4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
4BA1I 2VIIA 2AWOA 1TTTA 2CL6X 1DOAA 3B60A 5SZIA 4KLKA 3SOPA 3IBYA 4E03A 4BFVA 4WJ3M 3K0AA 3ZS8A 4JCVE 4I1OA 4GZLA 1GL7A 1OV4A 4GMXA 4LYAA 4PX9A 2VQFQ 1GITA 2EQSA 1AA9A 4JSTA 3AVUA 1NY5A 3AKEA 5E7NA 1S96A 2CQOA 3LQRA 5BN3A 4LV8B 2W0SA 2JCSA 3P32A 3REFA 2GESA 1UBEA 1KSJA 3EXAA 1IBKL 1N6KA 5HE8A 3GFPA 3M4OH 4K8OA 1GZSA 1IAQA 1YEZA 1G3UA 2NOAA 2VQSA 4GNXC 2VTKA 4WIAA 1YR8A 3T53B 4P4SB 4NPSA 2B92A 2H17A 3T35A 1OIWA 3B1YA 2EDGA 2NN6H 1L8QA 2J9RA 2QI9C 2ZI7A 4KLNA 4QFMA 4Y7NH 3K70D 4CDGA 4S35A 1GUNA 4W5HA 2RGDA 2YC4C 1ZM3A 4D4JA 1HQCA 2WVJA 1UEBA 1Q7YC 2OESA 1XD8A 3AVQA 4RZ3A 4CYMA 1R5OA 4YHHQ 1SVOA 3K7UC 1TL7C 3MD0A 4G0NA 3CM0A 3GTQH 2WJVA 2AUKA 2AD1A 2CBZA 5KOYA 3J7ZC 1OXSC 1UM8A 1YZNA 5IYCH 3EX7C 5FBLB 2QAGB 3I5YA 1G6HA 3VHLB 2R7DA 4Q66C 4KVGA 3VFDA 5JRJA 4L9WA 5LBIA 2D06A 2GEDA 2ZJBA 3QPVA 4QGAA 3P1JA 1TWCH 2ZJAA 3WXMA 1ZM4A 5L3RA 4ZI3A 2ZM5A 4FINA 3OW2A 3QVVA 3BERA 1XJ0A 1N9WA 3KKNA 3IIKA 1X6OA 4WOPA 4Q21A 4UXHA 2QSYA 4DAMA 2RGBA 1CP2A 2IUUA 4EPXA 2F9MA 1P9NA 2QRZA 4JLAA 4AK9A 4GI7A 1LS6A 2CE2X 1XEWY 2VYFA 5G40A 2IWHA 2XGJA 3CC7A 2WJJA 5JEAG 1HH4A 2P6NA 2D2EA 4D4LA 1ZC4A 1U8ZA 4LHWA 2UUBQ 2R6DA 3MWYW 5GAHC 5M5YH 3FKQA 4NH0A 3PFIA 4TMVA 4D0GA 2DFTA 2VP0A 1TEXA 3LWNA 1R0YA 3S1NH 3LAWA 1VG8A 2VW9A 3H0KA 1HH2P 3FHWA 3PVSA 3ZZUA 3UDFA 5DH9A 3S15H 1HE8B 4YCVA 3FFBA 1YZUA 1X8JA 2HF9A 2E5LL 3B6YA 3AP2A 4HUQA 3KB2A 1HTWA 2EVBA 4M1SA 1B0UA 1R4AA 5JCPA 2YWHA 2UUBL 1XNJA 1TUIA 3A8JE 3PENA 3CD6A 3R7WA 4E07A 3BIFA 4QBGB 4DEYA 1QHSA 4UP8A 4GLAC 3GTLH 1E94E 3LNNA 3A8KE 4HJ8A 2BMEA 4KHPL 2N3SA 1G5RA 1NN5A 5EUQB 2Q3MA 2YWEA 3GTMH 2WKPA 1A62A 1YNJC 1JEDA 1W0KD 2W6ID 2R6GA 1YJWA 2WJGA 4KV9A 4Q1EA 4US2R 2FZLA 4BFZA 5C0XG 2GJSA 2A5JA 1NKSA 4U00A 4IPDA 4Q4AB 2IS6A 1U9IA 4TT3A 2IX3A 4JL6A 3CIOA 2GETA 1E98A 2B8FA 1KK0A 2PZFA 3GCGA 5FTNA 1W36D 2UUAL 4DCTA 3CRRA 5D3QA 3I4NH 4RFVA 3L0PA 4A82A 5L3VA 4YWKA 1VG1A 2QY9A 1ZUHA 3AB3A 1D5CA 3NWJA 3RVBA 1DXMA 3BRWD 4FCTA 1E2WA 4P73A 3RRNA 4CT4B 1H9KA 2WBLC 2ZRFA 3SI7A 2FF7A 1M74A 1OJLA 3S24A 1AK2A 3TS0A 2H1LA 3IKJA 2VL6A 4TQUS 1CU1A 1Q57A 1SVIA 1Z8FA 4PHHA 4PQYA 1XJVA 2PX0A 1E9SA 4M1TA 1G8YA 1P61B 1EK0A 1CSPA 1E1TA 2XTZA 4B47A 4LFAQ 1OKKA 2ZE7A 2A5GA 2W58A 3AKDA 4P31A 4B73A 3PUVA 1LW7A 2NO9A 1V1QA 3W8RA 1VQOA 1U8YA 3WP0A 5BQ5A 2JIZA 3PJRA 1IN8A 1XMOL 4XWOA 1M7HA 4XSGA 4LZZA 1HT1E 5FTKA 1ZAKA 3U4QB 3ECCA 2FPLA 4TLEA 2N78A 4RCNA 1G3QA 4BEJA 1Y14B 4LK1C 1WB9A 3D4RA 2WAQG 4JVSB 4QC2A 4PO1A 1LS1A 4FMDB 4Q1AA 2KCTA 1JE5A 1OYWA 2DWPA 1PFSA 3KDFA 2UXCL 1OFIA 4C3ZA 3EAQA 3FE2A 4AYXA 2ID0A 1VDZA 3S1RH 1PH9A 4B3SL 4DR5Q 2OEPA 2Z0MA 4TL7A 4H0LC 4R2IA 2XZPA 3WP1B 2IHYA 4Q03A 2DR3A 1K5DA 1GD7A 2P5SA 4PSKA 3WMFA 1HNXL 3ZIAD 1YR7A 4NB3A 2ZTSA 1P2UA 2C2HA 3MXNB 4ZIRB 3KUCA 4HUQB 4ZCMA 3MCAA 2W0MA 3QEOA 1CKEA 2OBNA 3HFZB 2FEMA 3KDFB 3BAFA 3CONA 5FPTA 4DT1B 4OI1A 3GP8A 2BA1A 2D3WA 4M9ZA 4TMTA 1PH4A 1WYDA 4A3LH 4PC3A 3EIEA 1EFRA 1NBWA 4DLUA 1G7TA 3KFVA 3HOUG 2FEOA 3RN2A 4MDEA 4DDWA 1TF2A 3GLIE 3HPRA 1UPTA 2WJHA 3IIMA 2FSIA 3T1YQ 3EZ6A 4GL2A 3CNOA 2RHQB 3EA0A 4KN7C 1G41A 4LJ4A 3TW8B 1JR6A 4K0KL 4W5JA 1XCGB 1Z2CA 4HJ9A 5KU1A 2K52A 3PEVA 2KA7A 3K0FB 4YHHL 2WIBA 3ICQB 3CW2A 4B3FX 4KSCA 5LMNL 1GRNA 1E1RA 1N0VC 2CHGA 3PUXA 4DK1A 3JVUA 4GT1A 3OOCA 2H7VA 1HQYE 1KI4A 1SROA 2BEKA 4DAYB 1Y1WG 2WAQE 3HOYG 2QBYB 3QKTA 2IXGA 1JXOA 2JDID 1SMXA 3MAAC 4MGIR 1E0JA 4UPAA 2CL7X 2FG5A 3ADBA 2ZEJA 2ZRJA 3B13B 1EFUA 4HYYA 1PLLA 3CRKC 2E9SA 2QP4A 1JJVA 4O0MA 3BDOA 5HKKA 3U6KA 5GAEC 4Q1BA 1BKBA 4RD4A 5TY0A 2AFHE 1Z6TA 1I2DA 2GCOA 4JJZA 2J87A 3A36A 1NVXQ 1W2GA 2HCJB 4PANA 1YZQA 1Q1ZA 2HJVA 3K0XA 2PBRA 3G82C 5HR5A 3AM1A 3AVWA 1R0WA 4AH6A 1MR3F 4HZIA 1RRCA 4YMUA 4D25A 1G291 1AZTA 5CITA 2CVHA 3X2SA 1X8KA 1CRPA 2B3GA 4PC6A 4PPNA 5M04A 3BBPA 2JXMB 1HNZL 3B85A 2JJ1A 4BA2I 3DKVA 2WJYA 3THOA 1E1QA 5DIFA 3WNCA 4DDTA 3RRZA 2QG6A 3BFVA 3BU2A 3VNVA 1JALA 2YOHA 4BBSH 4UXJA 4L5BA 3LV8A 1T3SA 2NN6G 3LLUA 5TB5A 1BOFA 3X1ZA 5F9FA 1S40A 3L82B 3U6BA 2WHXA 3KQNA 4AKHA 4I1UA 1E2HA 3MSXA 1SRUA 1JJ7A 3A4NA 2P6RA 3UATA 3GEIA 1UE1A 4JVNA 3M4YA 2R65A 4MGKR 5M5WH 3A4MA 2D74A 1EX6A 3RHFA 1JJGA 2QQEA 4HR7B 5IP9G 5EXPA 4Z8YA 3UKDA 3AB9A 1S8FA 2QPTA 3I73A 2EJMA 2LSSA 2UVQA 4IVRA 4LWZA 4X8LA 1GP2A 2XTIA 2NIPA 4YY3L 2ES2A 2AFIE 3ASZA 4OQFA 3IEVA 3LNCA 1YVDA 3F5FA 1A1VA 2JLVA 3NG1A 1NMXA 5HZKA 1E7ZA 1NN3A 3KKPA 2N8NA 1U0LA 1SKQA 3H84A 3AP1A 3SNHA 1E2ZA 1Q90A 5C44H 3IILA 2VHQA 3K0FA 3DXJC 2I5LX 4JKIA 4KODA 4URZR 2E74C 2VHCA 3TNFA 2W6JD 1E2VA 2FOLA 4QY7A 2QT1A 3DZ8A 4A9AA 1VF7A 1P3JA 4C3HH 3C5CA 1E9EA 4LFBL 3ASYA 2QENA 4LOAA 1KSGA 3I2ZA 3HOZH 3EPKA 2XB2A 2QP3A 4OJQA 3KKQA 1CF4A 3RS5A 4G7ZC 1TAGA 4AURA 4I99A 1NNEA 1DG3A 4OHZA 3A1UA 5M5XH 4A3CH 2GNOA 2E5LQ 3TH5A 1YRAA 3ULJA 2C99A 3WWVA 1BS1A 2EIFA 1Q1QA 4A3KH 2HXYA 1ELOA 1XEXA 1TQ2A 2XGTA 2WM9B 4DV5Q 3O8RA 3KQUA 3SQXA 3FFAA 1H8EA 4GOPA 4KFUA 2C9OA 5E7IA 1WDTA 1DVRA 3DZDA 4ZCLA 4YLGA 3WHKA 2DPXA 2A6ED 3TZUA 1R8QA 2HJGA 4Q9KA 4RD1A 3I4OA 3A8IE 2QAGA 2ZETA 5EP4A 3BJUA 2ZJ8A 2A6EC 5JJIA 4MGZR 2EXDA 2ZAOA 3WNDA 1NJIC 3EW9A 5FJ8H 3UIEA 4L4UA 5C1BA 1M90C 2R6FA 1WBBA 3AYHB 4NDZA 2P0EA 2K4KA 2F4VL 5CDFA 4JBWA 2J3EA 1UKYA 1A6XA 3CR8A 4C7OA 1L1OA 1GUOA 4IJHA 1H9SB 2IW3A 4MYCA 4CEIB 4DIDA 5FOTA 4PC2A 4R4CA 2P5TB 1W36B 5KDDA 5LD2C 3GLFB 2EVWX 3LBHA 3R9IA 5FFMA 5DLQE 2OUKA 1E24A 1VQNA 3AP3A 1RIFA 5J4YA 1GILA 1XMQL 4BFTA 2ATWA 1E69A 1N5JA 4DR3Q 1ZC3A 5J40A 4QXAA 4LF9Q 3HOWG 3GLHA 5DO9A 4EQ6B 5EZ6B 3TEHB 4NYMQ 3T1QA 2IT1A 3NELA 1PH6A 1CI3M 1KXLA 1UEIA 1Z22A 2AR7A 2FFAA 1KHTA 3FB4A 4IVPA 1KO4A 4B3BA 3LO5A 4U5XA 4NXNL 3H0GH 1KRTA 1PH8A 1FYCA 4DUZQ 4DR3L 2A5FA 1N33Q 2XB4A 3CRW1 1N36Q 4CZ2A 5JJKA 1U2RA 4P0TA 2WOJA 5AWFC 1JB1A 2FSFA 2O8EB 1GRQA 1PH7A 3PCRB 1ZUNB 3M0EA 5D3MA 3KJHA 4IDQA 1WXQA 2JIZD 4ZDIA 2AXPA 4GN3B 2K5UA 2GAOA 3S17H 1JMCA 1KI2A 1UJ2A 1TQDA 1F2TB 1JJCB 1LB1B 4TLAA 5G41A 3EZ9A 2CHQA 2EFDB 4BY1G 2ZRLA 3OESA 5E4FA 1UBCA 3JAMi 4LFCL 1KYIA 1PYSB 3QQ5A 4NKRA 3IPXA 1ZCAA 4D6PA 2QL6A 2O5JC 4DR7L 1YJ5A 1P5ZB 2WSSD 4DK6C 2GXSA 3QY0A 1YZTA 2OQ0A 1A5TA 1G8GA 3NEYA 3QBTA 4ZI2A 2FMXA 3QXJA 1R6BX 1I4DD 3QKUA 3U3OA 4OQNA 5JEAJ 1Y1WH 5ELNA 1CXZA 2D7CA 3WYFA 3PSIA 1DPFA 2ZM6Q 2J0UA 5CM8B 1NLZA 2DCUA 4BY7H 3KUDA 2CXXA 4L5QA 3PIRA 4QHSA 1GKUB 2EYUA 4TYNA 2PNHA 1II8A 2WSMA 4PQFA 4LYHA 4JI2L 4RMFA 1FP7A 4M21A 4RCYA 3U7FB 2BBOA 3T1VA 2P67A 3CCRA 2ODEA 5JJLA 3VX4A 3CCMA 1PH3A 3GEHA 1F48A 2WAYA 2YINC 721PA 1OIVA 1T3HA 3PUWA 4GZYC 3M3YH 1E2NA 3IBGA 1P6XA 4BZQA 4DCUA 3CBQA 3G48A 2QA5A 1T0JB 3J80i 2NTYC 4OHVA 4LFBQ 1Y69U 3BORA 2ZIAA 3OIVA 2CK3A 2G77B 5FLMH 4X64Q 4DV6L 2JJ8A 1EFTA 3AGQA 3GFTA 1EOVA 2ZJRA 3RAPR 1EWHA 4RFSB 3AVYA 3GQBA 3BXZA 2VP2A 4XD7D 5EXXA 3D0FA 1QVGA 5IYBG 3KKOA 1T3LA 4BLRA 4MKGA 2B8GA 4RZXA 4G5QA 4IDHA 2WWFA 2YTVA 4QGFA 4DUGA 3FPPA 2L0XA 4FMBB 4NYJQ 5JHGB 1KZGB 5K8IA 4QGHA 1FTNA 1KIXA 5BXQC 1SVLA 3KJEA 4HJ5A 4JYAL 2IYQA 3D7MA 2ZRAA 3T1HQ 1P8LA 2HT1A 1E2MA 1JT8A 5KUTA 4JKYA 4KYIB 3I72A 4URWR 5BN4A 3E5HA 3BOSA 2P3SA 4JI6Q 3WRXC 2IS4A 4JVLA 4Q1CA 1PH5A 3HOZG 5J4LA 1TF5A 1WFQA 1H8HD 2OM2A 2FPKA 2ZRHA 3SJZA 3H94A 1E9AA 1JPNA 1FJGQ 3P27A 3OE7D 4Z8XA 3K8AA 4POFA 1FTSA 1CTQA 3OE7A 4OX9L 4AWXA 2ZXUA 2AN9A 1UBGA 1F2UB 2Y0SG 3BZCA 1LTQA 2WTUA 4S2EA 1X1RA 1SR3A 1S72A 2WAXA 3TMKA 2OCYC 3U3MA 3UMRA 4Q18A 4IFDH 4ZDJA 3CCVA 1K8RA 4PHTA 2ZU6A 2GZDA 3VNUA 1IJFA 2PJZA 3CZPA 2JJ1D 1DS6A 3DKPA 4IW3B 3RR5A 1GL6A 2NZ8A 3I8SA 4YQFA 1F3OA 1KMQA 1X54A 1KDRA 3HOVG 2FFHA 2XX3A 1Q82C 2ZR0A 3CCQA 1IXZA 4N3NA 4A3IH 4OWTB 1NL3A 4PSVA 2R7FA 3TR0A 4BPBA 2FN4A 3TR5A 3I61A 5IY0A 4BXXH 3NC1C 2RH5A 3EC2A 2ZSEA 5JI2E 2EYQA 2WWGA 2YOGA 5JRZA 2G88A 4WBSA 1P2TA 4NCKA 4RFSA 4HJ7A 4IOLA 5IHPA 1EWRA 1Z07A 2VP4A 3H3VI 1WBDA 4LUOA 4FWIB 1G3RA 3IUYA 4LJ8A 4NHOA 2Z83A 1DAFA 4LDJA 1QHYA 2NVXH 3SS8A 4A3MH 1N36L 2C95A 4OYHA 2IYYA 1A63A 1SXJD 4MRPA 4ARZB 4F7WA 4L5RC 2OE2A 2HIVA 1AH9A 2QZ4A 3M9BA 4RD0A 1JNYA 1O7IA 2MSEB 3C14C 1Z6HA 2GXUA 4DR2Q 4AQYQ 2LKCA 2WPDA 2YU9H 1QVAA 2IF0A 4AI6A 5K36G 2ORWA 1CSQA 2HLDA 3WBKA 4A0FA 2F3RA 2Q9BA 2L5TA 1EFWA 3NEJA 2NVTH 1XTKA 1KRSA 4P4UA 3TSWA 2I5MX 4DPGA 5HZHA 2JJ2A 2VSOA 1U5KA 3GTPH 1KC8C 2BM0A 3PCOB 1TWAH 2GCNA 2IBMA 1PH1A 3AGPA 2ZJYA 3QXSA 1Z9FA 4G5SA 2ZRGA 5DI3A 4IVQA 2WP8J 5GJWC 3FVQA 1G9XA 1E4YA 5FUVA 3AF0A 4WJ4A 3RC3A 3TKLA 5K8LA 1ZM2A 2QMOA 3QI2A 4QBHA 2VP9A 4Y0AA 3KQLA 3PUZA 2DFKB 1Z0IA 4RG1A 3CX6A 1D2NA 1XNRL 2BHRA 2VUMH 2E2IH 4A3GH 1R2QA 1SXJE 2EWWA 2O52A 2OXCA 2R8RA 2ZRCA 3GJ6A 3MJRA 3SHWA 1OXTA 1YU9A 1ZIPA 2C98A 2QP9X 2WSSA 2PEYA 3C4JA 2Z6KC 4UQOA 1RYFA 1YNNC 4NYJR 1W4AA 2D4HA 1VQBA 3QPWA 4APVA 1N34Q 1KI9A 4JV5L 1NRJB 4X6AH 3BB3A 5LDDC 2BBSA 3SBEA 2OILA 3LDAA 3BK7A 3K0SA 4RD6A 1KNXA 1N32L 1DG1G 1SXJA 1GWNA 4YMVA 4II7A 3E0EA 3NBHB 2PCLA 3FHTA 3TLXA 2Q9AA 2RCNA 1P62B 1GM5A 2N46A 5GVSA 1UE5A 5J4VA 1XTRA 5C4XG 1I94Q 2KJQA 3FMPB 3PIPA 1R9TH 4B3SQ 4V0NA 3AF2A 4LBYA 1X86B 1IBMQ 1BYIA 2XAUA 2WPDD 4R4IA 1EESA 3UDIA 1ZU5A 1W44A 2BCJQ 3OZXA 5B58C 3CH4B 3N2EA 3X1XA 1OTCA 3N2IA 3QJYA 1Q46A 1NVVQ 4A3BG 3KFUA 4DV4L 2UUCQ 5ELXA 3W5IA 1E79D 2A1AA 2ZSBA 3IQWA 4DEXA 2ODNA 4X66Q 1PMRA 1XPUA 1YQTA 3U7HB 2GCPA 3B82A 3AFPA 1I94L 2H8KA 3MWLA 5BN5A 2PMDA 3C15C 1N33L 2BVNA 3ND8A 3HKZG 1FMJA 1WCMG 4BBRH 1YJNA 1IBLQ 4Q9HA 4R71A 4AY2A 1GNRA 3KLRA 4QOSA 1Y3AA 4NBSA 4NYIQ 2IHFA 2JASA 5IT5A 2ZI9A 4A2WA 2O8BA 4OX9Q 3SU8A 4OO1G 4D4MA 4JI8Q 4IHQA 4MKFA 2ZE6A 4LPKA 2QM8A 1Y63A 3LXXA 5H1SE 4TT3D 2X19A 2B63G 1TUEA 1VYUA 3BWDD 3NH6A 2IYSA 3ADDA 1YNXA 2FDCA 1ZIOA 1VIAA 3RSOA 3FGNA 1Z28A 1UWVA 1W48A 3PF4A 1XEWX 2ZUDA 2IWRA 4A8JB 4DNRB 1KI6B 4JYAQ 3LLMA 1F6BA 4IPHA 2B21A 2KI5A 2NZOA 1MO4A 4HAUA 1N0UA 3HU2A 4GNXB 4JI3Q 1NKTA 5FBQB 5C2JB 3FWYA 3EG5A 4JLMA 4DLVA 3NIBA 4FN5A 1N6NA 4EFMA 5FPSA 1GVPA 3RLFA 1XDBA 3GLFA 2D0PA 1IJEA 2RGNC 4GPTA 3ZDQA 5LMUQ 4AYTA 6Q21A 2C9YA 2ZI3A 2D5DA 3GTJH 3LA6A 4X8HA 2JA9A 5JSZA 4NYMR 4R4TA 5B2ZA 5LMNQ 4XWAA 2QGQA 3THYA 4ESHA 4EJSA 4A3FG 3TIFA 3ADKA 3D6TB 2GK6A 4HB0A 3VQTA 4DUGD 1IYJB 4CEJA 3T34A 3ZJYA 2CFMA 4LC0A 4TMWA 4BLOA 1AQUA 1VQDA 2NN6I 4O0AA 1SXJB 3KL4A 1O87A 2GBLC 4RD3A 2QROA 3W3ZB 2B7BA 2PJRA 1YBYA 3L0OA 2VY3A 2UUCL 2LWIA 4A3EG 2BE5D 2PQAA 4GKKQ 1K0RA 2GEVA 2WIAA 3IFTA 1E2JA 3L0SA 1VQ5A 5AJYA 4B3XA 2O8CA 4AYBG 1UDWA 2CDNA 3DM5A 3S1AB 4F4JA 1XNQQ 4PO9A 4A92A 4DSOA 4IFEA 5FPKA 3EWSA 3QF4B 4TQAA 5FOSA 1L0WA 1OIXA 3FDIA 2QORA 3FYHA 4G01B 2Z6KA 4DCVA 5FLMG 1FMLA 3IO5A 2OBLA 2GZAA 2ZI6A 2R92H 4OKSA 1YHBA 4V0OA 3RDPA 5C4MA 5CDFE 2ONJA 1Z2AA 1Y8NB 5E3HA 4EUNA 3PR1A 1SN8A 2EW1A 5HKKD 1Q8KA 3I92A 5JECA 2WKQA 1HR0W 4DR5L 1FNNA 4OONA 5IYDH 1GOTA 4ME3A 3I4NG 1T0HB 1YZLA 4LF7L 2BEJA 2GF9A 2J0VA 4C2TA 5KDOA 4DV3L 2EQBA 5BYKA 1YJ9A 2HEIA 5P21A 5CJPA 5A35A 1XTQA 3J80c 2BH8A 2PZGA 5FPHA 1ODFA 5H68A 1CKOA 2ZRMA 2R62A 4Q4JA 2N1BA 5EXSA 1H9MA 1LABA 4ITRC 1CJKC 3T12A 4CIDA 1XMOQ 2A7QA 4K46A 4IEEA 2QMUA 1IXSB 2P65A 4E5UA 4A6XA 1MRSA 4B3DA 3G0HA 3ZIAA 1E3PA 1DARA 3CMEA 3T56B 1FVIA 3TUJC 1IN7A 2ECKA 3E70C 4N1AA 3SR0A 1TWHH 4N0DA 1G1MA 5DN6D 2UXBQ 4RSGA 2H5XA 2F1IA 1M7BA 2ZSAA 4RZ2A 1ESMA 2O8FA 1VTKA 1WE2A 2JLQA 4QRHA 4ALPA 1DEKA 1VIYA 1HZCA 4P71A 4R4QA 4PQRA 5EP1A 5TXGA 3K7AH 5JCZA 3ERSX 4JG2A 2DN8A 4YCUA 1N34L 1G5PA 5KHOC 2HYIC 3JZMA 2KWIA 1E9RA 2ZSFA 4W5WA 3M4QA 1CJUC 4CEHA 3PITA 1COWD 1PA6A 4HAWA 4N0EA 4PAOA 3N5CA 3AEVA 2BJVA 4DLRA 3A1WA 3W5JA 4MZ9A 3TUIC 5IWAQ 2JA6G 2P2LA 1U98A 2V54A 2AK2A 3T1OA 3T5DA 3W9YA 3LY5A 5GJBA 4JYBA 3Q85A 1E79A 1VQMA 1Z6YA 2W2VA 3K09A 4O2LA 4V02A 3M1IA 4RJLA 4JLBA 2O8DA 2QRNA 5FL3A 2ZI5A 4QJ4A 4CVNA 2CE7A 2V4ZA 2JLRA 4DDVA 3RRYA 1HNWQ 2YWFA 2A3RA 5DHFA 2VHJA 4YMTA 3IHWA 1XEXB 3K9GA 3NXSA 3LD9A 4DJTA 4DLSA 2IYTA 5AJ3Q 2CCJA 2IYVA 2PPBC 4LYFA 3HOWH 3QKSB 1OB5A 4HDOB 1I2MA 4YC7A 1KJYA 2ODWA 2WICA 3AKCA 1D8LA 1Z3IX 2CNWD 4QG7A 4BFYA 1DAIA 4F91B 2HHHQ 4HB2A 2R2AA 1H9RA 3TJZA 1Q0UA 3IRBA 4OBEA 2O8EA 1KK2A 4DUYQ 2WWHA 4JLPA 2ZJOA 2C03A 1BVSA 4DV3Q 4L8GA 3U2QA 4OQMA 2VZAA 3AKYA 4M8NE 4B6EA 2XEXA 1OFTA 2PT5A 1E2GA 2PX3A 1OF1A 4QBIA 3QKSA 1ZBDA 2IS2A 2PZEA 5B64A 3PQCA 5LB4A 1WJJA 1X1SA 5FPYA 2OG2A 3QKRA 4JS0A 3KXLA 2E1RA 3DM9B 4TYQA 2DFLA 2ZRDA 5IP7H 2HYDA 2PH1A 1AZSC 3CRLC 3L0IB 4F38A 1JPJA 3AVVA 1HV8A 1R8SA 3AQQA 1Z6GA 2H5EA 4B34A 4RY2A 2WMOB 1NIJA 1BMFA 4PC1A 4OI0A 4LF6L 1XTIA 1E6CA 2ZJ2A 4B75A 4QKQA 1Q22A 2NGRA 4Q4HA 2MNAA 4DK0A 2ZYVX 3QPUA 2V55B 1O78A 2ZTDA 2W6IA 3FPAA 1YE8A 1ZMXA 3CRQA 2IYLD 5EE0A 1PH2A 1NVWQ 1KD1C 2JA5G 2FZ4A 1JR3A 4TLBA 5AJXA 5TDHA 4KVAA 3CWZA 2J0UB 1HNZQ 1KY3A 3GJ5A 2X77A 4AG6A 5JHHB 3I4MG 1H9JA 3HOXG 1ANKA 1PYBA 2YV5A 2CEAA 2GJ8A 4TLDA 4JBYA 3C8UA 3TVTA 3A7AB 3WMEA 2QU8A 1NTGA 4LUZA 1OH8A 2V3CC 1G6PA 2G3YA 3NTUA 1VPLA 5CB8A 4LYJA 3SDZA 2HIXA 4PXAA 2KHIA 4TTQA 4XH9B 4H1VA 1AE2A 2MFIA 3CCUA 5JS8A 2UZIR 1HR0Q 4BY1H 3QEJA 4QL3A 3CC2A 2JATA 2FH5B 2ZTEA 4AIIA 5JBQA 2UKDA 2V9PA 4C9BA 2OQKA 1VQFA 5IRCD 2OT3B 4LJYA 5L3SB 4C3IH 2OXRA 4KMUC 3ZZ0A 3U9SA 3CCEA 4PZYA 3NDBB 3OTOL 4W7SA 1E1OA 3TQCA 5J4HA 3LBIA 3FKIG 5DLQC 2R93G 3U7EB 1CFMA 4FXPA 4GMDA 1TX4B 2B6HA 4QM7A 5IP9H 3THWB 3IO3A 2Z43A 1US8B 3LXRA 4Q1FA 3LFUA 4IPCA 3HPQA 1NI3A 4BQSA 1U8AA 1WCV1 4TYYA 3EQLC 1QVRA 1P9WA 521PA 2RGXA 5L3SA 2I1VB 1W5TA 5TARA 4PR0A 3U50C 4V0ME 1E2QA 2AD5A 3RWMB 2W2TA 1NE3A 1TADA 2DBYA 2JEBI 3R20A 1GUSA 1V5WA 1E2IA 2X1VA 2XTMA 3CPWA 2QTVB 5KPJA 1AQYA 3MRSA 4IOCA 1II0A 3CPEA 4G1UC 1QG2A 3T5GA 4O2DA 3P20A 3SFZA 4X65L 1CR1A 3TQFA 421PA 3V4RA 1M1YE 2ZREA 4TMXA 4B3CA 3A1SA 3QVUA 2AHOB 3CF6R 4B2PA 5GVRA 4DB4A 3K81C 4GDFA 1A4RA 2YHSA 3D8BA 1NF3A 3BZKA 4NZYA 4EAQA 2BWJA 2ERYA 2JAQA 1QVCA 3K70C 1ZNWA 2MO1A 4X65Q 2GBLA 3EZ7A 4TL9A 5IYDG 5L8VA 2ZE5A 2GWHA 4EQ5A 1GJXA 3OIWA 4CT5A 1AM4D 1GFIA 2XOKA 3ADCA 2EFHB 3CKLA 1D2EA 1XMQQ 2EFGA 5F98A 1D2MA 5M3MH 3DO6A 1UE6A 4PZ6A 1ONBA 1E9BA 4H1UA 4M53A 1LFDB 1U94A 1G51A 3QG5A 4PAMA 4M22A 4C0HA 4XVUA 4ZDKA 2UUAQ 3C41J 2ORIA 3L2PA 2A69C 2VHTA 5FOWA 3SN6A 2Y8EA 3TREA 3KOJA 1KHIA 4YONB 5GADl 3UANA 3GJ8A 3RWOA 2JA8H 5DHAA 2CCZA 3W34A 1DAHA 1OH7A 221PA 4FD2A 5B57C 3LVRE 1AS3A 3WYAA 1UKVY 3HU3A 3CCLA 2FA9A 4A8JA 3C16C 3SYKA 1G19A 2NPIA 2ATVA 2IK8A 2PLFA 4L16A 3IPYA 4IOMA 1UKEA 2QUZA 4Q7MB 4J0QA 2PMZE 4B35A 2YJTD 4BEBA 4JI3L 1E2DA 1KGDA 2JJ2D 2IHBA 3BE4A 3GJ0A 1GUGA 1HJPA 5A5GA 4XIGS 1A0IA 3DMDA 3NC0C 3BB1A 3W90A 3W8NA 1ZYUA 2XSZA 1EWQA 3TK1A 1VQJA 1QDEA 2IUSA 3THWA 2F43A 3KXKA 2PNRC 3B8HA 4URYR 4V03A 5AJVB 2AHOA 1P73A 1KAWA 4L5SA 4GOKA 4JC0A 4JI4Q 2E76C 4NCJA 3WBJA 2CW0C 1G7CA 1XZQA 2QT0A 4JI1L 3NHAA 4OQLA 4RKEA 2OTJA 5FBRB 1GUAA 5ELOA 1WMSA 2NZJA 1L4UA 2KBFA 2C5LA 4G5GA 3THXB 3T51B 4A15A 1N6OA 1Q1BA 1N6IA 1XD2B 2ZS9A 3S16H 2F43B 3BH0A 2WKRA 4PC7A 3R8CA 2HDNB 2IYXA 3KYHC 4XSHA 5C4XH 4GS3A 1C9KA 2GTPA 1X65A 1CR2A 3RZOH 3HU1A 4I1SA 1T91A 1KKMA 2Z5FA 3NHBA 1H65A 3HR8A 2VF7A 2N42A 3SQWA 1KOFA 1KMHB 1Z0FA 1RC8A 4BRWA 5H8WA 4L5TA 1K73C 2PI2A 4H02A 4A75A 4JI7Q 1HT2E 2O8BB 4JOIA 2REOA 1MO3A 2GCOB 5JI3E 4LUCA 4BLPA 3EASA 3WYGA 1XD2A 4HAYA 3GJXC 4HZUA 4OK3A 2JJQA 2IX1A 4IFDI 3GFOA 4MH0R 4Q02A 4R9UC 5CIWA 4BBSG 1UADA 1E3MA 4K0KQ 4PPQA 2VHUA 2XNDD 3CPJB 3ZJYC 3E1SA 2Q2TA 1VQKA 2Q2IA 4O2RA 4PMWA 1UEJA 2CKZB 1G8HA 2AXNA 1UE7A 4OL0A 1NJFA 1QBKC 5K8TA 4IDNA 5KYKA 5DSZA 5JZVA 4HB4A 1AE3A 4Q4JB 5K36H 1XNQL 4TTPA 1GKHA 2IX0A 1G6OA 3VAAA 1AS2A 2VEDA 1IY1A 1Y8OB 2ODBA 1FL0A 5GQOA 1QHXA 2VPPA 1MT0A 4EDHA 3FMCA 4QGUA 3ZGXA 1W1WA 1Q20A 4TWZA 5CK4A 5DYGA 3L43A 3CH5A 4U02A 1FUUA 4OWXB 4BY7G 3THXA 3AVPA 2J41A 4JT2A 2WWYA 4AKGA 4ZV4A 1RRGA 4LJ5A 5FR1A 1JBKA 3GJ7A 2JLWA 2A69D 1J5EL 5BWMA 2FV8A 1H8ED 4BWYA 4DNTB 5KTYA 2KBNA 4A3DG 1L4YA 3UPUA 4BRUA 4W9MC 3LVQE 5CLLA 4A3DH 2X2FA 2B29A 4NYIR 1KSHA 3DOEA 3CPFA 5LD2B 1HY3A 1SVSA 2BCGY 4PO8A 1I4TD 3B1VA 2UU9L 4HATA 2OCBA 3EPHA 1C9OA 2HHHL 4YXWD 1KI7A 3K8YA 2I4IA 4QM6A 1E9FA 4F93B 3TGPA 1JI0A 1Q86C 1AIPA 4EFNA 3A74A 1XMJA 2EU8A 1G4AE 2ZJZA 3OPOA 3VKHA 1I4LD 2WV9A 4IO9A 3TRFA 4WXPA 1BIFA 3HOUH 3FKIH 4D0NA 1A2BA 5E95A 2IL1A 1G7SA 1NVVR 2JLSA 3X1WA 3AFQA 2FSHA 3O47A 4JI2Q 1RIPA 1W5SA 2WWXA 4ACAA 1P7CA 3FKSD 3LGJA 4DSTA 1VCOA 3TW4A 2OTLA 3SGIA 1IBML 1KK1A 4M0LA 4KBGA 1FW6A 1P2SA 1FL9A 1NBMA 1J8MF 4M2LA 2ZR7A 1O7LA 1QJOA 4IDOA 1AGPA 4POAA 4UNRA 4DR1L 1DO0A 2WFWA 4LBVA 1K3RA 1SZPA 4NE2A 4ASUA 3A5UA 1ZNZA 4MGYR 4GN5A 1KI6A 3ZQ6A 3TRZA 1ESNA 1W4CA 5FR2A 1E9DA 5BYJA 3PXGA 1TXYA 3BFKA 4DSNA 1QHHA 4FIDA 3SBDA 1IL2A 3OYYA 1KSFX 2JLYA 1HURA 1Q3TA 3DDCA 4JZKA 2BE5C 1SHZA 4EKDA 4A3IG 1VQ4A 2NVQH 4DR1Q 1J99A 5FBWB 3AV0B 4BXXG 1LF5A 2RGAA 1XNRQ 1NJGA 3B78A 4Q4AA 3STBD 1ZD9A 5IYCG 1PLJA 1XTDA 3RN5A 2YVUA 4GRAA 1GDDA 3RC8A 5CM9C 1E22A 5M3FG 1N25A 2I1QA 1OH6A 1NBMD 4IOAA 1IQPA 3CRVA 4JI5L 4QQBX 4PG3A 3ULPA 1S1CA 2ZRNA 3KTAA 3MGCA 1CJMA 4DUZL 5C4JH 4AIMA 4MKIA 1XTSA 4M4SA 5HCNA 1VQ6A 2ZTCA 2HV8A 3W6PA 3WHLA 1WQ1R 3GLGB 2OFXA 3FOZA 4B74A 1HEIA 4EX5A 2UU9Q 2NO1A 4EPTA 4QL5A 5G53C 3U44A 1OXUA 2YOFA 1X56A 4JIMA 4LK2A 5HY6A 1MABA 2JEOA 3W3AA 4KKSA 1CKNA 1XXHB 1VMAA 2QEQA 4O25A 3TSOA 5C0XH 4HIOA 1VF5C 1E2FA 4HSEA 3LW8A 3CQZH 1PJRA 2IYZA 4A8JC 3E9HA 2G1KA 3T61A 1MH1A 2NG1A 3AF4A 1S3SA 3G6EA 3CB4A 3L8ZA 5EXTA 2O8FB 4A1FA 1U9IC 3FMOB 4BE7B 1S2MA 1YI2A 2QF7A 1VHTA 3R9XA 2JA1A 1G8FA 2Y0SE 1QHHB 4NTZA 1KQSA 1AS0A 4CW7A 2DY1A 2JA8G 1WP9A 3U3RA 4UKDA 4B71A 1CRQA 2QQ0A 3VTKA 4CF7A 1VQ7A 1CKMA 1LY1A 2IYUA 4A93H 4JSYA 4YMSA 3UE1A 2C04A 3W6NA 2ZI4A 4LBZA 4DLXA 5AUNB 1YRBA 4JOIC 1SQ5A 4TMKA 4C4PA 1R5NA 4URUR 1LYLA 2GDJA 4C30A 3RRMA 5GROA 3V00A 3K9HA 4DV5L 1XMIA 4FI3C 3PO2G 2OWOA 1EX7A 4DCNA 1E96A 3ER0A 4OO1I 4LFAL 1Z0DA 2FJUA 1MO6A 4LHVA 1T5IA 4EPYA 1IXRA 1XPOA 2IEYA 1IBKQ 4TTRA 2PI2E 3U4VA 3QBVA 3OIYA 3RNUA 2NO7A 2RGEA 3MG9A 3MLEA 4LV6A 3GLGA 1Z0KA 2VA8A 1Z63A 4HIMA 2LXKA 1BMFD 2QSZA 4EPRA 3AVTA 4NU0A 2X8AA 1U90A 2IY5B 1JAIA 2IYRA 4M9QA 1E4VA 4Q47A 2BKUA 1SKYE 4V0MA 4D4KA 4KCGA 4LCBA 4GP7A 1S3GA 2VQFL 4A3GG 3TBKA 3JZAA 2KBEA 1TKWB 2JA7G 2ZRKA 3LX8A 4LX0A 4GZMA 1RRFA 1ZVQA 2F3IA 4RCZA 3CAMA 1V8QA 1KZ7B 1NN0A 3SJCA 3M7NA 1YHQA 3PO3H 1CS4C 2ANBA 2UXDQ 2LCFA 4JI0Q 4DR4Q 2OFWA 1KI3A 1ZP6A 1E2EA 1YZ6A 2C78A 1HNXQ 3B2EA 3PO3G 3SE0A 1IONA 2L15A 3VR3A 1WA5A 2VSXA 5EE1A 4B2IA 2Q3HA 1E2KA 4NCIA 1P9RA 5TV2A 2K7VA 1W0JD 5FI0B 2ZJQA 2K33A 1NSTA 4A2QA 4MTNA 1R5BA 4KHZA 1N8RC 4Q7LA 4Z51A 2W00A 1XXHA 2R6CA 1EFCA 3B1ZA 3T06B 4D2IA 4DSUA 5KSZA 1KJWA 4OI2A 4AKEA 1VQ9A 3J81c 4GKJL 2C9CA 1U0JA 1IN6A 5LMNW 1TU4A 2W6JA 1NP6A 3A4LA 3TS2A 4UP7A 5C3EH 3RNLA 821PA 3P4YA 1F2UA 2XSZD 3GD7A 1KDTA 1F2TA 3LX5A 3O8BA 3CUEF 3DLLA 2QMEA 1ZNYA 5KSOA 3SC3A 1W4RA 5IT9c 1HNWL 4WA7A 3J81i 3F2DA 2GVAA 2CLSA 1GO3E 3KB1A 2BMJA 2JEAI 1ZCBA 3V4FA 5EZ5A 4M1WA 4A3FH 3KLWA 1PUIA 2EJGC 2AKWB 2JK8A 1Q21A 1FOEB 1U81A 3AF3A 3G71A 3VR6A 3W6OA 2KSQA 3ZVMA 1R7RA 5AUQA 4C7OB 2V1XA 1RL2A 1UBFA 1GVNB 4C0LA 1XMSA 5E7JA 1RFLA 3TVDA 4IQZA 1VQHA 3K80C 3CO5A 3CPHA 2EFCB 4KKTA 4CRWB 5TMPA 3OAAA 4PPFA 5IF9A 1X3FA 3PEUA 1CIPA 1DAGA 2OV2A 4B76A 3KJIA 2G0NA 2NO0A 4J15A 3VMFA 4BZPA 4KITB 1RRPA 4XTRA 1TPZA 2C96A 2H16A 1E0KA 4KXFB 4A4DA 4LF8Q 3GLHE 3UWOA 4ASUD 5F2EA 2EJFC 2NVYH 3SZRA 4EJSC 1A8VA 4BLSA 1GG2A 3DEFA 5SZHB 3EPLA 4PZ7A 1I50H 4JK1C 1G7RA 2J7PA 4GN4B 1S0UA 3EARA 1TNDA 2OFOA 5LMUL 4OO1H 1QUQB 2J7KA 5L3QB 1P72A 3O8CA 1CUKA 1V43A 1CJTC 2DFNA 3FHOA 4HAZA 2ZT9C 1OT3A 2J1LA 2R6AA 1OHHA 4C0QC 3TAHA 3QOFA 1AKYA 1V9PA 3S2HH 4QJ5A 4DLYA 1VQAA 4ZKDA 3CP0A 3OEHA 2ZROA 2OBMA 1H95A 3S1MH 1RE0A 2BC9A 3HYTA 3MJHA 2A30A 3VHXA 4DKXA 3CLVA 3R8FA 4MUAA 2Q6TA 4D26A 1UAAA 4X8MA 1TF7A 5M3MG 1YHNA 2H92A 1JB7A 2UZ3A 3Q7QA 4KU4A 2QE7A 1Z83A 5GJVC 4BGDA 2MQHA 2RGNA 4GOPB 3R7WB 1SHKA 5EQTA 3FKSA 1II9A 3HP1A 1EQRA 2R92G 1I5FA 4LJ9A 4Q9JA 3J81k 5TVKA 1OLOA 2FPMA 4HI0E 4OK5A 4EIWA 1VS0A 1GIAA 2D2FA 2FSGA 1VQIA 3EN2A 5DYIA 3KF8B 2ONKA 4HB3A 2XZOA 3LWUA 1HZAA 4LHYA 3CCSA 2E75C 4B3RQ 2QAGC 2ZE8A 4TVAB 4G5RA 3IEUA 1B8AA 2RAPA 4LJAA 4WZBE 1NLFA 4IRUB 2V6IA 5IE8A 4X64L 4DV6Q 2V7QD 4Q4HB 4US1R 4DV4Q 1XCMA 2VUMG 1FPMA 1VQCA 1M6NA 2FFBA 3H86A 4I1VA 4WW0A 4IOJA 1CEEA 4KFTA 1KDPA 4Q01A 5JWHA 5SZKB 3UMFA 3EIHA 4OHXA 4M1MA 4PHGA 2DNEA 3AQ4A 4QNRA 3D31A 3U58A 1CR4A 1QHGA 1DE0A 1VCMA 3Q7PA 4KYUA 4Q9LA 1DELA 2YWGA 5LPNA 1Z6AA 4MA4A 2GVZC 3VR1A 3U60B 2HT6A 5IK2D 1KDOA 3M6AA 4DV0L 3KFXA 5EE3A 2YYZA 3CF2A 2VQEQ 3GLIA 3GTGH 4FCWA 4A0RA 4MITA 1T4GA 1XU4A 4IXNA 4HDQB 2GKSA 4IEIA 3H15A 2XZLA 2F1RA 5J47A 1NLYA 1SULA 4K81B 4LPSA 4DV0Q 5JEDA 5HCIA 4B3GA 3ETLA 4V0LA 1A2KC 1W7AA 2BOVA 4A3LG 4GP6A 4PPGA 3Q5EA 4B3MQ 2JQOA 2Q2HA 1AGRA 1U99A 4E09A 3BB4A 1N6LA 1UFQA 3CR7A 2C77A 2F9LA 1KNQA 2CL0X 1Q12A 4URVR 3KQKA 2F3TA 1Q44A 3V9PA 1SE8A 2GJKA 2A5DA 5C46F 4R7ZA 1B7YB 3CRMA 1KAGA 4WZ6A 1BBUA 3HOYH 1UDXA 4DR6Q 4KHPQ 1OW3B 1M7GA 4RKFA 5C0XJ 1W36C 3MWJA 4HZUB 4E22A 1KTVA 2PLRA 4LF4Q 1OKKD 1WCMH 1YVCA 2KB0A 2OSBA 1GKYA 2VLIA 1KO5A 2JLXA 3A1TA 3OEED 4X66L 3U3JA 4UNPA 5AJ3L 1XX6A 2KCCA 2K50A 4OWWB 3W5OA 4WVFA 2GXQA 3HKZE 1EFRD 1ZINA 1IOZA 3DM3A 3J81j 4HJAA 1VCNA 2AX4A 3LBNA 4TZ6A 1IW7C 3CNNA 4X62Q 2G1JA 3AH8A 4WZAE 1JECA 4CEJB 3GEEA 1ASZA 3W1BA 5CK5A 3THYB 5JMTA 8OHMA 2IHEA 3A5ZB 5IDVA 4H13C 1KAOA 4M1OA 3IQXA 4G5OA 4US0R 3VKWA 1J5EQ 3I5XA 2ZVPX 3VR4A 1SLJA 1N2CE 5HPYB 2GJ9A 4BLQA 2A5YB 2HXSA 2QBYA 4HIKA 1RZ3A 2K32A 2IF2A 2BMFA 4V0KA 5CYPA 4GOXA 1E0AA 1J7KA 2VH5R 3QF7A 3HDTA 5KSPA 4POGA 3PGZA 2BIFA 2B7CA 5FOUA 3Q5DA 3STBC 5GJCA 5FTLA 1O3YA 5LB2A 1A82A 1OE0A 1JXMA 3B1XA 2ZITA 5DI9A 1I6HH 1LM0A 5IYBH 4FDBA 1L7VC 3LQQA 4UXIA 3U61B 1B70B 2OCEA 4BBRG 2GILA 4JLNA 5UKDA 4D81A 1KY2A 4C2MH 1GHKA 2C8VA 1X3EA 4XOIA 3RSLA 3VU9A 4OHYA 2HUPA 1G8PA 4G3XA 4IJLA 1ZYRC 4HAXA 4P33A 4B6FA 2IXEA 5AK0A 2Q21A 1XF9A 4KBFA 3U4ZA 3UG6A 1YZKA 1R10A 3MEFA 3NBZC 3SJAA 3KQHA 4ZO4A 3F8TA 2PT7A 5SZJA 1JEEA 3X1DA 2KE5A 2QMHA 1R0ZA 3GJ4A 2CVFA 2CLCX 1Z6XA 2E87A 1X6VA 5JS7A 1H8HA 3I8XA 3GPLA 2CK3D 4JI7L 4Q1DA 4BFUA 4BZXA 3QUSA 4M9SA 3ONWA 2KCMA 1E1QD 1FP6A 2XJ4A 5FL7D 1GHJA 1MRNA 2IC5A 4B48A 1OH5A 2QN6A 3RLNA 4MDFA 2W83A 5FH9A 1QZXA 2F52A 2YZ2A 3TQYA 2BM1A 3NBYC 2XOKD 5EE9A 3UK6A 2V1UA 3N70A 4L8JA 5JLJA 4JBMA 5C4GB 1LF0A 1GKIA 1XTJA 3NBFA 5JEAH 1YZGA 2BH2A 1G3MA 1ZU4A 2H18A 5A0FA 1W0KA 2JGNA 3KJOA 4JVMA 2VRWA 1OB2A 4DV7Q 2KENA 4YDHB 3FTQA 2FU5C 4URXR 3I4LA 3I56A 3ZD6A 1D7QA 4ACBA 1N5KA 4HLQB 5EE5B 2ZUCA 3ZZTA 4JI1Q 5JSZB 2GK7A 3IIJA 5AJWA 4F4CA 2NPFA 2K75A 1BH2A 3K09C 1HPCA 1G21E 1X55A 4NMMA 1M34E 1RVDA 3LRPA 4XTCS 4YY3Q 3MFYA 4GKJQ 4MYTA 4EPWA 3HWSA 4NXML 4KO8A 3TAUA 3NBXX 1E2LA 2FFQA 2RB4A 3S1AA 2MMGA 1VCIA 2QE7D 3QXHA 2Q3FA 2YTXA 2WZQA 1SVMA 2PQAB 2MSCB 3KTAB 3E9IA 1GL9B 1QRAA 1XFAA 3G5UA 4KKUA 5HTKA 2IS1A 4YWLA 1VYTA 2FWRA 2ZM6L 2B8WA 1RYHA 3UWKA 2P6UA 5KNDA 3CMAA 5HGQA 3A1VA 4DK3C 1T9HA 3UDGA 2R7ZG 2QTFA 3QXCA 5AJZA 3WNBA 2ZJ5A 1CTMA 4GKKL 2G83A 5CYOA 4KN4C 2IYWA 4Y0VA 3U44B 5GADC 3T1HL 1UKZA 4JT4A 1G3IA 2OAP1 4TYWA 4LRWA 5FOVA 1JJ2A 4A0GA 2AWNA 1BYUA 1MV5A 1IYUA 2PMKA 4OJKA 2ZVQX 4AD8A 5EP3A 4DKAC 2SHKA 4X8OA 3PUYA 2DGYA 4DV1L 3GMTA 4MRSA 1F60A 2VSFA 4RD2A 1MO5A 3OFNA 2DWQA 4UNQA 2KHJA 3QKRB 3PO2H 1IY0A 2Z4SA 1C1YA 2ASEA 3BC1A 1FNMA 2Q9CA 5FJ8G 1VQGA 1ZM9A 3GJ3A 2XNDA 4OK6A 4HUTA 4LJ6A 4B3TQ 4LI0A 2A2ZA 1VECA 3KJGA 2QTHA 4KFSA 4QHYA 3J7A5 3ICEA 2AKYA 4DV1Q 3ZYCA 1ZKOA 1D9XA 1II8B 3CF0A 4XJXA 3BJIC 5EP2A 4BUJA 4DLTA 4DZZA 3AVXA 1R0XA 3X1YA 1JQJC 4B44A 2ZANA 3IDQA 1KO8A 3OHMA 2OLKA 4HLDA 3RS0A 3DVLA 4IJMA 4G7HC 1VQ8A 4A3JH 1G17A 5EAYA 3CZQA 2CNWA 2EWVA 2RMKA 2DHRA 4AC9A 1QZHA 1CULC 1MKHA 1J2JA 3CXCA 1HYQA 2OLJA 1SVWA 4A3KG 2O8CB 1E1RD 3M85A 1RW4A 5FI1B 1DADA 3N6RA 1KL9A 1J70A 1LACA 3FHCB 4GNKA 4JI0L 4PZZA 5C3EG 1CR0A 3EZFA 3SJBA 2O8DB 2PCJA 4KFRA 4C0SA 4F92B 5FTJA 2CMKA 5GAGC 1RJ9A 1YITA 3AVOA 1S1MA 2J46A 2ASBA 4OI4A 4LF6Q 1NBME 1N6HA 1OXXK 4ZPXA 1BKDR 5D3MB 3MXUA 2RHSB 2A68D 1W0JA 3EA5A 4LJ7A 5C0XI 4TN1A 3ZVLA 2OO7A 1NVUQ 1COWA 4BFWA 3KX2A 4HEJA 4JLKA 5FUXA 2A19A 1US8A 1EYGA 4HAVA 1PV4A 3KJPA 3K9LA 4ARZA 4JBJA 1XBTA 1OPXA 2GF0A 1PLKA 1EQQA 4LW1A 4Q4LA 1LUZA 2ZUBA 4NPHA 3F1ZA 4P74A 3GO5A 1WRBA 1SKYB 1PVOA 1FFHA 2Z0SA 3HYRA 1W3SA 2ZQ5A 2WB1G 4FW9A 1J90A 4DUYL 1G64A 1OFHA 1XEFA 4MYHA 3ULLA 1G16A 1CBUA 3LW7A 4C0AC 2GHIA 5JEEA 4R1JA 3SEAA 1KI1A 4FMDF 4KAXA 1M2OB 5J3BA 3OF5A 1H9SA 4OGQC 1E2PA 2QGNA 3RANA 4O3MA 4MRNA 4IFBA 4Q5IA 1XWIA 4MRVA 4ZDWA 1L1OB 1K83H 3TE6A 3QXXA 1N5IA 2BKEA 2YC2C 3B1WA 4UNNA 3OFND 3LH5A 2QM7A 1XMVA 1FGUA 2VS1A 2JLZA 1LNZA 2FXQA 3AEZA 3AF1A 4TSFA 4BLTA 1Q3HA 5DISB 3GLIB 4L9SA 2F4VQ 5KO2A 3GLHB 3E2IA 4Q19A 1FQKA 3H4MA 2J0QA 3KF6B 5J5CA 2GXAA 4ZCIA 4HLUC 2W2XA 1TWGH 1EXMA 1Z0JA 4GLXA 3M4PA 2ZRBA 2VL7A 4DCSA 1W4BA 3WDNA 1JQLB 1TMKA 2XNSA 2ZR9A 3OEHD 5JWRA 4DR2L 1TQ4A 3U5ZB 2ZYTX 3QG1A 3NKVA 4LWCA 1SXJC 2WB1E 3K0CC 3OTOQ 4TQ9A 4P75A 3HGBA 2YNMA 4GSYA 4TLCA 3K0AB 3ZQJA 1T8TA 3ZH9B 2DNCA 1GTVA 4QJ3A 4B2LA 2MO0A 3DPUA 2HF8A 3R9WA 1HTPA 1K8OA 3SHFA 4XWKA 4YWMA 1Y8PB 1MIUA 1VYVA 2F1JA 2CCKA 4HIDA 3BS4A 4RVCA 4UNSA 4WAUA 1EUJA 3L7ZC 3G4SA 1MKYA 2DUDA 2MMCA 2ZS8A 3BH6A 1ZD8A 2PL3A 2OAQ1 3QE0A 2G0TA 3PG5A 3T15A 4A2PA 4JL5A 3I4MH 4DIEA 4A3EH 2XXAA 3VDYA 1OFUX 2ZS7A 4ZIRA 4R4OA 4F4IA 5IWAL 1EG7A 4UJ3A 5BR8L 2EFEB 5AUPB 2I0QA 4B3ML 5FUWA 2NMVA 4LGMA 4X62L 1GRRA 1NY6A 5EUMA 1CJVC 1J6QA 4A4IA 1KK3A 4MKHA 4P3YA 4D0LB 1YR9A 4DWJA 1HA3A 1G18A 4MQBA 5B30A 4Y52H 4PAQA 2ORVA 4GFDA 5C44G 1IW7D 1YKSA 2VF8A 2FE4A 2V8OA 3JC66 3A0JA 1PHJA 5AR1A 4C0BA 4IFDG 1ZM7A 2G6BA 2ALYB 3C5HA 3BG3A 2ANCA 3W1GA 4UJ5A 3EBEA 4EFLA 1B9NA 2RF4A 2ZU0C 5BR8Q 3REGA 5J4KA 4DNIA 5DGXA 1Z5ZA 4WXRA 1HR0L 3AUXA 3K53A 1VG0B 1TU3A 4H44C 4DV2L 1E32A 4CEHB 5M3FH 4JI6L 1XJCA 1SFOH 1A7JA 2BV3A 2H57A 4JLOA 4MNOA 1EGAA 4HLCA 4KLZA 3EIVA 4GOPC 1IN4A 2R9VA 4B43A 4NXMQ 1TWFH 2BDOA 4TZ0A 2VBCA 3SYNA 4A6PA 3UG7A 4A3CG 4EQ6A 2RGCA 5HE9A 4BASA 3GTOH 1NMZA 2A78A 4FCVA 4DR4L 2BBWA 1LVGA 1WF3A 1XP8A 1K8GA 2RGGA 3HKSA 1B23P 3NDPA 4LHXA 2OCAA 2D2CC 3A7LA 1JR3E 3KF6A 2NQ2C 1W47A 2WJIA 1ZUIA 2WWIA 2XXAB 2RHDA 4I4LA 3FMIA 1GAJA 3Q3JB 2N49A 3OW7A 4PTLA 1ZD1A 1NMYA 4DR7Q 4BFSA 1TU2B 3H3VH 2AMCB 1P2VA 3QIAA 2DYKA 2IUTA 4M9XA 4LF8L 1E0SA 1XJQA 2CWPA 1ZRHA 2VP6A 2ZYWX 2ERXA 3TUZC 3I55A 1NSFA 4C3JH 3MUFA 3ZVNA 1GSIA 1I6VC 4M1KA 4QHTA 3K9NA 5KSYA 3P26A 2JA6H 1ETUA 3B9QA 1IYVA 2CWAA 1EIYB 4XD7A 4A3BH 1NG9A 2A8VA 4KJZA 3RS3A 1N6RA 4LF5L 2X2EA 2I5HA 2BBTA 3BH7A 1EIFA 3AUYA 1EWIA 2K14A 4PSAA 3WY9A 4DT1A 1G4UR 5JFGA 3RS7A 4Z1MA 3Q9LA 4TL8A 2IA5A 2O5IC 1DO2A 3L8YA 1QG4A 1HZBA 1D8TA 1E99A 1KIMA 4R98A 4AQYL 1JR3D 2VP5A 2E2JH 3MWKA 4XVRA 4D82A 2GEUA 3TSZA 3CNLA 3BGWA 1I3QH 4ESVA 2K5NA 1K8AC 1JAHA 1KO1A 1AKEA 2CHVA 4B3TL 1YIJA 1ASYA 2GA8A 4DLWA 1F5NA 4FWTA 2DB3A 1C4OA 1E9CA 3KDSE 1AN0A 4Q7JB 3RS4A 1S4QA 3UXMA 3K0CA 2ZYUX 4MRRA 5KNBA 3EWAA 4PZLA 2WWWA 1U0HC 3B6EA 1VQEA 1FZQA 1TEVA 4XVQA 1Z29A 5L3QA 2XTNA 1QVFA 2V7QA 621PA 4A76A 3S1QH 1FQJA 1ZW6A 1IXRC 1GUTA 3Q72A 5JWOA 3QENA 4HLUA 4DBLC 1SVKA 3L2OB 2F55A 3QNUA 1Y1VH 5DE3A 4TKOB 4Q9IA 1BBWA 1ONLA 2AUJD 4JBKA 5F3WB 4PV1C 2J0SA 4B33A 1HE1C 2ZRIA 5K8UA 1X3GA 1P75A 2CLDX 2A6HC 2QEXA 2HCBA 2ZSDA 5DNYB 4JBXA 2JE6I 4JI8L 2FGKA 2FX3A 1WOCA 2C35B 4OXPA 1IM2A 1DD2A 2PEZA 4L15A 4ILEA 4DRZA 3PIOA 4IFDJ 1DAKA 2A6HD 2BDTA 3B7GA 1T8UA 1L1OC 3OIUA 4JL8A 1K9MC 1DCZA 1Z0AA 1IBLL 3GDEA 3WRYC 2CJWB 3VR5A 4LF9L 4NCHA 4C2UA 2UXBL 1SGWA 1QHNA 1FJGL 2V1CC 1NN1A 3I3SR 3DMNA 3EC1A 3I32A 4G7OC 4JI5Q 3NVAA 1NMGA 1D9ZA 1X8LA 1M8PA 3ZVRA 1RPZA 3NEMA 1J8YF 2OHFA 3ZD7A 4ABYA 4UY8C 2JA5H 4BFXA 1VQPA 4LF4L 1IN5A 1IHUA 2O0HA 3GTKH 1M1KC 3PEYA 2Q8IB 4LF5Q 2VO1A 1YHAA 1DGSA 4IPGA 3HR7A 4DC9A 2GVDC 1W46A 4AG5A 1G5TA 2ZJPA 4JMPA 1K5GA 2F1HA 4OHWA 3KXIA 1LV7A 4GOJA 4QNMA 4P72A 2XITA 1KJZA 3K0EA 1OXVA 2Q2UA 5IP7G 3B9PA 4JLDA 2QNRA 4M1YA 1XXHE 4LJZC 3SYLA 4JYCA 2ZAMA 2V6JA 3EZ2A 2LKDA 1N0WA 4R2HA 1ZJ6A 3U3KA 4C0KA 2YTYA 2VNUD 2R93H 5E7MA 4PFSA 1NY4A 2QPAA 5CB6A 2QPOA 5H70A 5FTMA 5ANRB 5KPDA 1KO7A 2AL7A 4JV5Q 4LFCQ 1W2HA 4Q48A 4EPVA 4IXMA 3A58B 4NL4H 1BDOA 2K5VA 1NIPA 5CIQA 4Q00A 1MJEA 4YDSA 3EPJA 1B9MA 2O0JA 1CKNB 4LUVA 4AYWA 5G3YA 2BMDA 2J7PD 4YMWA 3VU9B 4A0HA 3JAMc 4A3MG 1RKBA 4LV5B 4IDPA 1Z06A 2B63H 4JLJA 4LNQA 2WOOA 3IHLA 1PUJA 3I7FA 4KSBA 1XZPA 3HOXH 1EFHA 2XJ9A 3EIQA 4NP6A 5FBVB 1GNPA 4HDCA 3VX3A 2OCPA 2WMNB 1T6NA 1P16A 2BA0A 5AUOB 3C7KA 2V4DA 4QJFA 3F2CA 3K1JA 3CX8A 3K70B 1AJEA 4QGGA 3HOVH 3S2DH 5FUYA 3Q8DA 3F2BA 2A9KA 4DDUA 2YKGA 1K8MA 2I3BA 1VHLA 5KNCA 2E2HH 1NG1A 2REXB 4PHFA 4RZUA 3DHWC 3VA7A 3F3YA 2GVBA 1HQMC 4AKIA 1XPRA 4A36A 1Q1EA 4PZ8A 3A37A 3H1TA 2GAAA 4MUBA 3RS2A 4D80A 4ERNA 5DI3B 1GNQA 4QBFA 5BW8A 1DBSA 2D62A 2ATXA 1VG9B 3F0TA 1N5LA 3DL0A 5KDLA 2CJWA 3S14H 3ZLJA 1IZ6A 5FLXc 1X9NA 1KI8A 4FMCB 4DR6L 4DB2A 1SMYC 2GN5A 2GJAA 3DOFA 3H2YA 1S3OA 3FMFA 1FX0A 4DLZA 3A6PC 2AKAB 1W2BA 3BFXA 4IOKA 1HUQA 1QHIA 2HQLA 2B8TA 1C7YA 4P32A 5CLQA 4YCWA 3VKGA 5F9HA 1XB2A 1FR3A 1MJCA 4GNXA 4NXNQ 4P4TA 4TL6A 1T5LA 2MSDB 5A4JA 4MYUA 3CWQA 1X3SA 2FNAA 3T1TA 2CCGA 1IBRA 2TMKA 3IGFA 4TYPA 2RHMA 3UMSA 1P60A 1Q81C 2UXDL 4GLVB 1XCPA 2IEZA 4UP9A 2A68C 3NENA 3UE0A 1DAMA 1PZNA 2BJWA 2F7SA 2OZEA 4QIWE 3CCJA 2PCFB 4TSFD 1YR6A 5G3ZA 4Z54A 1N3BA 4JI4L 1OHHD 5C18A 4I81A 1FUKA 4EJSB 4NCNA 3BD9A 1QF9A 1QUQA 3D3QA 1S9DA 1KMHA 2R7ZH 1ZNXA 3I62A 1OYYA 2REBA 4LSGA 2D0OA 1MABB 1WI5A 4ON9A 4GBMA 2DWOA 4LY6A 2F6RA 1HCZA 3VR2A 1RJ9B 1LTLA 4JLVA 2Z4RA 3KZ1E 5FL7A 1VKJA 2RKOA 4LBWA 4DHEA 4DV7L 4BECA 4YXWA 3QSYA 3U4QA 2K5HA 3CW2C 4OQXA 3PEWA 1BO6A 3QF4A 1T5EA 4Z1MD 1TQ6A 3CC4A 2Z6VA 4I7ZC 5EJEA 2NZHA 4CGZA 2QA4A 121PA 2GRJA 2J45A 3H0GG 1MOZA 2JLUA 5H1YA 2J5XA 1N6PA 3NH9A 1Y1VG 4JJKA 2R44A 3JVVA 4DXAA 3CF5A 4IKEA 4ZKEA 3PF5A 2FGJA 3UDXA 3PV0A 1N32Q 2JA7H 1W49A 3KKMA 3RZDH 1XRJA 3OAAD 2O0KA 3ZS9A 4B32A 4Q7KA 3SFVA 1L2TA 2VQEL 1D6JA 4U7DA 1S9HA 1KKLA 2ZPTX 1Z7TA 2QAJA 3GLGE 1UF9A 1XD9A 4H9GA 3B5JA 1NMFA 2G9NA 3OEEA 4KI0A 2LXJA 1DTSA 2Q0HA 3RABA 1K6MA 3O8DA 1CLUA 5DN6A 4P4SA 2UXCQ 5FOXA 1IY2A 1HZ9A 3T1YL 4NONA 2JDIA 1P4SA 3I1FA 4DV2Q 1Z08A 3U7GA 4A3JG 2O5VA 1L2FA 3MMPA 4LC1A 1OSNA 2HLDD 3HJNA 3RYTC 2GZHA 1QZGA 3RLOA 3A8TA 3Q8XB 4DVGA 3GLFE 2AK3A 1DAEA 4LF7Q 5IK2A 2D7DA 1FX0B 2QGZA 3ND9A 4A93G 4AYBE 2LMCB 1Z47A 2ZRPA 1C0AA 4B3RL 2J59A 1VQLA 2NO6A 4FMCF 4LHZA 3WMGA 4CEIA 4C0JA 3FP9A 2IXFA 3NE5B 2F1MA 3P4XA 3CX7A 1G20E 4TMZA 2E8GA 5CJ2A
chains in the Genus database with same CATH superfamily
2DUUA 1HLFA 4J0IA 5CEFA 5SZIA 4KLKA 1M73E 2EBWA 3RVJA 4BX8A 3IBYA 5CB4A 2HSWA 4OP3A 1M75A 1WB5A 5BYBA 2ZAYA 3K0AA 1EIHA 3ZS8A 3CMCO 1IULA 4I1OA 4GMXA 4DZRA 4HNHA 2AVNA 3I6QA 1AA9A 1PK7A 4JSTA 3VO9A 4EEZA 3D6UA 5KNCD 4HPJB 3VPDA 4ARAA 5JXHA 3REOA 1JIVA 4E4YA 2CQOA 3OETA 2CLOB 3SXPA 2ZULA 3T5TA 4FOSA 4Z3KA 1BXKA 3FH0A 3AINA 3FUVA 3OLQA 2HMWA 1JHVA 3V8RA 5HE8A 4B35A 4N8X1 1ONOA 1UODA 1CUJA 2EERA 2NOAA 2GPBA 3RAJA 3E7DA 1YR8A 3NTOA 4P4SB 2H17A 3JU3A 2UYGA 1OIWA 1ORDA 1UK7A 2J9RA 3W05A 2DUNA 4U7PB 4DIBA 1D7OA 4W5HA 1LI5A 2RGDA 2YC4C 4NNOA 1RMQA 3WLFA 5ERYA 1Q7YC 3C98A 2V0NA 1XD8A 1JYSA 3HKBA 1HE2A 1CRWG 1R5OA 3NX4A 4R2WA 3RPEA 5YASA 4NW2A 3CM0A 2R1ZA 2AD1A 1QFSA 3J7ZC 5HXAA 5JH7F 3HFGA 5A06A 2XVMA 2FPPB 2I2AA 5REQB 2XRZA 2C5GA 4G24A 4CKBB 1R3UA 3PDJA 3VHLB 4B46A 2R7DA 1P33A 4KVGA 1Q7CA 4V1CA 3AW8A 4O4LA 3PA6A 5F52A 2GX6A 4GQAA 3BICA 2PUTA 3LWDA 4FINA 3WDKA 3BERA 4QX6A 4QB4A 1TGYA 4B6RA 2BLLA 4BTEA 4WOPA 4Q7QA 4Q21A 3W9BA 3DV9A 4DAMA 2Q2NA 1O5IA 4IQ8A 2VYVD 4NPCA 5JCOA 4EPXA 2O1XA 4AK9A 3AHJA 4MW0A 2DAPA 4GI7A 2P68A 1PTOB 5LP6C 2CE2X 1XEWY 4UAVA 4P2CB 3LTEA 3RSHA 1ICFB 1XDUA 2FMMA 4ZTBA 5BT8A 5LYJF 1MW9X 2D2EA 2AOTB 2HB6A 1KR5A 2EYMA 1U7XA 3N28A 4IIHA 3SK6A 2ZYDA 5B1HA 1U8ZA 1K5HA 3LM8A 2Q6VA 3PFGA 3RR2A 5T1IA 5GAHC 2YJ5A 3WICA 3FKQA 3HEMA 3PFIA 4RYLA 4WUTA 3H3XA 2VP0A 1TDJA 1W5FA 2PRYA 1RYNA 3VI3B 2NQ8A 8MHTA 2AOUA 3GGCA 1D2HA 4N8EA 4LGCA 3AETB 3PVSA 1BDBA 3FHWA 3ZZUA 3KOOA 4A3EB 3UDFA 1IYZA 2DR0A 2GVNA 4WLNA 1XQ1A 1WLSA 4BQOA 2B9VA 1LBTA 3FFBA 1GUYA 5KTNA 2WF5A 1W94A 3AP2A 2PWZA 3JV7A 3KB2A 4HH1A 2Y0EA 4NFSA 4Y1FA 1R4AA 3IDAA 5AW1A 3RFFA 3WI7A 1XNJA 4ADSG 3A8JE 3HCBA 3PWKA 5LDGA 4BIIA 2Z30A 1Y6JA 3I83A 3WGNA 5BMVA 3R7WA 5CH5A 3RAFC 3IP1A 4LTNA 2XH8A 2YWDA 3DWIA 3GNLA 1QHSA 4HYEA 1QO7A 2EYFA 3DT8A 2X23A 3S2FA 4GLAC 3IX7A 4I50F 3LNNA 4HJ8A 3G2QA 3G9QA 4CJ1B 1K86A 4GPZA 4C4RA 3CG0A 4Y1RA 5JT1A 2O8EA 2YWEA 3V8BA 1YNJC 1X39A 4AU1A 4KV9A 2OZVA 4Q1EA 3G8DA 1O95D 1Z5OA 2FZLA 3K7AB 5C0XG 4ND5A 4BFZA 5KOJA 5TIIA 1NKSA 2RKWA 5HEKA 4EGFA 2IX3A 3W7BA 1RHJA 2DQKA 2GETA 3HH8A 5CFMA 1NMSA 1KXZA 1IIBA 2PZFA 5E9AA 4EEKA 1GVHA 3WA7A 5FWXB 1FC0A 3L0PA 4OOFA 4QYXA 2QY9A 1FDUA 1X9GA 3NQIA 1JMKC 2CWWA 4AAYA 1C7IA 1XYIA 2OGUA 3RVBA 2WFLA 1E2WA 1XMOB 1ICEA 3EZYA 2D0PB 4C6TA 2WBLC 1A9TA 2YXDA 5IC6A 3AZOA 4IJ6A 5JQWA 1Q57A 3MW8A 1SYGA 3KYDA 1XJVA 3EK2A 3KJXA 1E9SA 2JLBA 3EHDA 3KLSA 1CSPA 1E1TA 4O4LB 2IPXA 2W58A 4KUHA 1NT2A 2C4MA 3PUVA 1NWHA 4CETA 2K7FA 3VR4D 3WWYA 4BMYA 4CF4A 1VQOA 3WP0A 5BQ5A 4FF4A 3AFGA 3OCUA 3QGMA 4GGPA 5FHQA 1H4QA 4AJ1A 2I7CA 1M7HA 2WIFA 2EBFX 3P2OA 4MB2A 5MGBA 4OHOA 4TLEA 3MJEA 4FB5A 4RCNA 1G3QA 2HCIA 5AW7A 2N75A 4HWSA 4JVSB 1X3LA 3K16A 4DA8A 4FMDB 5FNZA 4Q1AA 1JE5A 2WD9A 1BG6A 1KP9A 2IH5A 1P2DA 1PFSA 2I46A 1RM4A 3PD1A 1OFIA 4XFDA 3WG9A 4AYXA 3ZD8A 4LDRA 1WHTB 4FO2A 2J33A 1UOOA 1ND6A 3I9OA 4PGAA 3V4SA 3AY0A 1MH9A 2DFVA 3D0OA 2JAWA 4TL7A 2XZPA 4N0QA 3WP1B 3ZCUA 3DOHA 4Q03A 4K5WA 1K5DA 1GD7A 2O8NA 1PTOC 2P5SA 4AZ3A 5A9RA 1TWGB 4WFIA 1I30A 4D3YA 1ZGZA 2C2HA 2EKQA 3MXNB 5G3LF 3C1TA 3KJFA 2R8XA 4OMDA 4HUQB 4ZCMA 2YHUA 1T0UA 1CKEA 1WW2A 2OBNA 2ADOA 3KDFB 3IKMB 1KMIY 3L1UA 4MV5A 5FPTA 1HFNA 1ZJYA 5CXXA 5U9CA 1SCIA 4TXHA 3T9BA 1WYDA 4PC3A 1J21A 4C1BA 3HOUG 2FEOA 3ORYA 3RN2A 1EY6A 2IXAA 3AI7A 3SEZA 1Q2UA 5DXFA 5BVGA 2FDXA 8ABPA 1YXMA 4ZC1A 3TGLA 3HPRA 4KB5A 1V6SA 2WJHA 2NBFA 1PFVA 2FSIA 2H65A 3B12A 1B43A 1ZJWA 1NW6A 2X0JA 2ZTUA 3EZ6A 3I04A 2VXCA 2LS01 1X70A 3CNOA 3TDNA 4A73A 4KN7C 4BVBA 4RX1A 2GPSA 1LVUA 1Z2CA 4W5JA 1JIIA 4DAOA 1YJ8A 2XLBA 1XJ5A 2WPNA 1UBRS 4YHHL 4BN0A 1Y8RB 2CLEB 3N8KA 2P6PA 2XRYA 3OVMA 4O33A 4KSCA 3PUXA 4DK1A 2AEJA 2F3SA 3IAAA 4Z4CA 2H7VA 3IUEA 1J00A 1SROA 2AFRA 3SIXA 4CMEA 4DAYB 1Y1WG 3DA8A 3HOYG 3DDSA 1H9BA 4EGJA 4NQRA 1JFLA 3MAAC 4J2OA 2CL7X 3D81A 2HKIA 3OC6A 1EFUA 1GAEO 1X14A 2E9SA 3CRKC 2QP4A 3E9RA 4TVKA 5J2TF 3PGJA 5HQ3B 3JAMA 3IV7A 1MJNA 4M3NA 1RC0A 1YS9A 3AHDA 1EK5A 1N2CA 1BKBA 1RI5A 4GP9A 4JBGA 4LWOA 3SYTA 1G42A 4K3VA 4QXRA 5JDCA 1ONSA 3T0IA 5L45A 1Z4NA 3K0XA 3EISA 4CKEB 4JI3B 2Q45A 1OPRA 5A5EA 3AVWA 3EE6A 4AH6A 1HT0A 1XHLA 2GYUA 1GGKA 2Y1FA 2ICAA 3DJYA 4G0QA 4PICA 4CL3A 5CITA 1CRPA 4XPIB 1X8KA 1LVHA 2NZYA 4KQJA 4PPNA 3IHKA 1QYWA 5HQ3A 5BRAA 2PG3A 2HWYA 4F97A 3W7AA 1E1QA 4DDTA 2QTAA 1U9CA 5HTOA 3RRZA 2X8JA 2QG6A 3JZFA 3Q3GE 1BCPF 3HNOA 4OQDA 3BU2A 5FK9C 1A8PA 2IU4A 4FFDA 4RA6B 2W5UA 1T3SA 2BY4A 2KM1A 1L1RA 3RYFA 3IVCA 3LLUA 4OYYA 3T7SA 4LZOA 4GM4A 4HXEB 4TRJA 1SBIA 2PPLA 2SKEA 4NJMA 4KVZA 3G2NA 1GPMA 1GQFA 2W7TA 2G82A 4JVNA 2M1XA 4B74A 2QN7A 4EMBA 5M5WH 1PR6A 2D74A 3TBHA 2C8KA 2JK1A 3N52A 2QQEA 3CJQA 1RJFA 3STYA 3FHJA 3K2BA 5IP9G 1H2FA 1Q92A 1NUHA 2XTJA 2Y1LA 3KLOA 1H2ZA 3AB9A 4IWYA 3ELBA 2UVQA 2X15A 1X2BA 4LWZA 4X8LA 3RCBA 2WF9A 1Q3LA 3L7IA 1THTA 3BCSA 3KQMA 2F8TA 4LXIA 4WJKB 4BB0A 2ZIXB 1KOJA 2ES2A 2HA4A 3ABIA 4QTTB 4RJIA 4TRNA 1EJ2A 1WVGA 2X2PA 3G9ZA 3LNCA 4MR9B 5JZBA 3IEVA 2X0DA 4DIUA 5IUJC 2FN7A 3Q9UA 1XALA 1E1CB 3G85A 3KKPA 4J1SA 3SNHA 1U0LA 3H84A 2NV6A 3AP1A 1Q90A 3K0FA 3AL3A 3T99A 3UC9A 3SZUA 1QYVA 4XPIA 4DMHA 2DEUA 2W2LD 1VB5A 1CHNA 1P0IA 4HDSA 2VHCA 3PB3A 1DGQA 3IP9A 3TNFA 2B5WA 1E2VA 1EVLA 2YWCA 1VF7A 3C5CA 2EXXA 3LL7A 2PWYA 2KW5A 7MDHA 1EBUA 4LOAA 4N6OA 2GF2A 4PG4A 2CFTA 2PSJA 3RUEA 4Y7CA 4YCJA 4D9MA 2QJOA 1NVEA 2P9BA 3T0FA 3S9WA 1E3WB 2XB2A 1CF4A 4G7ZC 1CJCA 3MHPA 4DA9A 4E32A 4OHZA 3A1UA 4WJWA 9MHTA 3LMKA 3PYMA 4EBFA 3WWVA 4O4IB 1PGJA 1G8SA 1NQ5A 1YB5A 1TQ2A 2XGTA 2WJ4A 4J1TA 1PDQA 3F74A 4KFUA 5E7IA 4OX9Y 1GA6A 3F4BA 4HH3C 1V0JA 4ZCLA 4Q9KA 5AJUA 3VYSA 2X0RA 4RD1A 3HKCB 3A8IE 2QRLA 3EGXB 3BJUA 3DFKA 3KDPA 2TSSA 3U7QA 1TS4A 4GUAA 3O83A 2J3LA 2C5HA 2JGDA 4LN1A 2ZAOA 1NJIC 1K92A 1JFFA 5G0WA 3ZGLA 1E2BA 5FJ8H 4ZUIA 1JSRA 2ZKLA 3HN6A 4L4UA 4XB2A 3TNJA 2R7ZB 3I9V1 1M90C 3UIEA 4AQDA 3AYHB 1DKMA 1HPLA 2C9BA 2R1TB 3WIOA 2K4KA 3IR7A 2F4VL 3WRXA 4JBWA 3FFWA 3M5DA 1L1OA 3ZXIA 1Y4DE 1IUKA 2BFEB 1A77A 4IJHA 5EPLA 1USGA 2D5CA 1ZCJA 2E37A 4NJMB 1XIVA 5ITSA 2PS3A 3B3JA 2BR5A 2YRXA 3RVQA 3ZXSA 2Q6KA 2P5TB 4H6VA 1E59A 2QR5A 3K7EA 4GLOA 3EXHB 4GYKA 4PC2A 3AJRA 3GLFB 2EVWX 1Q0PA 3GMIA 3LBHA 1AGXA 1DUIA 1T24A 4NCXA 4TS1A 4C88A 1AKWA 2VDNB 3G79A 5IT9L 3BT7A 1NRIA 1RIFA 4HH0A 5J4YA 4FUQA 4TLMB 2ATWA 1K7CA 1N5JA 1QRDA 3UJCA 2X3FA 4OB7A 5C4IA 5J40A 1I3NA 1C8VB 3EOZA 4LF9Q 3HOWG 3MC0B 1O6CA 2P11A 3ANNA 3GLHA 3SM3A 3TEHB 3HKEA 1KJ8A 4EQ6B 7AT1A 5LQRA 5AUNB 1QCYA 3K2EA 3BD7A 2XGSA 3TAXA 1JU9A 5EJ2A 5JDCC 2GCIA 4PRYA 4B3BA 1RZRD 4NXNL 3S1MB 3T7JA 1O54A 1QYCA 1N33Q 2HJRA 3U31A 3A0RB 2VR1A 4CZ2A 3PQDA 4LSZA 3FJYA 1GG9A 3ZZMA 2G9UA 1CDZA 5IKXA 1JRLA 2FP4A 5A3JA 2G25A 1AH2A 3W2IA 4GMGA 3ZXXA 1AZQA 2Q1WA 4IDQA 4IUVA 1R27A 4GN3B 1JMCA 1UJ2A 1TQDA 3VYWA 5KMGB 1JR4A 1Y8QB 2PR2A 4UVEA 2KPOA 1YQXA 2CHQA 2J07A 2PGOA 2ZRLA 3QELA 4FT4A 2ASVA 5E4FA 2QR3A 3RV4A 3UNXA 2JBAA 5I3ZA 5JTUA 3M3DA 1WUJS 3H8JA 4HDAA 4DR7L 2P2ZA 1YJ5A 2C2OA 2GXSA 1DC4A 2WSSD 3BE5A 1F4LA 3FVTA 3IJ5A 4JU9A 1K9SA 4LC9A 4ZMRA 5C3MA 9LDBA 4BRZA 2D6FA 3KOZA 1R6BX 1T6ZA 4YCBA 5F4ZA 4OQNA 1JIXA 3JWIA 3OT5A 4CMEC 4Z3OA 2ZIWB 1TAQA 4Y2RA 2ZM6Q 3UMVA 1QE3A 1YCFA 1YJAA 4JGBA 1XSEA 4DR6B 1IBSA 3KUDA 1N8SA 1DRUA 1OWLA 1TQHA 1GKUB 2EYUA 3FYUC 1DIHA 5DGTA 3UK2A 4TYNA 1CWUA 3PXCX 2PNHA 2EOTA 1II8A 2CVQA 2WYIA 3Q10A 4LYHA 4PQFA 4JI2L 4M21A 3ZWOA 1U2DA 4RCYA 4G85A 1E4OA 4FDLA 3WY9A 4D44A 4EY7A 2P67A 3ZY3A 1F0PA 1PH3A 1F48A 3RUFA 3A26A 2X9QA 1OIVA 1L5QA 4ZVRA 4E2XA 3ILYA 1LTKA 1M0TA 1T4CB 2RAUA 4O42A 3CBQA 4X1YB 5JVH3 1V1MA 4ZU1X 5CB4F 1EUCB 1Y69U 1YL6A 4LI3X 4BGIA 5ES3A 5KKNB 2B36A 3OIVA 3HOYB 3VPCA 2G77B 3NHPA 3RVPA 4X64Q 2DBQA 4A3GB 2E1PA 3VVMA 3GFTA 3P94A 1ORVA 1SA0B 3PUIA 4IFTA 1TB4A 4X7MA 3A3PA 1MSGA 4NS1A 3CLRD 3L6CA 2X0IA 3KKOA 3DFIA 1OMOA 1W581 3OT4A 5HIJA 4AF7A 1QSGA 5IZCC 2VP3A 2B8GA 4IDHA 3H6KA 4DUGA 2GZSA 3Q11A 2YXEA 3G2LA 3S1SA 3AHFA 2C2BA 1A76A 2E5FA 3RASA 1FA9A 4YRDA 4FDVA 4HJ5A 4JYAL 1ZMRA 2H4WA 2AOTA 2IYQA 4KLRA 3T1HQ 1BE6A 1P8LA 4X3TA 1E2MA 3UJDA 4NG5A 3PQ3A 1YQGA 4R8NA 1IPHA 4KXLA 3WRXC 1D2GA 4KMOA 4ZCSA 3TMAA 3ZPXA 1ZD3A 1W35A 1WFQA 2FPKA 3WYDA 1LKZA 1N1MA 2C20A 3ESCA 1MX1A 3L5OA 5D86A 3SJZA 1NFFA 4JUFA 3OIPA 3P27A 5D7BA 3I39X 2EOAA 3C1UA 3OE7D 5DNFA 4OX9L 1FYXA 1PQPA 2A5HA 1UBGA 1MB9A 2CMGA 4FE7A 3WQBA 3K5HA 1SR3A 4KTAA 2WAXA 3K31A 1Y8QA 4AJ4A 4HQNA 5FWXA 4Q18A 3CCVA 2ZU6A 2GZDA 3GROA 1RLMA 4YUXA 4KQWA 3QVKA 3CZPA 1Z35A 4O2AF 2H1VA 4IW3B 5A7GA 1GL6A 1HL3A 1KMQA 1WLYA 1KDRA 1Z12A 2X4DA 4BPBA 3VVBA 4K03A 5D5QA 3UZUA 1RQNA 2B98A 3OCXA 2VYVA 5IXYA 2EYQA 3Q8KA 2R7MA 4LHEA 4IOLA 1UDAA 4I1RA 4DMKA 3W06A 1CM9A 2H48A 1QHYA 4F21A 2NVXH 5IABA 5BN5B 3GEDA 5BN1A 4A3MH 4E30A 5BV0A 5F7XA 4G84A 3S5JA 3K6OA 1SXJD 4MRPA 2RK4A 2Q99A 1CY7A 1SUEA 2FFKB 4MDHA 1OO9B 2WIDA 1AH9A 1DWQA 2BGLA 3C48A 3AM4A 1KZ4A 2BUAA 2GEBA 1GNVA 1JNYA 2XOXA 2PW7A 2CMDA 1NW8A 4DR2Q 3GTJB 4Y7NB 2IY8A 2LKCA 4Q15A 4AULA 4EMSA 2SOBA 4DDKA 3F78A 1WETA 4AI6A 4XXHA 5KYLA 1O4VA 1QORA 2F3RA 4F6RB 2L5TA 1EFWA 3NEJA 2RIRA 4C78A 5I4IA 5JS1A 4GYYA 2XMQA 1UP6A 2I5MX 1YZFA 2FMFA 4MW5A 5HZHA 1GU7A 1KC8C 4DG5A 4J8QA 1RLTA 1KH1A 3K32A 5HKLA 4PMBA 3D3KA 4IUPA 4JA2A 4EG6A 1QH1A 1G9XA 2GCGA 1V26A 3FI9A 1IUNA 1NC1A 1BJTA 4BEVA 3GRZA 4B3TB 2WE7A 2X6GA 1PR9A 1BU5A 3TRJA 1XNRL 3ZWDA 2R8RA 1R2QA 2A67A 2OXCA 5IVIA 3MJRA 4EW3A 2WYWA 5GOTA 2NU6B 1ZIPA 2QP9X 2OA0A 1RTKA 2PXAA 4HVLA 3NTLA 3O3CA 1YU6A 5F23A 1ESZA 1YNNC 2PLAA 4A8JC 3DSRA 2B83A 3LDUA 4FJ2A 1ID8A 4BVLA 5J1ZA 4APVA 1C0IA 1KI9A 3BYTB 2OC9A 3A6KA 4PYIA 1L5RA 2PA0A 3BB3A 4UVHA 5LDDC 4GEGA 1HLGA 1SXJA 5GINE 4OHJA 4YAWA 1TT7A 1QAMA 2ROQA 2RSLA 3RIMA 3H91A 3HVJA 1UIMA 2Q9AA 3ZHUA 1DLJA 1P62B 2WVAA 4ZI7A 3O84A 1E1NA 3PLRA 3RJTA 2BGNA 1FXWF 1NQUA 1XTRA 3ZTWA 5C4XG 1BNCA 2KJQA 1QH0A 4V0NA 3AF2A 2AW3A 4LBYA 1X86B 4FYWA 2FK7A 5TS3A 1VLMA 3K6KA 1PIWA 1X1QA 4HDSB 2BCJQ 4W7IA 1W44A 1ET9A 1T5DX 3MTIA 2IUFA 2XHZA 3SPXA 1TVMA 3X1XA 1JBQA 1YVEI 2JA2A 4KAFA 1Q46A 3QJYA 1NVVQ 3P9ZA 4BNHA 5I7OA 2VPQA 2H1IA 3NWEA 5AM3A 1TWAB 3BXGA 4ZKCB 2ZSBA 5C35A 1UZAA 3BXHA 1C9NA 1RHMA 3OUZA 5G0SA 1NTRA 3SXUB 1TYZA 1YQTA 4C3OB 4LZNA 5J5AA 1I94L 2H8KA 4FSXA 5BN5A 1V4NA