4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
4RMFA 1EQQA 4A8JC 3RLNA 1R5OA 3CX8A 3K0XA 3RZDH 2QBYA 5JRZA 3NH6A 3DKPA 3UWOA 3I4NG 3GLHB 1J5EL 3LFUA 3MRSA 1SVIA 2IS2A 1KAGA 4NXMQ 2QTHA 2OTJA 4WJ3M 1N6HA 3NBHB 2YU9H 3PUXA 2DWQA 2O0HA 3QF4B 4Q9HA 2DHRA 3SC3A 1WBDA 4PZLA 5KUTA 2KCCA 1OXTA 1PLKA 3WHLA 2J0QA 3AGQA 1AE2A 1X8LA 3OYYA 2XOKA 2GJSA 1E2WA 3PJRA 3T12A 2JQOA 4GN4B 1AKEA 3U50C 4JLVA 4B3TQ 4JJKA 3OIUA 3QENA 5BXQC 2OO7A 1F3OA 4JG2A 2IW3A 1Z29A 3AKDA 3NE5B 1JXOA 3TR0A 2XTZA 3W5IA 3VA7A 3J80c 1LYLA 3TR5A 1I94Q 2FF7A 2VHTA 1P6XA 1TX4B 2GBLC 2ERYA 1EXMA 4IDQA 3H15A 1QHNA 2AR7A 2V55B 1SXJB 2YHSA 4FIDA 4Z1MD 1RRCA 2NVTH 1CR2A 2C95A 2JIZA 4C0HA 3VX3A 4Q4AB 5AJZA 1GITA 3VR6A 3L2PA 1ASYA 1JJVA 1XMIA 4DK6C 1JAHA 3LH5A 1G3RA 1AE3A 1D8TA 1UBGA 2FPLA 2UVQA 2ZYTX 3CRRA 4G5OA 4D6PA 5GROA 2AL7A 5KDOA 3KQNA 2MNAA 3GDEA 3EXAA 4KJZA 821PA 2ZRNA 5L3SB 2R93G 2ZI4A 3P1JA 4IOAA 1NBME 1UKEA 3WY9A 2VP0A 3DO6A 1JE5A 2OEPA 4IXMA 4C0JA 4A3LG 1EWHA 2Z6KA 1MH1A 2VQFL 1AN0A 5JJKA 3HKZE 1RL2A 2RF4A 2ZTCA 2D74A 2BBOA 2OAQ1 4PQFA 1LVGA 1ETUA 2AK3A 1EFCA 3AQ4A 1UDWA 1K5DA 3D4RA 4Q4HB 4DCSA 3UMSA 2JA5G 1CJVC 4BRWA 4Q7JB 5JSZA 4DR6L 4QHSA 2KENA 4GS3A 4ALPA 3PCRB 4TL8A 4LK1C 3GTJH 4DT1A 2Q3HA 2GEUA 3V9PA 1XJ0A 2LXJA 4BLSA 2YVUA 2RH5A 1J8YF 3IQXA 2ZITA 3LNNA 4M1KA 3B85A 1KQSA 4JL5A 4RD3A 3FTQA 3FWYA 4WZBE 4ZKDA 4GKKQ 5EZ6B 3HJNA 2OZEA 5B57C 1H9SA 1XBTA 1YR6A 5IYDH 2C8VA 4HZIA 1E4YA 2Q6TA 4OK3A 4BFZA 2N49A 3MEFA 1E9DA 1EWRA 3S1MH 1ANKA 3CAMA 1VIYA 2V54A 1JB7A 4Q1CA 2F3IA 1E1QA 1P4SA 2A69D 3EZFA 2VF7A 2UKDA 5CYOA 4TMKA 5IP9H 4RD1A 3ASZA 2ZSAA 3TUJC 4EPRA 1G18A 5JHHB 4JI7L 1OFTA 2L15A 4X62Q 3UG6A 4TQAA 1GL6A 4C3HH 3H0KA 4M21A 1ZUNB 4XSGA 5KPJA 5KPDA 4CEJA 1EFWA 2MMCA 1VHLA 3DEFA 4JI8L 2RGAA 3SQWA 2K7VA 1SVWA 4JI3Q 2VP6A 4LI0A 4TTPA 5TB5A 4DPGA 4WIAA 2RHQB 3IPXA 3BD9A 2GEDA 1KI1A 1QVRA 2JCSA 3MAAC 3QBTA 2O8EB 4G1UC 3BH0A 3PUZA 1AQUA 5ELOA 1S1CA 3SJBA 2CK3A 2IYYA 4QHYA 1K8AC 1J5EQ 2RB4A 2ZSBA 1XNQL 4GOPB 2V4ZA 2ZE5A 2PZEA 4OQLA 2IUSA 3GEIA 1KJWA 1JPJA 1XJCA 4HI0E 4M9XA 1ZYRC 1JJGA 3L0SA 4JI4L 5FOWA 1NMGA 1E96A 2QY9A 4AYBE 2FFHA 1N5IA 2V6JA 1Z0KA 4YXWD 2R7DA 2JJ1A 4A93G 1U90A 5AR1A 1I4TD 2Q9AA 1E2FA 1G8HA 2DNCA 2B7CA 3HPRA 5HE8A 5TXGA 4DCVA 1KIXA 1F2UB 2ZE8A 4CT4B 3DMDA 2C9CA 1JR3D 3BIFA 4TL7A 4NYMR 2NO9A 1IN4A 4MH0R 1S4QA 4NP6A 4NCHA 3SZRA 2WB1E 5TVKA 2VW9A 1OIVA 3UKDA 3WMGA 1B70B 3ZS9A 3OFND 2QEXA 3C15C 1RFLA 5C46F 2NO7A 3SJCA 4L4UA 3KJPA 1WMSA 1SVLA 1NBWA 4V02A 2PQAB 4M1WA 1JJCB 3IHLA 2LKCA 4M1TA 4Q21A 1QBKC 1ZYUA 1G17A 3RRNA 4NMMA 4LYFA 5IP7H 3QXHA 1AZTA 4MYUA 5FOUA 4BGDA 1KO5A 3ZVNA 3WNCA 1FMLA 4W5WA 4RZ3A 3DVLA 3CNNA 1CFMA 3I4NH 2CFMA 5A35A 4DR5L 1Y1VG 1NN5A 3TQFA 3HKZG 5DHAA 1K8GA 1Q81C 4DC9A 1E2EA 1NN3A 1X3FA 2PH1A 4LJ7A 4LK2A 4B3CA 3F2CA 2R2AA 1NVVQ 4DR3L 4JIMA 2FA9A 1KOFA 2UUBL 3CF6R 1N6KA 2NZ8A 3K9NA 4C2MH 1Q1BA 1B7YB 2IL1A 1N0WA 1TF7A 6Q21A 4L5SA 3KDFA 4WOPA 2XEXA 1E98A 4CZ2A 1YZGA 3OW7A 2F1IA 2NVYH 3AP3A 4DR6Q 1Q86C 4LOAA 2WJGA 1WFQA 1Y3AA 4U02A 4ASUD 3GCGA 1S9HA 2J0UB 4K0KL 4RVCA 1V1QA 1P7CA 3CWZA 3K70B 5EXSA 4DV4L 1Q44A 3I7FA 2ZM6Q 1DARA 3RRZA 3RS3A 4EPYA 3IIKA 2BV3A 4MDEA 1WI5A 1NL3A 4R2HA 1NNEA 4Q66C 3N5CA 4JI5L 2QAGB 5LBIA 5FH9A 3GMTA 2VP4A 1MO6A 3THWB 3ZQJA 3WYFA 2O8CB 3CRVA 5BYJA 1HYQA 1X1SA 1K5GA 4JVSB 5JWHA 2JA6H 4B73A 3B5JA 3MD0A 3M6AA 5B2ZA 4JI6L 1H8HD 1I6HH 1EFRD 3QVVA 5JFGA 3B1VA 4LF7L 5DN6A 3G71A 1DAFA 1XFAA 3DL0A 3NVAA 1Y8PB 1E9BA 3M4YA 1TMKA 2R93H 1U0LA 1BMFD 1TWCH 4BBRG 1D7QA 2WHXA 3VU9B 4UP9A 2ZJPA 1N2CE 2ZAOA 3KDSE 3B6YA 3ULJA 4R9UC 1IYJB 4LF9L 1UEIA 4TWZA 3AVWA 3B1ZA 1DTSA 4JL8A 4R4OA 5IYCG 4UNQA 1JQJC 4KHPL 1AGRA 1KL9A 1VQGA 1RRPA 2D62A 4EX5A 1KZ7B 3FFAA 1KI7A 5J3BA 5AJ3Q 3SDZA 2BJVA 2QPTA 1WCV1 1N6LA 3G4SA 1US8B 4B3SL 1E4VA 2DFTA 2FSFA 3B7GA 1H8EA 4DEYA 3AYHB 1GKUB 2WKQA 5JI2E 3Q8XB 4AYBG 5FLMH 1CJTC 4ITRC 2FMXA 4XD7A 4UPAA 3AKEA 1PYBA 4RJLA 3EA5A 3FKSA 1PH5A 1TEXA 1WE2A 1RKBA 3B1YA 4Z8XA 3FMPB 1P61B 2YZ2A 2K32A 3OTOL 4JI4Q 3LBIA 3HYTA 4QGAA 1KSFX 2OQ0A 1PHJA 3UPUA 4HEJA 3A6PC 1XRJA 2ZRAA 1GAJA 5AWFC 2MO1A 1G7TA 1IJEA 1VQ7A 2WB1G 3RN5A 2G1KA 2IA5A 2ZE6A 3CF0A 4LBYA 2I0QA 4QXAA 4C4PA 4DWJA 1E3PA 2V7QA 3FMIA 2FSHA 2XSZD 2J46A 1N33L 2ZRIA 4FW9A 2YTXA 3NIBA 1Q21A 4KFTA 2PJRA 5DSZA 2YC4C 5JJIA 1KNQA 4F4JA 3UE1A 4JYAQ 4TT3A 4JS0A 1QDEA 3TZUA 1PLLA 3BORA 4AKHA 1HT2E 2ORVA 4Z8YA 1P3JA 2IYXA 1OXXK 4X64L 1EGAA 4JC0A 3A8TA 3S1NH 1OHHA 1IN8A 1U0JA 5TY0A 3HOWH 1J70A 4D4JA 2IT1A 4UJ3A 4LZZA 2JA7G 4LUZA 1G1MA 2BBWA 2OT3B 2IXFA 1MKHA 1Z0DA 2I3BA 3A74A 3DHWC 3STBD 2CJWB 2ONKA 4HZUA 5KDLA 1S40A 2WWXA 4P4TA 2W2VA 4DR5Q 3BFVA 2WZQA 4Q9JA 1OXVA 4MGKR 4C3ZA 4PZYA 5FOSA 4J0QA 3AVPA 1L1OA 4DR3Q 2AWNA 1IYVA 2NGRA 4JT2A 3K0EA 1W7AA 1AM4D 3HDTA 2V6IA 1XMQQ 3RNUA 3ZZTA 4AY2A 4JLOA 4A15A 4OWTB 2UUBQ 3CWQA 2XGTA 3UXMA 1DVRA 2CCKA 1GWNA 3LNCA 2WOJA 1KRSA 4DR2L 3RLOA 1MRNA 1SHKA 1IXZA 4DK0A 1ZINA 1NMZA 5H68A 2HCJB 3GLIB 3M7NA 4II7A 2Z0MA 3IPYA 1FR3A 4TYWA 4KODA 5ANRB 4C3IH 4PC1A 2P65A 3RS4A 2QSYA 4K46A 1BH2A 4K0KQ 3FGNA 4GLVB 3FKIH 4QNRA 3BBPA 3CP0A 1XPRA 3CD6A 4I7ZC 1FL9A 3ZYCA 4HLQB 4IJHA 4Q1EA 1PH3A 2FH5B 1L4YA 2EYUA 1E1RD 1XMOL 4HATA 4IJMA 4YC7A 4IPGA 1ZCBA 4R4IA 3J80i 3GJ4A 2VS1A 3T06B 2GCPA 2ZRFA 3RS2A 2F52A 2ZTEA 1KSJA 4ZIRA 3A4MA 5KYKA 2DFNA 3BWDD 3D31A 4HLCA 4YWMA 3I8SA 4WXPA 5P21A 4BE7B 5DE3A 2V3CC 4JI6Q 1GJXA 2N78A 1VQNA 3QKSA 1KJYA 2QMOA 4LF7Q 3IO3A 3R7WB 4QJ3A 3U6BA 2CVHA 4Q19A 1OH6A 4R4QA 1YR9A 1N6OA 2DCUA 4PR0A 2EW1A 3BS4A 1VYTA 2K33A 1XTRA 3M4QA 1OH7A 1IM2A 2ZYUX 4Q9KA 4KHZA 1FOEB 1G19A 2B8WA 2Q2HA 5EZ5A 4TSFA 4IFBA 2IX0A 3CRKC 4LFBL 2G77B 4UP7A 4XVUA 4OI4A 1JQLB 5JJLA 4LJ5A 1XTDA 4A3JG 4KHPQ 1JBKA 1MJEA 5JS8A 3CH5A 4BZQA 1RRFA 2WWGA 2ZUDA 4FXPA 5FPTA 1BDOA 5KNDA 2YOHA 4BY1G 1KI6A 4POAA 1P60A 1P9NA 1BBUA 3RVBA 3ONWA 5FUXA 2VIIA 2MFIA 2BEJA 2WOOA 3LY5A 4I4LA 5HZHA 1E7ZA 5A0FA 2A19A 5M04A 2J87A 2P5TB 3VMFA 4PO1A 3OTOQ 1RVDA 1ZVQA 4M9ZA 2VSXA 3REFA 1T0HB 2WV9A 4IQZA 2CLCX 4LBVA 2DWPA 3AF1A 4Q4JA 4M4SA 2IUUA 1X9NA 2YTVA 2ODEA 1IL2A 4QJ5A 4HLUC 4OQMA 3BJUA 5C1BA 2ZRCA 5DI3B 1YRAA 4DLTA 5CM8B 4B2IA 1OFHA 1PZNA 3EAQA 2R6AA 5FUWA 2UUCL 4HJ8A 1A63A 3C5CA 1H65A 3TRFA 3W5JA 3X1XA 3PO3H 4ZO4A 1PUIA 1T0JB 2AHOA 3CC7A 3U7GA 3FHWA 4KVGA 4BBRH 1JB1A 1QUQA 2P5SA 3FMCA 1P16A 4DUGD 4X64Q 1DAMA 4V0LA 1QHHB 3CPWA 2R7ZG 1RRGA 1IJFA 2F43A 4DV0L 4DV3L 2OLJA 3KL4A 1HQMC 3T5DA 4ARZA 5IDVA 2IYZA 4BFSA 2QM8A 3ADKA 3KJHA 1X86B 4UNRA 2YWGA 2C77A 1PH9A 1IAQA 1BYUA 1S8FA 1U99A 2ZETA 3AF2A 4DDVA 1HY3A 1NY4A 1G3IA 4WA7A 4P71A 1Q0UA 1ZCAA 5FPYA 4Y52H 1KTVA 1CBUA 1NG9A 1YR7A 2SHKA 3OEEA 2JDID 3FOZA 4F4IA 1C0AA 2ZRHA 4QFMA 2R92H 1Z6GA 2HYIC 1W3SA 4OHVA 3TSOA 4DUZL 2GZAA 4DR1L 3CONA 3P4XA 2O8FA 5CDFA 3Q5DA 4TTQA 2VPPA 3JC66 1CS4C 2W2XA 1EIFA 4DR7L 2BE5C 2CCJA 2J3EA 2ZI5A 5C0XG 1OYWA 4LYJA 4A9AA 4AK9A 1KNXA 3QEJA 4YCWA 3PIOA 4A3BH 3PO2H 1JI0A 4D4KA 4FMDB 2ZI3A 1K6MA 3K9LA 2ZR0A 4XWAA 1CUKA 3S14H 4UNSA 1NBMA 3FP9A 1N36Q 2UU9L 4EPVA 5JZVA 3A1UA 2H1LA 3AVUA 1G8PA 1Q46A 3C16C 1W4CA 4A1FA 2QA4A 2CL7X 3EZ9A 2A68C 4H13C 4LJAA 1R0YA 4Q1FA 1GKHA 4LF6L 3UK6A 1TAGA 2PCLA 1N5JA 3A8KE 5FL7A 2AKAB 2REXB 2OXRA 5FI0B 4TMXA 3CCEA 1CR0A 1VKJA 3K8YA 4N0EA 4IFDG 2JA7H 3GTMH 2OM2A 4G01B 1Z06A 4US1R 4BRUA 3RC3A 4L9SA 1V8QA 2FX3A 3KLRA 1ZUIA 5B58C 4OX9L 2BKUA 2IY5B 1FVIA 1R2QA 1Z0IA 2PLRA 4C30A 2WICA 2CWPA 2YJTD 3Q8DA 5JEAJ 2P3SA 4AKGA 2LMCB 3GLIE 4LFBQ 2LCFA 4MYCA 1QHIA 4LHZA 2ZS9A 1E2MA 4PHGA 2FV8A 5E3HA 3CCMA 1AIPA 1HZ9A 2QI9C 3ZZUA 3O8DA 4W9MC 3SYNA 3KF6A 4DSNA 2ZAMA 3TAUA 4C7OB 1KDOA 2REOA 3M1IA 3LLMA 2NVQH 2UZIR 3BH6A 4NKRA 2EFDB 2F9MA 4M0LA 3LXRA 4XTRA 1D2EA 3U44B 4E07A 4DXAA 5ELNA 2WWHA 4DIEA 1E79D 4WJ4A 3B8HA 4GLXA 4RZ2A 4POGA 3K7AH 4B6FA 2XNDA 2FEMA 1LS6A 3EW9A 3GJ8A 1Q1ZA 4PHFA 1CF4A 1XTIA 3B13B 4EPWA 3I73A 3OIVA 1JT8A 1X3GA 1YIJA 2W6ID 2JA8H 4DJTA 1BBWA 1CSQA 4MTNA 2ZPTX 3IIJA 5IHPA 2IHYA 4QHTA 2KE5A 3I32A 4OGQC 4XIGS 2FFAA 2G6BA 2UUCQ 4Y7NH 3HOXG 1NKSA 2GF0A 2IYWA 1XMJA 2JLQA 4Z1MA 4EFMA 4AKIA 1WP9A 5BN5A 2KBNA 3ADDA 2GJAA 4LPSA 1ZAKA 4HIMA 2ZIAA 3LWNA 4EJSC 1O87A 3JVVA 3RWMB 1NJFA 3N70A 3NEMA 1TQ4A 3T1OA 4A0HA 3H0GH 4GDFA 5C4JH 4Q03A 4TMTA 4GNXC 4DNRB 1UBCA 1UBFA 2RGNA 3AH8A 4YCVA 4KLZA 5JHGB 1EOVA 3TGPA 3R9XA 2F9LA 3LA6A 4X8MA 1VF5C 5G40A 2EJFC 5KDDA 2QP9X 1XP8A 2QT1A 3REGA 4DAMA 2R7FA 5FJ8G 2GESA 2XTNA 1VQ8A 1TWGH 3PQCA 3X1ZA 1VQMA 1AH9A 2O8DB 2IWHA 1W0KA 5KOYA 2B3GA 1WOCA 3CCQA 1VECA 2CE7A 4NYJQ 5D3QA 4QGGA 5FBRB 2GK7A 4BFTA 4KU4A 1GIAA 4DUZQ 2D2CC 4DR1Q 3LW7A 2EU8A 2C78A 3GLHA 5CITA 1YVCA 4B3RL 2J41A 3AKCA 1KAOA 4NCIA 2AMCB 1SMXA 1LTQA 1SVMA 4DCTA 1Y63A 1ZNYA 5LD2B 4NU0A 1CXZA 4DR7Q 2BOVA 3F3YA 3MWYW 1JPNA 2IYVA 4D25A 1GD7A 1IONA 2G3YA 1K8MA 3QF4A 2B6HA 2A30A 1C1YA 2AX4A 3U58A 1X8JA 4TYNA 2WP8J 2GEVA 3PEVA 2UU9Q 1L8QA 2RGDA 2ZEJA 2B7BA 3AVVA 2CQOA 5KNCA 5IYDG 3VHXA 1KK1A 3A4NA 1GDDA 1NN0A 2GCOB 4P3YA 5EP4A 4ILEA 3DLLA 4E22A 3X2SA 1Q82C 4BXXH 2W58A 3ETLA 3QOFA 4CEIB 1T5EA 5IP9G 2OBLA 4HB0A 4CVNA 4OYHA 3V4RA 4QL3A 3L43A 1G7RA 1SFOH 3A7AB 2NQ2C 2VQEL 4NB3A 4ZKEA 4ZV4A 4DCUA 5EAYA 2D0OA 4JLAA 1SXJA 3QKUA 1ZM2A 4E09A 3J81j 4TL9A 1OB2A 5LMNL 1ONLA 1WA5A 2MSEB 3GJ7A 4R2IA 3CLVA 3T15A 1XDBA 1VCIA 3OOCA 4HJ9A 1ZC3A 4Q4AA 5GJBA 4PC7A 1IW7C 3U60B 4E03A 1HTPA 1YI2A 4QBFA 5TV2A 2GAAA 1I4LD 4NDZA 4D80A 5L3SA 1SRUA 3UDXA 3HU1A 4PAQA 3BFKA 2FEOA 4P0TA 1QG2A 4D4LA 2ZANA 1YNXA 2VLIA 1HA3A 2XB4A 3G5UA 2W0SA 4MUBA 4JI1L 4URUR 2OG2A 2J0VA 2QP4A 5J4VA 4GKJQ 1A1VA 1O78A 1GO3E 4JOIA 1NSTA 3RSOA 1Q1QA 2RGNC 1GKYA 3PG5A 4O25A 4Q4HA 1X3EA 1FP6A 1ZRHA 1E2IA 421PA 4C0LA 3ECCA 4DVGA 1LB1B 3VNUA 2KCMA 4H0LC 4KFUA 1X55A 3TEHB 1ZMXA 4NHOA 1VQPA 3Q72A 1RJ9B 3A1VA 3TNFA 4CGZA 1SMYC 1BKBA 1VG9B 3S17H 1L2TA 4WW0A 4DCNA 4YMSA 4HUQA 4BZPA 2JK8A 1E1OA 2JATA 3K0AA 2CVFA 2GJ8A 3CB4A 4PQRA 4P74A 2D06A 2ZJYA 4FMDF 5DYGA 2OCEA 2FE4A 5EP2A 3JZAA 3CCRA 1KD1C 2J1LA 1HJPA 1L2FA 4AYWA 3BE4A 1VYVA 3I72A 4HLDA 1T5LA 3BERA 2N3SA 4A3IH 1PH4A 1NG1A 4IVRA 4A0RA 3SHFA 1XNJA 4NXNQ 1KMHB 4I1VA 3PIRA 4IDOA 4OI2A 2K5VA 3NEYA 1GP2A 1E22A 4JLKA 5IP7G 5LDDC 4M9QA 4P32A 2R8RA 4B35A 4KYUA 2EWWA 4BA2I 5CJ2A 1J8MF 3ZD7A 1GL7A 1SVKA 3ZD6A 4MKGA 2ZS7A 3CZQA 3NHBA 4OQXA 3SQXA 1VQOA 2WWWA 4ZI3A 1M74A 1TXYA 1GL9B 1N6IA 2WAQE 1RW4A 4XH9B 1UAAA 2O8EA 1V9PA 1II8B 4GMDA 5FTMA 1Z9FA 1I2MA 4PQYA 4A3KH 5JEAH 4TYYA 1G4UR 4MGZR 2BMEA 4PSKA 5IT9c 2JLXA 2HXYA 3PITA 4C0AC 3LD9A 4B3RQ 3OE7A 4IW3B 3KQKA 1SZPA 1E9AA 4FN5A 1KAWA 1FUUA 1M34E 4GOPA 2F3TA 3LX8A 2ANCA 3B9PA 4LJ4A 1H9KA 3U3MA 4A82A 2YINC 3B2EA 1Z3IX 1IXSB 4LF5L 2AK2A 2KJQA 1YHBA 3CH4B 3S1AB 721PA 3GLFB 4PANA 2QE7D 4K8OA 5DLQC 1KDPA 1CTMA 1XMVA 1PVOA 3S15H 3HOXH 4O2LA 1E0AA 4LJYA 4KXFB 4A8JB 2BA0A 4AQYL 1N32L 2FPKA 4U7DA 4DV7L 2N1BA 4ZDWA 1G9XA 3LAWA 5G3YA 1F2UA 1GTVA 2Q3FA 5C4XG 4DAYB 4BFWA 1SE8A 2QEQA 1EFRA 5CDFE 2JA6G 1GSIA 4KFRA 3U3JA 4X8OA 2WWYA 1BO6A 1AKYA 1HZBA 1W49A 1Z83A 1LTLA 1MV5A 4IHQA 1BMFA 4YY3L 3GTPH 1DO0A 2ZSEA 5C44H 3A8IE 2H92A 3VR2A 1WYDA 3KKQA 1E2DA 2VQEQ 2AXPA 2PI2A 1XF9A 4TTRA 4V0KA 5DI9A 2ZQ5A 2HT6A 4GPTA 1IW7D 2PQAA 5FJ8H 1C9OA 1GG2A 1WDTA 1YRBA 1TU2B 2KI5A 1W46A 2QG6A 4Q18A 5HKKD 1UPTA 5GVSA 1IXRA 3BAFA 2QSZA 3I3SR 1DAKA 2EFHB 1QZXA 4MKIA 1VF7A 2KHIA 4M1MA 4BQSA 2ODNA 1JEDA 1VS0A 1HT1E 3TW8B 1LF0A 1XD2A 1KO4A 1G3UA 3HOYH 2Z6VA 1N5LA 3TK1A 4KAXA 2CW0C 4YDSA 5FLMG 1Z6AA 4GT1A 3JVUA 1DAGA 2WAXA 5KU1A 5BR8Q 3GJ5A 3I61A 3D3QA 2MSCB 2V1XA 2R62A 2VBCA 4G7HC 4JI1Q 2VA8A 4HUQB 3CR7A 5E7JA 3IEUA 3VHLB 1EIYB 2H5XA 1KXLA 1N0VC 3K0AB 1CU1A 1OH5A 2D5DA 2AD5A 1KI9A 2YOFA 4B71A 4KO8A 1SQ5A 4BFXA 1CI3M 4EJSB 2XSZA 5AJVB 1I4DD 3NH9A 1GILA 3ZVMA 2J0UA 4MRVA 3F0TA 5EP1A 1GKIA 2PBRA 3A4LA 2MO0A 1QZHA 1U9IA 2ZVQX 4RD2A 2GWHA 2DPXA 3KF8B 5BW8A 1ESMA 1KIMA 5C0XI 3EIQA 3PV0A 3TREA 3B78A 2QAGA 1E0KA 4Q9IA 3NEJA 3THXB 4DV5L 4BBSH 5AUQA 3THWA 4GP7A 3CCJA 2GXUA 2OBMA 5C2JB 5J4LA 2O8CA 1UKVY 2AKYA 3HOWG 1ELOA 1M7GA 1U8ZA 1RPZA 1W2GA 3ZIAA 1D9XA 3V4FA 3ND8A 5FOVA 2PJZA 4RD6A 2IWRA 2KHJA 2WAQG 1VQAA 1R9TH 4AC9A 4B43A 2IS6A 1JR6A 4IFDI 2FU5C 3AF3A 3VU9A 3B9QA 3VDYA 3HU2A 4AIMA 2A6EC 1N6RA 3CQZH 1XCGB 4XVQA 2JJ2A 2BCJQ 1E2JA 4TLDA 5JRJA 1KO7A 3U6KA 2WKPA 2XJ4A 3IO5A 4CT5A 3A5UA 5JWRA 1AQYA 1RYFA 1VMAA 2P6NA 3X1YA 3NWJA 3K0CA 3KQHA 1US8A 4WZAE 1CKOA 4D0LB 3PCOB 4L5RC 2HF8A 5AUOB 3U7HB 5E7NA 3D8BA 3E0EA 4HDOB 4QL5A 2EQSA 3TSZA 3CX6A 3E5HA 3GJ6A 2LWIA 5HE9A 1QVAA 3FKIG 1KJZA 2FN4A 3EWAA 2Z6KC 3UDFA 1D8LA 2YWFA 1W4BA 4TLEA 5A4JA 5EE5B 2Q2TA 1GVPA 2GHIA 5J4KA 1KI8A 3DOFA 3EC2A 3IBGA 1N32Q 3VNVA 4DV7Q 1W4RA 5HCIA 4EQ6B 1Q1EA 4B3GA 3GLHE 1VTKA 4LHYA 1G4AE 1MKYA 2VHCA 4KBGA 1JMCA 4GP6A 2V1UA 2ZJRA 3HOUH 3T34A 2WSSD 1TKWB 3H94A 2GN5A 4A4DA 1G51A 4A4IA 4YY3Q 2QZ4A 1XD2B 3I8XA 3ZZ0A 8OHMA 1V43A 1O3YA 4UJ5A 2F55A 4IOCA 1EYGA 4B3BA 3RHFA 1LV7A 2O52A 4WAUA 2F1HA 1D2MA 2EYQA 3TJZA 2ZJ8A 3CF5A 3AUXA 2A9KA 3KKPA 1DD2A 3M3YH 2OTLA 1HQYE 1NLYA 2VQFQ 3HU3A 3NTUA 1D6JA 4IVQA 4TLBA 2EFGA 3K70C 2O5IC 2JE6I 4OI1A 1W1WA 3KKMA 2QMEA 2CJWA 3FYHA 4JKYA 3J81c 1T8TA 1W0JD 4FD2A 1CKNB 4C0QC 4Q1AA 4V0MA 4KN7C 1E9SA 1HV8A 4A3DH 4K81B 1DS6A 4NYIQ 3T51B 4ZDIA 2VP9A 4G5GA 3MG9A 4X65L 1DBSA 4A0FA 2G0NA 1SXJE 3NG1A 5LMUL 5F2EA 5FBQB 5FL3A 2E74C 1XTKA 2RGEA 5LB4A 621PA 4PX9A 1HNXL 2ZRKA 4ON9A 2JAQA 1N25A 3WYAA 4D4MA 1XZPA 3UG7A 2CWAA 3GLIA 1F5NA 4IPDA 1W2HA 2J9RA 4HYYA 5C4XH 1X54A 1G41A 4JLMA 1IY1A 4PZ7A 5G3ZA 4C9BA 2QF7A 4KFSA 4CEHB 3IIMA 2O8BA 2H5EA 1M6NA 4JI7Q 4PPQA 2R6CA 4RCYA 1A8VA 2WMOB 1Q3HA 4PXAA 3PO3G 1S3OA 4TKOB 2K50A 2O0JA 1K9MC 3MSXA 4ACBA 4LBZA 2CNWD 1I6VC 4DV6L 2ASEA 3AUYA 4Q1BA 4JI8Q 4DV5Q 4Z51A 3I92A 3FDIA 5F98A 2NZOA 2DUDA 4HAWA 1VQDA 1OFIA 1JR3E 3CZPA 4PC2A 2OBNA 3K1JA 1XU4A 4A75A 5JEEA 3ER0A 3R7WA 1G7CA 2A6ED 3WNDA 1SLJA 3SR0A 4ZDKA 1QHXA 2ZUBA 5SZJA 1TU3A 1Q57A 1CJKC 3V00A 2JDIA 2BEKA 1X6VA 2D4HA 4NCNA 1XNQQ 3TVTA 4UXHA 1KDRA 1T5IA 4B2PA 2C9OA 3B1XA 3LQQA 4DV2L 1SHZA 1ZJ6A 4I1UA 4QBHA 1XEWX 3VR5A 2R92G 3W8RA 4PAMA 4MA4A 2BM1A 3EG5A 1HQCA 2REBA 5M5XH 3W3AA 3CIOA 3KFXA 2RAPA 1P9RA 2CMKA 4ZCMA 4JBMA 4LDJA 3FFBA 5KSYA 1IY0A 3S16H 2PEZA 4A3BG 1A2KC 3PO2G 4Z54A 3GTKH 2XZPA 3D7MA 3ERSX 3KFVA 3MJRA 2QM7A 4FCVA 4Q48A 3OZXA 3CPEA 3KUCA 4HB4A 2RGGA 1FL0A 3H86A 2OFOA 4QQBX 3QVUA 2MSDB 1WJJA 2I1QA 2CL6X 2J0SA 1N34L 4C2UA 1T4GA 2WWFA 4AG6A 3KJGA 5IE8A 1YU9A 2X77A 4NZYA 5C18A 4DKXA 1PJRA 2AWOA 1JJ2A 1T6NA 2BKEA 4IDPA 1GUAA 3RS0A 4YLGA 4DHEA 5DI3A 3RWOA 4KSBA 1YJ5A 5SZKB 1E9CA 3JZMA 4OHXA 3IDQA 1Q12A 1HNWL 2XZOA 4JV5L 1KI4A 3CUEF 3ASYA 2BM0A 1VQKA 3I55A 2W83A 1G6HA 3P4YA 5DHFA 4B74A 1E1QD 2FFBA 3NBYC 2OQKA 1TU4A 4B3ML 1R10A 1GUOA 1QHHA 3GTLH 1LACA 1COWD 1XD8A 1XJQA 1Z7TA 1P72A 2W6JD 2AUKA 2G88A 1KC8C 4DB4A 1U81A 3LV8A 5BN3A 3Q3JB 3ND9A 4NTZA 3G48A 2RGBA 5CJPA 3K0SA 2EQBA 4UKDA 1UFQA 4TQ9A 3SFVA 3TLXA 2VHUA 3U3RA 4NPSA 4LJZC 1ZD9A 2C5LA 2GVDC 1TEVA 2VL6A 1SROA 4IPCA 5IYBG 1G291 3LGJA 4QJFA 1YZUA 2PMKA 4XVRA 4X65Q 2PI2E 5L3VA 5K36H 3FHTA 4Q01A 3AFPA 1E9FA 4DV4Q 1Y69U 2K52A 2CK3D 4PO9A 2O8BB 1T9HA 3LX5A 1OXUA 1P2TA 2IK8A 5J47A 1X65A 1XTSA 2ALYB 3Q7PA 2R6GA 3T1QA 5AUNB 4X8LA 4JI5Q 2J7PA 2W6IA 4URXR 5DH9A 2BWJA 3I5XA 3OAAA 2C98A 4JVLA 5HGQA 3T61A 2JA8G 4GN3B 2HLDA 1W36C 1G3MA 4C3JH 1DOAA 3PGZA 3QY0A 1Z22A 2WVJA 3QXCA 1U98A 2DBYA 2JJ1D 2B8FA 2E75C 3OW2A 3HYRA 1PH6A 1FQJA 4JSYA 3EWSA 3H3VH 1GHJA 4QOSA 3CMAA 4DR4L 1AGPA 2UUAL 1JAIA 1W48A 4RFVA 4C0KA 3KTAB 4TVAB 2JLVA 4DV6Q 4NE2A 3P27A 2Q9CA 1E9RA 3AP2A 4LF9Q 4HSEA 4LWCA 3H0GG 3S2DH 3SYLA 2I5MX 5TDHA 1VQEA 1IBRA 1VQCA 1S0UA 2DN8A 3EZ6A 1P9WA 2IUTA 3K53A 4ZCLA 3UIEA 4AIIA 4DSTA 2C04A 5JI3E 4PO8A 3K7UC 1G6PA 3PR1A 1TUEA 4BUJA 2F6RA 4AURA 4B3SQ 1P75A 4FMCB 2P67A 4JT4A 4KBFA 3WBKA 1YJWA 4HAZA 3VAAA 1I5FA 3BGWA 4LRWA 4XTCS 2E8GA 4DK3C 3TE6A 3AVYA 1NI3A 4LJ9A 5E7IA 4DV2Q 1LY1A 1S9DA 1XTQA 2B21A 1LNZA 2QRNA 4HB2A 2EFEB 3AV0B 1XCPA 1E2VA 1ZW6A 3KKOA 1YHQA 1KSGA 1UE7A 2ZROA 1VQIA 3TIFA 1YE8A 4C7OA 3WP1B 3I62A 4A3GG 4RSGA 4XSHA 3PEYA 3IKJA 1K3RA 4RZUA 3ADBA 1N33Q 4R4TA 1S3SA 3U44A 5F9HA 1L1OC 3F2BA 2BDOA 3DZ8A 1M7HA 5LMNW 1ONBA 2BMDA 2YNMA 4MRNA 3EIVA 2UZ3A 5K8LA 2Z83A 4LUCA 2XXAB 4CIDA 3BU2A 2RCNA 5FR2A 4YQFA 2HUPA 5GVRA 4DLWA 4DIDA 4LHVA 1N34Q 1TWAH 3P20A 3CCUA 3WRXC 4HJ5A 1KY2A 1WB9A 5D3MA 2WJJA 5K8UA 4BXXG 2P2LA 3VQTA 2TMKA 4CW7A 3ZH9B 3BFXA 2CEAA 2H18A 3WNBA 3IRBA 1UJ2A 4JBXA 4LUOA 5TMPA 2F3RA 4W7SA 4OONA 1EFHA 2OCPA 1UEJA 4JV5Q 2ZRMA 5DO9A 3SBEA 1MOZA 2ZRPA 4G5QA 3RRYA 1KI2A 5H8WA 1N5KA 2QA5A 2NO1A 4A2PA 1WRBA 3EARA 3MXNB 5TARA 4C2TA 3H2YA 5AJWA 3ZJYA 1RE0A 4Q00A 4G7ZC 1W5TA 4D82A 3W1BA 1G21E 3WBJA 2LXKA 3IUYA 4LFAL 3CRLC 4A3CH 2VHQA 4ZCIA 2JEBI 5GAHC 1J90A 1OF1A 4DR2Q 2UXBL 3DDCA 3SU8A 3B6EA 2YYZA 5IWAL 1QHSA 3HPQA 1H9JA 2PNHA 4LPKA 4M8NE 3BZKA 1YBYA 2VSFA 3SNHA 2O8DA 2ZJQA 1NJIC 3LO5A 2PPBC 3BRWD 4DUYL 4FCWA 4QBGB 1FJGL 3C4JA 1NVVR 2HEIA 4GOKA 4YMUA 2D0PA 1IZ6A 2E2IH 3CO5A 4OO1G 1P5ZB 1PYSB 3OESA 4LSGA 5FUYA 3I5YA 2ZE7A 4B2LA 1C7YA 2VYFA 4JKIA 4KV9A 3RS7A 4XD7D 5EUQB 2FG5A 1DEKA 1R6BX 1XMOQ 4RY2A 2IS4A 1JJ7A 1YEZA 4GRAA 5JMTA 3LQRA 3FKSD 4GMXA 2GILA 3KYHC 3PF4A 3N6RA 3S2HH 1OSNA 2E87A 1DG3A 3KKNA 4V0ME 1CSPA 4HR7B 2ZU6A 5BWMA 3TUIC 5K8IA 2VSOA 4P73A 2ORIA 2ZRDA 1VQHA 1PUJA 3BH7A 3BDOA 1UADA 2A5FA 3RLFA 1YNNC 1Y1WG 2JA1A 4RZXA 4Q1DA 3GD7A 4BLPA 1L7VC 4LNQA 2GNOA 2UUAQ 3RN2A 2D2FA 2GCOA 3QXXA 4YMTA 2NN6H 4A3IG 2Q0HA 3W3ZB 4CEIA 4EPTA 1FTSA 3NBZC 4IOMA 4CDGA 3EPKA 1XXHB 3A1WA 3B60A 1TTTA 1S72A 1A5TA 2ZJAA 1ZU4A 2IYSA 2JJ8A 4TT3D 4AYXA 4J15A 1A7JA 4DV1L 1SN8A 1KK0A 3R20A 2Y8EA 3TS0A 2OSBA 4BEBA 1TQDA 1OHHD 2H8KA 3NDPA 2ORWA 4HIKA 5DGXA 5IYBH 2JLRA 4IVPA 2ZRLA 4QKQA 3J81i 1HTWA 2L0XA 3DPUA 5H1SE 1G20E 4EDHA 5LB2A 1OIWA 2PMDA 2W2TA 4XOIA 4M9SA 2G1JA 3MGCA 4HJ7A 1SR3A 2RHSB 2FPMA 2FZ4A 1Q3TA 4OK6A 4A3KG 5JEAG 1KK3A 1E32A 4DNTB 4L8JA 2D3WA 4X8HA 1E69A 4A3FH 1E99A 2W00A 2K75A 3GJXC 2ATWA 1N8RC 4A76A 3J7A5 3NXSA 2FFQA 3KOJA 4DLYA 3QXJA 1K83H 1Z8FA 2CE2X 5D3MB 1QVFA 2QE7A 3J7ZC 5FFMA 3NBXX 2ZRJA 3Q7QA 3RC8A 4URZR 4R7ZA 4TZ0A 2GCNA 3L82B 4P4SB 2A78A 1G64A 3FVQA 3TW4A 1HZAA 5B64A 4YONB 2FOLA 3M85A 2ZXUA 1FZQA 1FMJA 2WWIA 3MLEA 2E9SA 3PENA 4PHTA 5AUPB 2VZAA 3EASA 2IS1A 4YCUA 1RJ9A 3E1SA 1UE1A 5JS7A 3WDNA 2ANBA 4TZ6A 1VG8A 2GXQA 2BMJA 4DV0Q 4DK1A 4DV3Q 2ZI9A 3CKLA 4X66L 1Z0FA 2VL7A 3LW8A 3JAMc 5C44G 3HOVH 1OT3A 4PPGA 4WBSA 1NIPA 1RYHA 1E9EA 3GLGB 4LV5B 4QGHA 2Y0SE 1YKSA 1ZD1A 1OPXA 1SKQA 3DKVA 4UXJA 4DLRA 1IBLL 2RHDA 1GNQA 2I4IA 2R9VA 3U7FB 1XEXB 5EP3A 1VCMA 1KMHA 4UP8A 3L2OB 2PX3A 2IYRA 2WJHA 3AQQA 4Q4LA 5G41A 3KQUA 5DIFA 3KB1A 3RANA 2IHBA 1P2VA 2BE5D 3S1QH 1ZNXA 2IF0A 2ZUCA 3LVQE 3U4QB 4GI7A 1K8OA 3HOYG 2NOAA 3E2IA 521PA 1FP7A 3SFZA 3W34A 4DRZA 5A5GA 2P6RA 5J5CA 1I3QH 2ZVPX 4A3GH 2GRJA 5IWAQ 3GO5A 2FGJA 1D2NA 4LX0A 4UXIA 1Z5ZA 4H1VA 4HDQB 2N8NA 1E2PA 3CW2A 5FTJA 2CCGA 3G6EA 1HNZL 4NXML 4HIDA 1FJGQ 1II8A 2EXDA 1SULA 2WSMA 3EZ7A 4JLDA 4PPNA 5FTNA 2A68D 1EWIA 3U4VA 1R0XA 4NYMQ 1LFDB 4RKEA 2MMGA 1MABB 2VEDA 3UMFA 4GNXB 1XWIA 1ZNZA 1FX0B 1G5RA 1PFSA 3TQCA 1QRAA 1Q22A 1P8LA 4QNMA 3EQLC 4LF6Q 1U8AA 3ZS8A 1NN1A 4QRHA 4TLAA 3UATA 2OCYC 2WJVA 3S1AA 1C9KA 3U3KA 1P2SA 3EX7C 3GLFA 2ZRBA 4B3TL 4B3XA 2DWOA 1E2GA 4AH6A 3K80C 3GEEA 4A8JA 2J5XA 3ADCA 5L3QB 3UDGA 2N42A 2P0EA 4BBSG 4OX9Q 1DCZA 1XEWY 4JMPA 1EUJA 2AKWB 4OXPA 2FZLA 2ZREA 3I4OA 2B63H 4KYIB 2NG1A 4B34A 1DO2A 4TMVA 4WZ6A 1YJ9A 2WBLC 4PC6A 4GSYA 2L5TA 4HB3A 5AJYA 1HE1C 3FB4A 1MIUA 4C0SA 1JECA 2VUMH 2K5NA 1GNRA 4FINA 5KHOC 4PAOA 3SJAA 1Y14B 1MO5A 1GFIA 5HZKA 3DXJC 4A3EG 1IY2A 3SI7A 4TYQA 4U5XA 3L7ZC 4IDNA 5FBVB 1R0WA 4PHHA 2VO1A 4US0R 1NVWQ 1GUNA 1KYIA 4YXWA 4Q47A 3W90A 2GA8A 3KB2A 4OO1H 1JEEA 3THOA 3OEHD 5M5WH 2G0TA 1PMRA 1VQ5A 1LM0A 2CLSA 2K5HA 2JXMB 1FQKA 2GK6A 1JR3A 1ZBDA 1KHTA 4YMWA 3OPOA 3OEED 1Z2AA 5CLLA 2GBLA 1PH1A 4KKTA 2V9PA 2ZS8A 3M0EA 3HGBA 3KXLA 4Q7LA 2KBEA 3OHMA 2WIAA 3OFNA 3ICQB 4A6PA 1J7KA 3EIEA 4R98A 1TQ6A 4PZ8A 3THYB 3HKSA 5BQ5A 2J7KA 4HJAA 1Y1WH 3U2QA 1O7LA 4RCNA 1XXHE 1M7BA 2Z5FA 4DLUA 5B30A 4JBWA 2DY1A 1DAEA 2IYTA 2QTFA 1T91A 1HURA 2WSSA 3K09A 3W6OA 2DNEA 1NBMD 1J2JA 1B9NA 2Y0SG 2QT0A 3HOUG 3F5FA 2D7CA 1WQ1R 4ME3A 2FSIA 4IFEA 2JEAI 2E2HH 1OKKD 4EKDA 4KMUC 1NLFA 3BOSA 4G5RA 1Q8KA 2XGJA 3FPPA 3THXA 3KXIA 5FL7D 4X62L 3E70C 3J81k 2IHFA 3QIAA 1BVSA 1HZCA 1IBLQ 2NPIA 3QQ5A 3LRPA 5CYPA 5C4GB 1M8PA 2HDNB 2OCBA 3P26A 3I1FA 2LKDA 2I1VB 2D7DA 4YWKA 4L5QA 1FFHA 1FUKA 4JI3L 1E2LA 1W0JA 2IXGA 2ZYVX 4MRPA 4P33A 3ZVLA 1ESNA 3RR5A 4BPBA 1GOTA 2F1RA 2OWOA 2E1RA 2EWVA 1Q90A 2BBSA 1UM8A 2QL6A 3VR1A 2Q2UA 4ASUA 3L0OA 1G16A 4A3DG 4DZZA 4QG7A 1AS0A 5FTLA 4I1OA 1IN7A 3AVOA 5DISB 4URVR 3QPVA 1SXJC 3ZGXA 1GRQA 3CM0A 3I4MG 1M90C 1HPCA 1FNMA 2A5DA 4TQUS 4FCTA 2Q2IA 3VFDA 1VQ9A 4PTLA 2QP3A 4D0GA 4ZI2A 2FDCA 5F9FA 1HNZQ 1CEEA 3BXZA 2WFWA 2QPAA 1G3QA 4NPHA 3F2DA 2GXSA 1E2ZA 3T1TA 1MO4A 3GLGE 1LABA 2KCTA 1H8HA 3TBKA 3H4MA 4EUNA 4UY8C 1NMYA 3AF0A 4JJZA 4BZXA 4A36A 2HQLA 1Z6YA 2QMUA 3E9IA 1PV4A 1XJVA 1NP6A 3FPAA 4JLJA 4APVA 1ZC4A 4JOIC 5EUMA 4BECA 2CNWA 1UEBA 2XNDD 4XWKA 4DSOA 4BA1I 2B29A 4TN1A 2PMZE 1N6NA 3KQLA 1A4RA 2C03A 1SGWA 2VF8A 4EQ6A 2QRZA 3ZQ6A 3OIWA 2YV5A 1FTNA 2BJWA 2HXSA 1EK0A 2RHMA 1I2DA 4Q02A 5LMNQ 2IHEA 1KO1A 2YWHA 2EJGC 2F7SA 4OKSA 2JLUA 4IRUB 1Z63A 1KO8A 2CHVA 2PLFA 2WJIA 1TWHH 1TADA 3FMOB 3LBNA 2A8VA 3GTQH 3QKRB 3FE2A 3EZ2A 2BCGY 3B1WA 2A6HC 3MMPA 4KVAA 4RFSB 3A5ZB 1Z2CA 4W5HA 5HPYB 3K8AA 4OHYA 2HJVA 4G7OC 5J40A 2R6DA 1ZU5A 5CB6A 3RAPR 5M3FH 3IILA 2H16A 1L4UA 1U0HC 2WIBA 2QQEA 1R8SA 2IYUA 5UKDA 3RZOH 1AZSC 3AF4A 2HV8A 2OFWA 2JLZA 3GFTA 1E2NA 5JBQA 3AB9A 3BZCA 2V4DA 3K09C 5CB8A 2I5HA 4JBJA 1F2TA 1PH8A 1ZM4A 3I56A 2QNRA 3GFOA 4M2LA 3UANA 5EE9A 5BN4A 2GVZC 3O47A 4LHXA 1CKNA 2MQHA 5M5YH 1G8FA 2BH8A 2UXDL 5CIWA 1ZIPA 1XPUA 1W0KD 1Z6XA 2ZU0C 4JYCA 4EJSA 3N2EA 1G8YA 1UE6A 4GLAC 4Y0VA 3A1TA 4U00A 2B92A 4Q9LA 3N2IA 2PX0A 3ZVRA 3THYA 1ZKOA 2XZLA 2JJQA 1G6OA 2CBZA 2FWRA 3VTKA 3FHOA 1TF5A 4OWXB 2E76C 1K8RA 2X1VA 3C5HA 4LJ8A 4NL4H 2H57A 3DM9B 5SZIA 3T35A 5GADl 3HR8A 1FNNA 2ZM6L 5CLQA 3X1DA 4TYPA 3G82C 1H9MA 2EJMA 3SGIA 1HH4A 1S1MA 1FPMA 4OO1I 1VQJA 4GOPC 3IHWA 3AFQA 2G9NA 4IEIA 1YZNA 4CEHA 1EWQA 3CMEA 2CDNA 3GJ3A 5BYKA 1OB5A 3IEVA 3A7LA 4IPHA 1YQTA 1E24A 2HF9A 2Z0SA 3A58B 3FMFA 1DGSA 2FJUA 4O0AA 1BKDR 2QGQA 3CPFA 1P2UA 3MWJA 3S24A 2QU8A 2WPDD 1COWA 4IEEA 4L16A 4A3EH 121PA 1GVNB 3RNLA 3BG3A 2W6JA 2QBYB 1H9RA 1U94A 2FXQA 4L5TA 3CCVA 2IF2A 1X8KA 2Z4SA 2C99A 4RKFA 3HOZG 3BB4A 3ICEA 1B0UA 3LDAA 4WXRA 2RGXA 3MJHA 1NMXA 1SXJD 1R7RA 1GRRA 5AJ3L 4EFNA 3TUZC 5J4YA 1OXSC 2OHFA 3T5GA 4B48A 4YHHL 2QENA 3SJZA 4I1SA 5K36G 2A1AA 5C3EH 1YZTA 2DR3A 3IQWA 4LF5Q 1AA9A 2A7QA 3LXXA 1IXRC 1E1RA 1Z0JA 4NYJR 5EE0A 4EPXA 2NO6A 4QGUA 2NTYC 3A0JA 5KTYA 4Q7KA 4Q7MB 4D81A 2HT1A 1NF3A 3MWKA 1UDXA 3QPUA 1FW6A 4AQYQ 5EXXA 4M22A 2F4VL 4KKSA 3U9SA 4MNOA 3CRQA 3A36A 4ESHA 4AD8A 4H1UA 1DADA 2ATVA 2QAJA 5IK2D 2A5JA 4OQFA 1NVUQ 3QEOA 5FBWB 4B6EA 4ZPXA 1MJCA 1UWVA 1E2QA 1B23P 1OJLA 4QIWE 1AJEA 1R4AA 1GM5A 5HTKA 3CRMA 3TKLA 4OHWA 1N9WA 1DAIA 4BFUA 2EVWX 3JAMi 3KJOA 2E2JH 2BH2A 2NVXH 3S1RH 4JYAL 4MKFA 4DLXA 2A6HD 2UXCL 5FPKA 3GPLA 2GF9A 4LBWA 4LWZA 3QNUA 3WHKA 4KI0A 1F2TB 2QGZA 1RIFA 1U9IC 1A62A 3PXGA 3W8NA 3PFIA 3AEZA 1M1YE 3GLFE 4H44C 2QAGC 4LF8L 3T1YL 2K4KA 4JI2L 2KBFA 3WMEA 5GADC 4MDFA 3C8UA 4LHWA 4YMVA 4MRSA 4JLPA 3I4MH 1IN6A 2DFLA 2B8GA 2KWIA 5JSZB 4DT1B 1SVSA 4QM6A 4LYHA 3STBC 4PV1C 4FI3C 1UKYA 3X1WA 1YITA 5IT5A 5SZHB 3C41J 3NKVA 1VQLA 4OQNA 4JL6A 4LV8B 4FWTA 1XMQL 1Z0AA 4QM7A 2UXDQ 1OTCA 2X8AA 3HP1A 4MUAA 4O2DA 3SEAA 4DLVA 4ZDJA 2JLYA 1TUIA 1H9SB 2B8TA 1QG4A 3ULPA 3CNLA 4FMBB 4C0BA 4KKUA 4EIWA 3W6PA 3IFTA 4DLSA 4IO9A 3MXUA 2XOKD 2DB3A 3NDBB 3OE7D 2JLWA 5J4HA 1VQBA 1PH2A 1HR0W 1NY5A 4MRRA 2XITA 3A8JE 2W0MA 3K0CC 4DUGA 4L8GA 1W44A 5CK5A 3SN6A 2J45A 3WMFA 2IC5A 4CEJB 4JCVE 4HAYA 5DLQE 4F91B 3F1ZA 2D2EA 3BB3A 1K0RA 3M9BA 3O8CA 3W9YA 2H17A 2OCAA 2XNSA 1IBML 3TSWA 2ZI6A 3BK7A 4S2EA 4OI0A 1QZGA 2GTPA 4JVMA 3A1SA 1R5NA 3EPHA 5H1YA 3CF2A 2NO0A 1PA6A 1D5CA 2ASBA 1FYCA 1KDTA 5IY0A 2JIZD 3KTAA 4FDBA 5AK0A 4EFLA 3B82A 4P4UA 4F92B 3PIPA 2R44A 1DG1G 5G53C 1G8GA 1A0IA 1VG1A 5FPHA 4A3MG 4IOJA 1MT0A 1S3GA 2ZR9A 4LF4L 4A3LH 4DSUA 1EFTA 4A3CG 2DFKB 4GFDA 1NIJA 3GFPA 1NMFA 3AM1A 2QQ0A 1Z6TA 2ZT9C 2PZGA 1NTGA 4DDTA 3M4OH 2CHGA 5JWOA 1O7IA 1OYYA 221PA 2WMNB 1A82A 4FWIB 1ZP6A 4F38A 3QG1A 2JA5H 4YHHQ 3EPLA 3U4ZA 1IOZA 2R6FA 2EDGA 2DGYA 1YZKA 2A5GA 4MGYR 4EAQA 4PFSA 4HUTA 5FOXA 1U8YA 3EBEA 3TRZA 1EX6A 1XD9A 2ECKA 2AUJD 1RZ3A 1XZQA 1GUGA 2VRWA 4QBIA 4DLZA 4PZ6A 4URYR 3PUVA 4UNNA 3TVDA 4NCJA 4CRWB 2IXEA 3MCAA 3WYGA 4CF7A 2GKSA 5GJCA 2F4VQ 1UKZA 5GQOA 4IKEA 2Z4RA 2GJKA 3P32A 1VCNA 1Z28A 2V8OA 1WCMG 4UNPA 5FUVA 4RCZA 3PUWA 1YHAA 4OL0A 3AVTA 2WTUA 4JZKA 2XXAA 1LF5A 1A6XA 2RKOA 2QTVB 3PF5A 4JI0L 3O8BA 2G83A 4LY6A 2CL0X 1J99A 4JYBA 4PZZA 2OAP1 3K70D 1GRNA 5HCNA 1BIFA 2NN6G 1X3SA 3ZDQA 1GNPA 3VR3A 1VIAA 2GXAA 3W5OA 4GZMA 2A3RA 4H02A 2UXCQ 5FI1B 4RD4A 3EN2A 1HE8B 3HOZH 2GDJA 4R4CA 3NENA 1KK2A 3GTGH 1FGUA 4I99A 2OLKA 1E3MA 3RYTC 4D2IA 3BB1A 4M1OA 2RMKA 2O5JC 4LF8Q 3RRMA 4JI2Q 3D0FA 3T1YQ 3KJEA 3L0PA 1YZ6A 3ZIAD 1E79A 3KDFB 1G5TA 3R8CA 4ACAA 1E0SA 2BIFA 2OFXA 2AFIE 3QXSA 2JGNA 4Y0AA 2PCFB 3D6TB 3CRW1 5LMUQ 1OW3B 4HLUA 4IOLA 4IOKA 3RABA 3LWUA 1HNXQ 4A3FG 3R9IA 2GZHA 4JVNA 4MKHA 1K73C 2HIXA 3LBHA 1XX6A 3NBFA 1HH2P 4LJ6A 2XTMA 4V0OA 4F7WA 3SHWA 2BHRA 2JJ2D 3WRYC 5EXTA 4XWOA 2E5LL 1VHTA 5LPNA 1QF9A 1XEFA 3I2ZA 1ZIOA 2ONJA 1E0JA 2OV2A 4GZYC 2PZFA 1KI3A 1NY6A 3HWSA 2CLDX 4A93H 5EE3A 5EXPA 1OIXA 3DM3A 1WBBA 5GJWC 3OIYA 4HAVA 2NZHA 2HHHL 4CYMA 4BFYA 2JEOA 2ZSFA 3CC2A 4D0NA 4BLQA 4OHZA 3GP8A 1IHUA 2WKRA 1TL7C 4O2RA 2XB2A 3QUSA 1I50H 1N36L 3KXKA 5CM9C 5FPSA 4B3DA 3U5ZB 2YKGA 3RS5A 2ZRGA 3EIHA 2QPOA 3QKTA 3T1HL 1UF9A 3KJIA 1F48A 5M3MG 2OESA 2FNAA 1R8QA 1NE3A 3HOVG 4N1AA 1T3SA 2NZJA 1IBMQ 3T1VA 3UDIA 4NH0A 2BDTA 1XCMA 2X19A 3R9WA 2ZJ5A 2ZTDA 3AVXA 3QSYA 4MZ9A 5FTKA 4DDWA 1QVCA 4POFA 4GN5A 2HIVA 4P75A 1OFUX 1Y1VH 3MFYA 2F1JA 2IYLD 3F8TA 3CR8A 4PMWA 3TMKA 3SBDA 4S35A 1B8AA 1NKTA 1S96A 1XXHA 2C2HA 4TMZA 3A37A 1LUZA 4LF4Q 1ZNWA 4E5UA 1W4AA 4MYHA 5E4FA 2N46A 4O3MA 1QHYA 1B9MA 1Z07A 3AEVA 2IBMA 1CJUC 2YWEA 3FKQA 1QHGA 4YWLA 2F1MA 2Q21A 1Y8NB 1VYUA 5KSPA 2XTIA 4TL6A 3EPJA 2ZI7A 2ODWA 2PL3A 1EG7A 3SE0A 3HFZB 1AK2A 1VCOA 3NC0C 4L9WA 1LW7A 2AD1A 2Q9BA 1T3HA 1JNYA 2KSQA 5DNYB 4URWR 4BLTA 2ATXA 3IBYA 1QJOA 4R1JA 4AWXA 4LV6A 1CRPA 2I5LX 3EA0A 5AJXA 1CTQA 1RIPA 4P4SA 4F4CA 1HNWQ 4JLNA 5KSZA 1CRQA 3VKWA 4RG1A 1MRSA 1GZSA 2ODBA 2ZR7A 5JLJA 4JI0Q 4B47A 1KZGB 1N3BA 2OE2A 5GAEC 4HZUB 2B63G 2KA7A 4B3MQ 3GQBA 1VQ6A 1ZUHA 3QF7A 1YJNA 1HR0L 3EC1A 3L8ZA 4A3MH 5DN6D 1W36B 1XMSA 2VUMG 4KLNA 1KHIA 3GLGA 4JSTA 5EQTA 4B76A 1L1OB 2GAOA 5IYCH 2VTKA 3W6NA 4RD0A 3WP0A 5JECA 2YOGA 5F3WB 4GL2A 2ZM5A 1II9A 3TAHA 5FLXc 5C0XJ 1XEXA 1HCZA 4XJXA 2CCZA 1W47A 4O0MA 4GBMA 5CIQA 3OEHA 4L15A 4LFCL 1Y8OB 3KZ1E 4AYTA 3CCLA 1H8ED 3U4QA 4A2QA 1Z47A 3CPJB 1CULC 1F60A 1OE0A 4V0NA 2PNRC 1CR4A 3ULLA 1WXQA 4GOXA 5IRCD 4IXNA 4LW1A 1CP2A 1XTJA 1W36D 1F6BA 4MQBA 3VKGA 2E5LQ 1VQ4A 4HDCA 4NYIR 1P73A 4DDUA 1GUSA 1WCMH 3CPHA 4W5JA 1X56A 2GZDA 4OK5A 1DE0A 4B3FX 3ZLJA 4DEXA 2ID0A 4IFDJ 1YHNA 5L3RA 4PG3A 1Z08A 4QY7A 2IX1A 4M53A 2HHHQ 4R71A 1MO3A 3AB3A 4PPFA 2X2EA 2X2FA 4P72A 1CJMA 1MABA 4G3XA 3AP1A 4DBLC 4GNXA 4JLBA 4ZIRB 1BYIA 4HIOA 3QE0A 1FX0A 4I81A 3SYKA 5KO2A 1SKYB 2J59A 4DR4Q 2V7QD 1YNJC 3QKSB 1A2BA 3QG5A 2GETA 4OJQA 4BY7G 3DOEA 4MYTA 1OKKA 2QN6A 3T1HQ 1VDZA 5JCPA 2QROA 5E7MA 3SS8A 1IBKL 4B75A 1YVDA 2NIPA 1E6CA 2JLSA 1Q20A 5L3QA 1TQ2A 2YTYA 2C96A 1ASZA 2NPFA 4ESVA 1PLJA 3KUDA 1ZD8A 5DYIA 2ZSDA 3Q9LA 1NVXQ 4TLCA 3Q5EA 1ODFA 1G5PA 3RSLA 2WM9B 2XAUA 1OH8A 1NJGA 2EVBA 3H3VI 4EQ5A 1KI6B 1V5WA 4D26A 3NC1C 4HAXA 3U61B 5K8TA 2Q8IB 1CIPA 1Z6HA 1II0A 3AKYA 4JBYA 2IX3A 1OLOA 1IYUA 2A2ZA 1KMQA 1H95A 4A0GA 5KNBA 4GOJA 3T56B 1IN5A 3K9GA 3PVSA 4ABYA 2FGKA 4AI6A 4IJLA 3PUYA 1KKLA 2K5UA 1JXMA 2C35B 1CKEA 4JK1C 4Q4JB 2AFHE 3ZJYC 1T8UA 3U7EB 1UBEA 2QUZA 4LCBA 2JA9A 5JEDA 2KB0A 4GZLA 2QORA 2CKZB 4GKJL 2CXXA 4LYAA 3K0FA 2K14A 1IQPA 3MWLA 1NRJB 4N3NA 2AN9A 4WVFA 2CHQA 4NBSA 3CCSA 2RGCA 1XNRL 3LLUA 4KN4C 3SOPA 3KFUA 1C4OA 4DB2A 2AHOB 1AS3A 1X1RA 1R0ZA 1ZM9A 3K9HA 3PSIA 2QMHA 3AVQA 2WJYA 5M3MH 4LC1A 5E95A 1QUQB 2HJGA 1WF3A 2PT7A 4NCKA 4F93B 4KCGA 4MITA 2J7PD 2GVAA 3BJIC 4NONA 3GEHA 3QBVA 3CC4A 1SVOA 2VP2A 2F43B 4Q5IA 5HKKA 1RC8A 1T3LA 1E1TA 3OAAD 4ARZB 2A5YB 2HLDD 1LS1A 2JASA 5LD2C 3KLWA 2NMVA 3GTOH 3VR4A 1VPLA 4GNKA 1KY3A 2QGNA 1S2MA 4L5BA 5L8VA 4BLOA 1PH7A 1HR0Q 2VP5A 3QPWA 1JALA 3L0IB 3O8RA 5FBLB 3E9HA 4NXNL 1TNDA 1N6PA 3PEUA 4LFAQ 3M4PA 4N0DA 4QC2A 1CR1A 5H70A 2DYKA 1ZM3A 2BBTA 2H7VA 2ZYWX 4A3JH 3QI2A 3OF5A 3NELA 2UXBQ 3BC1A 1X6OA 5M3FG 1TPZA 4QGFA 4TSFD 4BLRA 2R65A 3VKHA 1XPOA 5C4MA 2O8FB 1GUTA 4LUVA 4BY1H 4FMCF 4DUYQ 1L0WA 3U3OA 5IF9A 1NLZA 4LFCQ 1OV4A 3QJYA 2O0KA 3C7KA 3DMNA 4US2R 1KGDA 1HEIA 5ELXA 1E94E 1R5BA 2BC9A 1W5SA 2FSGA 1U2RA 2IYQA 3WWVA 1HUQA 4V03A 4BASA 2OXCA 3CNOA 1M2OB 4PC3A 1KSHA 1N0UA 2BMFA 1DPFA 1BOFA 1G7SA 3PEWA 4PSVA 2ERXA 2VQSA 5GJVC 3RDPA 2GJ9A 3HR7A 4M1SA 3TH5A 4B33A 3R8FA 3CX7A 1W2BA 4KITB 1YR8A 4M1YA 3UMRA 2LSSA 4DNIA 3GJ0A 1VQFA 1DELA 3DM5A 1I94L 5GAGC 4AKEA 5FOTA 2Q3MA 4ERNA 1ZM7A 2HCBA 4KLKA 1CLUA 2IEZA 2WAYA 3KX2A 1E2HA 4H9GA 2O5VA 1GHKA 5JCZA 4OJKA 2VH5R 2EIFA 1YZQA 2ZJOA 1QVGA 2C9YA 1UE5A 1IBKQ 2WPDA 1NSFA 3CXCA 2R7ZH 1TWFH 2HYDA 1Q7YC 4DV1Q 2PT5A 4AG5A 2GVBA 5EE1A 2PEYA 2BVNA 4LGMA 4QJ4A 1EQRA 3FHCB 3I4LA 4A6XA 2YC2C 2VY3A 1D9ZA 1DXMA 1P62B 4P31A 3KF6B 4BWYA 5FR1A 3G0HA 3QKRA 2XX3A 2ZJZA 4RFSA 2NN6I 3UWKA 2P6UA 2ZJ2A 3K0FB 4MGIR 1KKMA 1KRTA 1TF2A 1EESA 2ZJBA 3DZDA 3UE0A 2ZTSA 1EFUA 3H84A 3MUFA 4OWWB 1SKYE 5C3EG 2ES2A 4YDHB 2VNUD 1AS2A 3IGFA 4IDHA 5C0XH 5BR8L 5EJEA 2AXNA 4BFVA 4PSAA 3T53B 1YZLA 5HY6A 3L8YA 4UQOA 2Z43A 3CBQA 2EFCB 4GKKL 4KSCA 5IK2A 2OUKA 3K81C 1XB2A 4BY7H 3WXMA 1XNRQ 3NHAA 4TMWA 1M1KC 3CW2C 1EX7A 4A92A 1CKMA 3W1GA 4DKAC 2XJ9A 4X66Q 4G0NA 3VX4A 3LVRE 5KSOA 3TQYA 4IFDH 3TS2A 2IEYA 4OBEA 4A2WA 4B44A 2V1CC 3H1TA 2A69C 1E2KA 4LC0A 4G5SA 4BEJA 2BA1A 4X6AH 2OILA 1DAHA 2VHJA 4B32A 1U5KA 1J6QA 1BS1A 1MR3F 3Q85A 4HAUA 5HR5A 4JBKA 3AGPA 1VG0B 5CK4A 3C14C 2PCJA
chains in the Genus database with same CATH superfamily
2Q1YA 2IPMA 1I32A 1J1UA 3RC1A 2IS2A 2X22A 4S24A 2WD8A 5CBAE 1PKXA 4KK7A 4IF6A 3T16A 3O7MA 3OIUA 3QENA 4XSVA 2FW7A 4DA6A 1EXMA 2WINI 3H15A 1YB1A 4LN1A 4ZMBA 1PK8A 4KRYA 3ZZMA 2I6XA 2C95A 1NA5A 3GLKA 4M7PA 2SKEA 3L2PA 4AY3A 3GDEA 4N9TA 4IOAA 4AUKA 5CU7A 2DMRA 4PYJA 2F9FA 3U7RA 3QRWA 2F0FA 3D4RA 3HN2A 4TL8A 5JAHA 3ENVA 1L1EA 2LW7A 1RQ2A 1X1QA 3B85A 1FMFA 4ARUA 4JL5A 3EN0A 1HQKA 4G8JA 5DFAA 4R0NA 2Q6TA 3MEFA 3BWBA 3OIPA 3WL8A 3ELUA 3KSRA 5D6NA 4EPRA 2FN7A 1TZCA 2I6SA 3ZV7A 1RT9A 2RHQB 3OMCA 3AHCA 3O73A 1GGEA 5C4IA 5LWHA 3WGJA 1NUSA 1XZLA 5GZ3A 2PZEA 4TV9B 1IUPA 3EPPA 4ZZIA 1IJBA 5KBYA 4D44A 1G8HA 1TJPB 5ERGB 5B3AA 3DAHA 3I76A 3ZS9A 4I19A 1OIVA 2IQIA 4DV0B 4NOJA 5D1HA 2O48X 2XOXA 1JG3A 3FRJA 4XWWA 4TS4A 1BXGA 1HETA 4D02A 3FWZA 2BOSA 2DH5A 4DR5L 1Y1VG 3K4QA 4B3CA 3C3BA 4QLAA 2J9FB 4I4NA 4CZ2A 1Q86C 1WFQA 2JGMA 1NL3A 2Q6KA 3N5CA 2YMLA 3JD3A 1Z17A 4DLKA 1UZLA 2XF8A 1KP3A 2Q28A 3VO9A 4ZXPA 3MMXA 3LPDA 5B64A 2JFNA 1J8QA 1AGRA 1IY9A 4N7RA 3ME5A 2AUTA 3S55A 4RJLA 3UHOA 3DBLA 4XM0A 4BL5A 4KXQA 4M88A 3CKMA 5AWFC 2G1KA 5IYZF 3WB9A 1E1MA 2YTXA 4W9RA 3P9XA 2ZT7A 3C8ZA 4AS1A 5JJIA 4ZQGA 2HIAA 4MNTA 1Y9EA 4K6GA 4D4JA 4NQRA 1MGPA 3QEKA 4LUZA 3UGKA 3DHWC 2CJWB 5I5GA 1FDRA 5ALMA 3MT9A 4BJ3A 1Q11A 1Q7RA 3E9CA 4F46A 1ICFB 3CWQA 1GWNA 2YQ5A 3FN4A 3GLIB 3M7NA 3WNVA 5DWDA 2XUPA 5J1TB 1WXIA 3ZYCA 4DA7A 1B26A 1Q7TA 3AFIA 2F0HA 5D3ZA 3WAJA 3RUDA 5KYKA 5TLSA 4LEIA 2P6PA 4O1HA 3O91A 4BO6A 4RVUA 3C7TA 3K16A 1G19A 4OG2A 4IFBA 2IX0A 4WUTA 3ZHCA 1WUJS 4KHPQ 2QJTA 4BN5A 2EERA 2DJFC 1FTYA 3PD0A 4E5KA 2OV3A 4R6XA 5ER9A 5JMWA 3FNHA 1O94A 1OILA 1CV2A 3HB0A 3TDKA 2CLCX 3AUAA 3OMGA 3AIIA 2R6AA 3X1XA 4UMDA 1Z13A 3FHWA 1SC3A 2NXCA 5JISA 4J9UE 1HQMC 5IDVA 4BFSA 2QM8A 3DUFB 3OECA 4P71A 5B7GA 1ZXTA 1R6AA 3E5NA 1QLHA 4F4IA 2R92H 5HRAA 2NUAA 2O8FA 1DQRA 3PO2H 4U2EA 3UJ7A 4A1FA 3UFXA 1R0YA 4MVJI 2P75A 5A4DA 4BPBA 1VZ3A 1U2SA 3G7UA 3T4UA 5ED4A 2K5WA 2OHIA 4G97A 3C3DA 1R16A 2BKUA 2YRXA 3HM9A 3RVSA 2YJTD 1VLLA 3GLIE 5A9SB 3OQBA 1XYIA 2P7HA 4Y2XA 3RSZA 3P94A 4UPEA 3E4DA 4XTRA 2WQZA 5KS2A 2VYVA 2XNDA 6CHYA 2RIRA 2EFJA 2W6ID 1BBWA 4Q3CA 4NOLA 2ZSIA 3H13A 1C2YA 2W6NA 3TINA 3I83A 4EJSC 2XV1A 3KVYA 2FXIA 3RWMB 5C4JH 1NUCA 3AH8A 4KLZA 5JHGB 2PU5A 5I9MA 1FS6A 2K6GA 3ZGNA 2B3GA 3HB5X 4DUZQ 3M9LA 1JHMA 3FSEA 3D8SA 3CY6A 4DCTA 4L0CA 5LD2B 1CXZA 2D5CA 3AR2A 2IY8A 4WFN3 4TYNA 3HDVA 1YQEA 1U0NA 5IP9G 4OYHA 4WOKA 3MFGA 2C94A 3H91A 4JLAA 4YWHA 4GYJA 1VCIA 4DXFA 4PBSA 1GZUA 1GTZA 2FPOA 1I4LD 2BR3A 4ZU3A 2XCRB 4LGYA 4UHCA 1B1AA 1QQ6A 4ETMA 1Q1QA 2Z5GA 3DBOB 3SDSA 4OFWA 4WW0A 1GG8A 5KOIA 1UPCA 4BGVA 3ADOA 4WI1A 1YB2A 2EG5A 2RGUA 5IP7G 3EPRA 4DV2B 2Q62A 4XVCA 1EA7A 1B53A 5KYYB 1GL9B 2PZBA 3GOHA 1N33B 5FTMA 4A3KH 4U9IS 5DBFA 4QJIA 4DIUA 4V1CB 2B25A 1KJNA 4X3CA 4XYMA 4NCXA 4TVSA 2FPKA 2PUHA 1GTVA 1VMKA 2K03A 5A02A 2VQEQ 1T29A 3ZLBA 3MYRA 3ET5A 3TB4A 4C7VA 4I7AA 3I6ZA 1OVGA 2YN2A 1HT1E 2Z6VA 4QUGA 3TK1A 2Q29A 1RKUA 3I61A 3RVJA 1GPYA 1WDMA 2MSCB 3SICE 2VA8A 5JRDS 5LM3A 5HVNA 1JU9A 1T4CA 3SC6A 3TL3A 3N8IA 5EZYA 6REQA 1V11A 1WSWA 2MO0A 3RW9A 4E12A 1RJDA 1STHA 1VPDA 4OYRA 5TF0A 2F03A 3UGTA 1RCVD 1NQXA 1GA6A 1B2TA 4AY6A 5EBDA 1UWCA 4M9CA 1E2JA 1T5HX 2XJ4A 3A9VA 1RZRD 3PCOB 4WGFA 1E4OA 3NORA 4C3IG 5JBIA 1D1SA 1P8JA 2FN4A 3C45A 4PIVA 2COKA 2I3AA 3PQ3A 1PTOD 4YIHA 3EC2A 4W6QA 1VTKA 2A94A 1G21A 1JMCA 3IDFA 4KEAA 3TCXB 2CNBA 3N2KA 3H94A 4MQFA 2R86A 3HU3A 4Q1AA 2QDXA 3JWHA 3VUEA 4NDNE 1K92A 1K06A 2JFQA 3KT0A 1QH1A 3V8MA 1N9GB 4MSUA 2Z1MA 2C07A 1XYGA 2WMOB 4PXAA 1K9MC 5L40A 1HORA 4J0KA 4YRQA 2I0FA 3D3RA 3VC2A 1UPXA 2A6ED 3EEIA 3PE6A 4E2ZA 3I12A 4XX0B 3IP9A 2BEKA 2IEAA 2D4HA 1ISMA 4HDNB 1XEWX 4M0FA 2RCFA 1F2LA 4BNJA 7YASA 3KFXA 1P9RA 4LDJA 5KWJA 3K0YA 3CPEA 3JYLA 2ZKIA 2CHBD 2I1QA 1N34L 4OMUA 4R8SA 1YS6A 5A3RA 1GUAA 4P22A 1UOOA 5IJ0B 4RPJA 3P97A 1E9CA 1QILA 4NVRA 3CUEF 2W83A 5DEIA 4G86A 2FFBA 2GRUA 1P72A 1Y42X 3MCTA 2Z04A 2PIAA 1Z2EA 1PAUA 3UUFA 2UVPA 1SUDA 4DMRA 5L3VA 3ZX5A 4XRGA 2K52A 1B41A 5A6SB 3HTXA 2IK8A 2J7PA 5EGNA 3OJLA 4W1SA 2C98A 4JVLA 4CV2A 4GN3B 4C3JH 1XI2A 2WVJA 3IQGX 6NULA 3EWSA 4DR4L 1Y8QB 5JPDA 1BX0A 3K4PA 4J0DA 1XZNA 4C6SA 2IUTA 2GNPA 1G6PA 1GQSA 1QVVA 2OVBA 4AQDA 4KBFA 2BGUA 3CN7A 7REQB 1XZJA 3USZA 3HHPA 4KDRA 1C4WA 5KTOA 2EFEB 3AV0B 3K6KA 4UCQA 1K9VF 2PX8A 2TECE 3X44A 5FR2A 2YWBA 3WV4A 4JPBW 2CLHB 5AT1A 3IKTA 2PKQP 4WA8A 4Q4CA 2CDBA 1ILQA 4MROA 1L5LA 4IALA 2QG9A 3E4CA 1UEJA 1EY5A 1M0WA 1AKTA 3MJDA 1N5KA 4BFCA 2HK9A 1G21E 2QRPA 2VQ6A 2VHQA 2PNHA 4QBGB 5AI0A 2IKQA 3G2KA 2GFIA 3FKSD 1BC5A 4CM5A 3N75A 1I13A 2JA1A 2FP4B 5F7ZA 3GIDA 3QXXA 2IV7A 4EA8A 5TR9A 1O6ZA 4CDGA 3OQVA 4MA5A 2PYZA 3T4XA 3R5FA 2KYRA 1G9TA 3J7A5 2FFQA 3R0JA 2SCUA 1Z15A 2POCA 4KK3A 2FQYA 2IVZA 4BPRA 4W5QA 3HOZB 3P9SA 3RAFC 5IH3A 4ZREA 3IT0A 1S5PA 1KYQA 4HMQA 3LIIA 1USIA 3HOVH 2E6KA 4EX6A 5C34B 1IBLL 1JDSA 1NUUA 4A93B 2XZTA 5DIFA 3H42B 1C8BA 4F5YA 4FB4A 2ZVPX 4REQB 5KIXA 1Z5ZA 3BSYA 1HNZL 4P5DA 2L9HA 1P1KA 2RD2A 4PPNA 2A68D 1BDJA 1TT5B 3DV0A 1NVKA 4JZYA 1SNMA 1A9XA 3A04A 4EMTA 5A2QL 3TN2A 1E2GA 3NXKA 5FLXL 2O3TA 3RTCA 3I4OA 4JJ8A 3I64A 3TQTA 4P86A 2FLVA 3U0BA 3DXJC 1WMEA 1Z0SA 5TC4A 2O20A 1T4BA 2P41A 1WY5A 1FQKA 5CV6A 2V9PA 3UKJA 1JHRA 1J7KA 2IEIA 4HJAA 1Y1WH 3JD0A 1O7LA 2Q4TA 1XG5A 4BB5A 4BNUA 1H69A 3AY3A 4FYXA 2IXGA 1FUKA 3D0OA 2OWOA 1RLIA 4HNVA 3U4HA 3NK9A 2WFWA 1LKZA 2AZMA 4WX2B 4XJTA 1YQQA 1ZS9A 4JLJA 3TTWA 4DMUB 4N40A 3QU5A 4RBNA 4XYBA 1PFWA 3EZ2A 3HRHA 5CV7A 5M3FH 4RIEA 1E2NA 2IOFA 4MVJF 2HHHB 4CKBA 3HKBA 2ZU0C 1QIFA 1MAAA 5BUSA 4FYMA 3V6LA 1HDEA 2WJ4A 3LK6A 1OBCA 4IPHA 2I33A 4A03A 1N2ZA 4O0AA 1BKDR 2WPDD 3WDSA 3BG3A 2JB9A 2GZ1A 2II6A 3ICEA 4ZT7A 1ZN2A 3E6ZX 1YH3A 5AJ3L 3TUZC 3KS9A 5HS4A 4YHHL 3HY3A 2IEGA 4ZEXA 5C3EH 2R3ZA 4NYJR 3LTNC 1HHVA 2PV0A 4RZQA 4D4IA 5ALWA 2G9DA 4JOSA 4OQFA 2MYPA 1AJEA 3HA5A 1C3EA 2PGXA 1BWRA 3TMYA 1RAHA 5HTKA 3S2UA 3HI6A 4JEHA 2RDHA 2A6HD 1YFZA 3V1MA 4B40A 4B85A 2E37A 3QFTA 3HI4A 2CV2A 3G9TA 4H44C 3LUPA 3JU3A 3ZU3A 3GJQA 3STBC 1G8MA 1YD7A 5IT5A 3PBKA 3FCYA 2XA1A 4O2DA 2RDMA 4EIWA 3W6PA 1CUJA 2XOKD 4BO4A 1FRZA 5J4HA 2HRDA 1YBFA 2OHXA 4ZD6A 3IEXA 4P3PA 2AS0A 1BWPA 2BRUC 1K0RA 4PNPA 2O2SA 3O8CA 2XNSA 5I7UA 1Z34A 1YHYA 4FDBA 3GU3A 4MW9A 3H18A 1AG9A 3W06A 4X97A 2DFKB 2IJ0A 1AVTA 4MB2A 5CFOA 2TSSA 3EPLA 3FR8A 1GUGA 1E7SA 2PX4A 4IINA 1JV2B 4BNWA 2CB9A 4UCFA 1C7ZA 2FRDA 3MINA 5BMVF 5GGXA 5CEJA 3QMVA 2PGLA 2QZPA 2DRIA 4YJDA 4XR9A 3F3KA 4GZ5A 3I0ZA 4RPGA 4RD4A 4O6VA 2M6KA 3SK4A 3IJ5A 3H17A 4IDFA 5C1PA 5CUQA 1W88A 2JJMA 5EPOA 2PMWB 3KOOA 4AJIA 3HHEA 1K73C 3IPLA 3LPAA 2PZFA 1CEEA 1OIXA 3DM3A 3STWA 4YGYA 2FMMA 1IL0A 1I50H 1HTBA 2ZRGA 2IHJA 4B7XA 1NOJA 1YONA 3WV5A 4GEGA 3T1VA 1RQXA 2OLEA 4FHFA 4D9EA 3THRA 4GN5A 4X1KA 1NKTA 5AD1A 1AKVA 3DOJA 3B1JA 1LUZA 4E5UA 2FHSA 3N05A 1QIKA 2PS9A 4GKKB 2PWAA 5JSYA 1QJOA 4MN3A 3OU7A 1P2GA 1OLXB 1QC5A 2QK4A 3BCRA 2Z5LA 3C3AA 1HGXA 1N3YA 3I04M 4KJXA 4MKXA 1NVEA 4NIMA 2FPGB 4JJGA 1E1KA 4JSTA 3WP0A 1T0BA 1II9A 1XEXA 3KZ1E 3U4QA 4HBGA 5ALZA 2BZGA 4OYLA 1Z47A 4JQZA 4CKWA 4W5JA 3ZLJA 3IQDB 1RCFA 3IOEA 1CUBA 4PG3A 4WOJA 3ESXA 5M2QA 5K8JB 3MWDA 4S3MA 4D41A 5KO2A 5CCEA 2IHVA 2IP1A 5CBKA 1A9YA 1J22A 3ZDBA 4F1JA 1VDZA 1IPFA 2QROA 1YVDA 3SP1A 1KABA 2C96A 2EZVA 2BFMA 3ZJTA 1NQVA 5DYIA 2ZSDA 3RSLA 1ES9A 4HAXA 3G0IA 3HL4A 1NTRA 4A0GA 3A4VA 3IUJA 4CMIB 1P4AA 4B6RA 2IEDA 4M89A 2QUZA 2QORA 1IRXA 5L45A 4WVFA 3CCSA 3KFUA 3V8VA 5ALVA 2AHOB 3EIOA 3ACDA 2WAQB 3ICVA 3VKUA 1QUQB 1EDEA 2DR2A 2E0IA 3H09A 1T3LA 1LS1A 1VPLA 1NW8A 3UW3A 2VP5A 1GTRA 3D81A 5HJEA 3O8RA 4LFAQ 3KAKA 2PPLA 1X6OA 2B3DA 1HL3A 3KEFA 4LUVA 4DUYQ 3EQ7A 3ASVA 3EAGA 1TT2A 1KGDA 3CCBA 3OQJA 2YYAA 3TZHA 2KLHA 4BX9A 2WPNA 3G2PA 2XBLA 3PEWA 1JBQA 2Q8NA 4CTJA 4AKEA 1DELA 2XMRA 4OJKA 2EIFA 1UE5A 1NSFA 1TWFH 1UBHS 5AQEA 3VXKA 3I4LA 3H2BA 4BNXA 2UUBB 2RKSA 3VI4B 5E8RA 3PNMA 4LXHA 5HK8A 5B5SA 3D6AA 4ZOEA 4J0IA 1WDLA 2WNIA 1VFNA 3P4UA 3K9BA 1I3LA 3T53B 1WKVA 1KPGA 1OZHA 13PKA 1DXOA 4M0DA 3CW2C 1JORA 5HURA 3NNDA 4CCWA 1QM5A 2IEYA 3MJSA 2BA1A 4MRMB 1U5KA 4JBKA 2P1DA 1E5VA 2IY9A 2QBYA 5LP6C 4YRSA 3ZHXA 3MXTA 2DHRA 3GUCA 3WHLA 4MULA 4DL9A 3LOUA 4RL6A 2BUBA 4JFRA 1JQKA 5AIAA 4JJKA 3QW2A 1Z29A 3NQTA 3E3AA 4QOFA 4ZYYA 1JG4A 5AVVA 2D0OB 3HCWA 4WK0B 3WLTA 4E11A 1Z6ZA 2WQ7A 2R93G 1NBME 4UOQA 5BWNA 2QKIC 1LTTD 3TZKA 3DR3A 2Q4DA 2BBOA 4OXNA 3EY9A 5JIBA 4Q24A 4RV5A 5D5QA 1ZI8A 1LK5A 2Q5CA 3CNBA 3IMEA 5CNIA 1NULA 1KQSA 4WOBA 2VB3X 3ZIUA 1YR6A 1I4OA 1KYTA 3VNRA 1KP9A 4Q1CA 1R27A 2W4QA 3MCZA 1QOZA 3FOAA 4M21A 2EV9A 3AXSA 4IIYA 4FFBA 3L7BA 1KI1A 4IPTA 4EGJA 3PUZA 3LRTA 3OURA 3SJBA 5F9MA 2FWNA 1IE3A 4OQLA 3ZQ4A 2IUSA 1U8FO 4EW2A 4JI4L 4EUEA 1PWXA 2QY9A 2QAIA 3S2FA 3PFKA 1MAUA 1I4TD 5LQAA 3C6BA 3QIVA 4Z0TA 3N53A 1V5IA 1A8IA 4MH0R 3SZRA 2VYCA 2NO7A 3U9TA 5HX7A 4M1WA 1FTGA 2VCEA 4MUFA 4ZLTF 4JSRA 2XNAC 1E4EA 2QUBA 5BW6B 3WWPA 3V34A 5F7XA 5LWQA 4MUJA 4QPZA 1NCVA 1CERA 1JQYD 2IH5A 1UODA 4CLRA 1VBKA 3CF6R 1B1CA 1E98A 1BNCA 3T9EA 4BTEA 1DBPA 3AL2A 3B6ZA 4YH1A 4RVCA 4I4TF 3RHZA 2BV3A 2F8MA 5CEFA 5BYJA 5JWHA 1X32A 3MQ2A 2OWDA 4QU5A 2A0UA 1JT2A 1DTSA 1INLA 4EX5A 4AMBA 2FSFA 3FJYA 1J8IA 2FMXA 2MTBA 1PK7A 2XODA 3AM3A 3B1YA 4XWKA 4Z8XA 1V2GA 4OQEA 3LOPA 3T0IA 5AI5A 5BSEA 1TK9A 4DWJA 1E3PA 1J56A 3NIBA 1QQ5A 1QDEA 2ORVA 3A8TA 1U0JA 5DM4A 3EODA 2JNWA 1JH9A 5DP2A 1S40A 2P6MA 4HL6A 4P4TA 1QNLA 2W2VA 4YAOA 2Y0PA 1NXSA 1U8UA 3M81A 1IYVA 2GZSA 3LNCA 4QOEA 5FORA 3EUWA 4IHJA 3SPXA 4TYWA 1C3LA 1PJAA 2P65A 4P5PA 2J85A 5TEWA 3ZW7A 2ZYRA 1VDMA 3J80i 3GJ4A 1NAPA 4ZIRA 1VE9A 3F6CA 5P21A 4LF7Q 4D3XA 1K7XB 1YR9A 4HNAA 4HN7A 5I8WA 4OD0A 2RHHA 3QFSA 5JVG3 3P2YA 3OBBA 2WWGA 3H19A 3M4NA 5KNDA 2BYTA 2WOOA 5HZHA 1YB4A 5BRAA 3AO0B 1GPUA 5DYNA 1B43A 4U3JB 2ZZMA 2HNKA 1VLZA 1ZXXA 4WN9A 1NR2A 5A5VA 3TRFA 5B53A 3IELA 4DOMA 1XUOA 5EJIA 1G59A 4A3DB 4X64Q 1DAMA 3OETA 4G9GA 2FSVA 1IIBA 2LCIA 3T5DA 2IYZA 4IDDA 1W35A 4C6TA 4DDVA 1V7PC 1NY4A 3RIYA 1U7PA 3DE2X 2SHKA 4R2WA 2EY2A 2HYIC 4LF5B 4QUEA 5CB4B 4ND5A 1RYNA 2GSDA 3AUUA 4ZV7A 1FW8A 3LUJA 2Y1DA 2G9QA 1FNVA 5JZVA 1WW8A 5LXTA 1CUCA 2RB5A 2PCLA 7AT1A 1B3AA 3GTMH 4US1R 1BS2A 3UHPA 1MP0A 3V3KA 1P4RA 4PAWA 1ZGHA 1Y4SA