4KHXL

Crystal structure of gp41 helix complexed with antibody 8062
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
207
structure length
205
Chain Sequence
IELTQPPSVSVVPGQTARISCSGDNIPYEYASWYQQKPGQAPVLVIYGDNNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCASWDSMTVDGVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHYSCQVTHEGSTVEKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of neutralizing and non-neutralizing affinity matured Fabs with a mimetic of the internal trimeric coiled-coil of HIV-1 gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords gp41 helix
total genus 30
structure length 205
sequence length 207
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4khxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4khxL01
5ITFB 3W0WA 3BD3A 4HMDA 3FFDA 3EJZC 3UTTD 2HKFH 4M4PA 5FUZL 1K4DA 1R5WA 2BVPB 1YNLH 5SV3A 5GGVH 3HHRB 3G5XB 2R2BA 1U3HC 1A6ZA 3HE7C 2VZTA 2EYSA 5GGTL 3O3EB 4PGCB 4MX7A 3VH8B 5B39G 1EZVY 3RKDC 3QO0A 1F4WH 2BNQD 5IMMA 4MJ5A 3MO1A 4QCIA 3QDAA 1X5HA 4JZOA 5EOCL 1MVUA 3Q0HA 4NQEE 4X6BB 3DNKA 1S8DB 4KXZI 5IMLB 1NBQA 2BY2A 2ICEB 1A6TB 3RAJL 3SGEH 1L4IA 1Z2KA 5LVEA 5EIVA 5E5MA 5LG1A 3O2VL 1B4JL 3DECA 3EDKA 4EI5A 4E0RA 1EEYB 3C5ZC 5CILH 1NLDH 1N6QL 4EUPA 5KAQF 2XQYK 5DD5L 4HT1H 1FYTD 1LO3H 1U8OB 4ODBD 4ZYKA 1S7WB 4XHQA 5J11C 1G7LB 5F1NA 2E9BA 3C6LC 4JM4H 4PJGA 4MQSB 1J8KA 1IKNC 4WI6A 3OJVC 4RIRA 1FNSL 3DPBA 4U0RC 1KLUA 3QIBD 3HUJF 4HUMB 3BH9A 3GJFK 1AGBA 4D0BA 4D9RD 3RNQB 5KZCB 3VWJB 1OAZH 3T77B 4UINL 4HX1A 3TT1L 1I75A 2RBLA 1SY6H 1JPST 4OGYL 2CRZA 3GHEH 3I2CL 3MJGX 3GSVA 1P1ZB 5T1KB 2IFFL 4ODXA 3GSWB 4OF7A 5EU6D 5I73C 3ORJA 2OL3B 2B5IC 4OZGE 4WHYH 2OMBA 2EDXA 3IFOB 3BVNB 1MAJA 1V3KA 3LS4L 4YHLH 5B21A 1TZIB 3A67H 2DLGA 3HR5B 1FL6A 2P8LB 1XGUA 1F58H 3I6GB 4JRWA 5KG9A 5HDQL 1XCTB 4J3TA 3BSZH 3O6FD 2HLAA 1TZGL 1LO2L 4GAJH 1XZ0B 1G1CA 3UTTE 1TTFA 1WAAF 3TWCH 2MHAA 1G0DA 3DUUA 4U1NA 5A3IC 1I1RA 1JTPA 3RZCA 2IC2A 3FO1A 3OKEA 4MSWA 3MR9A 3HPJB 5F44A 1UJ3C 4LOUD 3NCMA 4OD1L 4IHOB 1IC5H 4GBXC 4I48B 4BZ1L 3QCVH 3WNOA 3T0BA 2XKNB 1G1YA 4IBLT 1B9ZA 1PZUB 5I1AB 4NRXA 4HG4K 1HIMH 2VXSL 4JFED 1IEAB 5I1EL 2AKRA 2FO1A 4PJHE 4HZLA 5F7EL 5KW9H 4D3CL 5I8OH 4MJ6B 4LHUB 5EUOB 1OM3L 4J4PD 5BS0A 1IC7L 1B90A 2VTFA 2IMMA 1AJ7H 1KEML 3MZGB 4S0SD 1HSBA 1D6VL 3MA9H 2IPUK 3BH8A 1VESA 5T1LD 1Q94B 3NPZB 4LDLB 4HK3J 3D0LA 4DK6A 2ARJB 1XGYL 4CJ0A 4EI5B 4NO0D 1WT5C 4H88H 3FQUA 1Q9LB 4NJ9H 1HDMB 3AY4A 5EBMB 3RRQA 2DKUA 5IW3A 5CJOL 1PW3A 3CCHB 1T7YA 5AEAA 5JPNA 2R69L 2DQIH 2IAMC 3AAZB 4F7CA 4ZS6D 3RPIB 3QEUB 2PW2A 5EG6C 2BNRB 2IMNA 2NXZC 4JN1L 1FLRH 1M7IA 3U1SL 4X7TB 1INEH 4HKJA 2VYRE 3ZYOA 2H2PD 5D6DC 1FGVL 3OJDA 3CLEL 1I9RH 5JR1L 5TE6H 4M9OA 4MA8L 1MNUH 2W1NA 3RNQA 1TMCB 3OKYA 4OZGF 1DR9A 5CUSH 3SKNA 3VXRB 3CFBA 4O5LH 5DTFA 5L8LB 2DWDA 1JF1B 1NCBH 3RY4A 4XC3L 3MLPA 1CDGA 1KSRA 4NQXA 5EOCJ 4DEPB 1QR1B 1DBKH 3NIFF 3BGMB 3W9EB 5D8JH 2X70A 3C5SB 4PJIA 2UZXB 4J4PC 1I7TB 3O8XD 2VB5A 1KT2B 1DEEA 3FQWA 5I1EH 5GZNC 2GJZB 3RWIA 4QRQB 3VA6A 3S96B 3FQNB 3PGDA 1GRWA 4MWFA 3TN0C 4X5LA 3AROA 4KAQH 3DO7A 4RMRA 5I8EA 1CFSA 5C0CB 4C83B 3GJFH 4CKVX 4WUKL 1B2WL 3JTSB 5GS1B 1AD0A 1GH7A 1NAKH 3IF1B 3MRFA 5BO1H 3OAUL 4N8CH 5GRXG 5K9KA 3MRBB 3C6LA 3WFZA 1CD1A 5IESH 3QUMH 3UBXG 4NQCB 1MFEH 4PJ5A 3WL9B 4KMTL 4PB9H 5JMRA 5CGMA 4NZJA 3TVMA 5KS9F 3KHQA 1TJGL 4G5ZH 2WBWB 5FIEA 1SEQH 3DX6B 1NUFA 4NHUB 3G5VB 3GHBH 4OZHB 3BEVB 4NO5A 3SPVB 4KI5E 5DVNA 4XBEL 4CVUA 2YUXA 3RHWK 3EYVB 1AFVH 1DBMH 2WIIB 1RJLB 1TJIH 3KWWB 1OT2A 2ZNWA 3EIFA 4NKMB 4NNXA 3WE6A 1SYVA 2AEPH 5DHVA 4LMQE 1CL7I 5JORA 1KIQA 4JPKH 1AC6A 3OZ9L 5HHPB 2XXMB 1CE1H 2CLZB 4GW4A 3MSPA 4HWBL 1KG0B 5C0EB 4Z7UE 4Q6IA 1JNJA 2APFA 5I6XC 3SKJH 5ID0A 1AQKL 4YDLC 2XICA 3ZKSD 1IGFL 3I9GH 2GYSA 3FHQA 1K6QL 4FZ8H 1X4ZA 2R0LL 4LVEA 2AVGA 4KUZH 4HUUA 4LAQH 1I8LC 1NMCC 4P3DA 1XR9B 2GFBA 2NY5L 5CD5D 1ROWA 1WEJL 4HS8L 1IGYB 4D9LL 1KB5H 3QJFB 5DRZA 3ROLB 2WUCL 2N7BA 1LEIA 2E7CA 3W9DA 4QNPF 3BO8A 2E9JA 1NCDL 1WZKA 3UC0L 4X6FB 4RMQA 4L4TE 3PHOB 3U0WL 5FUOL 1HSBB 1HI6B 2ICCA 4L5FH 3W11C 1A1NB 4FQHB 1MRFL 5JOPE 5HYQB 4JY4B 4HEPG 3VFGL 4KRNA 4PJIB 4N0UB 3IFLH 5DUPL 3FQUB 4DKFH 4YWGH 4K8RH 5CD3A 2F5AH 3MRCA 1NANH 3FN9A 3ARDB 4DN4H 3RWIB 3QDHA 4MQXD 5IB2A 2P48B 1IBGL 1RURH 3ARTA 3RDTB 2BRQA 2HRPL 3NOIA 3HZYB 4NN5B 4G6JH 3JWOH 3QUXC 3BKCH 5E6ID 3DGGA 1T0MB 3RWJB 1FORH 3HNTL 5I1DA 1HILB 2Y25A 4JHWL 1TJHL 5L7XH 1KN4L 4C4KO 5EU6B 3L3JA 5ITBL 4CNIB 5ILTH 4PYHA 5C0CA 1NDGB 3QDME 3EYFA 3OJDB 3LVEA 4LL9A 1NCCL 1AD9B 4X6DB 4K8RC 1KTLB 5HYEA 2BVOB 4FA8A 4IOFC 2QV2A 4PS4L 3ULVH 5T33H 1EAPA 4FXLA 1K9TA 4FQ1L 4TUOB 1EHXA 5AZ2L 2AW2A 1CCZA 1OARH 2FIKB 3DI2B 1QTYT 3WXWL 2Q6WA 3BGMA 2V5YA 3OMZA 1E4KA 4YFLF 3IFPB 3MRDB 3T0EE 4HS6B 5IBLD 3IU3A 3GBLA 3K8MA 4RIRB 5IR1A 1WGOA 1KTKE 4K23H 2Q1EA 1YEGH 5FHBH 2PW1A 4FQJH 3RZCD 2CGRL 3NCJH 3WFEH 4JDZA 5DEFB 4U7MA 4KHTH 4TRPL 5FYKH 3P0VL 3HPLB 4AG4H 4ZUVA 2CLZA 2H1PL 4XXDA 1BMGA 1F97A 3WFDL 5E6YA 3WJJA 1VEOA 1ORQA 4XP5L 4KKBD 1P53A 4F37K 3WS3A 4F9PA 5IVXB 2WIMA 2C3VB 4O02H 3I50L 5IVOA 3QUXB 5ECJE 3EOAB 1KPUA 4H0GA 1VPOH 1IE5A 5F1IA 5HI3C 4NQDA 2R29L 1DLHA 4HC1A 5D96C 4A6YL 4U1HA 4WV1A 1TZIA 1MQ8A 1QLEH 4K3DL 3M45A 3QG7H 3BKCL 1SEQL 4L8SB 4N68A 5DK0A 1NAMH 3B4NA 5C2BL 1Q9WB 1A0QH 3L3HA 3P73B 2DKMA 4PTTA 5ILTL 5ITBH 1E27B 2XWJA 4FABL 3LCYA 2XY2A 1G9NC 2X10A 3PWPB 3S5LG 2WINB 3VFPA 2Z91B 3CFCL 1AC0A 3IJHB 4JEGB 4U1KB 2X40A 5AYUH 4F15B 1WVZA 3MLXH 4NHCH 4H88L 4KXZH 1I9IL 5ISZA 5EU7C 1VFAB 5IIEB 2WUBH 1C12B 6FABH 5DR5L 4OI8A 5FO8A 4FQQB 3RX5A 2R4RH 1EX0A 1Z6JT 5CZKA 4OZFA 4TSBL 4YZFF 2OL3L 1AQDB 15C8L 4G8IB 3JVGC 3LS5H 3T0XA 1FG9C 1TTUA 3QNYB 1YYMH 1I8MB 2NY7L 3CUPB 3C60A 4PYGA 3VFNA 4EI5C 5HPMA 1KFAL 2MSPA 3RWEA 4MA1C 4ODVH 2NY6B 3O41B 1S7QB 3BSZL 3P0GB 3V8CA 1G7QB 2EICA 1YEDA 1EFXB 3U46A 4WW1A 4QF1A 5DJYB 2PYFB 1NLBH 1EO8L 5I1JH 1EJOH 5I75B 3FKUS 2F53B 1T3FB 5BZDB 1HH9A 1T21B 2VL4A 4KQ3H 4A6YH 1S9WB 5J1SC 2Q3ZA 2VUOA 1NC2B 3V6BR 3BQUA 1YEFH 2HG5B 1ZSDA 2Y7QB 2BVYA 4KTEL 2NNAA 2BNRA 1A2YA 4OFIA 1C5CH 3MRCB 4GBXB 4ZFFA 1A6PA 2G9HB 4WWKD 2UUDH 5AD0A 5IVZA 3QQNA 4PJBE 2E7LA 4F2MA 3QDGA 2HT3D 4LRIA 3SCMB 1J5OL 1PKQB 5SX4I 3CAFA 3QPQD 1OGAB 5D2LF 3JTTB 3C09C 3SDDA 4BQ6A 3CX5K 3OF6D 4G8FB 4P46A 1KEGH 4Y5XC 3MLSH 1ZOXA 4MA3A 2VISA 4JFDE 3ZE2F 3QIWC 5FA4A 2ZUYA 4NQDE 1DQMH 1JMXA 1BQHB 4OQ1A 3T2PA 4UNVA 2DQUL 3HI6H 4OUUA 5TF0A 2DM2A 5F3HB 5E00A 5DYOB 3MJ8B 1JWSA 4KJQD 1R6VA 1SYSA 1AXIB 3ZDZE 1ZWIA 1H15A 1YYLL 4YHOH 1X7QB 1BQUA 1P7KA 4MDIA 1RUPL 1JHKH 4KH2A 4ZS7L 5KSAC 3QEQB 4K7FB 5JPMB 4XB8A 4AIOA 3O6FA 3JZ7A 4XPTH 3GMNB 3JTSA 3S35L 4LCUA 4HT1L 4XVSL 4LPUA 4IIQC 2J8UF 3QO1B 2NY4C 3WFCL 4NQVA 4X9BA 4FFYL 1DVFD 3O3EA 4PGCA 1MWAL 3QUZC 3O6LH 3EBAA 1UWGH 4XNZB 5IKCB 4LLDB 3AS3A 4KVCH 5DUML 1G6RL 3EJYD 1YZZA 4YBHA 1JNNH 1JGDB 3D39A 2VDNH 4K3DH 4PG2A 3LEYL 1LGVA 1QA9A 5I19L 1CDJA 2BP3A 1SMOA 2X7LB 3AC0A 1JZ2A 3SCMC 4XMLL 3BEVA 2VSDA 4YHML 1OSPL 3H42H 2W0FB 3VD5A 4F7PB 5CZXC 1A4JA 3BAEL 3KG5A 1S7QA 3RVUC 1HSAA 3RKDD 3VMPA 1QBAA 4OGYH 5B38A 1OAYL 4I0KA 5JHLH 1BZ7B 2YEZB 5IV2A 4U49A 1DBBH 5C6WH 3S7GA 5CEZL 2ZSVA 3EW3B 2Z8WC 1GPOL 1E0OB 1HCFX 2D0HA 4U6YB 4OLVH 4EDXB 3VE0A 3V8OA 2O5XH 2C4XA 1BOYA 4HK0A 2VLRE 1OTUD 4PUBL 1F90L 2X4PB 4HAGA 4ODSL 3S97C 4PJ7F 5I1HH 3MGOB 3QQ4A 1KELL 2R2HB 1FIEA 4FS0A 1KCVL 5D1QD 1LK3L 5J3HC 4P23A 5L2KE 5ALBH 5J6HB 1I7RA 3QIBB 4TQEH 1F45A 5L2KD 1BZ9A 2VLKA 2AXHA 4KVNH 4JREB 3WIHH 4NQUA 5A1AA 2YXMA 1LO0L 3SDDB 2OBGA 3NN8A 2GK0A 1C5DA 1E4XH 4KDTC 4HUXB 5E5MB 2D7MA 1XGRA 1MCJA 2A2QT 1IAKA 3HUJA 5EPMB 2FWOA 1M6OA 3FQRA 3HAEG 4GAGH 4KUCF 5MEPB 3BEWB 4R4FH 2MQ0A 4C4KT 2XXCB 5E8DL 25C8H 1IT9H 2BSSA 1W0WB 2CJUL 4Z7UA 4NC2B 2YRLA 3Q1SH 3SQOL 4C56E 4XBGB 3ULUD 2HVKA 1ZHLA 4LF3A 2FNBA 3T4YA 2ZP0T 3MRQA 5EU6A 3QUMB 5MERA 1B0GB 2DF3A 5C07D 3MRPA 4LASL 3I84A 4TVSa 1TCRB 4M7JL 5FF6A 2ICWI 3KPLA 5HDOA 4WEUD 2C1PB 1KTLA 2EXWC 5E24E 4OLWL 4G9FE 5FOBB 5T3XE 2QL1A 3KPRE 4L9LB 3SO3C 3LD8B 5CBEB 2V17H 3Q3GA 4GAYB 4IRSB 5E2TL 1DQJA 4PUBH 4P2RB 1CZ8H 2NR6D 4R7NB 5GISH 2ADJB 3BVNA 3HMWH 2E8ZA 1RAMA 3QUZB 5IMKA 2X4SA 3IU3B 2ILLA 5I18L 1BX2B 1GOHA 3EFDL 2Q8AH 5F1KC 5IR1B 5DJ0B 5DRNB 1L0QA 1SMAA 3LQAL 5CS7A 3O4OC 3HI1A 4P46D 4Q9QH 1F13A 1U6AH 3H9SE 4GLRI 5HHNA 1FORL 4EI5D 3HE6A 4GRMB 1MHPH 5MI0C 2ESVB 3T04D 4U1NB 4LPYA 3TBTB 5DD6A 1D9KC 3QAZC 4G9FA 1ORQB 5C0CD 5D7JC 5HYJD 4OCXH 2FO4B 2EYRA 5C0CE 4PJIF 1GC1H 5M7QA 1OAQH 2Y4SA 1RZIA 5HGHB 3EOBA 4L4VE 5GS1C 4ODWA 1F3DH 4JDTL 3VGDA 4MQ7A 3MXVH 4L4VD 2FL5A 1I7UB 3GJEB 5FCUL 4V1DB 4HIJB 1T2QH 2Q7YB 3RL2A 1YQVH 1D6VH 2GSGB 3V6FA 4GW5A 4PJEB 1J1OL 1G0XA 4HKXB 4QOKE 1CR9L 3VRLF 2AABH 4I3RL 1YN6A 1DBJL 5BV7B 1JFQH 4UAOC 4XPAL 1U3HA 4RWYH 4DTGH 1NDMA 3QEQE 3PGFL 3PDOA 1OP5K 5CINH 4HPYL 1WF5A 1KTRL 4WW2A 5DI8B 1EGJH 2FECI 5FXCH 2C7UA 1R3HB 2ZPKL 3KYKH 3VXPB 1J1XL 5DD1L 3WJLC 4ZQKB 1JZ6A 2NX5B 3FT3A 2G9HA 4C59B 2A9MH 3O6ML 1RUKL 4POZC 4XZUA 5K93A 3UP1A 3PV6A 5EU3B 4JZOB 3T4YB 2IH3B 4HUWA 1FSKC 4EKXA 5D96B 1AO7D 2ICES 3DV4A 2B1HH 4TUJB 2APXA 3OZ9H 4PIRF 1G7MB 3PXJA 1BVLA 2Z31A 3B9KA 5EZOL 1SBBA 3C6LB 3L5IA 4Y2DB 4PLKD 1G7JB 1GC1L 4DOHB 2NPLX 2Q7NA 1SHMA 1QBLH 3GKWH 1UACH 1CE6B 4NJAH 3N0PB 3TVMB 1MJUL 2L4OA 5LXGL 1C8PA 5DJZB 1ZHNB 4HK3N 1BD2B 3TJHC 3ARBD 3GJFB 4OQTA 3P9LB 3W9EA 4X8XA 1SVZA 3GKZA 1ZHKB 25C8L 2HT2D 1MF2H 5J13B 2F54A 3B6SB 4OZHA 1KT2A 4DW2H 4KJPC 4OT1H 3IDYC 3JV0A 3M17B 3QXTA 1FVEB 5K59F 2O5ZH 4NDMB 4HJ0D 2CQVA 3CC5A 2E9WA 4Y4HC 2NW3A 5C8JA 3NABL 1HZHH 4LNRB 3L3DB 4J1UB 3TBVA 2X4QB 4AMKL 5I8EB 2R29H 4QTHB 5DQ9A 1EO7A 1T2JA 3IRZA 4FP8L 3VMOA 1CL7H 5CSBA 5KVEL 3PGDB 5IGXL 5E5UB 1CD0A 4WENB 3WLWC 4BZ1H 5K9KB 3ZT7A 4JFDA 4MNGE 1BQLL 1JGEB 4M93B 2X2YA 1UH3A 2DDQL 5CGYD 3AB0C 2DAVA 4FXKA 4XPBH 4GKNA 5KZCD 1MVFA 1D9KB 3QRGH 3DXAD 2W0FA 4LARH 5T5NG 2QHRL 3U9PL 4OIIH 3GMRA 3L6FA 3V52L 5EZIH 1G7IA 3BUYA 4CDHA 2EDLA 4NGHL 2I9TA 5E70A 4JR9H 4HKXA 3CDGA 2NXYC 5DXWA 5IB4A 5KANI 2A6IB 4GRWB 4OAWB 4QRPB 4S1RL 3KVQA 3DTXB 4BK4A 5DGQA 2G60H 5IVXE 2X09A 2X1PA 3L5XL 3TBTA 1HEZA 3P9MA 3D69B 4XMPL 4M6ML 3JVGA 2WLZA 3BP6B 4K3EH 2PO6B 1RK0B 3UYRL 2VZ3A 3PV6B 1RZ7L 4G7VH 3V6ZB 1RK1A 4J3WA 4OT1L 2Q86B 1MRDL 2YC1B 1INDL 5D1ZB 2I60H 5ALBL 5FKAA 2R1YA 4G80B 4FG6C 3O81A 3U30B 4KJYB 4G9DA 5FDYA 5JO5A 2OM5A 3LKRA 5F7EH 5E8PB 3MQIA 2ORBL 2NY1D 1FZMA 4H20L 5GGSB 3KPQB 3GMMB 1BFOB 3MRMA 4X6DF 4CU7A 4HKBA 1TNMA 1OAUH 5DEGA 4AT6B 2AS5M 5DRWB 4NOBA 1BREA 4OD1H 2P43B 4RWHA 1NMBL 1A6UH 2ZKHH 4F7CB 3MBEC 4EDWL 4FQ2H 1OOAA 1C7SA 1R3JA 3RZCB 4MNGB 2JB6A 3DXAA 2D7TH 3BGFC 3CFDA 5IWLC 3TP4A 4YHNB 1YEKH 3SDDC 1FNEB 4O58L 3NZHL 1FZKB 3SKOA 4JM2D 2DIBA 3GZKA 3TNNA 5C0NC 4B41A 2JJUA 2VDRH 3T0WA 3ARDA 3BISA 3O9WD 4WJ5A 5ID1B 1T5XB 5CJ5A 3V6OE 1M4KA 1IAKB 4KWUA 1WZ1H 4LHUA 2Q8BL 3A6OA 3WNNA 5J06A 4Y5YA 3PWNA 2B1AL 5H35B 5DA0B 1OW0C 1QBMH 1MLCB 2NZ9D 1Q94A 3B9EA 1MJJB 2NW2B 1Q9WA 3GSXA 3UYOD 5IVNA 2P4AB 3EAKA 4UTAL 3KLHD 1ZT1A 1AY1L 3QWOA 5D72L 1G9MC 2X4UB 5FK9A 1HDMA 5KVGL 5MERB 1MFNA 5DJDA 3T2OA 4OI9A 4R7DA 12E8L 2HJFB 4D0CA 4JQVA 4LQFH 2OL3A 5TPWH 3VFWB 4Z76B 2ZUQB 3RVXD 3TVMC 2CDEA 2OTUB 5MHSE 1I4FA 3E2HB 4M7LT 3OBAA 1UXSB 4NFCA 4KTDL 4X7CC 2Z31D 3ALPA 1HN1A 1Q1JH 1TVHB 2FHCA 3U83A 2RCSH 4HSQA 2W9LA 3IFNL 4OZ4A 5FYKD 2A6JA 4JO1L 4X83A 2NZIA 4CGTA 4EDWH 4N8VG 1CQYA 1B2WH 2IPTH 2YR3A 1FNAA 2BMKB 1DVFB 3MROB 3GRWA 3THML 1I9EA 4Q7DA 4Z7VB 3NFPB 1CS6A 1UWXH 3TIDB 1MCNA 4WU7B 1WJ3A 4HIHB 4X9IA 2D31B 4PJGE 5SX4H 1S3KH 3F8UB 3U6RB 4LASH 2GTZB 4PJFF 4OZIA 5CJ8A 4ZNEA 3MRJB 1ZT7B 3MLWH 5F96L 3U0TB 4X80L 4HDIA 1OWWA 1QNZL 1I9RL 4KTYA 4JN2A 2EDRA 1CF8H 3TCXA 4XCCH 1HEZB 3D0VB 3ZTJG 2R1WA 1OB1B 3DV4B 2H8PA 1V7NL 3KJ6L 1V3JA 4KJWD 4P59H 4RFNC 3QEHB 5ICZA 4HHAA 3QDMD 3F7YB 5CHNA 5BOZG 2DRUA 4EI6A 3C87A 3RBGA 4WFHD 5TDOB 2W91A 5FGCB 3ELAT 3P30H 5F9AC 5IBUG 2AQ2A 4Z0BL 1RHHA 5JUEL 1TPXC 4MCYB 4FQHA 1KBGH 4MAYA 43CAB 4TPRL 2A6KA 1TDQA 3MLTA 3O3DA 3OKLB 4ODTH 2YSSB 1H0DA 4UU9B 2FJGB 1LO0H 5INCB 3VGFA 2F74B 4I77L 4LLMA 5ANMA 4M8VA 1AI1H 5H2BA 5ACLA 2CRIA 1IGJB 4JFFE 3F58L 4YHIB 4WCYH 2FIRT 4BYHA 2AQ3A 4X4ZA 2VWEE 5FYJD 1NAMA 4NUJA 2NCMA 1L9NA 4OGZA 3K4DA 5CSZA 1U93B 3FFDB 3J8F7 5EORL 2X1QA 2VLRB 3U4EA 2IWGA 4XNXL 1YYLH 5JW3L 1ZSDB 1JI1A 3IDIA 2R2BB 1NQBA 5I76A 4XPAH 4K94H 3ARFD 4NO3B 4PFEA 4LSUL 3VI4F 1CR9H 1MREL 1CE6A 1XCQB 4IIQB 4LBEB 4PY8I 3T8XA 1UVQA 4PRPB 2VISB 2GW5A 3VGBA 3DO7B 3G6JF 1S7SB 1INEL 3G9AB 2FYYA 4OUUB 4HQQL 4YWGL 4TNVK 4M6OL 1UG9A 3REWA 4XNUL 4IRSD 1MCDA 3LQMA 3KJ4B 1UQSB 5E99H 5C0RL 1JNNL 4NGHH 1UCBL 1XGQB 5EO9B 4X9FA 4UIMA 4GKOA 2DM3A 5D5MF 4BELD 4JO3L 1FO0B 1K5NB 5DJ2A 5DQJA 3HMXA 4Q2ZA 1KEMH 1FHGA 5I2IB 2EZ0C 2HN7A 5E7BA 3ZDZF 4Y1AE 3P11L 4PJDE 3M8OH 5F7DA 4GRWH 5BJTB 5C9JB 2MCPH 3LKPB 3UTPE 3C08H 3WEXA 2XWTB 2W65A 3S36X 1ED3B 3FB6A 5D7LE 1CD9B 2GY5A 1EPFA 3HG1A 1DLHB 1ZLWH 2VZUA 1RZFL 3KS0J 1I3RA 1R24B 2R9HD 4MNHA 1WCBA 4GJTB 5F7WC 4NKMA 3WE6B 3QIUD 2ITCA 1W8NA 3KPPA 4S10A 5C0JB 4HMEA 1O0VA 5JHDA 4P4RB 3PV7A 4FZ8L 3ULUF 4F58H 3P73A 4PTTB 1I3GH 3F7YA 4JFZL 4Z9KB 3ZE0E 3FQXB 4J3VA 5DZNA 2F19L 3MRKA 5FEBA 2WW8A 5FDWB 4YFEA 2PXYB 3TNMA 3SE8H 2I9TB 3GFUA 3WUZA 4DVRH 3VFPB 2AI0H 4UBDC 1AXTL 1RULH 2GJJA 5I0DA 2VXTL 2FR4B 5A16A 4O9HH 1IM9B 3HUJB 3DSNA 3QZWA 1X5XA 5JOEA 3BDXA 4ZSOE 1NL0L 1H0DB 1E28A 3D2UB 5J12C 4JM2B 2WBJC 2OR7A 4MXWL 1MHCA 2UYLA 2FECL 2BNQA 3RGVB 2ZNXA 1IM3A 3HC0B 4AIZB 3CCHA 3RL1B 2ARJA 3VXUA 3ESUF 5LBSH 5C71A 1G6VK 3O45A 3LQZA 5EZOH 2XI9A 1ZANL 2EH8H 3QCTH 5HI4D 2AGJL 1OB1A 5TQ0H 3C60B 4IOIA 5F9WC 5FYLH 4ZUUB 2VE6B 3W0WD 5FV1L 5FO9B 4OCYH 1JPGB 4P5MA 4IMLB 1FBIH 1GSMA 5D93B 1M7IB 1EIBA 3MGOA 2G2RB 1IQDB 3DUHA 3CH8A 5AAWA 4JFXA 3BZDA 2E7HA 3GB7B 3LKNA 2NY3D 4PJDF 2AV7B 3UCRA 1RZFH 3K3QA 4P9MH 1QBML 5JIPA 3MLTB 3O3DB 3GIVA 3ALWA 3VFOA 4ALAH 2CKBL 4QHNB 5MEPA 1MSPA 2BY0A 5KTEH 4BQCA 1QRNB 1HOCA 3QXAA 1UKSA 4ZXBA 1HQRA 4AEHL 5C09B 2OL3H 3KS0H 1NMBH 4LCCA 1LO3L 3ULVD 4Y1AD 1MJ7L 4I2XE 2Z0BA 2YWZA 1BQHG 4EXPX 4XP1L 2BSSB 4YBQC 5T3ZH 3O3UN 4BSWA 4YPGB 3MV9D 3QDJD 2P46B 4F9LC 4APQA 2R1XA 3P9WB 5BQ7B 2UWEB 2RCSL 4BFBD 3WFHA 2CXGA 1LVEA 5DJCA 1Q9KA 3IFNH 3WBDA 4H8WL 4G6AD 2KPNA 4L9LA 4O2EA 4HWUA 1T0NB 4XAWH 2UY7A 2JELL 1OGAE 3KPLB 3VDAA 1F4XL 1PY4A 4L8CB 3V0VA 3ZL4H 1YN7A 3GSXB 5KJRH 1Z5LA 3MLRH 1FFOB 5HD8C 4WU5B 4MDJB 2F9BT 1C5CL 3QWQB 4GW5B 3HC4H 4U2ZA 5C0AD 1QOKA 4YC2B 3JSSA 2CR6A 1CICD 4H25B 1MFBH 2BVQB 1HHIA 5JQ6L 5DVMA 1AR2A 3WNPA 3Q6GL 3QUZA 5IMKB 4PRPE 3BE1H 4MJIB 4LPWA 4PJCA 3KLHC 4K2UL 1ZGLM 1RZ7H 1PY9A 4G7VL 4NCC2 3HC3L 3QCUL 4ORGA 2AERT 3IDYB 2Q8BH 4EBQH 5GGSY 1K4CA 4L3CA 4BKLB 2EYRB 3GSOB 5H94B 3HR6A 2CGRH 3NCJL 1QQDB 2CO6B 3VFRB 3P0YH 2W38A 5D2NC 5DVLA 1WCBB 2R2EB 5F7YC 1FDLH 4NT6B 2G75A 1F3JA 5DJXA 3VFMB 5FB8B 1N0LA 2AJYH 4Y19D 1NUNB 4TSBH 3RWHA 5LAXB 1BAFL 1XEDA 4QHUA 5L9DL 3T2NH 2LVCA 5KSBA 3TBYB 4FFZL 4LIQH 3C2AL 4R8WL 2ITDA 3TNMB 4D9RE 3N9GH 2VSCA 4HFUH 1A6UL 2ZKHL 1MLBB 4HWNA 5CD5C 5E08H 1H15B 2ID5A 5CINL 5DRZB 1OCWL 5FECB 5IFAL 4JHZA 3SDCC 3EJYC 3FAWA 1ZHNA 4UOW1 2Y6SC 3QJHA 4OCNC 3E8UL 2X1OA 4MJ4A 3QUZD 3WD5H 1NEZA 3T0EA 4P23C 1IFHL 3FQTA 2IPKA 2ZCKL 3GMNA 3OV6A 1YQ2A 4M6NL 5IOPA 5JORB 1PG7L 3QHFL 3O4LE 3U46B 1YEFL 3ZHKA 1H5BA 3IGAB 4DVBA 1HNFA 4WFED 3L3DA 1WBZA 2ZCKH 1QFWL 3TBVB 2ICWJ 3LEXB 1Q8MA 2EIDA 4HWZA 5HYJA 1UA6L 1S5IH 4N0UE 4Z8FH 4MVBC 4RDQF 2EIBA 4PTUB 5I1HL 5HGAA 4NRZA 2P24B 4HUUB 1KJ2L 2GIYA 4M8QB 4OLZL 4IJ3C 3L1OL 3SGDH 3CGTA 1T83C 2FYYB 3V2AR 4GRLB 5KANG 5C0FB 1H8OA 1YYML 1T20A 4N0CC 2ZJSH 2IBZX 3ES6B 5EO1B 2YPLD 2ERJC 5HI3D 3WIHA 2W0LA 4HS3A 1R0AL 2BVEA 2NY7H 1P7QD 3H2WA 5E6IB 4LSPH 1UB5B 4NO0B 3FTGB 5IB1A 3D48R 1MY7A 2XN9B 3K8KA 2Y06H 2M26A 4NM8L 1EUUA 1N5YL 1M71B 3BN9D 3BT2H 4R4BB 3QSKB 1FPTH 5C8JB 1AY1H 2GCYA 3DUSB 5INDA 1CL7L 3BDBA 4LP4A 3PF2A 2BSTB 2BY1A 3DIFB 3P9MB 4TSAL 4UUJB 2YD4A 3GNMH 3IKCB 4IDLA 4U1GB 3SKNB 3VXRA 5E1HB 1U3HD 2X4RA 4LLAA 1Z9OA 3MUHL 3VFSA 1UA6H 4Z8FL 1DQLH 3UYRH 3V0VB 1ND0A 3UJJH 1XF1A 1FQ9C 3FT2A 8CGTA 2I9LA 2WLYA 3PL6B 5DWUL 1IC4H 2BERA 1UYWL 5JW3H 1E6OL 3ZKQD 5I1AA 3SJVA 5ERWA 5JA8B 3ALXA 2Z8VC 2J1KA 1CYGA 1UJ3A 3TEUA 2E27L 5GIRB 5IWLA 3X12A 4FZEH 4HZLB 4PRDA 3EYSL 4G8GD 1CGVA 3EO1B 1NEZB 3H9HB 5DMKA 4KVNL 4OCXL 4HQQH 2DN7A 2C1PA 1RMFL 3MNWA 4PJ8A 4U1SB 5KSUA 4BJLA 2CKBB 1J10A 4ONFH 1CXLA 3G08A 1I8MA 3MXWH 3IJYB 4NT6A 2I27N 3OX8B 3QHTC 1N8ZA 3FO2A 4X5WB 3F6IA 1AHWB 2VITA 4G9DB 4GT7A 3WJLA 3N1MC 3EO0B 3QXDA 2DLTA 2J8UE 4JFEB 4AM0B 2ZSWA 3CNKA 3SDAC 3QNYA 2MKLC 3IDGA 3GIVB 4G80A 4YXLH 3D6GA 2DLHA 4MXVF 2EH7H 5I66A 1WITA 3NACH 3PGFH 3P4LA 1JFQL 1A02N 3OHXA 2P49B 1LO4L 4N9GB 1PKQE 4X8JB 5GGSA 1DQML 2XZZA 2WINA 1RJYB 3SDXF 3OXSA 2DB8A 2R0KH 4NM4H 3EO9L 4PJAA 1HH9B 1U58A 5D7LB 5B39A 1YY9C 5GS2H 3IFLL 3C8DA 1OT1A 1AKJA 4OCMC 1UM6H 5GXBB 2YWYA 3NCFB 2DBLL 3LB6D 3SKOB 2BSRB 1OD7A 2OZ4A 3V7AE 1RUPH 4TTGA 1F02I 3QUXD 5E6IC 2X42A 4OJFL 4WIQA 4R90H 1NBVL 1T7VA 3CDCA 5FYJE 3PG2A 5D2LE 3C6SB 2FEDC 3HAEA 3U4BL 1FFPA 4JCLA 5GGVY 3AXLB 4JKPH 4EQ2A 2CUMA 1F11B 3OAUH 4P2CG 1HHHB 3FONB 4JB9L 5C3TA 4X6FA 2KQNA 4HX1B 4KI5F 3UYPA 3TM6A 2HFGL 3NFNA 3PE9A 1WSST 3S3SA 3TIEB 3AREC 1DZBA 4JGUA 1S7VB 3KYMB 3X3FH 3X11B 4H1LG 4UDUB 1WUNT 1YEDB 5GJSH 3O8XA 3O6MH 5CEYA 5E8OA 4L29A 2C1OB 1U91A 5DD3L 1FSKB 4M1DH 4OLUL 5H35A 1IGFH 2VIRA 2YK1L 1SY6A 1YUHA 4JFFB 3SKMB 3M07A 3D3VB 5I18H 1F6AA 4KUZL 2H9GA 4MD4B 2VLKE 3ISWA 3CVHL 1DBKL 1WBXA 5D7KE 1U36A 4HAFA 4OCYL 1R5IA 1ZT1B 1I4FB 1S3KL 4Z5RB 1QPXA 4L4TD 1HHGA 3DX9A 1U8LA 3L3JB 1CE1L 4WDIA 4U0QB 3PDDA 4HWEL 4J2XA 3H9HA 4NN7B 2UZIL 4NNYB 1YQVL 3BH9B 4QNPE 1MJUH 5IB5B 1LHZA 4R4ND 3NGBB 4NNPL 4HPOL 2XZCL 3IKCA 4OZFH 1JGDA 2ESVA 1UM6L 2HMID 1N2RA 1WV7T 1TVHA 4H0IA 4JFYB 4RFEB 3SEPA 4LRNL 1KGCE 3TBSB 1EVUA 4TVPL 4ZPVA 1XIWA 4KV5E 4N8PA 4XVJL 1XIWD 1IVLA 1U8HA 1JV5B 5J12B 3QUML 2GY7B 3TLRA 3MRDA 2DJ4A 2KZWA 1EA9C 1A7PH 2EDOA 1O7VA 4Q6IC 3F65A 3TF7C 4UOW0 5E2WL 3G6AA 4XNZC 1ES0B 5F89B 2Z35B 4KK9C 1PQZB 2A77L 3OR6B 3CPLA 4FQ2L 5DK2B 5DJAB 2NY2B 4G6KH 3EJZD 2GITB 1H5BB 1DQQA 3TBWB 3PJSB 3EOTH 4HWBH 4OZFG 1ITCA 1EEQA 4ONFL 4X99A 4JFDB 5DZOA 5E2VL 1FFNB 4KROD 3VG0H 3MBXL 3MYZA 4W70A 4FTVE 4JN2B 2YD8A 4NYLA 4K9EL 4Y1AA 4XWGL 4APQC 4CW1B 3FB5B 5KVFL 1MWAA 4GFTB 5IB2B 3SDXE 2OTWA 3JV4A 3R1GL 4Q0XL 3QA3A 2PYEE 5FKPA 4LBEA 4WWKC 4ODTL 5E5RB 4C56B 4FMFA 4MCYA 1S7TB 1HILA 3WKNA 4QXTA 5GGTA 2JK5A 3RAJH 1AIFB 1MHEB 4QHLA 5HHXL 4OZHE 1JE6A 4GAFB 4J3SA 1QEWA 1BLNB 4FQXB 4WTXA 1U8IA 4M6MH 4R2GB 3UBXB 4U6VH 1KIPA 4AH2B 1WFUA 4NO2B 4DQOL 1WWBX 4GBXD 1EHNA 1XGTB 1JNLH 1NCDH 1NAMB 4NQDD 3MLYH 1NANI 2FH8A 3F7RA 1U93A 1Z9SA 4F8TA 1PG7X 4Y4KB 1QSED 3S4SA 3GBML 3CX2A 3GSQB 2ZUUA 2VDPH 4MXWH 1GVIA 5FKAB 1BFTA 2CLRB 5KN5B 2E7MA 1G9NH 3VD4A 4P0DA 4LLWB 5EOQH 4NDMA 3RTQA 3SKJL 3S88L 1MFAH 4OLEA 4UT9H 5I8OL 1UM4H 1EH9A 5E2VH 1TVDA 4YIQB 4TSCL 3PL6D 1MCKA 4NO3A 1PFCA 5D93C 1QSFA 3WFBL 2NY4D 3CSGA 4P23D 5K33A 3RVTC 1UZ8B 1CLCA 5C07B 6FABL 3HI1B 4WWID 4OCRH 5DUBB 1R0AH 3VCLA 4IMKC 4WTZA 1WZMA 4HIIA 3P4MA 3MCG1 3QI9B 2V7NA 2ED8A 3S8WA 1I7TA 4PJGF 3BN3B 2J4WH 2R0ZL 2VDOH 5INDB 3HMXL 15C8H 4JG0L 2XG4A 5AD0B 2ZCLH 3QFDA 3AGVA 3D2UD 1DDHB 1CXHA 1UT9A 4E42B 2X89A 3VWJA 4MJID 4AENA 5EZLA 1HHGB 1NGWA 4UV4L 4RGMB 3MROA 1DLFL 2ORBH 1A9BB 5L8KB 1RZKH 1TIUA 3ARBB 4L4VB 1P69B 5GPRA 3DX7B 1F3RB 2ADFH 3TIDA 3ZKMD 3MLUL 5KSAB 3Q6FA 1V05A 5C0DB 4QY8A 2GSGA 2I60L 4N90D 1UADC 1NC2D 5BVPL 2NX5E 3UTSD 1AJ7L 4KTEH 5GRYA 2B7DT 2XN9D 1WWCA 1FYTE 1J0KA 3OG4B 5FYJL 5ACMA 1T4KB 2WP3O 3C8KB 4N8VB 2EH7L 2CIIB 1AGCB 1YNKL 3REVB 5ICYB 4JFFD 2GTWB 1TQBC 3TA3B 2DQHH 2CJUH 2XZQH 1J88A 2HTLD 2PNDA 2VDRL 4ZFZA 1SBSL 5F96H 2DTML 1U58B 1A6WH 3L7EB 1FNLA 5EN2A 5C09A 1OAKH 4RDQG 5FHAH 2IQ9H 2BSRA 4DN3L 3C5JB 3VXNA 4D8PB 3VJ6A 1RFDL 1BBJA 3IKKA 5KS9E 2PTTA 1DP0A 2OJZH 2GKIA 2CIKB 1CN4A 1PG7W 4L9DA 5JW5A 1T83A 3U1SH 1PYWA 3AXLA 3WSQH 5IW1A 2R4RL 3RY6C 1F11A 1QFPA 4XNMB 2PETA 4JQIH 3OB0H 1HQ4A 4OM1H 2YRPA 1JRHL 2D31A 4Z0BH 5JUEH 3X11A 1BD2E 5EWIL 2QQNL 4HIJA 5EOCH 3QNXB 4YIQA 4YLQT 2YEZA 5IV2B 1G7PB 1EAPB 2WSKA 4JFXB 4PLKC 3P4NA 3T3MF 5IF0A 3AB0B 1IRAY 1U8KB 2APVA 3UTQA 1PSKL 3ZL4L 1GGTA 1BJMA 3BP5B 3NZ8A 5DURB 1FLTX 4UT7H 1OSZB 1JJUA 3UTPD 1Y6NR 2ZWLT 2MWCA 2NXYD 2Z8RA 5DF0A 3HZYA 5FGBA 1NBZA 3V0WH 1X7QA 4YHMH 1CDUA 3VGAB 1OQXA 3WUWA 3INUL 2Y5TB 1Y18B 3SY0B 4D9LH 2B20A 2I5YH 4TNWF 3G6JA 3LIZH 1N6UA 2LU4A 1CXKA 4GSDH 1AP2B 2D0GA 2XOTA 4LSDA 2XN9E 5E7FA 4NQEA 3O3AA 3RWFA 1L7IL 2DIAA 2OJZL 3UX9B 2F74A 1X44A 3QG6B 4OV6F 4TNVF 4P5TD 1JUFB 3K2UH 2YPKB 3T1WA 2PUQT 3AMKA 2Q6WB 1S7UA 1FLRL 1IEAA 2O61A 4JPKL 4ODUB 1G7IB 3QJHB 2V7NB 2Q76A 3V4PL 4ZAKC 1J0JA 1K8IA 4KK8D 4Y8DC 3EDFA 1A7QH 5DQDH 5CCKH 5EU4A 2X5PA 4OV5B 2XPGA 5I9QC 5CUSL 3RUGA 3TH4T 3U9UA 5JZ7D 1FVCA 4J8RB 3JWDL 4IM8A 4XXCA 1PZ5A 3RVTD 4Y1AB 4HC1H 5HGBA 4O2FA 4XAKE 2BHYA 3ROOB 1MCWW 1EXUA 2D0FA 5DJ6B 2VXVL 1CICA 4DEPC 2R1YB 4EEEA 1RZKC 4KI1A 2V9TA 4P4KB 2AXJA 2R4SL 5DFWH 1U8MB 2ATKA 3GMPA 4PJ9C 2IANB 2M2DA 4QRSB 1FZJA 4TQEL 4JPVH 1J5OH 5C07E 1I1FA 1BD2D 3QULB 5GGRY 4EOWH 3CUPA 4GKNB 1T03H 2GJ6B 5K59E 4YO0B 1F5WA 2ZCHL 1RIVL 4DJMA 1LP9B 3BZEA 3L3KA 4LHUG 4Y5XB 5E9DD 1EJ6A 4P5KB 5IW6B 4NBZB 3LEVL 1RY7B 4APQD 3LQZB 3SGEI 4GSDL 4LCWD 5IESL 3KPMA 5ID0B 2X6MA 3IDNA 3NACL 1Z0MA 2IQ9L 3E6FB 4RAUB 3SKUD 5EIQA 2VAJA 3FB6B 5DC4B 3RVWC 4X7DC 4WHYG 5FA3B 3T0EB 2IJ0C 2IQAB 2EDWA 5L88H 1XF5B 5F88A 2Y07L 3MLWL 3SN6N 4XB7A 5IOPB 2EZ0D 4GUPA 3QA3B 4UOJA 1GGUA 2QR0A 4NRZB 4HUVB 3U36B 2V2WA 4URTB 1OGAD 5JR1H 5EFIB 2QQKH 3O8XC 3BKYH 4HWZB 1KCVH 4LCWB 1U3HB 5DD0L 5FM8A 1UEYA 1XF3A 3SBWA 1RZGB 5C07A 4CJ1A 1CGSL 4KI5D 3OGCA 2A9NH 4NQEB 3RWFB 5LGHH 5FFLA 4NZUH 2I26N 2H41A 5IMLA 3DHMA 5EOTB 1MIML 4JZJB 3VRIB 3S98A 3A6BL 4GAYA 3R8QA 4NPYA 1JUFA 4TUKH 4YXHL 4I0PC 2ED9A 5FHBL 4AYFA 1L6ZA 1YEHL 2ZCHH 1JF6A 4GRLC 4UDTA 3S37L 1NC4D 1T03L 2FJFA 3LDBC 4AIXA 4FMKA 3DWTA 3QEQD 4U3XA 4OM0L 2A6DB 3M1BA 1K8IB 4KKLC 1D5MB 2J3SA 2K3TA 1XGQA 1FNEA 3TJEL 4J3OC 4HULB 2RFXB 5GS0L 4IMLA 5DSCB 1P4BH 4Y2DD 3WHXB 5DDHB 1QRKA 4PJ7B 1NBYA 4N1EA 5GRJH 1PBYA 4K07A 2VKXA 3WKML 4OFPA 3HN3A 1P1ZA 5T1KA 1CBVH 4R4NC 4PRBA 4H20H 4P3CL 4WY7L 1NCTA 4JFEA 4OKDA 4LRIC 4XH2A 3QG6A 1J05A 4Y4HB 1FL6B 4RQQB 5GISL 2GJ6A 3ILPB 4NSKB 3UTTB 4OF5A 4OZIB 1DE4A 4M3JA 3LRHA 3TESA 3BRDA 5CIPH 2HLAB 3ARFB 4JKMA 4BKLA 3ZSTA 3JV5A 5C0AB 1GGCH 5GS0C 2MHAB 1YMMB 2PO6D 2HJFA 4XBEH 5HD8D 3QUKA 1IZKA 4TULL 5F1OB 5IBTL 1I9IH 4FFVD 4I0PB 3D0VA 2E6QA 4PB0H 1W72L 3AMLA 4MSWB 5HDBE 5GGUB 3L5XH 4J8RA 5C92A 3VFUB 4I1NB 1A9EB 3D5OF 5IW1B 4M6AA 3KPSD 5CLWA 2C7UB 1T0NA 1ZANH 2EH8L 4QY8B 5T3XL 3GDBA 3V7MA 1KJ2H 3L3IA 1OAXL 3WO4B 1RUQH 2X9XA 5FYLL 3RDTA 1MCBA 1S78D 1VKXA 1QLRB 1FGNH 1I85C 1T4KA 3C8KA 1RIHL 35C8H 1AE6H 1HHHA 2CIIA 3UAJD 1BECA 1E6JH 3W5NA 4MNQB 3OX8A 1GHFH 1LDPL 4ZUUA 3LN5B 2XRAH 3HG1E 4DGYL 3U0PB 4PJFA 1KENH 3MGTB 4RISL 5EC2A 5B8CA 2ADIB 4ZD3L 3PUCA 1VFAA 3HLAA 1CLYH 3S9DB 1L6XA 2NYYD 3DJ9A 4JRXA 5HYSA 1KUMA 4D8PA 5DHYB 3D3VA 3TYFA 4P3CH 4WY7H 4OCSH 1EERB 1FN4A 4PRAB 3K4AA 1G9EA 1PKOA 3VI3E 4ZFOL 4GXVH 4RNRB 2YK1H 3C2AH 4R8WH 1J0ZA 1N0XL 4B53A 5JOFA 1A0QL 1U8NA 3LN4A 3I6LE 1JYVA 3MRPB 4PLJC 2GT9B 4RSVA 3FRPG 4ZO9A 4HGKC 1IGML 4HV8A 5IB5A 3G9VA 1IARB 4JR9L 4ELMF 4LKXA 4XWOD 3M8OL 3RPKA 1LK2A 3KXFD 3CVIL 3QNXA 3LV3A 4NRYB 3H42L 5FOBA 2PF6A 5D71L 1BFOA 3SE4A 1OAKL 2WAHA 5T3XH 4TN9A 1KF9B 4YHLL 2HJLB 2YA2A 5HDQH 5JNYB 4I18C 2OLDA 5I1KH 4TSCH 3QDMA 4LSRH 2VIRB 4NJ9L 3F5WA 4YNYB 2JB5H 3NCBB 5E56A 4UDUA 2AABL 4I3RH 4KQ4L 3FQNA 4RA3A 4L3AA 5FO7A 2GSIA 2ADFL 1QYGH 5J1AB 1FAIL 4GLRH 4M7ZC 3BESR 3S35H 3V5DB 1ZA3B 4PG9A 2BOCA 3MNVA 4WHTB 3VFGH 5C70A 2JJTA 2HH0H 3CLFL 4Q6IB 2H6PA 3IF1A 3B9DA 3L9RA 5KOMC 3B2VL 1NPUA 2AK1L 2GJ6D 3DTXA 2XWTA 4PGJA 1TLKA 1EV2E 4KK9D 4LHQB 2ATKB 4XC1L 3VH8G 2I9LB 4N0YL 1H3PH 1I3RB 1R24A 1U8PA 4MNHB 2Q87A 4XPHL 5F3HA 3RY6A 3KR3L 3W2DH 1UVQB 1XIWB 3MRFB 1T2XA 5JHDD 5KG9B 2MNUA 3VI4E 3ZO0A 2DD8H 3QIUA 4JZNA 2O93L 2YRZA 1OP5H 1LP9A 3BZEB 4DGVL 5HHMD 5C2UB 4JQXC 3HG1D 1QHOA 3SQBA 1EDQA 3NGBC 1EBPA 2JK5B 1JWUB 1BBDL 2H3NB 1VHPA 4IS6B 3HTLX 1RU9L 1IJ9A 4CN1A 3HS0B 1GPOH 4NWTL 2X44D 1A1MB 2AXFB 2NY2D 4XX1E 4MD0B 5HYQA 2WWKO 4ALAL 4RGNE 3EYSH 4WUUA 3G04A 1WZLA 3PJSA 3S4SG 1ZLSH 5C9JA 4PJCE 2OK0H 3MUZ1 4P59L 4MS8D 4HJGB 4OLWH 2BMKA 3B9AA 1KG0A 5C0EA 1QFWI 3ARDC 2X1XR 1KULA 5GJTL 2VXSH 2UWEF 1JGLH 5KS9A 4ORZC 4Y7MA 2XFXA 2AJSL 1WBZB 1KFAH 3HZMB 3MBEA 2HKHH 4H5SB 3X3GL 4QLRA 5C6TL 3SO5A 3MLUH 2C3GA 4OD3H 5ENWA 1URLA 4L8DB 3B5TA 1KB5A 5IK3A 1BFVL 2MQCA 4LU5L 1UJ3B 3S5LA 3R0MA 4PV8B 5DJZA 3ARDD 1JK8A 3ZDXE 4X6BA 2VJXA 4UMGA 5H37H 4J23A 3G6DL 5F9OL 1R3HA 3VXPA 3B8SA 1XF5A 5F88B 5E00B 2D4FA 1PLGH 4HKJB 3LH2L 5JDSA 4H8WC 5JQHC 3MUGB 3H3KA 3KLAA 4EOWL 5B8CC 1BBDH 2R0WH 4JPVL 5EH1A 3TPKA 4HUWB 1TQCC 5HVFB 1OW0A 4X6EB 5TDOA 1CFTA 2IANE 4ZTPH 1Q72H 3QPXH 1KB9J 1VADB 2HVJB 3L9RB 2HYMA 4LLUA 3MRNA 3DVNA 4NBXB 2ZSWB 1F4WL 1X5GA 4BFIB 3LOWA 1ORSA 1V8HA 4L29B 2D4DA 3V9FA 4G7YL 3CU7A 5HHVH 3X3FL 5DMIL 3FOLB 3VMNA 4WTZG 4H25A 1H9VA 3QPQC 1QSEA 1E27A 2XWJB 3VXSE 2DMCA 3MLZL 2WBKA 2BDNL 4BSJA 1NGYB 5GZND 1ZT4B 1RQ5A 5BRZD 2AXGA 3HB3C 3V5DA 5LKNA 2X4QA 3WO3B 2ED7A 2VQTA 4B0MM 1NH6A 3QXWA 1HINL 4JDZB 5DEFA 5EU5B 4E5XA 1D5BB 1L7TH 2UWEA 4P5TA 1I3UA 1XZ0A 5AYQA 1YPZF 4XCFH 3O4OB 4EQ3A 5KSAD 1TQCB 5B3NA 3TIEA 4FQ1H 4XH2B 5ISZD 4MNQA 1GGIL 4LSVH 1DL7L 5FGCE 1GC1C 4OD2B 2C3VA 4WI9A 5K9OB 5MP6L 1AXSB 3RVXC 1WISA 4F7MA 4XAKD 1LE9A 4XMLH 5H37G 4L8BA 5F1IB 1N26A 3MLSL 5IP4A 3MGTA 2AK4B 3MFFB 3QAZB 3CFEB 5E1AB 2XZQL 1F6FB 1KJ3L 1EGJL 4HH8A 3TA3A 5DO2C 5BCAA 1N8ZB 3FO2B 4UT6L 1P4BL 5BZDA 2BY3A 4I4WB 3GI8L 2CH8A 4IOSD 1H3TA 3ARVA 3T3PF 1PGRB 2FWOB 4GKSB 1CI5A 3C8HA 1HXMB 3L7FA 1EEUA 2OK0L 3BKMH 2OXGA 3BH8B 5F6HI 3UJIH 3O2WH 1TTGA 2D9CA 2EDEA 4GMTH 2VRAA 1B6UA 1INQA 1BIIB 2H45A 1S5HA 3NAAH 5A40E 4PJAB 3VXOA 4LHUD 2FEEL 3V79C 2OZ4L 2VXQH 3KLSA 4RMTA 3QO0B 5IMMB 4YHYC 3FZUC 1VADA 1F3DJ 3ZHDA 3BX7C 4JKKA 3IDMA 5KSBB 4XVTH 2P5WA 4V1DD 1X5KA 5DHXB 1L7TL 3PDGA 1N64H 4JM2A 3MRMB 3K8LA 1CDIA 2H32H 2K9UA 4G3YH 4PPTA 4MD5B 4ETQB 1PEZA 1ULVA 5IJKA 3L3GB 4MAUH 2DYPB 1AO7A 4OQTH 4JPWL 4R7NA 2I07A 4PV9B 5EIIB 4J3UA 2ZPKH 3KYKL 5KVFH 4EBQL 3L95B 1AGFB 4NZRH 1U8KA 1EO5A 1RUMH 4WCYL 3KLAB 4X6CA 5MENA 4X6DA 4Y2DA 1UCTA 1NJ9A 3LQAC 4GW4B 1X5AA 4JGMA 3EFFB 3MV8D 1X5LA 2AK4E 1II4E 3DIFA 4WEBL 3RZWA 4OJFH 3UMTA 3BN9C 2Y07H 5EO0A 4WI4A 2NXZB 2P24A 4R2GC 4HF5H 3T08A 2CUIA 3CLEH 3T77A 3UROR 3DV6B 4PJXE 3Q48A 3RUGF 2EE2A 3HG1B 3SGKC 3W0WE 1QEWB 4XP9L 4F37F 1JZ7A 4QWWC 5DJ8A 1I85A 4G6JL 4Y16C 3RA7H 4JKPL 4L4JA 3U82B 4ZXBB 3CFCH 1ETZB 1IAII 4S1RH 1AGEA 1DQTA 5C0BA 4P5KA 5IW6A 5HJ3A 4X4MA 1UJTA 1RI8A 3E0GA 3EZ8A 4KDVA 2OMNA 3K2MC 5FUZH 3KPMB 1WAAE 4R4BA 4XVUC 1IM9A 1RZJH 1UACL 1QP1A 2P45B 3D9AH 1DBAH 3VE0B 4TYUA 2B4CH 3UC0H 3HE6D 5CJXC 2NY3B 1FJ1B 3B5GA 3DYOA 5EULV 3PWPD 4JHAH 5HHPA 1EFXD 2QR0B 2PXYD 1INQB 2OR9L 4RX4D 2ADGB 4GH7B 3DO3A 3PABB 1ZXQA 3TBWA 1UZ8A 1TETH 4KQ4H 1EZVX 1H3UA 4PY7B 4MNQD 1NAML 2BRRL 3RTQD 3X3GH 4HUXA 4KZDH 5FYJH 3A0OA 4YFLI 4LVOB 1S78C 5GRJL 3FB5A 1NUGA 4OZHF 1J1OH 4CRPA 4O02L 1QSVA 3GMOB 4K8RD 4I9WD 2IALB 2DIJA 3IDNB 5IFHH 4G8GA 5JDSB 5HGDA 4EDXA 4CMMB 4PJ9B 3BO8B 2HJKB 2VDKL 1NGZB 2NQCA 2J8OA 1U8IB 3O6LL 3CFKA 3ARBA 4JJ5A 4PY8J 4Z6AT 4AY0A 3HPJA 3BGAA 4HGWB 3E6FA 3MMEB 4ZO8A 3N1GC 1XGTA 2JJTC 2F53D 5ICZB 3BZFB 5HHOB 2V2WB 1G7HB 1A3RL 1Q0YH 1S9YB 2R15A 4JHWH 3VXUD 2XG5A 5L7XL 3GHEL 3I2CH 1MCFA 3MBEB 4B7IA 1VFBB 3KPNA 1MLBA 1IC7H 4XP4L 3BPNC 1CGSH 2DWDB 4A2MA 4UTBL 4XCYB 4YH6A 2QLVB 5AWNH 4OF6A 5EWIH 3V6OC 1RJZB 1KB5L 1WWWX 4F58L 4KKCC 4PJIE 4Y19E 5I16B 2W9EL 1JF1A 5ANMB 5D1QA 4M3KB 1A7RH 1K8DA 2VABA 1YEJL 5BV7C 4NC0B 4O5LL 4WFGE 2YD2A 5FUOH 1NGQL 3O8XB 2CD0A 5HVGB 5FGSA 1A6VL 4K7PL 2AJYL 5JXED 1AGEB 1T89C 5IFJB 1V7MH 4JM2F 3QEGL 1BAFH 4FQJL 5ID1A 4ZDHA 2NY0C 5BVPH 4G8EB 2F58L 1TCMA 3AAZA 3B2UD 5MI0B 2PW2B 5HYIA 4JFQB 5ESVA 3DVNB 2HTKD 4ZUWA 1JPTH 4M02A 2VN7A 5LBSL 1C12A 2ERJB 4KKAD 4O51B 3BP7B 2I25N 3Q3GB 3LEYH 5AYUL 4X5XA 4ENEC 3H0TB 1SJVA 4IRZL 2VH5L 2VR4A 2HLFC 1B0RA 3GJEA 1JPTL 1S7SA 4F7EB 1IC1A 2NMSA 5CZVH 4JO2L 4ODUA 1CGUA 1PG7H 3KPRB 5C7XH 3RL2B 5FYJU 1UYWH 3B2UC 4BUHA 4IRSA 1CG9A 3FFCA 3GMLB 1VB9A 3KPTA 5F89A 1MCIA 1I8KB 4O00A 4QHUB 4I9WE 3HE6B 3WJJC 1W0VB 4ZOCA 1SY6L 3GM0A 2YA0A 3QPXL 4XMKL 4Q58C 4RQQA 2FSEA 4NBYB 1J8HE 2DQEH 4YHKL 3V5HB 1NBZB 5DFVC 3T0ED 1R5IB 3O4LB 5TE7L 1JRHH 1MCPL 1QSZA 5DLMH 5TF1H 2P44B 4JFPB 4QXGH 2AAVA 4UQ3A 3P0VH 3SE4C 4IOIB 3GGWA 1DLFH 3MRGB 1E6JL 3LSOB 3LZFL 2Y06L 1KBGL 4P2OB 4KRLB 2B2XL 1BF8A 4JVUA 4NKOB 3KDMA 3T0EC 5L6YH 3KPNB 1NCWH 1IL1B 3ET9F 1BLNA 3OF6A 5TJWK 1N4XH 3AS1A 4KTDH 2CK2A 4OFYD 1HNGA 5ESAA 4UT9L 3K0WA 4QXTB 4ZUSA 4AEIL 2X4OA 5MHSD 4WGVB 1S8DA 1R3LB 2A1WL 4N0CD 3VFOB 4ZPTB 2V2XB 2AJUH 4OD3L 4YXKH 1FRGL 2W07A 4HXBL 3UBXI 1FL5A 1MLCA 2R1WB 4NNXB 1JWSB 3IDUA 1CXEA 4KK5D 1X3DA 4X7SL 1MCWM 1AR1C 5GSRA 1ZMYA 3VXUB 1I7RB 3SGJA 3HI5L 2HKFL 5FM5M 2LVEA 3BQUD 5T1DL 3MJ9A 3T0DA 4ZS6C 3R8BB 5F9JB 1YNLL 4P57A 3IAGC 3SGDI 2H2SC 1MJ8L 4CN4A 2PO6C 2YUZA 4GRWE 4HBCH 1P9MC 4PBXA 2GUOB 5D7KD 5T5FH 1CDBA 4LRNH 3CJJA 2YBRB 4YHZL 4S2SA 4DAGH 4G5ZL 4F2MB 1K2DA 1QD0A 5J8OA 4BZ2L 4ZNEE 1AGBB 4D0BB 4LLDA 1KLGB 5KSVB 4PP2A 4YDIH 4OM1L 2NYYC 3MUY1 2BVOA 4BSVA 5CKAA 2E7LC 5EUKA 3PHOA 3QDJA 2CKNA 1C5BH 4TUOA 5HHOE 3QFJD 4AH2A 4K7PH 2P8MA 2I24N 4U1MA 2VDML 3QFJE 1T0PB 1YNTA 1X5YA 3V4VL 2XWBB 3P2TA 1A6AB 1LMKA 4F15C 3BP4B 4XRCA 1Y0LA 1FIGH 2VL5A 3GSNL 4PBVC 2BSED 1K6QH 1F2QA 2DQJH 4YC2C 3QFDB 4WRLA 1D5IH 2DTMH 3CC5B 3GSQA 5I1DB 2XQBL 1QFOA 2Z93B 2EDHA 1KCUL 1IC5L 3I02B 4PG9B 4MLSA 2EXWD 5BW7C 1U0QA 3ARRA 1D5XB 2EO1A 5C08A 1JP5A 4JGJA 3S35X 1ZGLB 1F3JB 5EDXA 5FB8A 4MB5A 5CEZE 4B50A 4PRIA 4Y19B 3CMGA 1ETZA 3QO1A 2R4SH 4JKWA 3DLQR 1OTSD 4BQBA 5KW9L 2NY6C 1KTDB 4LKCB 3S36H 1LNUA 3BPOB 4L5FL 3LDBB 2NY0D 5IQ9B 1CQKA 1MRFH 4NFDA 3B9VA 3QQ9D 3EJJX 1A1MA 4G8GB 4KRMB 1I7ZB 3VDBA 2PCPB 5ISZE 3ULSB 4WDIB 5DT1L 3ARGA 3CDGB 5ALCL 4LLMB 1A1OA 1HK6A 4OF3A 4OFKA 4KY1L 4QTIL 1RK0A 4XCCL 5B38B 1TNNA 2R0LH 4PJEF 5I1LA 1N2RB 1G7HA 1JHTB 1BIHA 1FNHA 1XR8B 2J7LA 1KNOA 4LVOC 4PJEA 2WUBL 3KXFB 1CIUA 4M1DL 5B3JF 4GO6B 1JPFB 1XF4B 3VGGA 2FX8H 1VGEH 5KBNC 4RAVA 4HH9A 4UILH 3GRWH 4PJ8D 5DA4A 4Z7WB 1V5JA 2QSTA 3K80A 4FXGB 4PJAE 2DOCA 3EYQC 2HFGH 5D6CA 1F4HA 5J9PA 3CFJA 3RWEB 4NQCE 4KHXL 1CFQB 1DSFL 4RISH 1A7OH 4NC1C 3UTQB 2CK0L 3P3YA 2X4OB 2XRAL 2CR3A 3GBNL 3BQUB 4HFWB 2NY3C 2HAZA 2DMBA 2GITA 2OCFD 1HYSC 3MLVL 5E6IA 1ZVSA 3HCVA 3P4NB 3NZ8B 5HHVL 1FNFA 5JXAL 4G3YL 1UXWB 2CMRH 4G6ML 3MLYL 3VGHA 2IH1A 4ETYA 5GSRB 3Q1SL 1WIPA 2VDKH 1RPQA 2CRYA 1BVLB 4HCRH 4KDTA 1F2XK 2AGJH 1Q72L 3EO9H 1F6AB 1IAIH 3GI9L 5CJXA 5JPNB 1RIUH 1RZJC 4MQTB 4GW1B 5T1MA 1JVKA 4NNPH 3WXVL 4KUCD 5BRZE 1IQWH 4LLYB 2DQGL 5MEND 4DWHA 2DWEB 3VW3H 3P77A 4YDIL 5EA0L 2ZOKA 5IEKB 3GSVB 3WN5B 3MRBA 4G42A 2JIXD 1S7UB 4P4KC 4OGXL 4I8DA 2QQKL 4Y5YB 1YJDH 4LVHC 3MOAL 5CBEA 4ZUTB 1MFBL 2DM7A 3FB8B 2P8LA 2BOCB 3E1F1 3MNVB 1D6EB 5D8JL 1MJJA 5F8RC 4PJ8C 4L3EA 43C9B 5J89A 2UVFA 5E8NA 2ICWB 3CXDH 3HNSL 2NX5D 3NIDE 1X4XA 4HZAA 2AEPL 2CDEB 2OTUA 3DRTA 1OVZA 4ZUWB 1N3NA 2EDTA 4HMCA 4X4YB 2FB4L 3EO1A 4R6UA 3PWUA 3EHBC 3ZT5A 2RHEA 4C56D 3BD5A 4JANB 1AE6L 4YR6B 4WI8A 2PYEB 1ZT4A 4DTGL 4RWYL 1MF2L 3RL1A 4F9LA 5C0AA 2CDGB 1WC7B 1U8MA 5JW4Q 1QFWM 4DW2L 4I48A 2XA3A 3KPRA 4DKFL 3FFCD 3BKJH 1VFUA 2HT3C 1N7ML 1GL4B 4KMTH 4PB9L 4WWKA 4F7PA 2F54D 3TO4B 1ZHBA 5IJKC 4PJAF 2F54E 1BVZA 1MCLA 1MHHB 1OTTD 4KVCL 5JLZA 4PJ5D 1ERNA 3MFFA 1J87A 5F7NC 1QG3A 5I8KL 3IVKA 5AUMB 1I1AD 5GS2D 5IBLC 2JF1A 1QLFA 4M5ZH 3VFTB 3V5HA 1I7UA 4JFHD 4ENED 1CFQA 4ZMAT 3SDAB 3G6DH 1F6LL 1U6AL 3TZVB 4Y89A 5GGVL 3W82A 2NTSP 3CDYA 3V6ZA 3H9SD 2BOBA 2FATL 2X4PA 4AL8H 1JIBA 1YY9D 3DROB 4LCUB 1A1NA 2AJ3A 4R26H 5TQ2H 5DMYA 1LEGB 4N5ED 2A9ML 1U3ZA 4PJ8B 2J12B 4G6KL 3NCEB 2IAND 3F12B 4MVBD 4OLZH 1JNHA 5FM4A 2BFVL 2N1KA 4RBPK 3DRQB 4ZFOA 5C09D 5DHVH 3QQ9C 3KPQA 5C0BE 5CLTA 1D5ZA 1MIEH 3AM8C 3T0VA 5F71A 2R23A 3HMXH 1WTGT 4GW1A 3F7VB 1O5DT 5FGRA 2UVEA 4EIZC 1K3ZA 3MOBH 3V0AC 3H3PH 4X4XB 1F8TH 4UIKH 4Z95L 5JIHA 2DWEA 1MAKA 3P77B 1WFNA 3CFDB 4PJHF 4QXGL 5DVKA 1YN7B 4LFHG 5TF1L 3FRPA 3GMRB 3L6FB 4LFHD 1NC4A 3FT4A 1GZQA 3O2DH 4XI5C 5EOTA 4DKEH 4R9HA 3B9KC 3BI9X 4U6YA 4EN3D 4R4FL 4YUEH 4ZODA 3GJFA 3WIFB 4UDTB 2J8HA 1TCRA 4X6CE 3N9GL 2C4FT 2A6IA 4AMKH 1KB9K 2HVJA 3GK8L 4QRPA 3VXRD 1HZHL 4OCLC 2VXVH 3ARFC 1B0GA 1D5IL 3BWUC 4LCYA 2R56H 3BQUC 3PWUB 3L5WB 4K9EC 3VDCA 1KJ2B 1W72H 2B0SH 2DTSA 1NFDF 4PGBA 4I5BA 3PP3H 3O11B 4LEXL 4XAWL 4LLYA 3WHXA 3X13A 4J12A 4JRYE 3B3IA 4R3SB 2HFEA 4BFEA 1NCUA 4NKDA 3QHFH 1E4JA 4QHKJ 1FO0L 4JO4L 1ZLUH 1J05B 4Y4HA 3S5LB 4PRPA 3IXTA 2XTJE 3ILQD 3VWJC 1U8JB 3ULUL 5BXFA 2BNUB 3WSQL 2ARJQ 3ULSA 1UWXK 1NFIB 5ACZB 4G43B 1FAKT 2BNQB 5SWZE 4KMLB 2Z35A 5CP7A 3JWNC 2XQYG 3GSRA 1KIQB 5SWZD 3IDJB 4GRMA 5F6HJ 1JNLL 1CLOL 3EYUH 4OSUL 1F58L 1FE8H 3PWLB 4Q2ZB 5F7LB 3QHZH 1NGXB 2QADD 4Y16B 2HKHL 1ZGLA 4U1KA 3NFPA 4GG6A 4LCWE 3GEWB 1BOGA 4WI7A 2LTQC 1M7XA 5FUCC 2MKWA 5C0BD 2QEJA 2VDNL 5CBAA 1ND0B 1A7NL 5HXMA 4NYLB 5I1IH 3RI5K 5GZOD 1WBYA 4LQ1A 5T3ZE 1BP3B 3W5MA 4EN3A 2V5TA 2AJZB 3GK8H 3SDAD 3JV4B 3OAYK 1OF2B 1P4LB 4XCNB 3MO1B 4LCIH 1RUAL 1A14H 2QQNH 4U1HB 3EDEA 4KHXH 5KVDL 5I30H 3N1FC 1MI5B 3F58H 2Y1VA 1KYOK 2CK0H 4R2GD 1QBBA 3E8UH 1T20B 4JO4H 3MRLB 5CIPB 3HC4L 5HHNB 5IFAH 1SQ2N 1JRHI 4TTDC 4UT6H 3PDOB 4YDKL 1RU9H 4H5SA 5I1KL 1R3IH 2WBJD 3KNBB 4OFDA 2C26A 4M7JH 4MXQD 5GGQH 4HKZA 2FO4A 2DQUH 1EBAA 2F15A 4JVPA 1GIGH 1MNUL 2H2PC 1JHLL 3RGVC 4YE4H 2IH3A 2XTJB 1DN0B 1RFDH 2NY0B 2FJGA 2K7QA 1D5ZB 5IHLB 4GAJL 1BEYH 2EEDA 4V1DA 3SCMA 1LQSR 2EDYA 3TFKD 4OLYL 3EZJB 2BHZA 5E2JA 1J1PH 1AIFA 1MHEA 2OI9C 1C1EH 1MFDL 4NKDB 5GJTH 4HLZH 3OXSB 4WU5A 5GJSL 5KSBE 2CRMA 5EC1A 2NR6C 4NZUL 1I1AA 2JJSC 1CG9B 3EYOA 5JNYA 4QF1B 4L8SC 5DJYA 1GGCL 2JCCF 1X9QA 3O6KL 4NC1E 3I75A 1PD6A 4HLJA 1YEEL 3F5WB 3DMMC 5CGTA 4ODHH 3SDCB 5B4MC 2LU3A 4JY6B 3D39E 7FABL 3MREA 4X9GA 4YDJB 5IT2L 1R3KA 5IMOA 1AHWC 1IFHH 3D1MC 4YDVB 4G9FD 2FHFA 4BH7A 4UB0L 1S9VB 1FPTL 2V5MA 3AREB 1OAQL 2X4UA 5FK9B 1FVDB 4ZFFB 2VXUH 2XA8L 2DLFL 4O2EB 1FIGL 4PJHB 4LLWA 4AQ1B 4BFGA 1LILA 4G8EA 2D2OA 1I8IA 4OFVA 3THMH 2R1XB 3PHQB 3MNWB 4ZTPL 3ZTNL 4ONHA 4IHOA 4Y4KC 1VEMA 4GS7B 5HI4C 1YC7A 5I73B 2AI0L 5JLZB 4HF5L 4ODXB 5DUBA 3J7HA 2NY5C 1Q9OA 3QRGL 3QDMB 1FFOA 3CSYB 3MJ9L 2VC2L 4R97C 2A38A 2GTWA 4QRTB 1XGUB 3I6GA 2NY6D 2J88H 2Z91A 1AXSA 3CXDL 3HNSH 1HKLL 4YR6A 1T7ZA 1KXTB 3MRLA 5CIPA 3UAJC 3ZDYE 4JY5L 5D70H 1MCSA 3CK0H 2YOCA 5DVOA 5HSFA 5E4EB 1NCBL 1WC7A 3PWJA 3RP1A 3HB3D 3T2QA 2EYSB 2Z4QB 3HE6C 4I4WA 3DXAE 1BF2A 1BM3L 4M7KH 2O5YL 3O6KH 4JFOB 4GKSA 3LRGA 3JWDH 4YZFE 5HHMB 3KPSA 1WBYB 3NA9H 1FZOA 2DQTH 3L5HA 1DUYB 1HXYA 3U7YL 5EORH 3VFNB 2VXQL 4AEIH 1KXQE 4KGJA 3L3HB 1GOFA 3Q5YA 4X4ME 3HC0A 2BC4B 3FONA 4WFGD 3TZVA 4KPHL 4NN7C 3SCMD 5L2KA 1H8NA 1TFHA 4GS7C 2R2CA 2EEBA 3PP4L 5IK3B 4ZFZB 4M61B 2XY1A 1EHLH 3E6HA 2UV3A 1BJ8A 1NCAH 3PP3K 3W11D 3U7AA 1MCHA 3WO4C 1CDYA 3D87B 3I75B 1A9EA 3WXVH 1FFQA 3BEWA 3MGAA 5D7JA 4WEMB 1R3JB 4MAYC 5JW4M 1C7TA 3GI8H 4QRRB 2VXTH 2G2RA 1R3KB 5LWYL 2BSTA 4YHIA 1RUML 2FX7H 4XPFH 5I74B 5GQBA 4K94L 1G9MH 1ZHLB 3O0RH 3LKPA 1H3PL 2Z93A 4U7SA 5JIKA 4DOHE 3PQYB 4PS4H 3LEXA 4G6FB 3X13B 5EZJB 1DQDH 1I3VA 4M43H 5HPMB 5F7KC 4FQXA 4XBPA 4Y4FD 3KPPB 2RFXA 4LSSH 2MCPL 1EAJA 3HNTH 2MQ3A 3QUYA 4YQXL 3TO2B 2J6EL 5CMAA 4Q9RL 5ENWB 4WO4A 4F57H 2EE3A 4RGNB 4JRXE 3ECBB 1OPGL 4U1JB 5ESQB 2P5WE 3CXHJ 3LMJH 2B1AH 3RU8H 5DEGB 2HRLA 4I77H 1JV5A 5CEZD 4CMMA 4OCWL 5JHDE 3RGVD 2JJVA 4HIXL 5ANME 5F1SA 1J8HD 4TUKL 4YXHH 3GSRB 5LCVH 1X6NA 4DKDC 2PCPA 3BRFA 3VRJA 3S36L 2DS4A 4GKZB 3REWB 5A2KH 3CFKB 4JJ5B 3RWGA 1DEEB 2H1PH 4UTAH 3GSNA 4TULH 5IVZB 5C08D 3G6AB 3QDGB 1RJLA 3GBNH 2AV1A 2VLLA 1N7MH 2WQRA 1J18A 1BOGB 3FJTA 5C0BB 4IMKA 3S34H 1PKQA 4FNLH 1BQLH 4Z95H 4NQVB 5C6PB 5C0IA 1AR1D 1CFTB 2AEQL 3UXFA 1JHTA 4KK5C 4LIQL 5EBLB 3N1PC 3H7LA 2Z31C 4POZD 3X14B 3W81A 4YK4B 2AJZA 1Q1JL 4LLUB 4X99B 3I6LD 4EXKA 1MREH 3ZLQC 3UZVB 4UINH 3VA2C 5FUCE 4JFDD 4S1DD 1HXYB 1G9ML 2V5RA 3HMWL 2LV4A 5J1TC 5JMOC 4PJDB 2D7NA 3QJFA 3MPCA 2LAGB 3DX6A 4PJBA 1G84A 4KZEH 4Y5YC 2ZG2A 4NOFA 5L2KB 4WHTA 1UM4L 3FN3A 2VDLH 2XPGB 1G6RA 3MX0A 4B5EA 3FO1B 3PQYE 2DQCL 2YA1A 3U0PA 4Z76A 3GO1H 1TZGH 4PR5A 2BXZA 1GGBH 1CLOH 1PZ5B 4LCCB 1UH4A 1P7HL 3LSOA 2ZOLA 1T04A 4LGSB 5DD6B 3QB7C 3SDYL 2MPAL 3H9YA 5D4QA 1YDPB 1ZK9A 4KGLA 2G60L 4ZO6A 4YHZH 2CKBA 4K2UH 4RNRA 5TH2A 3ZHLA 4K55A 3IDXL 5GGTH 1T80A 2ZCLL 4Z7VA 4ZPTA 1ZAGA 4XHJC 4H0HB 3EYFB 2YD5A 4PGDA 5T1LB 3RWDA 2WWMC 4BQ8A 5JDJA 1CGXA 4DCQB 4M7ZB 2W0KA 1JHKL 3D0LB 2HFFB 4U7KA 4NUGL 4X98A 5D72H 4ZS7H 3V6FB 2V7HA 1VFBA 5HHXH 4EJ1C 2BNQE 4DVBB 2AK1H 3RNKB 3B2VH 3BJLA 2J2ZA 1A4KA 1FV1B 1FNSH 2GHWB 4GQ9L 1SBSH 1LP9F 4JY6A 4KZDL 4U1LB 4P57B 4HIEB 5E8NB 1NEUA 5K9JL 3R4DA 4JVWA 1YEKL 1WBXB 4M4RA 4P9HC 1PX4A 4M62L 2Y5EA 1KV3A 2NY2C 2W9DH 1QYGL 2C3WA 3EYQD 5A3ID 1SVCP 3OL2A 4OIAA 3DHJA 1HINH 3I3BA 2YBRA 2PW1B 5SWSE 5K9JH 1IGTB 3MRGA 4BH8B 1FFPB 5SWSD 4L1DA 3GBMH 4PP2B 1RZJL 5EA0H 4S0TD 1NJ9B 2OTPA 1LWRA 2B4CL 4PJ7A 1WFTA 2D9QB 3NFNB 2AJXL 4D2NA 1OAYH 1QFUL 3TO4D 1P5UA 3FB7A 4DUXA 5FGBC 5BOPA 1QR1A 3IDMB 1QO3B 3KPOB 4DN3H 2LE9A 3IS0X 1KPUB 2XT1B 1MAML 2FZ3A 1TJGH 3KYOA 2Y6SD 2BVUA 5TE7H 1FL5B 4NM4L 3VD7A 5SV4A 1VFOA 1CFNA 3FB8A 1JTTA 2IADB 4KK8C 2J4WL 2R0ZH 2VDOL 1ZKAA 3T65A 2BCKB 4PV9A 3ZZ1A 5EIIA 4BK5A 4PJ5E 2RB8A 4ONGL 4ODVL 4HC1L 4MD4A 2IBZY 4L3EB 43C9A 1WK0A 3OKMA 1JN6B 2HWZH 1D5MA 4JHBA 3DROA 4AG4L 1BQSA 3MNZA 1F4YL 5FYKU 4FFVC 2FBJH 3ZSSA 5EU7E 1KIRB 3O2DL 3ULVC 3GUTA 5DSCA 5ISZB 4HXAH 1MCPH 1M1SA 3FT2B 3WD5L 5GS0D 3MV9E 3ZDXF 3VJ6B 1XR9A 2GFBB 2VDQL 4XC3H 3TYGL 1MUJB 4ZXBD 1G9NL 1QRND 2JE8A 4Y4HD 5F9WB 1QQDA 1PYWB 5D6DA 5JXEA 1RK1B 3IETA 4ERSH 3C5ZA 5F97E 2XKUA 3BPNB 4DZBB 4DGVH 4WWKB 4WHCA 4OQTL 3GMOA 1MIEL 2ZUWA 1MHCB 1IAOB 4PJDA 4K3HA 5I17B 3RUGB 1A1OB 3CSBA 3MV7D 5DHVB 1CIDA 5ETUB 2QQLL 3IYLW 4JO2H 5EC2B 2R8SH 4ERSL 4PJ9A 2R69H 5D2NE 3BW9A 5SWZB 1JCKA 2DLFH 4G6MH 3E3QE 4JN1H 4H26B 4NZTL 3HA0A 3RGVA 4DGIL 1A7RL 2XN9A 4MJ2A 4G6FD 1HH6B 3LS4H 1DUZA 2ATPA 2QSVA 4YJZL 2V2TA 4FFWD 4GMTL 1JNHB 3RIFF 4QXWA 4FN0A 3W0WB 5ITFA 2LQRA 4WEBH 3VH8A 4GMSL 4U1IA 1KLUB 4OD2A 5K9OA 3A6CL 2AEIT 3MOBL 3FO9B 4WFFE 3JXAA 5F7UA 4O9HL 4UILL 2NTFB 4WFFD 5TDPB 5D1ZA 4XPTL 4Q9QL 5L0QC 4PJ9D 1Y18A 3SY0A 4O2CA 3IAQA 5HTSA 1A7NH 3LQAH 1KELH 4FG6D 4MJ5B 4XCYA 5D1QB 1AI1L 1HHKB 4OLUH 4YHPA 4NO2A 3GSWA 4N1HB 1F4AA 5IJVA 1FZMB 5HYFA 4LSTL 3U0WH 1VCAA 1ZHKA 5E4EC 4CL7A 1FYHB 3C08L 1JPSH 4EVNA 4NCDA 1A6TA 3TN0A 5E95B 4MXVE 3N50A 4M03A 2NXZD 4XNYL 2BXYA 5ACZA 4YFDB 1JBJA 4LSVL 3VWKB 1T0MA 4LGPB 1UFUA 3LH2H 3RWJA 3SE9L 1T6WA 2GAZB 3MA7B 2NY5H 1XR8A 5EZLB 2COQA 2BVTA 3MOQA 5DQ9B 3U7YH 4HGWA 1NKOA 1KCRL 4UNTA 4Y4KA 3S34L 4LCWA 1A9BA 1CT8A 2JCCA 4UI2A 2M8XA 3H6JA 4UB0H 1OLLA 3P40A 1JPGA 2EC8A 1NFDB 2G5BB 4Z7WA 4V2CB 5CBAB 3ARQA 4U3HA 2CKBH 3DBXA 3LY6A 2IFFH 1CBVL 5T5FL 5ESQA 4ELMB 5D2NB 4QYOA 1EEZB 2A0LD 5DUPH 4MA1B 1BD2A 4YBLC 4YQXH 3D39B 2OP4L 1CU4L 1A21A 1UENA 1V7NH 4PJBB 4LEOA 4MDJA 3VRJB 1VEPA 3O9WC 1I1FB 3QULA 1U8LB 3IXTB 3HRZA 4WUUD 1BM3H 5CP7B 5HI5C 4MDIB 5F70A 2VLJE 5EN2B 2KL6A 5HVHB 5IQ9A 1B4RA 1DQDL 3BW9B 4I18B 4BUGA 2EDFA 3MV8A 3TH2T 3AS2A 3U2SA 3NA4A 3UTSB 1MIMH 2F8OA 4X6CF 3QQ3B 1MEXH 5F3BB 4Z77B 3OAZK 5KSAA 5JW4N 1U8PB 2XKNA 2XZAL 1TETL 2DYPD 5I71B 4LVNC 1FC1A 3GGWB 4OCRL 2YD7A 3C9NA 3OKOB 3STZA 4UIKL 3MV8E 2XTJC 1PQZA 1Z5LB 3CPLB 5FM5O 4ZUSB 3TBYA 4WW1B 4DGYH 3QWRD 3OG6B 4NCC1 3U30C 1U8QB 3LKSB 4GG8B 2ZZUT 1DQQB 2GK0B 4AJ0A 3QDGD 1IGCL 1HHIB 3L7EA 2YPVL 4ZFGL 2XNAA 1XGPA 1SM3L 5EUOA 1WICA 4MD0A 2BVPA 4YBLB 1BHGA 4C58B 5A2LH 5CP3A 4FQPA 3ZE1E 3MRJA 3U0TA 5J57B 5LGKA 4PRHD 1CF8L 1FYTB 4J6RH 5DQDL 4Z7UB 2WWKT 4KKBC 4HJGA 4PLJD 2IG2H 4HK0B 1JZ8A 2I07B 4MQXC 1FVDA 4K8RL 5EBMA 5F9JA 3HZVB 4FQIH 4JPIA 3OR7A 4EUPG 3MYJB 4PJHA 2IH1B 5T5NF 2EIZB 3KPRD 3FO9A 1V3MA 4G8FA 4P46B 4X6CB 4GRLD 3FB7B 1G7QA 3I3EA 1J9CT 3C60D 3U7WH 5AG8A 3VWKC 5F6IB 3K7UA 4EI6B 5EU6E 3KYOB 3LHPH 1T5WA 1UZ6F 4OFYA 1GZQB 3MLXL 2Y9RT 4NHCL 4DK3A 1A4KB 4QKXB 2XZAH 4HUNB 5CWSA 2ZG1A 4PRHB 4JE4B 3V5KB 3MRRB 4X6DE 1XMWA 3PHSA 2MMXA 4QRUB 2P7TB 4OIBA 4Y2DC 3BPOC 1CXIA 1ONQB 1V7ML 1KIUA 3NCYP 2QTEA 3DYMA 3CSYA 4P2QE 5JOFB 4MNQE 1U8NB 3LN4B 5EC1B 3HUJE 1H3GA 3MUGA 1IGTA 2P5EE 5D7IB 5E8OB 4GG6F 4K3JL 3FO0H 3OPZL 3AREA 4C54A 4ZFOB 4JDVB 5HY9B 1N5AA 4ZOEA 2Z4QA 4ZD3H 3RVWD 2BX5A 5F7DB 4KY1H 1D5BA 1MCEA 2APWA 3PHQA 3QIWD 1MH5A 2HRPH 3FHAA 4HUKB 2W60B 3VCLB 4F33A 4IRZH 3BMVA 2HTKC 4PD4J 4DKEL 3QCTL 2CLVA 5HGHA 4LCIL 2EC9U 1K8DB 2VABB 3ZDYF 3RVVC 4LIQE 2NLJB 1DQJB 3GIZL 3BPLC 3FOLA 5TE4H 3P4OB 1VKXB 1FNGA 1QLRA 3MJ9H 4RMUA 3H8NA 3VXUE 2AK4A 3QDGE 2X4TA 4Q9BA 2APBA 4GG8A 4F57L 4RCAA 4KK6D 4LCCC 3HRZB 3CVIH 1KIPB 5IHUH 3LMJL 4Y4KD 1MQKL 2VLKD 5SX5K 4NWUH 1GYAA 4QHKI 1KCLA 5J7CC 4CVWA 1QNZH 4FQLL 4X7EC 4XNQB 1FDLL 1IM3B 5JXAH 2CDFA 4N0FB 1U41A 4OLXL 3TN0D 5L2JA 4L9LC 4P23B 3VG0L 2VITB 1L0XA 1QA9B 4OI7A 3O45B 4R97B 3G08B 5LJYH 4JKLA 2AEQH 1VACB 5BMFH 4FNLL 1T1YA 2QQQA 5AWNL 4M00A 3V4UH 3VFVA 4DKAA 4P3DB