A 3MFGA 4C3JB 1JE4A 3S1NB 1CSPA 1EFID 4XQJA 1IW7C 2VW9A 3K59A 4FP5D 4ZK9B 5G3LD 5GAHC 3DLLA 1Y1VG 3GTLH 1ML0D 1VMPA 4B3RQ 4GOPC 3TREA 3OW2A 4A3IG 1NSNS 3STBC 4P73A 2CCZA 3S9WA 3G7LA 5BN3A 2VY3A 3KLWA 3P75A 3BZCA 2F0DA 1HZBA 4ZRZA 1VQCA 4X3SA 5EBDA 3BVZA 3U9OA 2EYJA 2RF4A 5FOBB 4JI0Q 1CHQD 5IWAQ 4DR3L 1EWIA 3PMFA 1PRTF 1VQJA 1XMOQ 2HUGA 2XNAC 4DFAA 4R4OA 1FYCA 4A3MH 3J80L 2B2TA 4DR6Q 5KYLA 2B63H 5L37A 1CZGA 4AQYQ 1X3PA 4L5TA 1XTDA 1HPCA 4FXGC 2NWGA 3TP5A 3WOFA 1GHKA 3DEOA 1BUVT 3WWVA 4EQNA 1C8CA 4NDXA 2E2IH 1QCBD 3CXCA 1TXYA 3V96A 3OSOA 2Q2UA 2B8FA 5J39A 2VB2X 1I6HB 2D9UA 1F9QA 4IZ8A 1PMRA 2HDMA 3SE0A 5FO7B 2WIIB 4M8AA 3UI2A 2C5CA 5IP9G 3CCJA 1AZQA 5GAEC 4BXXH 4OIJA 3FKIG 1EL0A 1Y8PB 4JYAQ 1PZJD 1R4QB 4DV4Q 5BR8L 4PMCA 4ZUJA 1SNQA 3MEFA 4XT3B 4DV1L 5IP7G 3Q24A 3AFPA 2UUBL 4B3SQ 1BF4A 1JICA 5I6WA 4BBSB 1Q86C 2JA6H 2F0TA 3HOYH 4KN4C 1CKMA 3J81i 5IYBG 2BDOA 4A3BB 3HOUB 4C1NK 5JPMC 5CORA 5JJZA 1S5DD 5M3FB 2E2HH 1TQOA 4GN4B 1PH8A 4C3IG 3E9HA 1O80A 4ME3A 2RSNA 1GM5A 3PF4A 4NPSA 1BCPD 5AJ3Q 4R4CA 1IHZA 4A3EH 2Z6KC 1V9PA 1E0BA 3CW2C 5C0XI 3KK7A 2ZT9C 4HJ8A 2B2UA 2MJ8A 4DR2L 5K36G 5JAVA 1IBKQ 1UNSA 1Q8KA 2BE5D 4LK1C 3H3VI 2MHVA 1XMQQ 4LFAL 3PO3B 1Z9FA 4JBWA 2Y0SE 5ELBA 3X3NA 2B8GA 3HRZC 3A5UA 5C44G 1I5FA 2F3IA 3G4SA 4DUYQ 2F0WA 1F9RA 3QIAA 1WTHA 2C35B 4CKBA 3QOJA 5M5YH 3K57A 1J6QA 1HR0Q 1UUPA 1VQIA 2E8GA 3U9SA 2NBFA 4KY7A 2EYLA 4IALA 4RGNA 1WCMH 2JA8B 3RUZA 3UDGA 3N6RA 1YNXA 2O4XA 2F0NA 2CWAA 3BYYB 5CV7A 4PMBA 4R8IA 2NVXH 4YCVA 2DGYA 3PV0A 2NN6H 5CV6A 4KV6A 4R4TA 3HOXB 2A6HC 2JYOA 4DN4M 1HR0W 1T9HA 3PUXA 1SAPA 2LFNA 3HKSA 3NELA 4L6TB 4XTCS 1TS2A 4GKJL 3K8AA 1BBXC 5LMNQ 4XT1B 1CM9A 1QG7A 4DNRB 4JV5Q 3L3OC 3HOZH 3J81E 4IFDI 2A69D 3S15H 4X64Q 1L0WA 2BOSA 4ZQ3A 3I72A 2QDBA 3R2IA 5GQOA 2JK8A 5HGQA 2F0JA 3GTLB 2DNEA 4YWLA 5FLMH 2B2VC 3VR2A 1W6JA 3BVGA 1GXDC 5LMNW 3FVQA 3M85A 3D4WA 4G57A 3GTKB 1QB5D 1I50H 2HHHQ 4A3GH 1SNCA 1NMFA 2VXWA 1VQ4A 1ASYA 5EBCA 2F0MA 3CMAA 2F0QA 3H15A 4IJLA 3IAYA 3TP6A 4JI5Q 4FF1A 2EVBA 4WJWA 1Z47A 4P71A 4PMWA 4S3SA 4GOPA 4L5QA 1SYGA 2B3GA 5CV5A 4DKAC 1HNXQ 4A3MB 5JEAG 1SR3A 2K5QA 3QJYA 4K0KQ 2ZM6L 3F8TA 4C3JG 3AQQA 1ZEQX 4QIWE 2L9HA 2A68C 1Q1EA 4CDCC 1HFNA 1UEBA 4OGQC 2E2IB 1OXTA 2KHJA 3HKZG 5D3DA 5J1ZA 5I6YA 4HMJA 3RN2A 3L0OA 4ALPA 4A3JH 1T5EA 3PIOA 5EJWA 1QWYA 2JP1A 3UDIA 4R1JA 5LHY1 1PH5A 4G7HC 1NR4A 1X3QA 3P7JA 2UU9Q 1PZKD 1YI2A 3ITPA 3OMGA 4HJAA 3M7NA 4F8MA 2OTLA 4CKCA 4G7ZC 2KJXA 3A55A 1VQNA 3I8ZA 4PZ8A 2XSCA 1K3BC 2NZHA 1I4PA 3RD4A 5C0XG 4P72A 5JVG3 3T13A 1A62A 3R3OA 1O78A 4IUQA 2NZ1D
chains in the Genus database with same CATH topology
1SEBD 1DYQA 3MXPA 2JA6B 3GTOB 3K5NA 2WACA 2F0EA 4XQQA 3KUPA 4KN7C 4RKBA 2JA7B 3VA7A 1H9KA 3Q22A 2SDFA 1C4QA 2D2CC 1HFGA 4QMGA 1TU2B 2E2HB 4G7OC 1ET6A 2KECA 2QEJC 1PXUA 4A3EB 1B50A 4KTAA 1EEFD 1ZYRD 5C0XJ 3H09A 5IGDA 2HCIA 2A6ED 3LWUA 3NE5B 5D3IB 3C3LA 5CC4A 1HTPA 2E76C 1SE4A 2KVMA 4K2KA 2L5TA 5TSSA 3TBIB 3KLSA 1JWSD 5M5YB 2PNRC 2WINB 3QWNA 4ABNA 3Q0AA 2FHTA 3H0GB 4V0BA 4IFDG 2D5DA 1WCMB 2B2YC 1R4PB 2PW5A 4RHSA 4OHJA 1DM0B 4WORA 1PRTD 3SK8A 2FMMA 1R9TB 3NPPA 4OL7A 3VR4A 4N9PA 1AFPA 3CRLC 3K0YA 3R93A 4KKSA 1GJXA 3HOZB 1V8QA 3HP3A 4XYOA 4IUUA 1W6KA 3S15B 3TMEA 4DAPA 1ESRA 3DMUA 1EWCA 4J8QA 5ELFA 1G91A 2Q8IB 2ZXOA 2L12A 3OMCA 1U9RA 3IKJA 3NTKA 1LTBD 5DNFA 2JEAI 1QOHA 4ULLA 2Z4IA 5LL6X 1E2VA 1RCVD 2B2TC 4BBRB 1I50B 4A3GB 1VCIA 4A3FB 2LKVA 1CA6A 1JOKA 1IYVA 1S5BD 3KBGA 1STBA 1QE6A 2B2VA 3SR1A 4NKLA 2BE5C 1XXGA 2ZXRA 2EJMA 1ET9A 3BG3A 1EU3A 4HR7B 1AN8A 1IYUA 1MI2A 1HQRD 2F0KA 3SHLA 2X6GA 1OXSC 1RTOA 3DUZA 1GHJA 1ZXTA 2B2WC 3JAME 1VDZA 3A54A 1G8ZD 2C9OA 2KHSA 2Y0SB 4HSPA 5T1GA 5EKKA 1S4ZA 4NW2A 1UEAB 2PW7A 2RBMA 5C3XA 5IGCA 1SNMA 2EY2A 2K5WA 3C2PA 3FRPB 2XRSD 1GOZA 1EY9A 1BQQT 2NVQB 3IL8A 2A69C 3LNNA 5BN4A 2TMPA 2R92B 1EY0A 1E2ZA 3TSSA 1BDOA 4A93B 4K6DA 3DM1A 4KKTA 4F87A 3BDLA 3R8BA 3MZ5A 2F0IA 1YNJD 1G2SA 1PYWD 5DEHA 5HURA 2AWNA 4NMZA 2PYKA 4A3DB 1TWAB 3VYUA 3W3AA 1TWGB 4H0LC 2MGSA 2EXZA 3CQZB 4ILWA 1II3A 2IL8A 3A8JE 3X3MA 1ENCA 2L11A 4H13C 2QKIC 4ZKCB 3MVVA 3DWPA 2F1MA 5E4XA 3VYTA 4Y7NB 1BXTA 3WOEA 3MXGA 1V1OA 4PNYA 3NQIA 4RFBA 5FK9C 5KGUA 2J0TD 1U4RA 1SYEA 2B2YA 3NSWA 4QIWB 2H4OA 2CW0D 2RQXA 1SYFA 4C1NI 3BZDB 1Q1BA 3GV3A 3Q6SA 1CT1D 1FR3A 2SOBA 3H94A 1Y8NB 2E75C 3RLFA 5JVH3 1OXXK 3MXNA 1G291 4HSVA 4L8JA 2QF7A 1HA5A 5M9OA 3NBIA 1SNPA 1V1PB 3H91A 4KHVA 2PQEA 2JSOA 3ND9A 5EQ0A 3VA5A 3KLSX 1A2UA 1ZYRC 2XWBB 5CV8A 1UAPA 2A6EC 2F0PA 1DCZA 4B08A 1F9PA 1FGBD 4LMQD 2LMCB 4C3HB 3P1HA 5A2QE 1KLUD 1F2YA 5KYIA 3S1RB 2FJ2A 1KNEA 1FD7D 3ZYYX 1IL8A 1TS5A 4BY7B 1VF5C 5EPKA 3JAML 2F0LA 3GTGB 4NP5A 1KABA 3D3RA 2A5HA 1CZWA 3GO5A 5I2XA 5I9OA 2PO4A 1KNAA 5M5WB 2D62A 2WV6D 4FXKC 2H1EA 1KAAA 2ENBA 4RHRA 2Z8LA 2EDGA 2B2WA 3S14B 1JWMD 1O7ZA 1LABA 2VNUD 5IGFA 4O1NA 3RMHA 1A3VA 2NYZD 2IJ0A 5K5PA 1KLGD 4FF3A 3PUYA 3R2TA 3D6CA 1A3UA 1M4VA 4K8IA 4I65A 3J7YW 1XYIA 1PTOC 3IFDA 1CA5A 3EVQA 4OO1I 1WD0A 5JPNC 2K01A 4K5XA 4KD4A 4CKEA 1TWFB 5IIFA 1KDBA 1PFNA 1Y8OB 2I07B 3L9AX 3HGBA 1ENFA 1KTKA 1LT3D 1EIHA 1LT5D 3PIP3 3SXHA 4DAVA 1B53A 5COYA 3NTHA 3OW7A 3OWEB 2G9DA 4X3UA 2OXPA 4AYBB 5IODA 3T56B 3NQTA 3OWFA 4TQUS 4HAEA 1AZPA 1GUNA 1Q8IA 2K28A 2MPMA 3K5LA 4A3KB 2K6AA 1WTXA 1C48A 1HCZA 3VR3A 1TWCB 3T4AC 4KD3A 2K5DA 5KNDA 5EPJA 1H9RA 1SYDA 2KOLA 1O7LA 1JOOA 3O13A 3P20A 1LT6D 1YNND 4IUNA 4ZKBB 4UDUC 4O42A 5M3MB 2QILA 5IGEA 1PTOH 3K6OA 1JOQA 1YNJC 1I4XA 3OIPA 2AUKA 4MN3A 2B63B 2RDFA 1Z6HA 4U673 1WVLA 4WRDA 1LV9A 4Q0FA 2VUMB 3GV6A 4KK7A 2HCCA 2IX1A 5A2QL 4L63B 4M1UB 2CQAA 5CR3A 5CYUA 1F77A 3FPUB 4FXDA 1LTAD 1D2BA 1F9SA 4XXEA 1D6EC 1EZ6A 1DZ1A 1XTCD 4DXFA 3SVMA 4LJZC 2BCOA 1SYBA 3GP7A 1DD2A 2K7VA 4HMIA 1EY7A 3E6ZX 5IOCA 1PLFA 4ID6A 4PV1C 2IT1A 3NWSA 3D8GA 3KBXA 5CMDA 4RCOA 4OO1G 3HOYB 3ERQA 5K36H 2CW0C 2EY5A 4XDXA 4CHTB 5ELDA 1RDPD 1HUNA 5C4HA 2F0GA 4B9XA 2WP8J 4ZAIA 2KEEA 1GUGA 1BR9A 5C5LA 3MHBA 1DJRD 5I2YA 4R8NA 2R7ZB 1SYCA 2J4XA 1HRJA 3D6WA 4DF7A 3ND8A 3MFYA 1PDQA 1A6XA 4X3TA 1TKWB 1DOKA 4EVOA 3I73A 2WKCA 1JCKB 1JWUD 2ID0A 4DU9A 5KIXA 1AEXA 2K33A 5C6AA 1Y69U 1EWHA 1CFMA 2PZWA 5CV9A 1PFBA 3M4YA 4DGZA 1LTGD 1I3QB 3H3VC 3MEHA 1WD1A 2SEBD 3L7ZC 1HXYD 1SSOA 1VF7A 5EGTA 3H6MA 2NVXB 4H7BA 5DAUA 2PZTA 3NP8A 1Y1VB 2A73B 2CHBD 4QUCA 2K05A 4C56C 1M8AA 3HEJA 3HZXA 2FFKB 3G6JB 3NK9A 4FVMA 5KNBA 4RGOS 1ICWA 4JK1C 2NTTA 2EPBA 4TKOB 1EQTA 4QUFA 2EJGC 2N55A 1EU4A 1S5FD 2ICEC 4TRDA 4IUPA 5JEAH 3NBHA 5CBAE 1H9MA 2XVSA 4RWSC 1EY4A 4K14A 5IT9E 3NXWA 2SNSA 2ICIA 3OIQA 1PTOB 2L1BA 2JEBI 1BCPC 3FMCA 1B4OA 4HCSA 4XIGS 3OOCA 1ZKOA 3PUZA 2EJFC 3W2DA 5A35A 1RKNA 2KUMA 4QF4A 1XWEA 3S2DB 5C0XH 3TN2A 2O5IC 4CGYB 1TY2A 4A3JB 1G2TA 1STEA 1S5CD 1SXTA 2NUCA 5FO9B 3EA6A 1SBBB 2DY8A 4KJOA 1WTWA 4P2CB 2F0OA 2N88A 1I4GA 1QJOA 3N52A 3K7AB 1CK1A 1H9SA 1B9NA 4ZYSA 1T5XD 4LAAA 1B9MA 1PZID 2VB3X 3I4MB 3I70A 1STAA 1K8OA 3K5MA 5C44B 1G6ZA 2X6LA 1SE2A 5JOBA 3I4LA 3EQLC 1SE3A 4GZYC 2EY6A 2NTSA 2DY7A 4IFDH 3T16A 1QNUA 3MWYW 2G9HD 1YNNC 2IW3A 4HCEA 1STNA 3A7AB 5KRUA 1MGSA 3MTSA 1A3TA 1EYDA 2RSOA 2IWHA 3K58A 5ELEA 2K32A 1GUSA 2M2LA 4H44C 3EROA 1EY6A 3I90A 2R61A 4CJ0B 3AMUA 1Q90A 1D5XC 2KEDA 4UAIA 1HA6A 3NHHA 3NUCA 4OIKA 2DNCA 2ZXPA 1L0YB 2IX3A 1D1IA 2L0CA 2YYZA 1OO9B 1JC7A 4J1MA 4DK0A 1TVXA 2LY7A 5AFWA 4Z9CB 1FNUA 1K83B 1LO5D 2KCNA 4BS9A 4ZLTF 5IGGA 1I4RA 4F7XA 2F0SA 2E2DC 1O7YA 4RKLA 3QOLA 3MA2B 1RF2D 2K04A 2XN9C 2HDLA 2E2JB 1HHVA 1XX8A 3M4OB 2NVTB 2BDNA 5ELCA 4B9WA 2AQ2B 5IT9L 1D5ZC 3SEBA 2NN6G 3HKZB 3CRKC 1I6VC 2KCCA 3NWTA 3CU7A 2F0UA 2CVRA 1ILPA 1OXUA 2HQEA 1TR5A 4FNFA 1PFMA 4WFN3 3CKIB 3HG9A 1KDCA 4CJ1B 1S5ED 4MIUA 2F4IA 4RA8A 1U4MA 5T1IA 4KY6A 2XWJB 1F2MA 1JQYD 3QB3A 3URYA 1E2WA 3KLRA 4KKUA 4CBVA 4RGMA 3K5OA 3PUVA 3BDOA 3HS0C 2JXMB 1PRTC 5HGTA 3SDZA 3DXJC 3IFTA 2F3WA 2RA4A 2AWOA 2BA1A 2OEOA 2SNMA 1D5MC 1PTOF 5CV4A 4K6LA 1WTOA 3D4RA 1A2TA 2MUYA 3A7LA 1LTSD 3A8KE 3C1FA 2RDGA 3I3CA 1AP0A 3QO2A 3RZDB 2OT2A 2Z1CA 1SMYD 1NR2A 1QILA 1CI3M 1BCPB 3QG1A 4EGVA 3RZOB 5ISRA 1WTRA 3E5SA 1LLRD 2LS01 2F03A 2L4NA 1LT4D 1EEID 1SJED 1MSGA 5C4ZA 5EKIA 4IUVA 1D1KA 1EY5A 5C4XB 5M5XB 1U4PA 4FO2A 2F0VA 2WAQB 2E74C 3C1EA 2Z4HA 1CHPD 3VYSA 1SNDA 5CGKA 1B2TA 2Q8TA 2K1BA 3GTPB 1RJTA 3AU7A 3OHXC 4EQOA 2Q8RE 1EIGA 1TT2A 3ONAB 2GA4B 2AQ1B 1STHA 4ZUIA 4X3KA 1SFOB 2RDHA 2WB1B 1GUTA 3HOVB 3A56A 4U68A 1ILQA 1VMCA 1ESFA 1LTTD 3WDNA 1WTQA 1LTRD 1SDFA 4HTHA 1EZ8A 5FLXE 4FF4A 3DHQA 4R9WA 1AW7A 2F0HA 2EE1A 4KHZA 2BA0A 2I46A 3CHBD 1ENAA 2PMZB 2EYMA 4RH6A 1TIID 3LX0A 2XRQD 3GTJB 4DK1A 3BVMA 3KF8A 2EOTA 3BS1A 4XQNA 5EPLA 2R6GA 4KJNA 4ODGA 1BNZA 5D65A 3S2HB 3D31A 4KY5A 3HOWB 2MP1A 1CQFA 2R3ZA 4K5VA 4DA2A 3GQBA 5FO8B 1MSHA 2NVYB 5G3LF 1Y1WB 4RGTA 2IPKD 4IUTA 3DWQA 1TY0A 5KNCA 5JEAJ 3EJIA 1SJHD 2QCPX 2EZVA 2RKSA 4CJ2C 4C3HG 1V43A 1Q3LA 1IW7D 1Z7TA 1QNKA 2A74C 4BY1B 3LWEA 5E1FA 5IGBA 2EY1A 5LL6S 2IX0A 1LTID 4K8JA 4Q5VA 3EFXD 2EYPA 4J6HA 4K2LA 3SK5A 1MD2D 3V05A 2WKDA 3TP7A 1A15A 2KQ3A 2FMCA 3GTQB 1DOLA 3NTIA 3GD7A 3MC0B 5C3EB 1GUOA 1TWHB 1ONLA 1B44D 4YIJA 1KDAA 3S17B 5C3WA 3S16B 3BYTB 2FINB 4BA2I 2AQ3B 1CTMA 4FF2A 1GUWA 4BA1I 3E0JA 2DN8A 4K5WA 3J7AF 2F3VA 4A3IB 1F2ZA 1HUMA 3AB9A 1IKLA 1PRTB 2R93B 3S1QB 1RODA 3DWAA 4RAUC 3MAQA 5FKAC 4PQXA 4IQZA 2EYHA 1DONA 1BCPF 2JA5B 1FNWA 3TZDA 5E3FA 4XYQA 4V190 3J81L 4IFDJ 4EQPA 1LACA 2PPBC 4DNTB 5FLXL 1I4QA 1TS3A 3DEPA 1EY8A 3I4NB 3Q23A 4DXGA 5E4WC 3TDQA 1H9JA 1PTOD 1B1ZA 3VR5A 2X69A 1SMYC 2B39A 2J7ZA 3V2TA 3FKIB 4MHEA 3F2UA 4KMUC 5D14A 1SNOA 2YU9B 2L55A 1CQVA 2NN6I 4RCNA 2O5JC 5J22A 2EYFA 3J80E 5KEEA 4OO1H 5C5MA 3M3YB 3SK6A 4QCLA 2PZUA 1J8IA 1IKMA 1Q12A 3BDCA 4TSSA 3OPOA 4C3IB 4F88A 1L0XB 2A6HD 2TSSA 3FDTA 1EYAA 4BWGB 4I7ZC 1RD9D 3GTMB 1JORA 4E6IA 2AUJD 3MXUA 1J9OA 1FNVA 1WTPA 1F2LA 3I91A 2RVLA 3SK4A 3C46A 5CBEE 1HQMC 1STYA 1JR0D 2V4DA 3FEWX 2PCFB 5DM73 1HTLD 3T51B 2B2UC 1B3AA 5F2DA 4HEDA 4IN3A 3PUWA 1BOSA 3S1MB 1RTNA 3PIO3 1NUCA 1EOTA 4QB4A 3M7GA 1U4LA 5C4JB 3VYRA 4FYDA 2F0FA 1X32A 1TS4A 2K03A 4KI0A 3TZUA 2A68D 1K8MA 1H9SB 3D4DA 1EYCA 3TP8A 4HN7A 2OF1A 1STGA 1V1PA 4N9TA 1OXVA 5BN5A 1JB3A 3VR6A 1MBYA 3PO2B 1RHPA 2O2LD 1NCVA 5I4DA 4G4KA 2JE6I 5EKLA 3T53B 3FPPA 1EQVA 2KA7A 5DM63 1DOMA 4ME5A 4C2MB 3J7AV 2XIWA 1BO0A 2M00A 1DXMA 1NAPA 2EYOA 5NUCA 4IURA 4DAYA 1WTVA 1I4HA 2M9VA 3A8IE 5I9PA 2NB0A 3MFGA 4C3JB 1JE4A 3S1NB 1EFID 4XQJA 1IW7C 3K59A 4FP5D 4ZK9B 5G3LD 1ML0D 1VMPA 1NSNS 3S9WA 3G7LA 5BN3A 3P75A 2F0DA 4ZRZA 4X3SA 5EBDA 3BVZA 3U9OA 2EYJA 5FOBB 1CHQD 3PMFA 1PRTF 2HUGA 2XNAC 4DFAA 1FYCA 3J80L 2B2TA 5KYLA 1CZGA 1X3PA 1HPCA 4FXGC 2NWGA 3TP5A 3WOFA 1GHKA 3DEOA 1BUVT 4EQNA 1C8CA 4NDXA 1QCBD 3V96A 3OSOA 2B8FA 5J39A 2VB2X 1I6HB 2D9UA 1F9QA 4IZ8A 1PMRA 2HDMA 3SE0A 5FO7B 2WIIB 4M8AA 3UI2A 2C5CA 1AZQA 4OIJA 1EL0A 1Y8PB 1PZJD 1R4QB 4PMCA 4ZUJA 1SNQA 4XT3B 3Q24A 1BF4A 1JICA 5I6WA 4BBSB 2F0TA 4KN4C 2BDOA 4A3BB 3HOUB 4C1NK 5JPMC 5CORA 5JJZA 1S5DD 5M3FB 1TQOA 4C3IG 1O80A 2RSNA 1BCPD 1IHZA 1E0BA 5C0XI 3KK7A 2ZT9C 2B2UA 2MJ8A 5K36G 5JAVA 1UNSA 2BE5D 4LK1C 2MHVA 3PO3B 4JBWA 5ELBA 3X3NA 2B8GA 3HRZC 2F0WA 1F9RA 3QIAA 4CKBA 3K57A 3QOJA 1UUPA 3U9SA 2NBFA 4KY7A 2EYLA 4IALA 4RGNA 2JA8B 3RUZA 3N6RA 2O4XA 2F0NA 3BYYB 5CV7A 4PMBA 4R8IA 5CV6A 3PV0A 2NN6H 4KV6A 3HOXB 2A6HC 2JYOA 4DN4M 3PUXA 1SAPA 2LFNA 4L6TB 4XTCS 1TS2A 1BBXC 4XT1B 1CM9A 1QG7A 4DNRB 3L3OC 3J81E 4IFDI 2A69D 2BOSA 4ZQ3A 3I72A 2QDBA 3R2IA 2F0JA 3GTLB 2DNEA 2B2VC 3VR2A 1W6JA 3BVGA 1GXDC 3FVQA 3M85A 3D4WA 4G57A 3GTKB 1QB5D 1SNCA 2VXWA 5EBCA 2F0MA 2F0QA 3IAYA 3TP6A 4FF1A 2EVBA 4WJWA 1Z47A 4PMWA 4S3SA 1SYGA 5CV5A 4A3MB 5JEAG 2K5QA 3QJYA 4C3JG 1ZEQX 2L9HA 2A68C 1Q1EA 1HFNA 4OGQC 2E2IB 1OXTA 5D3DA 5I6YA 5J1ZA 4HMJA 1T5EA 5EJWA 1QWYA 2JP1A 5LHY1 4G7HC 1NR4A 1X3QA 3P7JA 1PZKD 3ITPA 3OMGA 3M7NA 4F8MA 4CKCA 4G7ZC 2KJXA 3A55A 3I8ZA 2XSCA 1I4PA 3RD4A 5C0XG 5JVG3 3T13A 3R3OA 1O78A 4IUQA 2NZ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2U A;  2F0H A;  3OSO A;  2KQ3 A;  1A2T A;  3MXP A;  5KIX A;  3BDL A;  3OMC A;  1KDB A;  1U9R A;  5J39 A;  3MZ5 A;  5CV8 A;  3C1F A;  2F0I A;  2WAC A;  2F0E A;  5J22 A;  2EYF A;  3HEJ A;  3QOL A;  1ENA A;  5KEE A;  4LAA A;  2EYM A;  2F0P A;  3HZX A;  4IZ8 A;  4RKB A;  1EZ6 A;  5C5M A;  5DEH A;  3SK6 A;  5HUR A;  3LX0 A;  4NMZ A;  2PYK A;  4QMG A;  5EKL A;  3NK9 A;  1SYB A;  2PZU A;  4B9W A;  1STA A;  3SXH A;  4YIJ A;  2LKV A;  4HMI A;  1KDA A;  3P1H A;  4PMC A;  4ZQ3 A;  1EY7 A;  5IOC A;  3BDC A;  1SNQ A;  1EQV A;  1JOK A;  2QDB A;  4ZUJ A;  3TP8 A;  5C3W A;  2EXZ A;  4ID6 A;  5ISR A;  1F2Y A;  1II3 A;  5JOB A;  5KYI A;  2F0J A;  3D8G A;  2F0U A;  3E5S A;  1EYA A;  1ENC A;  4KTA A;  1STB A;  4ME5 A;  4KJN A;  4ODG A;  2HQE A;  5I6W A;  4TRD A;  3SR1 A;  5IGD A;  4K5W A;  2F3V A;  2EY6 A;  2F0T A;  1TR5 A;  2M00 A;  1F2Z A;  3ERQ A;  4NKL A;  1JOR A;  3MVV A;  5NUC A;  2EYO A;  2OXP A;  3D4W A;  4E6I A;  5CC4 A;  4G57 A;  5IOD A;  2F0L A;  3NQT A;  3OWF A;  3T16 A;  4NP5 A;  1KAB A;  4K2K A;  1KDC A;  5C4Z A;  5I9P A;  4KY5 A;  2EY5 A;  1SNC A;  1EY5 A;  1EY4 A;  2F0M A;  4K14 A;  3SK4 A;  1TQO A;  5I9O A;  3NXW A;  4MIU A;  2F0Q A;  2SNS A;  4K5V A;  5C4H A;  1STY A;  1STN A;  2F0V A;  5KRU A;  5DAU A;  2F0G A;  4B9X A;  4PNY A;  3TP6 A;  1A3T A;  4KY6 A;  1EYD A;  2F0K A;  3SHL A;  3C1E A;  1IHZ A;  1KAA A;  4S3S A;  2ENB A;  1SYG A;  5CV5 A;  2EYH A;  5KGU A;  5C5L A;  1F2M A;  3MHB A;  1NSN S;  5F2D A;  3QB3 A;  4R8N A;  5JAV A;  1SYE A;  1SYC A;  1SND A;  3ERO A;  3S9W A;  1EY6 A;  4KD3 A;  5E3F A;  5CGK A;  1SYD A;  4DF7 A;  2PW5 A;  1JOO A;  2KHS A;  3EJI A;  3P75 A;  2F0D A;  4EQP A;  5CR3 A;  1RKN A;  4QF4 A;  5EKK A;  5IGF A;  2RKS A;  1SYF A;  3U9O A;  2EYJ A;  4EVO A;  2PW7 A;  2RBM A;  3NHH A;  4EQO A;  4IUN A;  1SNM A;  4WOR A;  5C3X A;  5IGC A;  5HGT A;  2EY2 A;  3NUC A;  3SK8 A;  5I6Y A;  1A3V A;  2F0W A;  5J1Z A;  4EQN A;  4HMJ A;  5K5P A;  3PMF A;  5IGE A;  3QOJ A;  2F3W A;  5E1F A;  1TT2 A;  1NUC A;  3D6C A;  4DU9 A;  1A3U A;  2EY1 A;  4QB4 A;  5IGB A;  1AEX A;  1EY8 A;  2SOB A;  4OL7 A;  1STH A;  4DFA A;  4ZUI A;  5C6A A;  1JOQ A;  4K8I A;  4I65 A;  4J1M A;  4N9P A;  2F0F A;  4KY7 A;  5KYL A;  2PZW A;  2EYL A;  1EY9 A;  4K8J A;  5CV9 A;  4IAL A;  3ITP A;  3OMG A;  3RUZ A;  2RDF A;  2OEO A;  4DGZ A;  2EYP A;  2NUC A;  2O4X A;  2SNM A;  2F0N A;  3EVQ A;  4J6H A;  4K2L A;  4WRD A;  5CV4 A;  3MEH A;  3SK5 A;  4F8M A;  3V2T A;  5M9O A;  3TME A;  1EY0 A;  4KJO A;  1SNP A;  3R3O A;  4K5X A;  3DMU A;  5CV7 A;  3TP5 A;  4PMB A;  2F0O A;  4HTH A;  3H6M A;  4KD4 A;  3D4D A;  5EGT A;  4KHV A;  1EYC A;  4H7B A;  2PZT A;  5CV6 A;  2PQE A;  4K6D A;  1EZ8 A;  2OF1 A;  3NP8 A;  4KV6 A;  4NDX A;  1SNO A;  3T13 A;  3TP7 A;  5IGG A;  1STG A;  5IIF A;  3VA5 A;  4F7X A;  2F0S A;  4N9T A;  4RKL A;  3DHQ A; 
#chains in the Genus database with same CATH topology
 1SEB D;  1DYQ A;  3MXP A;  3KDF B;  2JA6 B;  3GTO B;  1EIF A;  3K5N A;  2WAC A;  2F0E A;  4XQQ A;  5GAG C;  3KUP A;  1NTG A;  2DJF C;  2PQA A;  4KN7 C;  4DR3 Q;  4RKB A;  2JA7 B;  1AH9 A;  3VA7 A;  3I4M H;  1H9K A;  3KF8 B;  3Q22 A;  2SDF A;  1C4Q A;  2NVQ H;  2D2C C;  1A0I A;  1PA6 A;  1HFG A;  4QMG A;  1TU2 B;  2OTJ A;  2R92 H;  2E2H B;  4G7O C;  1ET6 A;  2KEC A;  4X65 L;  2KBN A;  2ZJR A;  4A93 H;  2DJG C;  2QEJ C;  1K28 A;  1PXU A;  4A3E B;  1B50 A;  4KTA A;  1EEF D;  1ZYR D;  2H5X A;  2D0P A;  4PZ7 A;  5C0X J;  3H09 A;  4JI1 Q;  2HCI A;  5IGD A;  1PYB A;  2A6E D;  3LWU A;  3NE5 B;  5D3I B;  3C3L A;  5CC4 A;  1HTP A;  2E76 C;  1SE4 A;  2VL6 A;  2KVM A;  1XNR L;  4K2K A;  2L5T A;  4A3C G;  1KQS A;  3G48 A;  3J81 c;  4DV2 Q;  1VQ7 A;  4A3D H;  5TSS A;  3TBI B;  1TWG H;  2PNH A;  3KLS A;  1JWS D;  5FLX c;  5M5Y B;  2PNR C;  2WIN B;  3QWN A;  1UWV A;  3T1H Q;  4ABN A;  1N9W A;  4BBS G;  2Z6K A;  3Q0A A;  2FHT A;  3H0G B;  4V0B A;  4IFD G;  2D5D A;  1WCM B;  2B2Y C;  4A3B G;  1R4P B;  1O7I A;  3BJU A;  4UY8 C;  4LF6 Q;  2PW5 A;  4RHS A;  4Y7N H;  4OHJ A;  2UUB Q;  1HZ9 A;  1DM0 B;  4WOR A;  1PRT D;  3SK8 A;  2FMM A;  1R9T B;  2JA9 A;  4CDF C;  1HNW L;  2UUC L;  1CKO A;  1VQG A;  4APV A;  2IHF A;  3NPP A;  4OL7 A;  3JAM i;  3I2Z A;  1NE3 A;  3VR4 A;  4N9P A;  1K8A C;  3CRL C;  1AFP A;  3K0Y A;  3R93 A;  4KKS A;  1GJX A;  3HOZ B;  2VQE L;  1V8Q A;  3HP3 A;  4XYO A;  4IUU A;  1W6K A;  4GLV B;  3S15 B;  3TME A;  1K83 H;  4DAP A;  1ESR A;  3DMU A;  1EWC A;  4J8Q A;  5ELF A;  3RNU A;  4OEM B;  1U0L A;  1G91 A;  1L1O C;  2WAQ G;  3M9B A;  2Q8I B;  1Y14 B;  1BVS A;  2ZXO A;  1X56 A;  2L12 A;  3OMC A;  1U9R A;  3IKJ A;  3NTK A;  1LTB D;  5DNF A;  4X62 L;  1QOH A;  4IO9 A;  1S72 A;  2JEA I;  4ULL A;  2Z4I A;  5LL6 X;  1E2V A;  1RCV D;  2B2T C;  4H02 A;  1VQD A;  4BBR B;  2E2J H;  2K5H A;  1I50 B;  4A3G B;  1VCI A;  4A3F B;  2A19 A;  2LKV A;  1YHB A;  4LF4 L;  1CA6 A;  1JOK A;  1IYV A;  3L2P A;  1S5B D;  3KBG A;  1STB A;  4JI4 Q;  1QE6 A;  2B2V A;  4DV5 Q;  2N8N A;  3SR1 A;  2WB1 G;  4NKL A;  4DV7 Q;  3CPF A;  1KRT A;  3HOV G;  4JI6 L;  4AYB E;  2BE5 C;  2E5L L;  1XXG A;  2ZXR A;  5IYC G;  2EJM A;  4NXN L;  1ET9 A;  3BG3 A;  1EU3 A;  2D0O A;  4C3H H;  4HR7 B;  2MNA A;  1AN8 A;  1XPO A;  1IYU A;  1MI2 A;  2K50 A;  1HQR D;  1IBL L;  2F0K A;  3SHL A;  2K4K A;  3S1R H;  2X6G A;  2BH2 A;  1OXS C;  3NBH B;  1RTO A;  5DLQ E;  3DUZ A;  1GHJ A;  1ZXT A;  2B2W C;  3TEH B;  3JAM E;  1VDZ A;  4EX5 A;  3A54 A;  1FJG L;  1G8Z D;  2C9O A;  3UDX A;  2DUD A;  3GTG H;  4FDB A;  2KHS A;  1CKN A;  2Y0S B;  4HSP A;  5T1G A;  1YJN A;  5EKK A;  2Z0S A;  1S4Z A;  1MJC A;  4NW2 A;  1UEA B;  2PW7 A;  2RBM A;  5C3X A;  5IGC A;  1VQO A;  1SNM A;  2EY2 A;  2GN5 A;  5M5W H;  2K5W A;  3C2P A;  3FRP B;  2XRS D;  1GOZ A;  1EY9 A;  3S14 H;  1BQQ T;  3F2D A;  2NVQ B;  3IL8 A;  2FXQ A;  4JI2 L;  2A69 C;  3LNN A;  5BN4 A;  2TMP A;  2R92 B;  1X3F A;  1EY0 A;  1SN8 A;  1E2Z A;  3TSS A;  4LFC Q;  1BDO A;  4A93 B;  2UXB L;  3EIV A;  4K6D A;  4GLA C;  3DM1 A;  4KKT A;  4F87 A;  1HH2 P;  3BDL A;  3R8B A;  3MZ5 A;  2F0I A;  1VQK A;  1YNJ D;  4DR7 L;  1G2S A;  3RZD H;  1PYW D;  2CKZ B;  5DEH A;  5HUR A;  2AWN A;  4OXP A;  2CFM A;  4NMZ A;  2PYK A;  4A3D B;  1TWA B;  4GKK L;  1LM0 A;  3VYU A;  3OTO Q;  3W3A A;  1TWG B;  4H0L C;  2MGS A;  2EXZ A;  4BY1 G;  3CQZ B;  4ILW A;  1TWF H;  1II3 A;  2IL8 A;  3A8J E;  3X3M A;  1ENC A;  2L11 A;  4H13 C;  2QKI C;  1N33 L;  4ZKC B;  3MVV A;  2JA7 G;  3DWP A;  4DPG A;  2K75 A;  3CP0 A;  4OEL B;  1JJG A;  2F1M A;  5E4X A;  3VYT A;  4Y7N B;  1BXT A;  1UE6 A;  1A63 A;  3WOE A;  5C4X H;  1VQM A;  3MXG A;  1V1O A;  3ER0 A;  4PNY A;  4LF7 L;  3NQI A;  4A3E G;  4RFB A;  2I5M X;  5FK9 C;  5KGU A;  1NJI C;  4X65 Q;  4IOA A;  2J0T D;  1A8V A;  1U4R A;  1SYE A;  2B2Y A;  3NSW A;  5C3E G;  4QIW B;  4P75 A;  2H4O A;  2CW0 D;  2RQX A;  3CCS A;  1SYF A;  4C1N I;  3BZD B;  1Q1B A;  3GV3 A;  3Q6S A;  4A3K H;  1CT1 D;  1FR3 A;  2SOB A;  3H94 A;  3U50 C;  1Y8N B;  3CCE A;  3H0G G;  2E75 C;  3RLF A;  5JVH 3;  1SFO H;  1OXX K;  4GNX B;  1TWC H;  3MXN A;  3JAM c;  1G29 1;  4HSV A;  4B3T L;  4L8J A;  2QF7 A;  2R93 G;  1HA5 A;  2VQF L;  5M9O A;  3NBI A;  4NXM L;  1SNP A;  1V1P B;  4JI7 Q;  3H91 A;  4DV0 L;  4KHV A;  2PQE A;  1JT8 A;  2JSO A;  3K81 C;  1L1O A;  3ND9 A;  4JOI C;  5EQ0 A;  3VA5 A;  3F2B A;  5M3M H;  3KLS X;  1A2U A;  1ZYR C;  2XWB B;  1I94 L;  3S24 A;  5CV8 A;  1UAP A;  4QQB X;  2A6E C;  2RCF A;  4AIM A;  2JA5 G;  2EQS A;  1MKH A;  2F0P A;  1DCZ A;  4B08 A;  2UUC Q;  1F9P A;  1FGB D;  2VUM H;  4LMQ D;  2LMC B;  2Q2H A;  1N8R C;  4C3H B;  3P1H A;  5A2Q E;  4A76 A;  1SLJ A;  2QDL A;  5FJ8 G;  1KLU D;  1F2Y A;  5KYI A;  3S1R B;  2FJ2 A;  5FLM G;  1KNE A;  1MJE A;  5LMU Q;  1FD7 D;  4DAY B;  3ZYY X;  1IL8 A;  1TS5 A;  3I4N G;  4BY7 B;  1VF5 C;  4BBR G;  5EPK A;  3S2H H;  3JAM L;  2F0L A;  4J15 A;  3GTG B;  4NP5 A;  1KAB A;  4A3G G;  3HOW H;  3AFQ A;  3D3R A;  4A3F G;  2A5H A;  4JPB W;  1CZW A;  1MHW C;  3GO5 A;  5I2X A;  5I9O A;  2PO4 A;  3F1Z A;  1KNA A;  1PH1 A;  1YIJ A;  5M5W B;  4DV3 L;  2D62 A;  2WV6 D;  1VQB A;  4FXK C;  2H1E A;  3ZJY C;  5JJL A;  5J3B A;  1KAA A;  1Y1W H;  2ENB A;  2F52 A;  4RHR A;  3J81 j;  2Z8L A;  2EDG A;  2B2W A;  1E1O A;  3S14 B;  1JWM D;  4DAM A;  1X3G A;  1O7Z A;  4GS3 A;  2A1A A;  1IXR A;  1LAB A;  2VNU D;  5IGF A;  4O1N A;  3ULL A;  3T1Y Q;  2E5L Q;  3RMH A;  1A3V A;  2NYZ D;  2IJ0 A;  5K5P A;  1KLG D;  4FF3 A;  3PUY A;  3R2T A;  1XNQ L;  3D6C A;  1A3U A;  1M4V A;  4K8I A;  4I65 A;  2MO1 A;  4UHV A;  3J7Y W;  1XYI A;  4X66 L;  1HNZ L;  1PTO C;  2R7Z H;  3IFD A;  1N36 Q;  1FVI A;  1CA5 A;  3EVQ A;  2Y0S G;  1WD0 A;  4OO1 I;  5JPN C;  2K01 A;  4K5X A;  2MQH A;  4KD4 A;  4CKE A;  2CH4 W;  1TWF B;  5IIF A;  1PH3 A;  3LGJ A;  1NNX A;  4OWW B;  4KLK A;  1KDB A;  2F4V Q;  3GTQ H;  1PFN A;  1Y8O B;  2I07 B;  3K7U C;  3L9A X;  3HGB A;  1ENF A;  2K5N A;  4KHP L;  4YWM A;  1KTK A;  1LT3 D;  1EIH A;  4LW1 A;  1LT5 D;  3BZK A;  1I3Q H;  4JI8 Q;  1TWH H;  1B70 B;  5IYD G;  4LF5 Q;  3PIP 3;  3SXH A;  4DAV A;  1B53 A;  4IPC A;  5COY A;  1PYS B;  3NTH A;  3IRB A;  3S16 H;  3OW7 A;  1Y1V H;  4DR1 L;  3PF5 A;  1UE1 A;  1VQH A;  3OWE B;  3A74 A;  2UXB Q;  2G9D A;  4X3U A;  2OXP A;  4AYB B;  3DM3 A;  5IOD A;  3T56 B;  3NQT A;  3OWF A;  4JI3 L;  4TQU S;  4HAE A;  4A3D G;  1AZP A;  3S1Q H;  1QVF A;  1GUN A;  4DR7 Q;  1PH6 A;  1N32 Q;  4B3M Q;  1Q8I A;  1VQE A;  1EYG A;  4DR5 L;  2K28 A;  2MPM A;  3K5L A;  4A3K B;  2K6A A;  2YTX A;  1WTX A;  1C48 A;  1HCZ A;  2N78 A;  3VR3 A;  1TWC B;  3PO2 G;  4QL5 A;  2KEN A;  3T4A C;  2Q2T A;  4KD3 A;  2K5D A;  4YCW A;  5EPJ A;  5KND A;  1H9R A;  1SYD A;  1ICF B;  2KOL A;  1O7L A;  1JOO A;  3O13 A;  3P20 A;  2I5L X;  5IE8 A;  2KCM A;  1LT6 D;  1VS0 A;  1Q46 A;  1YNN D;  4IUN A;  3ULP A;  4ZKB B;  1LUZ A;  4UDU C;  4O42 A;  5M3M B;  2QIL A;  5IGE A;  1JJC B;  1PTO H;  3K6O A;  1JOQ A;  1D7Q A;  1YNJ C;  1I4X A;  2OQ0 A;  3OIP A;  2AUK A;  4MN3 A;  1B8A A;  2RDF A;  2B63 B;  1Z6H A;  1DGS A;  4U67 3;  1WVL A;  4WRD A;  1LV9 A;  4Q0F A;  2VUM B;  3GV6 A;  4YHH L;  4KK7 A;  2HCC A;  3FP9 A;  2IX1 A;  5A2Q L;  4L63 B;  4M1U B;  3S2D H;  1N34 L;  2CQA A;  3I4O A;  4JOI A;  2YU9 H;  2ZTD A;  4N8X 1;  5CR3 A;  2HIV A;  5IP7 H;  5CYU A;  1F77 A;  3FPU B;  4FXD A;  1LTA D;  3G71 A;  1D2B A;  1E24 A;  1F9S A;  4XXE A;  4P74 A;  2KCT A;  1GD7 A;  1D6E C;  1EZ6 A;  1DZ1 A;  3M3Y H;  1XTC D;  5IYB H;  4DXF A;  3SVM A;  4LJZ C;  2BCO A;  1SYB A;  3GP7 A;  1DD2 A;  2K7V A;  4HMI A;  4OX9 L;  1EY7 A;  3E6Z X;  4LUV A;  5IOC A;  1PFS A;  4DV6 L;  1PLF A;  4B3T Q;  1QZH A;  2UUA L;  1SRO A;  3HKZ E;  4ID6 A;  2IT1 A;  1VQF A;  4PV1 C;  4C3I H;  1CSQ A;  3K7A H;  3NWS A;  3D8G A;  3KBX A;  1EQR A;  5CMD A;  4RCO A;  4OO1 G;  3HOY B;  3ERQ A;  3AYH B;  5K36 H;  1KL9 A;  1XPU A;  2CW0 C;  1K9M C;  2EY5 A;  2VS1 A;  4XDX A;  4CHT B;  1VQL A;  5ELD A;  1RDP D;  4LF9 L;  4RG1 A;  5C4H A;  1HUN A;  4GOP B;  5C44 H;  2F0G A;  4B9X A;  2WP8 J;  2RHQ B;  4ZAI A;  4BY7 G;  2KEE A;  1GUG A;  1BR9 A;  5C5L A;  4HID A;  3MHB A;  1WYD A;  1DJR D;  1BBW A;  5I2Y A;  4R8N A;  2R7Z B;  1SYC A;  2J4X A;  1HRJ A;  3D6W A;  4DF7 A;  3ND8 A;  3MFY A;  1PDQ A;  3S1M H;  1A6X A;  4X3T A;  1TKW B;  2YTY A;  1DOK A;  4EVO A;  3I73 A;  2WKC A;  1JCK B;  1JWU D;  1BKB A;  2UXC L;  2ID0 A;  1EUJ A;  4DU9 A;  5KIX A;  1AEX A;  2K33 A;  5C6A A;  1Y69 U;  1EWH A;  2RCN A;  5BR8 Q;  1CFM A;  2PZW A;  5CV9 A;  1PFB A;  3M4Y A;  4IJH A;  2ZJQ A;  4DV1 Q;  4DGZ A;  1LTG D;  3HOU G;  1I3Q B;  3JC6 6;  3H3V C;  3MEH A;  1QUQ A;  5M3F G;  2SEB D;  3L7Z C;  1HXY D;  1WD1 A;  4B3R L;  1SSO A;  1VF7 A;  1E22 A;  5EGT A;  3H6M A;  2NVX B;  1FGU A;  4H7B A;  5DAU A;  2PZT A;  1KAW A;  3NP8 A;  4AH6 A;  3CCU A;  1RL2 A;  4HJ9 A;  1Y1V B;  2A73 B;  2PQA B;  2CHB D;  4QUC A;  1IYJ B;  2K05 A;  4YY3 L;  4C56 C;  1M8A A;  3HEJ A;  2LSS A;  3HZX A;  2FFK B;  1YJ9 A;  2A8V A;  3PO3 G;  3G6J B;  3NK9 A;  4FVM A;  5KNB A;  4X66 Q;  4RGO S;  1ICW A;  3KF6 A;  4JK1 C;  4DR2 Q;  2I0Q A;  2NTT A;  4DR6 L;  2EPB A;  2ALY B;  4TKO B;  1EQT A;  4QUF A;  2EJG C;  4LFA Q;  3RR5 A;  4AQY L;  2N55 A;  1EU4 A;  1S5F D;  2IHE A;  4DR4 L;  3U58 A;  2ICE C;  3TS2 A;  4TRD A;  4NB3 A;  4IUP A;  5JEA H;  3NBH A;  5CBA E;  2JQO A;  1H9M A;  2JA8 G;  1GO3 E;  3Q8D A;  2XVS A;  4C3J H;  4RWS C;  3M4O H;  2NVT H;  3TRZ A;  1EY4 A;  2N49 A;  4K14 A;  5IT9 E;  1JMC A;  3NXW A;  2SNS A;  4KHP Q;  2ICI A;  1VQ9 A;  1EOV A;  3HOX G;  3OIQ A;  4A3L G;  2WAQ E;  1PTO B;  2L1B A;  2JEB I;  1BCP C;  1QZG A;  2HIX A;  3FMC A;  1B4O A;  4HCS A;  1IBM L;  2AKW B;  4XIG S;  4DV4 L;  4AYB G;  4IOC A;  3OOC A;  4IPH A;  1ZKO A;  3PUZ A;  4DR1 Q;  2EJF C;  3W2D A;  1YBY A;  4YCU A;  1RKN A;  4QF4 A;  2KUM A;  5A35 A;  1XWE A;  4B3S L;  4GKJ Q;  3S2D B;  4JI3 Q;  5C0X H;  3TN2 A;  2O5I C;  1X65 A;  4CGY B;  4A4I A;  1TY2 A;  4A3J B;  4POG A;  3H3V H;  2WB1 E;  1C0A A;  1G2T A;  1STE A;  4UP8 A;  4JG2 A;  2YV5 A;  1S5C D;  1SXT A;  2NUC A;  1J5E L;  2MFI A;  5FO9 B;  3EA6 A;  1SBB B;  2DY8 A;  5AJ3 L;  4KJO A;  3M4Q A;  1WTW A;  4P2C B;  2F0O A;  2N88 A;  1I4G A;  1QJO A;  3N52 A;  4HIO A;  2Q2I A;  3K7A B;  1CK1 A;  1H9S A;  1XMQ L;  1XPR A;  3HFZ B;  2QGQ A;  1B9N A;  4ZCK A;  4A3M G;  4ZYS A;  1T5X D;  4LAA A;  2B63 G;  2PMZ E;  1B9M A;  1PZI D;  2VB3 X;  4DUY L;  3I4M B;  1K0S A;  2OCE A;  3I70 A;  4A3C H;  1HR0 L;  5JJI A;  2AHO B;  1STA A;  1K8O A;  3D0F A;  3K5M A;  4DUZ L;  3PIP A;  2WFW A;  5C44 B;  1G6Z A;  2X6L A;  3I56 A;  4PG3 A;  2ZM6 Q;  4LWC A;  1SE2 A;  5JOB A;  4YHH Q;  3I4L A;  1LYL A;  3EQL C;  1SE3 A;  4BBS H;  4GZY C;  2EY6 A;  2NTS A;  1SRU A;  2DY7 A;  4IFD H;  1WFQ A;  4A3B H;  3T16 A;  4BXX G;  1QNU A;  3MWY W;  2G9H D;  4HIK A;  1YNN C;  2K14 A;  2IW3 A;  4HCE A;  2ES2 A;  1E1T A;  2V1C C;  1STN A;  5LMN L;  3A7A B;  5KRU A;  1MGS A;  1K8G A;  3ICE A;  3MTS A;  3RZO H;  1UE5 A;  4JV5 L;  1A3T A;  1EYD A;  2RSO A;  2IWH A;  3K58 A;  1PH4 A;  4JW0 A;  4OX9 Q;  5ELE A;  2JA6 G;  4X64 L;  3HOY G;  2K32 A;  1GUS A;  3KYH C;  2M2L A;  4H44 C;  3ERO A;  1EY6 A;  3I90 A;  2R61 A;  3PCO B;  4CJ0 B;  3AMU A;  1Q90 A;  4N8F A;  1D5X C;  5IT9 c;  2QA4 A;  2KED A;  4UAI A;  5M5X H;  1HA6 A;  4JBJ A;  2RHS B;  3NHH A;  3NUC A;  1YEZ A;  4OIK A;  2DNC A;  2ZXP A;  1L0Y B;  2IX3 A;  2HHH L;  1D1I A;  2L0C A;  4RMF A;  2YYZ A;  1OO9 B;  1JC7 A;  4J1M A;  2MO0 A;  4DK0 A;  4LUO A;  2VZA A;  1TVX A;  4JI5 L;  2LY7 A;  5AFW A;  4Z9C B;  2UXD L;  5JJK A;  1FNU A;  1K83 B;  3GTP H;  1LO5 D;  2KCN A;  4BS9 A;  1HNX L;  3SGI A;  3EBE A;  4JVZ A;  2ATW A;  4ZLT F;  5IGG A;  1XNR Q;  1I4R A;  2E2D C;  2F0S A;  1O7Y A;  4F7X A;  4RKL A;  2ASB A;  4K0K L;  1MIU A;  1VQ5 A;  3QOL A;  3MA2 B;  1RF2 D;  2K04 A;  1WCM G;  2XN9 C;  3HOV H;  2HDL A;  2E2J B;  2B29 A;  1HHV A;  1XX8 A;  3M4O B;  2NVT B;  2BDN A;  5IYC H;  5ELC A;  4B9W A;  2AQ2 B;  1YHQ A;  5IT9 L;  2QEX A;  1D5Z C;  2HQL A;  3SEB A;  2NN6 G;  2UU9 L;  1JJ2 A;  3CCL A;  3HKZ B;  3CRK C;  1I6V C;  2KCC A;  1PVO A;  1X3E A;  1HJP A;  3NWT A;  3CU7 A;  2F0U A;  2CVR A;  1ILP A;  2K5V A;  1OXU A;  4UPA A;  2HQE A;  1TR5 A;  4FNF A;  1PFM A;  1S40 A;  1QVC A;  3HOZ G;  4WFN 3;  3CKI B;  3HG9 A;  3GTK H;  1HNW Q;  4Y52 H;  1KDC A;  4I7A A;  4CJ1 B;  4MNO A;  4YY3 Q;  1L2F A;  3GTJ H;  1S5E D;  4MIU A;  2F4I A;  4RA8 A;  2VQE Q;  1U4M A;  3CD6 A;  5T1I A;  4KY6 A;  4GN3 B;  3J7Z C;  3CC7 A;  4LNQ A;  2XWJ B;  1F2M A;  1JQY D;  3PGZ A;  3QB3 A;  4LF8 L;  3URY A;  3U4Z A;  1AE3 A;  1E2W A;  3KLR A;  4DR4 Q;  4KKU A;  2IY5 B;  4MZ9 A;  4CBV A;  4RGM A;  1WOC A;  4X62 Q;  3K5O A;  3PUV A;  3BDO A;  3HS0 C;  1EQQ A;  4JI1 L;  2JXM B;  1PRT C;  5HGT A;  3SDZ A;  2JN4 A;  3A5Z B;  3DXJ C;  4MTN A;  3IFT A;  1X55 A;  2F3W A;  2RA4 A;  3MXN B;  3AEV A;  2NVY H;  3KFU A;  4LFB L;  2AWO A;  4DV2 L;  2GVA A;  2BA1 A;  4LF4 Q;  4JBM A;  2OEO A;  2SNM A;  1D5M C;  1PTO F;  4OWX B;  5CV4 A;  1M1K C;  3EN2 A;  1IBM Q;  3FHW A;  1L1O B;  5GAD C;  3T1H L;  4K6L A;  1QVG A;  4JI6 Q;  1H95 A;  4IPG A;  3GDE A;  1WTO A;  4BY1 H;  4LF6 L;  3D4R A;  2R7D A;  4NXN Q;  4A3J G;  4DNI A;  1A2T A;  2MUY A;  3A7L A;  3U4V A;  1P8L A;  5EAY A;  1LTS D;  3A8K E;  1RIP A;  3C1F A;  4PZ6 A;  2RDG A;  3GTO H;  3I3C A;  3RLO A;  1AP0 A;  3QO2 A;  4DK3 C;  2JA7 H;  3RZD B;  2OT2 A;  1NY4 A;  1IBL Q;  2Z1C A;  1SMY D;  1OTC A;  1NR2 A;  1B3Q A;  1QIL A;  1CI3 M;  1BCP B;  3QG1 A;  4EGV A;  2AMC B;  3RZO B;  1FJG Q;  5ISR A;  1J5E Q;  1WTR A;  3E5S A;  1LLR D;  2LS0 1;  2F03 A;  1BBU A;  2L4N A;  1LT4 D;  1G6P A;  1EEI D;  1SJE D;  3I4M G;  3NEN A;  1MSG A;  3B6Y A;  2EIF A;  5C3E H;  5EKI A;  5C4Z A;  5IY0 A;  2R92 G;  4IUV A;  1D1K A;  1EY5 A;  5C4X B;  5M5X B;  1U4P A;  3I7F A;  1U5K A;  1KC8 C;  4FO2 A;  2F0V A;  3S17 H;  4A93 G;  2WAQ B;  2E74 C;  4JI2 Q;  4YWK A;  3C1E A;  2K52 A;  1Q82 C;  4DUZ Q;  2Z4H A;  1GKH A;  1CHP D;  3H0G H;  3RLN A;  1LTL A;  3VYS A;  2XGT A;  4A3I H;  1SND A;  1X9N A;  5CGK A;  2I5H A;  4CDE C;  1B2T A;  3I55 A;  2Q8T A;  2R93 H;  2K1B A;  3GTP B;  1RJT A;  3AU7 A;  4JI4 L;  3ULJ A;  3CCM A;  4DV5 L;  3OHX C;  4EQO A;  4HJ5 A;  4DV7 L;  1R9T H;  2Q8R E;  5ELN A;  1EIG A;  3UE1 A;  1TT2 A;  3ONA B;  2GA4 B;  3J7A 5;  4GKK Q;  2AQ1 B;  1STH A;  1GVP A;  4ZUI A;  4X3K A;  1FL0 A;  1SFO B;  2RDH A;  2WB1 B;  1GUT A;  3M4P A;  3HOV B;  3A56 A;  3CME A;  2JA5 H;  4JBK A;  4L5S A;  4U68 A;  1ILQ A;  1VMC A;  1ESF A;  1LTT D;  3WDN A;  1WTQ A;  1N33 Q;  1HZA A;  1LTR D;  3W1B A;  1SDF A;  4HTH A;  5FJ8 H;  1EZ8 A;  3W5O A;  5FLX E;  4FF4 A;  1D8L A;  3DHQ A;  4R9W A;  1AW7 A;  2F0H A;  3RN5 A;  2EE1 A;  4TVA B;  4LUZ A;  4KHZ A;  2BA0 A;  3I4N H;  2I46 A;  3CHB D;  1ASZ A;  1ENA A;  2PMZ B;  2EYM A;  2R7F A;  4BBR H;  4LF7 Q;  3KDF A;  4RH6 A;  2XTI A;  1TII D;  3LX0 A;  3CC4 A;  1K3R A;  1EFW A;  2XRQ D;  5IP9 H;  1KD1 C;  3GTJ B;  4A3F H;  3FKI H;  3BVM A;  4DK1 A;  3QR8 A;  3KF8 A;  2EOT A;  3BS1 A;  1KIX A;  2UXD Q;  4XQN A;  5EPL A;  2R6G A;  2N3S A;  4KJN A;  4ODG A;  3CPW A;  3CCR A;  3NEM A;  1BNZ A;  4LFC L;  5D65 A;  3S2H B;  4WJ3 M;  4IPD A;  3D31 A;  1CUK A;  1C9O A;  4KY5 A;  3HOW B;  2MP1 A;  1CQF A;  1WJJ A;  2R3Z A;  4DK6 C;  2ZTC A;  4K5V A;  2KHI A;  4X6A H;  4DA2 A;  3GQB A;  5FO8 B;  3TS0 A;  3CAM A;  1MSH A;  4OON A;  2NZO A;  2NVY B;  2VQF Q;  4NXM Q;  5G3L F;  1Y1W B;  4RGT A;  3OTO L;  2IPK D;  4DV0 Q;  4IUT A;  3DWQ A;  3GTM H;  1Q7Y C;  1WI5 A;  1TY0 A;  5GRO A;  5KNC A;  1VQ6 A;  5JEA J;  4GN5 A;  3EJI A;  3E0E A;  1I94 Q;  1SJH D;  2QCP X;  2EZV A;  2RKS A;  4CJ2 C;  4C3H G;  1V43 A;  1Q3L A;  1IW7 D;  1UE7 A;  1Z7T A;  1QNK A;  2A74 C;  4BY1 B;  3LWE A;  5HY6 A;  1PHJ A;  5E1F A;  5IGB A;  2EY1 A;  1YIT A;  5LL6 S;  2IX0 A;  3K0X A;  1LTI D;  3STB D;  4K8J A;  1YZ6 A;  4Q5V A;  3EFX D;  4R4Q A;  2EYP A;  2QW7 A;  1C7Y A;  4J6H A;  4K2L A;  3SK5 A;  3UE0 A;  1MD2 D;  4GNX C;  3VDY A;  5IYD H;  4LF8 Q;  1AE2 A;  3V05 A;  2WKD A;  3TP7 A;  1A15 A;  2PI2 E;  2KQ3 A;  2FMC A;  1M90 C;  2GVB A;  3GTQ B;  1NMG A;  1DOL A;  3NTI A;  5C4J H;  3GD7 A;  3MC0 B;  2LXK A;  4DV3 Q;  5C3E B;  3CC2 A;  2L15 A;  1GUO A;  4LFB Q;  1VQA A;  1TWA H;  1TWH B;  1ONL A;  1B44 D;  4YIJ A;  1KRS A;  1KDA A;  3S17 B;  5C3W A;  3S16 B;  3BYT B;  2FIN B;  3CQZ H;  4BA2 I;  2AQ3 B;  1CTM A;  4FF2 A;  1GUW A;  3J80 i;  4BA1 I;  3E0J A;  3CCV A;  2DN8 A;  2Z6B A;  2OQK A;  1P16 A;  2F3V A;  4K5W A;  1PH2 A;  4A3I B;  4JI7 L;  1E3P A;  1F2Z A;  4A75 A;  3J7A F;  1HUM A;  3PO2 H;  4MTK A;  3KOJ A;  3AB9 A;  3W1G A;  4JI0 L;  1IKL A;  5IWA L;  1XNQ Q;  1PRT B;  2R93 B;  1XMO L;  3S1Q B;  1ROD A;  3DWA A;  2HT1 A;  1HNZ Q;  4RAU C;  3MAQ A;  2ZJP A;  2JJQ A;  3CCQ A;  5FKA C;  4PQX A;  4IQZ A;  4QJF A;  4C2M H;  2EYH A;  1DON A;  1BCP F;  2JA5 B;  1FNW A;  3TZD A;  4OWT B;  5E3F A;  5H1S E;  4XYQ A;  3E3X A;  4V19 0;  3J81 L;  4IFD J;  3CF5 A;  5LMU L;  4EQP A;  3OYY A;  1W2B A;  1LAC A;  2PPB C;  5C4X G;  3S1N H;  4DNT B;  3E9I A;  1B7Y B;  5FLX L;  1I4Q A;  1TS3 A;  3DEP A;  1EY8 A;  1YJW A;  3Q23 A;  4DXG A;  1IL2 A;  5E4W C;  3TDQ A;  3I4N B;  4JYA L;  1H9J A;  1QUQ B;  1PTO D;  1B1Z A;  3VR5 A;  3F2C A;  2X69 A;  1SMY C;  1K0R A;  3G6E A;  2B39 A;  2J7Z A;  3V2T A;  3FKI B;  3PQI A;  4MHE A;  4CDD C;  5ELO A;  1G51 A;  3F2U A;  4KMU C;  3KJO A;  5D14 A;  1SNO A;  2HD3 A;  2YU9 B;  4A3K G;  2L55 A;  1CQV A;  2NN6 I;  4RCN A;  4QY7 A;  2O5J C;  1V1Q A;  5J22 A;  2EYF A;  3J80 E;  5KEE A;  4OO1 H;  4DR5 Q;  5C5M A;  3T1Y L;  3KF6 B;  3M3Y B;  3SK6 A;  3BU2 A;  4QCL A;  2PZU A;  1J8I A;  1IKM A;  1Q12 A;  1YHA A;  4R4I A;  3BDC A;  4TSS A;  1JE5 A;  3OPO A;  4C3I B;  1IBK L;  5M3M G;  1N36 L;  1SE8 A;  1S3O A;  1L0X B;  2CWP A;  2A6H D;  4F88 A;  1HZC A;  1XJV A;  2TSS A;  3FDT A;  1EYA A;  4BWG B;  4BY7 H;  4I7Z C;  4HIM A;  1RD9 D;  3GTM B;  2ZTE A;  1I6H H;  1JOR A;  1EIY B;  4E6I A;  2AUJ D;  3KJP A;  3MXU A;  1J9O A;  1FNV A;  2VUM G;  1WTP A;  1F2L A;  3I91 A;  2F4V L;  2RVL A;  3SK4 A;  3C46 A;  5CBE E;  1HQM C;  1SMX A;  1STY A;  1JR0 D;  2V4D A;  3FEW X;  2PCF B;  3A0J A;  5DM7 3;  1IZ6 A;  1VQ8 A;  1HTL D;  3T51 B;  1E7Z A;  4JI8 L;  4LF5 L;  2B2U C;  4UP9 A;  1B3A A;  5F2D A;  1X6O A;  4HED A;  4GLX A;  4IN3 A;  1N34 Q;  3PUW A;  3HOW G;  1BOS A;  3HOU H;  1PH9 A;  1X54 A;  3S1M B;  2OWO A;  5M3F H;  1RTN A;  5E7N A;  2CH4 A;  4WJ4 A;  2EXD A;  3PSI A;  1KXL A;  3PIO 3;  2YTV A;  1Y1W G;  1NUC A;  1EOT A;  4QB4 A;  3M7G A;  1U4L A;  2G5D A;  1PH7 A;  1YVC A;  5C4J B;  3VYR A;  4O0A A;  4DV6 Q;  4FYD A;  2F0F A;  1X32 A;  1CKN B;  1TS4 A;  2UUA Q;  4B3M L;  1N32 L;  4QGU A;  2K03 A;  4KI0 A;  3TQY A;  1K73 C;  3PO3 H;  4GNX A;  3TZU A;  2A68 D;  1K8M A;  1H9S B;  3UDF A;  3D4D A;  3K80 C;  1EYC A;  1NBW A;  3TP8 A;  4HN7 A;  2OF1 A;  1PV4 A;  1STG A;  1V1P A;  4N9T A;  4O2D A;  3ERS X;  1OXV A;  5BN5 A;  1VQP A;  4L5R C;  4JCV E;  4LF9 Q;  1JB3 A;  3VR6 A;  1MBY A;  1JB7 A;  2R7Z G;  3PO2 B;  1RHP A;  2JA8 H;  2O2L D;  1NCV A;  5I4D A;  4G4K A;  2JE6 I;  1W3S A;  5EKL A;  4EQ5 A;  2LXJ A;  3T53 B;  3FPP A;  1EQV A;  2KA7 A;  5DM6 3;  3HOX H;  2BH8 A;  4A3L H;  1DOM A;  2Z9H A;  4ME5 A;  4UP7 A;  4C2M B;  1Q81 C;  3J7A V;  2XIW A;  1BO0 A;  2CQO A;  3J80 c;  2M00 A;  1KHI A;  4HJ7 A;  1DXM A;  1NAP A;  2EYO A;  2P5Z X;  2PI2 A;  4JC0 A;  5NUC A;  4IUR A;  4DAY A;  4POF A;  1WTV A;  1I4H A;  2M9V A;  2UXC Q;  3A8I E;  5I9P A;  2NB0 A;  3MFG A;  4C3J B;  1JE4 A;  3S1N B;  1CSP A;  1EFI D;  4XQJ A;  1IW7 C;  2VW9 A;  3K59 A;  4FP5 D;  4ZK9 B;  5G3L D;  5GAH C;  3DLL A;  1Y1V G;  3GTL H;  1ML0 D;  1VMP A;  4B3R Q;  4GOP C;  3TRE A;  3OW2 A;  4A3I G;  1NSN S;  3STB C;  4P73 A;  2CCZ A;  3S9W A;  3G7L A;  5BN3 A;  2VY3 A;  3KLW A;  3P75 A;  3BZC A;  2F0D A;  1HZB A;  4ZRZ A;  1VQC A;  4X3S A;  5EBD A;  3BVZ A;  3U9O A;  2EYJ A;  2RF4 A;  5FOB B;  4JI0 Q;  1CHQ D;  5IWA Q;  4DR3 L;  1EWI A;  3PMF A;  1PRT F;  1VQJ A;  1XMO Q;  2HUG A;  2XNA C;  4DFA A;  4R4O A;  1FYC A;  4A3M H;  3J80 L;  2B2T A;  4DR6 Q;  5KYL A;  2B63 H;  5L37 A;  1CZG A;  4AQY Q;  1X3P A;  4L5T A;  1XTD A;  1HPC A;  4FXG C;  2NWG A;  3TP5 A;  3WOF A;  1GHK A;  3DEO A;  1BUV T;  3WWV A;  4EQN A;  1C8C A;  4NDX A;  2E2I H;  1QCB D;  3CXC A;  1TXY A;  3V96 A;  3OSO A;  2Q2U A;  2B8F A;  5J39 A;  2VB2 X;  1I6H B;  2D9U A;  1F9Q A;  4IZ8 A;  1PMR A;  2HDM A;  3SE0 A;  5FO7 B;  2WII B;  4M8A A;  3UI2 A;  2C5C A;  5IP9 G;  3CCJ A;  1AZQ A;  5GAE C;  4BXX H;  4OIJ A;  3FKI G;  1EL0 A;  1Y8P B;  4JYA Q;  1PZJ D;  1R4Q B;  4DV4 Q;  5BR8 L;  4PMC A;  4ZUJ A;  1SNQ A;  3MEF A;  4XT3 B;  4DV1 L;  5IP7 G;  3Q24 A;  3AFP A;  2UUB L;  4B3S Q;  1BF4 A;  1JIC A;  5I6W A;  4BBS B;  1Q86 C;  2JA6 H;  2F0T A;  3HOY H;  4KN4 C;  1CKM A;  3J81 i;  5IYB G;  2BDO A;  4A3B B;  3HOU B;  4C1N K;  5JPM C;  5COR A;  5JJZ A;  1S5D D;  5M3F B;  2E2H H;  1TQO A;  4GN4 B;  1PH8 A;  4C3I G;  3E9H A;  1O80 A;  4ME3 A;  2RSN A;  1GM5 A;  3PF4 A;  4NPS A;  1BCP D;  5AJ3 Q;  4R4C A;  1IHZ A;  4A3E H;  2Z6K C;  1V9P A;  1E0B A;  3CW2 C;  5C0X I;  3KK7 A;  2ZT9 C;  4HJ8 A;  2B2U A;  2MJ8 A;  4DR2 L;  5K36 G;  5JAV A;  1IBK Q;  1UNS A;  1Q8K A;  2BE5 D;  4LK1 C;  3H3V I;  2MHV A;  1XMQ Q;  4LFA L;  3PO3 B;  1Z9F A;  4JBW A;  2Y0S E;  5ELB A;  3X3N A;  2B8G A;  3HRZ C;  3A5U A;  5C44 G;  1I5F A;  2F3I A;  3G4S A;  4DUY Q;  2F0W A;  1F9R A;  3QIA A;  1WTH A;  2C35 B;  4CKB A;  3QOJ A;  5M5Y H;  3K57 A;  1J6Q A;  1HR0 Q;  1UUP A;  1VQI A;  2E8G A;  3U9S A;  2NBF A;  4KY7 A;  2EYL A;  4IAL A;  4RGN A;  1WCM H;  2JA8 B;  3RUZ A;  3UDG A;  3N6R A;  1YNX A;  2O4X A;  2F0N A;  2CWA A;  3BYY B;  5CV7 A;  4PMB A;  4R8I A;  2NVX H;  4YCV A;  2DGY A;  3PV0 A;  2NN6 H;  5CV6 A;  4KV6 A;  4R4T A;  3HOX B;  2A6H C;  2JYO A;  4DN4 M;  1HR0 W;  1T9H A;  3PUX A;  1SAP A;  2LFN A;  3HKS A;  3NEL A;  4L6T B;  4XTC S;  1TS2 A;  4GKJ L;  3K8A A;  1BBX C;  5LMN Q;  4XT1 B;  1CM9 A;  1QG7 A;  4DNR B;  4JV5 Q;  3L3O C;  3HOZ H;  3J81 E;  4IFD I;  2A69 D;  3S15 H;  4X64 Q;  1L0W A;  2BOS A;  4ZQ3 A;  3I72 A;  2QDB A;  3R2I A;  5GQO A;  2JK8 A;  5HGQ A;  2F0J A;  3GTL B;  2DNE A;  4YWL A;  5FLM H;  2B2V C;  3VR2 A;  1W6J A;  3BVG A;  1GXD C;  5LMN W;  3FVQ A;  3M85 A;  3D4W A;  4G57 A;  3GTK B;  1QB5 D;  1I50 H;  2HHH Q;  4A3G H;  1SNC A;  1NMF A;  2VXW A;  1VQ4 A;  1ASY A;  5EBC A;  2F0M A;  3CMA A;  2F0Q A;  3H15 A;  4IJL A;  3IAY A;  3TP6 A;  4JI5 Q;  4FF1 A;  2EVB A;  4WJW A;  1Z47 A;  4P71 A;  4PMW A;  4S3S A;  4GOP A;  4L5Q A;  1SYG A;  2B3G A;  5CV5 A;  4DKA C;  1HNX Q;  4A3M B;  5JEA G;  1SR3 A;  2K5Q A;  3QJY A;  4K0K Q;  2ZM6 L;  3F8T A;  4C3J G;  3AQQ A;  1ZEQ X;  4QIW E;  2L9H A;  2A68 C;  1Q1E A;  4CDC C;  1HFN A;  1UEB A;  4OGQ C;  2E2I B;  1OXT A;  2KHJ A;  3HKZ G;  5D3D A;  5J1Z A;  5I6Y A;  4HMJ A;  3RN2 A;  3L0O A;  4ALP A;  4A3J H;  1T5E A;  3PIO A;  5EJW A;  1QWY A;  2JP1 A;  3UDI A;  4R1J A;  5LHY 1;  1PH5 A;  4G7H C;  1NR4 A;  1X3Q A;  3P7J A;  2UU9 Q;  1PZK D;  1YI2 A;  3ITP A;  3OMG A;  4HJA A;  3M7N A;  4F8M A;  2OTL A;  4CKC A;  4G7Z C;  2KJX A;  3A55 A;  1VQN A;  3I8Z A;  4PZ8 A;  2XSC A;  1K3B C;  2NZH A;  1I4P A;  3RD4 A;  5C0X G;  4P72 A;  5JVG 3;  3T13 A;  1A62 A;  3R3O A;  1O78 A;  4IUQ A;  2NZ1 D; 
#chains in the Genus database with same CATH homology
 1SEB D;  1DYQ A;  3MXP A;  2JA6 B;  3GTO B;  3K5N A;  2WAC A;  2F0E A;  4XQQ A;  3KUP A;  4KN7 C;  4RKB A;  2JA7 B;  3VA7 A;  1H9K A;  3Q22 A;  2SDF A;  1C4Q A;  2D2C C;  1HFG A;  4QMG A;  1TU2 B;  2E2H B;  4G7O C;  1ET6 A;  2KEC A;  2QEJ C;  1PXU A;  4A3E B;  1B50 A;  4KTA A;  1EEF D;  1ZYR D;  5C0X J;  3H09 A;  5IGD A;  2HCI A;  2A6E D;  3LWU A;  3NE5 B;  5D3I B;  3C3L A;  5CC4 A;  1HTP A;  2E76 C;  1SE4 A;  2KVM A;  4K2K A;  2L5T A;  5TSS A;  3TBI B;  3KLS A;  1JWS D;  5M5Y B;  2PNR C;  2WIN B;  3QWN A;  4ABN A;  3Q0A A;  2FHT A;  3H0G B;  4V0B A;  4IFD G;  2D5D A;  1WCM B;  2B2Y C;  1R4P B;  2PW5 A;  4RHS A;  4OHJ A;  1DM0 B;  4WOR A;  1PRT D;  3SK8 A;  2FMM A;  1R9T B;  3NPP A;  4OL7 A;  3VR4 A;  4N9P A;  1AFP A;  3CRL C;  3K0Y A;  3R93 A;  4KKS A;  1GJX A;  3HOZ B;  1V8Q A;  3HP3 A;  4XYO A;  4IUU A;  1W6K A;  3S15 B;  3TME A;  4DAP A;  1ESR A;  3DMU A;  1EWC A;  4J8Q A;  5ELF A;  1G91 A;  2Q8I B;  2ZXO A;  2L12 A;  3OMC A;  1U9R A;  3IKJ A;  3NTK A;  1LTB D;  5DNF A;  2JEA I;  1QOH A;  4ULL A;  2Z4I A;  5LL6 X;  1E2V A;  1RCV D;  2B2T C;  4BBR B;  1I50 B;  4A3G B;  1VCI A;  4A3F B;  2LKV A;  1CA6 A;  1JOK A;  1IYV A;  1S5B D;  3KBG A;  1STB A;  1QE6 A;  2B2V A;  3SR1 A;  4NKL A;  2BE5 C;  1XXG A;  2ZXR A;  2EJM A;  1ET9 A;  3BG3 A;  1EU3 A;  4HR7 B;  1AN8 A;  1IYU A;  1MI2 A;  1HQR D;  2F0K A;  3SHL A;  2X6G A;  1OXS C;  1RTO A;  3DUZ A;  1GHJ A;  1ZXT A;  2B2W C;  3JAM E;  1VDZ A;  3A54 A;  1G8Z D;  2C9O A;  2KHS A;  2Y0S B;  4HSP A;  5T1G A;  5EKK A;  1S4Z A;  4NW2 A;  1UEA B;  2PW7 A;  2RBM A;  5C3X A;  5IGC A;  1SNM A;  2EY2 A;  2K5W A;  3C2P A;  3FRP B;  2XRS D;  1GOZ A;  1EY9 A;  1BQQ T;  2NVQ B;  3IL8 A;  2A69 C;  3LNN A;  5BN4 A;  2TMP A;  2R92 B;  1EY0 A;  1E2Z A;  3TSS A;  1BDO A;  4A93 B;  4K6D A;  3DM1 A;  4KKT A;  4F87 A;  3BDL A;  3R8B A;  3MZ5 A;  2F0I A;  1YNJ D;  1G2S A;  1PYW D;  5DEH A;  5HUR A;  2AWN A;  4NMZ A;  2PYK A;  4A3D B;  1TWA B;  3VYU A;  3W3A A;  1TWG B;  4H0L C;  2MGS A;  2EXZ A;  3CQZ B;  4ILW A;  1II3 A;  2IL8 A;  3A8J E;  3X3M A;  1ENC A;  2L11 A;  4H13 C;  2QKI C;  4ZKC B;  3MVV A;  3DWP A;  2F1M A;  5E4X A;  3VYT A;  4Y7N B;  1BXT A;  3WOE A;  3MXG A;  1V1O A;  4PNY A;  3NQI A;  4RFB A;  5FK9 C;  5KGU A;  2J0T D;  1U4R A;  1SYE A;  2B2Y A;  3NSW A;  4QIW B;  2H4O A;  2CW0 D;  2RQX A;  1SYF A;  4C1N I;  3BZD B;  1Q1B A;  3GV3 A;  3Q6S A;  1CT1 D;  1FR3 A;  2SOB A;  3H94 A;  1Y8N B;  2E75 C;  3RLF A;  5JVH 3;  1OXX K;  3MXN A;  1G29 1;  4HSV A;  4L8J A;  2QF7 A;  1HA5 A;  5M9O A;  3NBI A;  1SNP A;  1V1P B;  3H91 A;  4KHV A;  2PQE A;  2JSO A;  3ND9 A;  5EQ0 A;  3VA5 A;  3KLS X;  1A2U A;  1ZYR C;  2XWB B;  5CV8 A;  1UAP A;  2A6E C;  2F0P A;  1DCZ A;  4B08 A;  1F9P A;  1FGB D;  4LMQ D;  2LMC B;  4C3H B;  3P1H A;  5A2Q E;  1KLU D;  1F2Y A;  5KYI A;  3S1R B;  2FJ2 A;  1KNE A;  1FD7 D;  3ZYY X;  1IL8 A;  1TS5 A;  4BY7 B;  1VF5 C;  5EPK A;  3JAM L;  2F0L A;  3GTG B;  4NP5 A;  1KAB A;  3D3R A;  2A5H A;  1CZW A;  3GO5 A;  5I2X A;  5I9O A;  2PO4 A;  1KNA A;  5M5W B;  2D62 A;  2WV6 D;  4FXK C;  2H1E A;  1KAA A;  2ENB A;  4RHR A;  2Z8L A;  2EDG A;  2B2W A;  3S14 B;  1JWM D;  1O7Z A;  1LAB A;  2VNU D;  5IGF A;  4O1N A;  3RMH A;  1A3V A;  2NYZ D;  2IJ0 A;  5K5P A;  1KLG D;  4FF3 A;  3PUY A;  3R2T A;  3D6C A;  1A3U A;  1M4V A;  4K8I A;  4I65 A;  3J7Y W;  1XYI A;  1PTO C;  3IFD A;  1CA5 A;  3EVQ A;  4OO1 I;  1WD0 A;  5JPN C;  2K01 A;  4K5X A;  4KD4 A;  4CKE A;  1TWF B;  5IIF A;  1KDB A;  1PFN A;  1Y8O B;  2I07 B;  3L9A X;  3HGB A;  1ENF A;  1KTK A;  1LT3 D;  1EIH A;  1LT5 D;  3PIP 3;  3SXH A;  4DAV A;  1B53 A;  5COY A;  3NTH A;  3OW7 A;  3OWE B;  2G9D A;  4X3U A;  2OXP A;  4AYB B;  5IOD A;  3T56 B;  3NQT A;  3OWF A;  4TQU S;  4HAE A;  1AZP A;  1GUN A;  1Q8I A;  2K28 A;  2MPM A;  3K5L A;  4A3K B;  2K6A A;  1WTX A;  1C48 A;  1HCZ A;  3VR3 A;  1TWC B;  3T4A C;  4KD3 A;  2K5D A;  5KND A;  5EPJ A;  1H9R A;  1SYD A;  2KOL A;  1O7L A;  1JOO A;  3O13 A;  3P20 A;  1LT6 D;  1YNN D;  4IUN A;  4ZKB B;  4UDU C;  4O42 A;  5M3M B;  2QIL A;  5IGE A;  1PTO H;  3K6O A;  1JOQ A;  1YNJ C;  1I4X A;  3OIP A;  2AUK A;  4MN3 A;  2B63 B;  2RDF A;  1Z6H A;  4U67 3;  1WVL A;  4WRD A;  1LV9 A;  4Q0F A;  2VUM B;  3GV6 A;  4KK7 A;  2HCC A;  2IX1 A;  5A2Q L;  4L63 B;  4M1U B;  2CQA A;  5CR3 A;  5CYU A;  1F77 A;  3FPU B;  4FXD A;  1LTA D;  1D2B A;  1F9S A;  4XXE A;  1D6E C;  1EZ6 A;  1DZ1 A;  1XTC D;  4DXF A;  3SVM A;  4LJZ C;  2BCO A;  1SYB A;  3GP7 A;  1DD2 A;  2K7V A;  4HMI A;  1EY7 A;  3E6Z X;  5IOC A;  1PLF A;  4ID6 A;  4PV1 C;  2IT1 A;  3NWS A;  3D8G A;  3KBX A;  5CMD A;  4RCO A;  4OO1 G;  3HOY B;  3ERQ A;  5K36 H;  2CW0 C;  2EY5 A;  4XDX A;  4CHT B;  5ELD A;  1RDP D;  1HUN A;  5C4H A;  2F0G A;  4B9X A;  2WP8 J;  4ZAI A;  2KEE A;  1GUG A;  1BR9 A;  5C5L A;  3MHB A;  1DJR D;  5I2Y A;  4R8N A;  2R7Z B;  1SYC A;  2J4X A;  1HRJ A;  3D6W A;  4DF7 A;  3ND8 A;  3MFY A;  1PDQ A;  1A6X A;  4X3T A;  1TKW B;  1DOK A;  4EVO A;  3I73 A;  2WKC A;  1JCK B;  1JWU D;  2ID0 A;  4DU9 A;  5KIX A;  1AEX A;  2K33 A;  5C6A A;  1Y69 U;  1EWH A;  1CFM A;  2PZW A;  5CV9 A;  1PFB A;  3M4Y A;  4DGZ A;  1LTG D;  1I3Q B;  3H3V C;  3MEH A;  1WD1 A;  2SEB D;  3L7Z C;  1HXY D;  1SSO A;  1VF7 A;  5EGT A;  3H6M A;  2NVX B;  4H7B A;  5DAU A;  2PZT A;  3NP8 A;  1Y1V B;  2A73 B;  2CHB D;  4QUC A;  2K05 A;  4C56 C;  1M8A A;  3HEJ A;  3HZX A;  2FFK B;  3G6J B;  3NK9 A;  4FVM A;  5KNB A;  4RGO S;  1ICW A;  4JK1 C;  2NTT A;  2EPB A;  4TKO B;  1EQT A;  4QUF A;  2EJG C;  2N55 A;  1EU4 A;  1S5F D;  2ICE C;  4TRD A;  4IUP A;  5JEA H;  3NBH A;  5CBA E;  1H9M A;  2XVS A;  4RWS C;  1EY4 A;  4K14 A;  5IT9 E;  3NXW A;  2SNS A;  2ICI A;  3OIQ A;  1PTO B;  2L1B A;  2JEB I;  1BCP C;  3FMC A;  1B4O A;  4HCS A;  4XIG S;  3OOC A;  1ZKO A;  3PUZ A;  2EJF C;  3W2D A;  5A35 A;  1RKN A;  2KUM A;  4QF4 A;  1XWE A;  3S2D B;  5C0X H;  3TN2 A;  2O5I C;  4CGY B;  1TY2 A;  4A3J B;  1G2T A;  1STE A;  1S5C D;  1SXT A;  2NUC A;  5FO9 B;  3EA6 A;  1SBB B;  2DY8 A;  4KJO A;  1WTW A;  4P2C B;  2F0O A;  2N88 A;  1I4G A;  1QJO A;  3N52 A;  3K7A B;  1CK1 A;  1H9S A;  1B9N A;  4ZYS A;  1T5X D;  4LAA A;  1B9M A;  1PZI D;  2VB3 X;  3I4M B;  3I70 A;  1STA A;  1K8O A;  3K5M A;  5C44 B;  1G6Z A;  2X6L A;  1SE2 A;  5JOB A;  3I4L A;  3EQL C;  1SE3 A;  4GZY C;  2EY6 A;  2NTS A;  2DY7 A;  4IFD H;  3T16 A;  1QNU A;  3MWY W;  2G9H D;  1YNN C;  2IW3 A;  4HCE A;  1STN A;  3A7A B;  5KRU A;  1MGS A;  3MTS A;  1A3T A;  1EYD A;  2RSO A;  2IWH A;  3K58 A;  5ELE A;  2K32 A;  1GUS A;  2M2L A;  4H44 C;  3ERO A;  1EY6 A;  3I90 A;  2R61 A;  4CJ0 B;  3AMU A;  1Q90 A;  1D5X C;  2KED A;  4UAI A;  1HA6 A;  3NHH A;  3NUC A;  4OIK A;  2DNC A;  2ZXP A;  1L0Y B;  2IX3 A;  1D1I A;  2L0C A;  2YYZ A;  1OO9 B;  1JC7 A;  4J1M A;  4DK0 A;  1TVX A;  2LY7 A;  5AFW A;  4Z9C B;  1FNU A;  1K83 B;  1LO5 D;  2KCN A;  4BS9 A;  4ZLT F;  5IGG A;  1I4R A;  4F7X A;  2F0S A;  2E2D C;  1O7Y A;  4RKL A;  3QOL A;  3MA2 B;  1RF2 D;  2K04 A;  2XN9 C;  2HDL A;  2E2J B;  1HHV A;  1XX8 A;  3M4O B;  2NVT B;  2BDN A;  5ELC A;  4B9W A;  2AQ2 B;  5IT9 L;  1D5Z C;  3SEB A;  2NN6 G;  3HKZ B;  3CRK C;  1I6V C;  2KCC A;  3NWT A;  3CU7 A;  2F0U A;  2CVR A;  1ILP A;  1OXU A;  2HQE A;  1TR5 A;  4FNF A;  1PFM A;  4WFN 3;  3CKI B;  3HG9 A;  1KDC A;  4CJ1 B;  1S5E D;  4MIU A;  2F4I A;  4RA8 A;  1U4M A;  5T1I A;  4KY6 A;  2XWJ B;  1F2M A;  1JQY D;  3QB3 A;  3URY A;  1E2W A;  3KLR A;  4KKU A;  4CBV A;  4RGM A;  3K5O A;  3PUV A;  3BDO A;  3HS0 C;  2JXM B;  1PRT C;  5HGT A;  3SDZ A;  3DXJ C;  3IFT A;  2F3W A;  2RA4 A;  2AWO A;  2BA1 A;  2OEO A;  2SNM A;  1D5M C;  1PTO F;  5CV4 A;  4K6L A;  1WTO A;  3D4R A;  1A2T A;  2MUY A;  3A7L A;  1LTS D;  3A8K E;  3C1F A;  2RDG A;  3I3C A;  1AP0 A;  3QO2 A;  3RZD B;  2OT2 A;  2Z1C A;  1SMY D;  1NR2 A;  1QIL A;  1CI3 M;  1BCP B;  3QG1 A;  4EGV A;  3RZO B;  5ISR A;  1WTR A;  3E5S A;  1LLR D;  2LS0 1;  2F03 A;  2L4N A;  1LT4 D;  1EEI D;  1SJE D;  1MSG A;  5C4Z A;  5EKI A;  4IUV A;  1D1K A;  1EY5 A;  5C4X B;  5M5X B;  1U4P A;  4FO2 A;  2F0V A;  2WAQ B;  2E74 C;  3C1E A;  2Z4H A;  1CHP D;  3VYS A;  1SND A;  5CGK A;  1B2T A;  2Q8T A;  2K1B A;  3GTP B;  1RJT A;  3AU7 A;  3OHX C;  4EQO A;  2Q8R E;  1EIG A;  1TT2 A;  3ONA B;  2GA4 B;  2AQ1 B;  1STH A;  4ZUI A;  4X3K A;  1SFO B;  2RDH A;  2WB1 B;  1GUT A;  3HOV B;  3A56 A;  4U68 A;  1ILQ A;  1VMC A;  1ESF A;  1LTT D;  3WDN A;  1WTQ A;  1LTR D;  1SDF A;  4HTH A;  1EZ8 A;  5FLX E;  4FF4 A;  3DHQ A;  4R9W A;  1AW7 A;  2F0H A;  2EE1 A;  4KHZ A;  2BA0 A;  2I46 A;  3CHB D;  1ENA A;  2PMZ B;  2EYM A;  4RH6 A;  1TII D;  3LX0 A;  2XRQ D;  3GTJ B;  4DK1 A;  3BVM A;  3KF8 A;  2EOT A;  3BS1 A;  4XQN A;  5EPL A;  2R6G A;  4KJN A;  4ODG A;  1BNZ A;  5D65 A;  3S2H B;  3D31 A;  4KY5 A;  3HOW B;  2MP1 A;  1CQF A;  2R3Z A;  4K5V A;  4DA2 A;  3GQB A;  5FO8 B;  1MSH A;  2NVY B;  5G3L F;  1Y1W B;  4RGT A;  2IPK D;  4IUT A;  3DWQ A;  1TY0 A;  5KNC A;  5JEA J;  3EJI A;  1SJH D;  2QCP X;  2EZV A;  2RKS A;  4CJ2 C;  4C3H G;  1V43 A;  1Q3L A;  1IW7 D;  1Z7T A;  1QNK A;  2A74 C;  4BY1 B;  3LWE A;  5E1F A;  5IGB A;  2EY1 A;  5LL6 S;  2IX0 A;  1LTI D;  4K8J A;  4Q5V A;  3EFX D;  2EYP A;  4J6H A;  4K2L A;  3SK5 A;  1MD2 D;  3V05 A;  2WKD A;  3TP7 A;  1A15 A;  2KQ3 A;  2FMC A;  3GTQ B;  1DOL A;  3NTI A;  3GD7 A;  3MC0 B;  5C3E B;  1GUO A;  1TWH B;  1ONL A;  1B44 D;  4YIJ A;  1KDA A;  3S17 B;  5C3W A;  3S16 B;  3BYT B;  2FIN B;  4BA2 I;  2AQ3 B;  1CTM A;  4FF2 A;  1GUW A;  4BA1 I;  3E0J A;  2DN8 A;  4K5W A;  3J7A F;  2F3V A;  4A3I B;  1F2Z A;  1HUM A;  3AB9 A;  1IKL A;  1PRT B;  2R93 B;  3S1Q B;  1ROD A;  3DWA A;  4RAU C;  3MAQ A;  5FKA C;  4PQX A;  4IQZ A;  2EYH A;  1DON A;  1BCP F;  2JA5 B;  1FNW A;  3TZD A;  5E3F A;  4XYQ A;  4V19 0;  3J81 L;  4IFD J;  4EQP A;  1LAC A;  2PPB C;  4DNT B;  5FLX L;  1I4Q A;  1TS3 A;  3DEP A;  1EY8 A;  3I4N B;  3Q23 A;  4DXG A;  5E4W C;  3TDQ A;  1H9J A;  1PTO D;  1B1Z A;  3VR5 A;  2X69 A;  1SMY C;  2B39 A;  2J7Z A;  3V2T A;  3FKI B;  4MHE A;  3F2U A;  4KMU C;  5D14 A;  1SNO A;  2YU9 B;  2L55 A;  1CQV A;  2NN6 I;  4RCN A;  2O5J C;  5J22 A;  2EYF A;  3J80 E;  5KEE A;  4OO1 H;  5C5M A;  3M3Y B;  3SK6 A;  4QCL A;  2PZU A;  1J8I A;  1IKM A;  1Q12 A;  3BDC A;  4TSS A;  3OPO A;  4C3I B;  4F88 A;  1L0X B;  2A6H D;  2TSS A;  3FDT A;  1EYA A;  4BWG B;  4I7Z C;  1RD9 D;  3GTM B;  1JOR A;  4E6I A;  2AUJ D;  3MXU A;  1J9O A;  1FNV A;  1WTP A;  1F2L A;  3I91 A;  2RVL A;  3SK4 A;  3C46 A;  5CBE E;  1HQM C;  1STY A;  1JR0 D;  2V4D A;  3FEW X;  2PCF B;  5DM7 3;  1HTL D;  3T51 B;  2B2U C;  1B3A A;  5F2D A;  4HED A;  4IN3 A;  3PUW A;  1BOS A;  3S1M B;  1RTN A;  3PIO 3;  1NUC A;  1EOT A;  4QB4 A;  3M7G A;  1U4L A;  5C4J B;  3VYR A;  4FYD A;  2F0F A;  1X32 A;  1TS4 A;  2K03 A;  4KI0 A;  3TZU A;  2A68 D;  1K8M A;  1H9S B;  3D4D A;  1EYC A;  3TP8 A;  4HN7 A;  2OF1 A;  1STG A;  1V1P A;  4N9T A;  1OXV A;  5BN5 A;  1JB3 A;  3VR6 A;  1MBY A;  3PO2 B;  1RHP A;  2O2L D;  1NCV A;  5I4D A;  4G4K A;  2JE6 I;  5EKL A;  3T53 B;  3FPP A;  1EQV A;  2KA7 A;  5DM6 3;  1DOM A;  4ME5 A;  4C2M B;  3J7A V;  2XIW A;  1BO0 A;  2M00 A;  1DXM A;  1NAP A;  2EYO A;  5NUC A;  4IUR A;  4DAY A;  1WTV A;  1I4H A;  2M9V A;  3A8I E;  5I9P A;  2NB0 A;  3MFG A;  4C3J B;  1JE4 A;  3S1N B;  1EFI D;  4XQJ A;  1IW7 C;  3K59 A;  4FP5 D;  4ZK9 B;  5G3L D;  1ML0 D;  1VMP A;  1NSN S;  3S9W A;  3G7L A;  5BN3 A;  3P75 A;  2F0D A;  4ZRZ A;  4X3S A;  5EBD A;  3BVZ A;  3U9O A;  2EYJ A;  5FOB B;  1CHQ D;  3PMF A;  1PRT F;  2HUG A;  2XNA C;  4DFA A;  1FYC A;  3J80 L;  2B2T A;  5KYL A;  1CZG A;  1X3P A;  1HPC A;  4FXG C;  2NWG A;  3TP5 A;  3WOF A;  1GHK A;  3DEO A;  1BUV T;  4EQN A;  1C8C A;  4NDX A;  1QCB D;  3V96 A;  3OSO A;  2B8F A;  5J39 A;  2VB2 X;  1I6H B;  2D9U A;  1F9Q A;  4IZ8 A;  1PMR A;  2HDM A;  3SE0 A;  5FO7 B;  2WII B;  4M8A A;  3UI2 A;  2C5C A;  1AZQ A;  4OIJ A;  1EL0 A;  1Y8P B;  1PZJ D;  1R4Q B;  4PMC A;  4ZUJ A;  1SNQ A;  4XT3 B;  3Q24 A;  1BF4 A;  1JIC A;  5I6W A;  4BBS B;  2F0T A;  4KN4 C;  2BDO A;  4A3B B;  3HOU B;  4C1N K;  5JPM C;  5COR A;  5JJZ A;  1S5D D;  5M3F B;  1TQO A;  4C3I G;  1O80 A;  2RSN A;  1BCP D;  1IHZ A;  1E0B A;  5C0X I;  3KK7 A;  2ZT9 C;  2B2U A;  2MJ8 A;  5K36 G;  5JAV A;  1UNS A;  2BE5 D;  4LK1 C;  2MHV A;  3PO3 B;  4JBW A;  5ELB A;  3X3N A;  2B8G A;  3HRZ C;  2F0W A;  1F9R A;  3QIA A;  4CKB A;  3K57 A;  3QOJ A;  1UUP A;  3U9S A;  2NBF A;  4KY7 A;  2EYL A;  4IAL A;  4RGN A;  2JA8 B;  3RUZ A;  3N6R A;  2O4X A;  2F0N A;  3BYY B;  5CV7 A;  4PMB A;  4R8I A;  5CV6 A;  3PV0 A;  2NN6 H;  4KV6 A;  3HOX B;  2A6H C;  2JYO A;  4DN4 M;  3PUX A;  1SAP A;  2LFN A;  4L6T B;  4XTC S;  1TS2 A;  1BBX C;  4XT1 B;  1CM9 A;  1QG7 A;  4DNR B;  3L3O C;  3J81 E;  4IFD I;  2A69 D;  2BOS A;  4ZQ3 A;  3I72 A;  2QDB A;  3R2I A;  2F0J A;  3GTL B;  2DNE A;  2B2V C;  3VR2 A;  1W6J A;  3BVG A;  1GXD C;  3FVQ A;  3M85 A;  3D4W A;  4G57 A;  3GTK B;  1QB5 D;  1SNC A;  2VXW A;  5EBC A;  2F0M A;  2F0Q A;  3IAY A;  3TP6 A;  4FF1 A;  2EVB A;  4WJW A;  1Z47 A;  4PMW A;  4S3S A;  1SYG A;  5CV5 A;  4A3M B;  5JEA G;  2K5Q A;  3QJY A;  4C3J G;  1ZEQ X;  2L9H A;  2A68 C;  1Q1E A;  1HFN A;  4OGQ C;  2E2I B;  1OXT A;  5D3D A;  5I6Y A;  5J1Z A;  4HMJ A;  1T5E A;  5EJW A;  1QWY A;  2JP1 A;  5LHY 1;  4G7H C;  1NR4 A;  1X3Q A;  3P7J A;  1PZK D;  3ITP A;  3OMG A;  3M7N A;  4F8M A;  4CKC A;  4G7Z C;  2KJX A;  3A55 A;  3I8Z A;  2XSC A;  1I4P A;  3RD4 A;  5C0X G;  5JVG 3;  3T13 A;  3R3O A;  1O78 A;  4IUQ A;  2NZ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...