4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
5JWRA 4K46A 4F93B 2J1LA 3QKSA 4M9QA 2V7QD 4TLAA 2E8GA 2FMXA 1AA9A 1M90C 1NG1A 5KU1A 4HAYA 4RKEA 4EFLA 1P60A 2F9LA 4ZCIA 3RS5A 3CZPA 1XCMA 2OAQ1 3BWDD 3CWQA 4KVAA 2O8FA 3KX2A 3OFNA 3LWUA 2VHQA 4AWXA 3K70C 3CRRA 2RHDA 1Z63A 1RVDA 2P2LA 1KI8A 3E0EA 2EJMA 4A3IG 3CH5A 4Q02A 4QL3A 1VG9B 3OZXA 2DGYA 1GRQA 2Q8IB 5L3SB 2AXPA 4R98A 2REOA 4G7OC 5LB4A 3ZIAD 1US8A 4LJZC 2N3SA 2YTVA 4TLCA 4TMXA 4W5WA 4MUBA 1A63A 2WFWA 4XTRA 3CIOA 4LC0A 1L1OB 2KBFA 3EZ2A 2BMEA 1U81A 4TWZA 2A6HC 3CXCA 1VKJA 3VR1A 2JLUA 2EFHB 4B3RL 5K8IA 4BLTA 2MFIA 2QORA 4A15A 2R6GA 4LF8Q 1IAQA 4OHXA 3ADDA 1JR3D 2C98A 4PMWA 4JI3Q 2D2FA 4C0KA 3WBKA 4DLZA 1AZTA 5CLLA 1U99A 2FA9A 4MDEA 4IEIA 2RGCA 3RN5A 4PZ8A 3QSYA 2QNRA 4QL5A 1Q46A 2DWOA 4JZKA 4E07A 5JCPA 4M9XA 1S0UA 4ACBA 4C7OA 1UJ2A 1PH3A 1IY0A 2ZS9A 5EP2A 4A0RA 3MWKA 4FMDB 4URZR 3O8BA 4TSFA 2LXKA 1G7CA 4NU0A 4A0HA 1KTVA 3IEUA 2JLYA 4G3XA 4V03A 3K9LA 4PANA 1E9CA 4KSCA 1N0WA 3SS8A 3RWOA 1TWGH 4M53A 3B8HA 3T1HL 1Y1WH 2B7CA 3EASA 4LV8B 4RD6A 2JA5H 1VDZA 2FX3A 2I4IA 2X8AA 721PA 1JJGA 1CSPA 4JL5A 4PZZA 4HUQB 2Z6KC 4ZKDA 1PMRA 2EFEB 3WRXC 4OYHA 2ZI5A 3SJCA 4GFDA 5FPYA 3W6OA 4JLBA 3LQRA 5DYIA 4RCZA 4LK1C 5HKKD 3ZLJA 2RAPA 4NPHA 1HR0W 2F43A 2P67A 2RGAA 4A2QA 1Y3AA 2KCCA 4EKDA 4NXML 3WNDA 3FE2A 3GLFB 3GTOH 2Q2IA 4PFSA 1ZUHA 1JPNA 1MKHA 1CULC 1FNNA 2HT6A 3LDAA 2BA0A 3LW7A 1W36B 3VNVA 1ELOA 3B1WA 2AWOA 4DJTA 1R8SA 2QUZA 4B34A 5FTLA 2V8OA 3NC0C 3SQWA 3MXNB 1J8YF 2YWHA 4PPNA 4IO9A 1II0A 2NMVA 5FLXc 4F4JA 4MDFA 1S3OA 3LXRA 2QAGA 4Q4AB 3GLGA 1H9RA 4JG2A 1DO2A 3NVAA 4JLPA 2BE5C 1G5PA 3H0KA 4M1YA 2DNEA 3CC7A 1Q1ZA 2A2ZA 3EC1A 5FBWB 2BDOA 5CLQA 5JS7A 1NVXQ 3AVWA 1T5LA 2A6EC 2IHYA 3RRZA 3TSOA 4JL6A 1OFUX 3R9IA 3B60A 3RLNA 1CSQA 4GLVB 4LGMA 3R7WB 1UADA 4TT3D 3KF6A 2EFDB 2QZ4A 3WYFA 4MYCA 4FWTA 1CJTC 3TKLA 4XWKA 4KVGA 3AYHB 1E4VA 3NH6A 1Y8PB 4BY1H 2F3RA 3U3OA 2NZ8A 4TYYA 1SHZA 4POAA 5DO9A 3IGFA 5HKKA 2VQSA 4YDSA 3W5IA 4A3BG 2YWEA 2DR3A 1QUQA 1N34L 3FOZA 2OXCA 3FP9A 1XB2A 5GJVC 2XSZA 4US0R 1DPFA 1G7RA 4LDJA 4FWIB 2CJWA 1Q20A 2ZU0C 4HB2A 4XWOA 4NYJR 4B32A 5KHOC 2JA5G 2R92H 3TRFA 1WB9A 4F4CA 3U3KA 2ZE8A 1II8A 2BBWA 2WJIA 3GO5A 4JI1Q 1T3HA 1ZCAA 2IYVA 2EXDA 1XJCA 2PNRC 3BU2A 1IYJB 3CNNA 3DHWC 2JA8H 4OHZA 5E3HA 5KOYA 1IONA 4BY7H 4DXAA 1YZLA 2JEOA 2ZI7A 1SZPA 1V43A 4DR6Q 2N46A 1W36C 1DXMA 4M1OA 4DR2L 4NZYA 1GILA 2RH5A 5F9HA 5H1YA 3A1UA 1NMGA 3DKPA 4N1AA 1FNMA 5JZVA 4F92B 2WJJA 4B3SQ 1IM2A 1I6VC 3GJ7A 1SXJB 3KYHC 4R2HA 4KBFA 1Q8KA 3CCSA 2VQFL 5J4LA 1OXXK 3T51B 4HATA 2UXCQ 2YV5A 1E0JA 2NO6A 3KDFA 1DADA 1NVVQ 3LWNA 3LLUA 1KO7A 5JEAG 3QXJA 4PSVA 4C0LA 5FUWA 4V02A 4L16A 2WWYA 3LNNA 3IPXA 1CP2A 1E79A 2XNDD 3OHMA 4E5UA 3O8RA 5G53C 3PUYA 1WMSA 1TX4B 5BYJA 1U0LA 1C4OA 3AB3A 2BDTA 2X1VA 1S2MA 3B13B 1Z6YA 3BH0A 4JSYA 5DI3B 3WRYC 5DYGA 2D0OA 5E95A 1D2EA 4DR1L 4LJ9A 2ZJ2A 3I4NH 3L0IB 5FUVA 2GCNA 3WBJA 2ID0A 3TH5A 1WJJA 3CKLA 5GADl 2D4HA 3C5HA 3G48A 4WAUA 2QM8A 3AGPA 5C18A 1J6QA 4ZDJA 3RS7A 2EJFC 1VMAA 2QMHA 4DV3Q 4XSGA 1JECA 3SBEA 4LF7Q 4PC6A 1UEBA 1HZBA 5J4KA 1OXSC 1KAWA 3RLOA 1DG3A 4MRVA 4RD2A 1ZRHA 1GKYA 3U4QA 3A74A 4Q9JA 5DHFA 1Z6HA 1YNJC 5JRJA 2EVBA 2WJGA 3CW2C 1G3UA 1W5SA 4NHOA 4LJ5A 3AKYA 3R20A 4PQYA 1FQKA 2CBZA 1DVRA 4I81A 2XGJA 3WNCA 2QA4A 1Z0DA 4JJZA 1NY4A 1OPXA 2Q21A 4DV6Q 3HU3A 1TEXA 4LF4L 1X3FA 5IP7G 1DOAA 3IIKA 3MG9A 4W7SA 1CF4A 2UXDL 2NTYC 1UEJA 3V00A 3TIFA 1GTVA 2AFIE 1N6HA 3H0GG 1PH4A 5JJIA 2QT1A 2FZLA 2NPIA 4WVFA 4CEIB 2J0QA 2WZQA 3VMFA 5IP9H 1FUUA 1R5BA 1XDBA 3PO3H 2YJTD 3MAAC 5EZ5A 3OW2A 2K5VA 3ADCA 5HCIA 3CWZA 2DYKA 3AP1A 3ZVRA 2HF9A 2GK6A 3GFTA 2RGNA 2G88A 1G51A 4X66L 1ZM7A 4UNPA 4XIGS 4Z51A 3A6PC 2QGZA 2ZUDA 3HOXG 2XTZA 3AVUA 5H1SE 3P4XA 2O0JA 1ZW6A 3MRSA 4ESHA 2EWVA 3WP1B 2HLDA 4BFYA 4UKDA 2QM7A 2E5LL 4P3YA 2WTUA 2NIPA 4JI8L 4U7DA 3OEHA 1KIXA 1I5FA 1D8LA 2GCPA 4TL9A 1WI5A 4CT5A 4D25A 4DV6L 1OXUA 5K8TA 3EZFA 1X8KA 4DCVA 1W2BA 2BMJA 3I73A 3HGBA 2W0SA 2A30A 2A6HD 1XZPA 4FW9A 2E75C 1P72A 4ZV4A 1VQ7A 1HQYE 2GBLA 4BEJA 4DEYA 3U3JA 2G83A 3EIEA 2JIZA 3LV8A 1EOVA 3G71A 1LY1A 4OX9L 5K36H 2GRJA 3RANA 2HYIC 1KO1A 1MABA 4Q19A 2DFNA 4NXNQ 4GSYA 1ZBDA 3T1YQ 4DV3L 2KHJA 2GKSA 4P31A 2IWRA 1HZAA 2C95A 2VHCA 1H8EA 1Z7TA 2ZRMA 2YNMA 4R4IA 2H57A 2LMCB 1CJUC 1MO5A 3KLWA 3KFVA 3LFUA 4QHSA 3WMFA 5J47A 1M7BA 3OAAD 4C9BA 3MJHA 4MRPA 1G3RA 4GZYC 2GEVA 2RGEA 3V4RA 1KO8A 2HV8A 2WJHA 4F4IA 3Q5DA 2JJ1D 4P75A 1GUAA 2F1RA 3KJHA 3MWLA 5KDLA 4UP9A 4H0LC 3BJUA 5EXSA 2D7CA 4LF8L 4ZIRB 4GNXB 2MMCA 2QTVB 4QM6A 4B3RQ 5C4JH 4AYXA 3BAFA 4HB0A 1Z28A 2C2HA 2ZRLA 1NLZA 1N0VC 1BYUA 2C96A 3S2DH 2YOHA 3VKHA 2CKZB 3HKZE 2QP4A 4JI6L 1IN8A 4IFEA 4Q9LA 3VR2A 3CO5A 4ZPXA 1GNRA 4IVPA 2IUUA 4UQOA 2J3EA 1E2HA 2MSDB 3M4OH 5E7MA 5FBRB 3WHKA 1PH6A 4JOIC 1XF9A 5AJ3L 2NN6G 2QU8A 1R9TH 1Y8OB 1QVGA 4K0KQ 1VPLA 4IOKA 4B3BA 1W7AA 5CB6A 3VR4A 2WOJA 1EXMA 2Q6TA 3H1TA 1FJGL 4Z54A 3CNLA 1ZD9A 3OE7D 4W5JA 4DIDA 1YVCA 5GAEC 1ONBA 2FGKA 1E2VA 1G3QA 1VG0B 3B82A 3ZZUA 2BCGY 4ME3A 1SVLA 1SROA 2JLSA 2UZIR 1UBFA 3W90A 2WICA 4GN4B 3G6EA 1CJKC 3K0AA 3K0CA 5A5GA 2J0SA 1N6IA 1MO3A 5LMUL 1KZGB 2PI2E 1GWNA 4DR7L 4G1UC 3CM0A 3OE7A 3FVQA 4ZI2A 4A3EG 1GAJA 2VYFA 3ETLA 5FLMH 1E2KA 3X1XA 2BVNA 4A3CH 5K8UA 1L2FA 4IOMA 1TQ6A 1XRJA 4LV5B 2K7VA 3S2HH 4C0HA 4GDFA 1L8QA 3CCJA 3K0AB 3GTGH 4MRSA 1Z83A 3AP2A 4QJ4A 3TZUA 4QG7A 3NWJA 4UNRA 1W44A 3AEVA 2R9VA 2GVAA 3U9SA 4KFUA 1P4SA 3FMCA 2HQLA 1E22A 1I4DD 2ZSDA 3T12A 3FGNA 3U61B 4P4SB 2O5JC 1E2DA 2UUBL 2CLCX 2ZETA 3M1IA 1E69A 4JIMA 4OK5A 4PHGA 3CC4A 4QNMA 2WWWA 4Q9KA 1Y63A 4KBGA 1CJMA 2IS6A 3NEMA 4TMVA 4YMWA 2KHIA 3CF0A 1GRNA 1DTSA 4AQYL 3IDQA 1D9ZA 4RFSA 5DE3A 1EWHA 4B48A 1P5ZB 1N9WA 3OYYA 3S14H 2FF7A 1N32Q 1NVWQ 2GXSA 4X8LA 621PA 4QGUA 1PYBA 2NO9A 5HGQA 1UKZA 4KITB 3TAHA 2OQ0A 1VQNA 4QM7A 3B6YA 4UNSA 1CEEA 4JI0L 4UXJA 1FZQA 5GJCA 2F9MA 2F4VQ 3UE0A 2CCZA 2YZ2A 2JASA 3K0EA 2R6AA 1AGRA 2WSSD 3KFXA 2W83A 4Q9HA 3UWOA 5CYPA 1Q1BA 4H13C 2R7ZG 2PLFA 4L8GA 5CK4A 4CEJA 2ERXA 1S40A 4BA2I 1I2MA 2W2XA 1XTDA 2FNAA 4OHWA 1K6MA 3UXMA 4US2R 1PH5A 5H70A 1UF9A 3R8FA 4QGHA 2BIFA 4RD0A 4URXR 1G6PA 3ZVMA 2FSHA 4KHPL 4YMUA 1P2SA 1CI3M 1GIAA 1OB2A 1B70B 3ULPA 2Q3FA 2XTMA 3CPFA 4LJ4A 4NCJA 2O52A 4WZBE 4QRHA 1TWHH 5L3RA 3EARA 1JXMA 3OEED 4HLUC 4TQ9A 4MZ9A 1FX0B 4UY8C 2GESA 3QY0A 1X9NA 4FCWA 2BA1A 4L15A 2NO7A 3AVXA 3QG1A 4DR4L 1DELA 3I92A 2FDCA 5FOVA 1Z6XA 3PGZA 2QQ0A 3O8DA 2CLSA 1AJEA 4IJMA 4KYUA 5LBIA 1CKMA 1QVFA 3SHFA 1KIMA 5JLJA 2JA1A 2IF2A 2YC4C 3D4RA 4OONA 4WW0A 4A3IH 1CKEA 4OHYA 2LXJA 1W4RA 2Y8EA 3KDSE 3IKJA 2CL7X 3CBQA 4ITRC 2OM2A 2R7FA 2JA6G 4TTPA 3L43A 3NDBB 2WKRA 1P9RA 3P1JA 2OFXA 1GRRA 1UDXA 3LRPA 1K8MA 5AK0A 3CPEA 5DISB 4C2MH 3OFND 5AJXA 4J0QA 1NF3A 1XNRL 1JPJA 1U9IA 1LFDB 2C99A 5ELXA 4AKIA 3F2BA 1SMXA 2A78A 3CONA 4QQBX 3Q7QA 1VTKA 3LO5A 1F2TB 3IIJA 3TQCA 5LB2A 1QHGA 1XWIA 5KDDA 3RLFA 4C3JH 2PH1A 2W6JA 3KKPA 2DNCA 1K5GA 2D3WA 1JJVA 1YRBA 3A4LA 4D2IA 4DLTA 2REXB 3TSWA 5J4VA 3X2SA 3HP1A 1WF3A 2PT5A 4CIDA 3EXAA 1MO6A 1L4UA 2A69D 1P9NA 5E7JA 4DLWA 4PV1C 3HKZG 2ZM6L 1KMHB 1NTGA 1MKYA 2ZI3A 3B6EA 4GOJA 3W3ZB 1KO4A 5E7IA 1IBRA 1VECA 3B85A 2BBOA 4JLMA 4DLRA 1FOEB 2A19A 1E7ZA 3RAPR 5J4HA 4RZ3A 2J0UA 1PLJA 2QSYA 2C77A 3AVVA 4IFDI 2DHRA 2GILA 2PJZA 2IHFA 4ABYA 4LYJA 4JSTA 4NDZA 2O5IC 3U7FB 3NEYA 3CRLC 2ALYB 2OXRA 2ZYUX 4P33A 4WA7A 4TZ0A 2N42A 4HAVA 1OLOA 1Q22A 1G5TA 1QBKC 2C8VA 3BRWD 2QTFA 2R62A 3I4MG 1KMQA 1OH8A 1KGDA 2PX0A 1VQHA 1KKMA 2OILA 2QENA 2VSFA 4DKXA 2O8FB 2CK3D 1R0ZA 4R2IA 2ZJBA 4U02A 4CGZA 2OCAA 1YIJA 1WBBA 1PHJA 4G5RA 3SFZA 4B75A 1KI4A 4JBJA 5BWMA 3R8CA 3BK7A 2IBMA 2R6CA 2K5HA 4B47A 2RF4A 3A36A 3DOEA 3H15A 2Q9CA 4DR3L 4PQRA 3KTAA 1E1RA 3PO3G 2HJGA 2ZRGA 4O2RA 1IW7C 1GVPA 2Z0SA 2OFWA 2Z4RA 1EQRA 1C9OA 1JJ2A 3F5FA 4IPDA 4CEHB 2IS1A 2F3IA 3FYHA 3W5JA 5AJZA 1KSHA 2UZ3A 1HA3A 2HUPA 2Q2UA 5GVRA 2EFCB 1CJVC 2V6JA 2QE7D 2BMDA 2G1KA 2OBNA 2VP0A 4RCNA 1QUQB 2ORIA 1ANKA 4GMXA 4N0EA 3OF5A 2CVHA 2VIIA 1C0AA 4ZCLA 4EJSB 2RHMA 4PHHA 4C0QC 4P4UA 1U2RA 2AUKA 2VEDA 4A3BH 3F3YA 2ATVA 4IVQA 4FI3C 2L15A 3CW2A 2SHKA 4BFXA 1QZXA 3RR5A 2CE7A 4DT1B 1RRFA 4BLSA 1CKNA 5C3EG 1KSFX 3K53A 2ZS7A 4R71A 1W48A 2F43B 1VF5C 1AN0A 1UE6A 4QBFA 2WWIA 5EP1A 3TGPA 1SKQA 2JDID 2IYUA 3P4YA 3DZDA 2FG5A 5IDVA 3J80i 4MKHA 1KSGA 4I7ZC 4PZ7A 4X62L 4B3SL 1FP6A 2ZRPA 3THWA 3GJ0A 4JT4A 1NKSA 4QJ3A 1GUNA 5KUTA 4H44C 3A7LA 1G4AE 1QHIA 2J45A 4NYIQ 5TV2A 5KNDA 2RHQB 4A6PA 4PZLA 3KQNA 1K9MC 2EYUA 4GLAC 2R6FA 5KPJA 3K70D 3HKSA 2QF7A 5FI1B 5C2JB 3KQKA 2IA5A 2WM9B 2QPTA 1ASYA 4HI0E 3P32A 2V55B 3PF4A 2FV8A 2ATWA 4XSHA 3GPLA 1CFMA 3KFUA 3KB2A 2ZM5A 2GJKA 5C4XG 3HR8A 1BBUA 1M74A 1DO0A 2ZR9A 1KQSA 3AKDA 3C15C 4JLJA 1VG1A 4L5TA 3CCLA 4JBXA 1R8QA 3QENA 3H3VI 3MXUA 3MMPA 1DG1G 4NYIR 2IYTA 1MO4A 3EPHA 2PX3A 3QF7A 4OL0A 4TL6A 2R65A 3LLMA 3M9BA 2Q0HA 3SEAA 2HCBA 3T5GA 1LYLA 1E98A 4IFDJ 1FMJA 2OCYC 2Q3HA 4XD7A 5C44G 1M2OB 1M1KC 1JXOA 5HE9A 4JMPA 3ADKA 3KQUA 4YXWD 2D2EA 3X1YA 2OLJA 4B3FX 2MQHA 1K8GA 1R2QA 4A93H 1A6XA 4DSOA 5C3EH 4QHTA 3CCVA 5C46F 4QNRA 4WZ6A 3C41J 1I94L 4HAUA 4MRRA 3U7GA 3UG7A 4MTNA 3M0EA 4MNOA 1HEIA 1EFWA 1BMFA 2VUMG 2UXBL 4ASUA 1NBME 2QL6A 3KB1A 1QRAA 4CZ2A 2X2FA 3S1QH 2C35B 2J46A 2VL7A 3AF1A 5FUYA 4BLQA 4UP7A 1TQ2A 1KY2A 4LF9Q 4KHZA 4JOIA 1DAMA 1RJ9A 2ORWA 2XITA 3NBZC 1TWFH 2FSIA 2QMEA 4D0NA 4APVA 3DVLA 5L3QA 3GLIA 4YC7A 1RPZA 4GZMA 2PZGA 1N0UA 5DH9A 4IQZA 2VY3A 2BHRA 1XMOL 1WCMG 1E9AA 1E9SA 3E1SA 3QG5A 2ZRFA 4LYAA 2QROA 1KJWA 1OFIA 2AKYA 4YMSA 4A82A 3QKSB 4I1SA 2EQSA 3MWJA 4DK0A 3E70C 3GTLH 1MT0A 3DLLA 1DAIA 1Z0IA 5B58C 2V1XA 2AWNA 3J7ZC 2WKQA 5HE8A 4A1FA 2ZUCA 1GHKA 3V4FA 3K0CC 4G5GA 4DV1L 4JI4Q 3VR3A 3PCOB 4A3GH 3CRKC 3J81k 3JZMA 2CHQA 1B9MA 1NIJA 3U60B 4GZLA 2N78A 2IYYA 1B7YB 2GAOA 3EIHA 1LVGA 1Q3HA 4DR1Q 2K5UA 3GLHE 1L4YA 5IK2D 4A8JA 1GG2A 2ZE5A 3G4SA 3QEOA 2XZOA 1KAOA 2F52A 1EFUA 5AWFC 1ZIOA 3CX8A 4Q03A 2PCFB 1E9EA 3GMTA 2ODNA 3AF2A 3L7ZC 2OBMA 4GOXA 2VNUD 1W0JA 4LBWA 4RFSB 4A0GA 5JEDA 2A6ED 3SQXA 1IZ6A 5FL7A 4D82A 4MYUA 2R7ZH 3OPOA 1MIUA 1PLLA 1NBMD 4A8JB 4A3JH 2XZPA 2UUAL 4AG5A 3BB3A 1XBTA 2P6UA 4MGIR 2FEOA 3DMNA 4MQBA 3U50C 5H8WA 1E96A 2K4KA 3B2EA 4Q7MB 4RJLA 4DV5Q 4QKQA 2NG1A 4TMWA 5LMNL 1ZUIA 1X56A 3I72A 1XX6A 2BBSA 2V7QA 2YHSA 4Q4JB 1VQLA 3T1HQ 2H5EA 3ASZA 2OAP1 3IILA 1CR0A 5IT5A 2UU9L 4RZ2A 4D4JA 3U2QA 4NTZA 4F7WA 2ZREA 1QJOA 2QE7A 2QN6A 2UXBQ 2NPFA 3OAAA 4LF6L 4GN3B 1P2TA 1E0KA 4JLVA 1ZU5A 3D0FA 2NGRA 1U90A 1UKYA 1XFAA 1ZC4A 6Q21A 4JBKA 2WIAA 4IVRA 2F1HA 3PUWA 1SQ5A 1T5IA 2HCJB 3N6RA 4DWJA 4OI4A 1AM4D 5IF9A 4OXPA 1XCPA 4R4QA 1NY6A 4GOKA 1WBDA 5IY0A 3NDPA 3I61A 3NBXX 1NNEA 1JBKA 4PPGA 5K36G 2VPPA 3Q8DA 2R93H 2XXAA 2JA7G 3AQQA 1FPMA 1KI6A 3QVUA 3T1TA 4M1WA 2OG2A 4DLYA 3I4OA 3AM1A 1C1YA 1EWRA 1ETUA 3BB1A 2K52A 4OK6A 5GAGC 4RVCA 3RS3A 3FFBA 3BERA 1IXRC 3U4QB 1XJ0A 3P27A 5CM9C 1IBKL 5M3FH 5GROA 1E2FA 5DI9A 421PA 4B6FA 2FH5B 2XOKD 4DNTB 1YR7A 1HQCA 2A5JA 4QBGB 5JHHB 2BMFA 1XPRA 4A3GG 5C1BA 1ZKOA 4FDBA 1Q21A 1HNZQ 4TVAB 2IXFA 3A1TA 4PO9A 1KD1C 1RW4A 1FFHA 4QGGA 3TMKA 4LCBA 3M85A 2IYZA 1E2IA 4OI2A 5BR8L 2TMKA 1R10A 2DB3A 4KLKA 2ZRAA 3QPUA 5G3YA 1YVDA 1A0IA 4ALPA 1UEIA 5F2EA 4CVNA 2HYDA 3TR5A 3BH7A 1NLFA 2A5DA 4FMCF 3FKSD 5FJ8H 1EIFA 2WPDD 3CAMA 4A3LH 2NVTH 1EFTA 3AEZA 1P6XA 1EFHA 3BZCA 4BXXH 1EESA 2FE4A 3AKCA 1BBWA 5DN6A 1U8ZA 4YCWA 2ZEJA 3VFDA 3EZ9A 2VP4A 3GLIE 1H9MA 2BJWA 4HDCA 5FPSA 4AKGA 5IE8A 2GF0A 3Q5EA 1VHTA 3EQLC 2J7PD 3NHAA 4LYFA 121PA 3CCEA 2HT1A 4Q7KA 3EW9A 4HB4A 3M6AA 4CEJB 1VQPA 2JDIA 3PO2G 2E2IH 2MMGA 3DM3A 1Z3IX 2P5SA 4PPFA 2K50A 2WOOA 4P73A 2Z6VA 4HZUB 1VQIA 3LAWA 4RD3A 5GJBA 5EXPA 1TUEA 4P72A 3QNUA 1H9SB 2CL6X 4B3TL 1SXJD 4EFNA 2QT0A 4AY2A 1FGUA 1G8GA 1UE5A 3SBDA 5KDOA 4FIDA 1M8PA 4EJSA 3AKEA 2FFQA 2JJQA 4B3MQ 4A3MH 1NMZA 1ZD8A 1HH2P 1VQ5A 4TL8A 2GXAA 2WAYA 1Q12A 1HY3A 3LD9A 4KODA 2QMOA 4BY1G 2DN8A 1E2EA 1IXZA 1M1YE 1UE1A 1JEDA 2QAJA 3AF3A 4A8JC 1JB7A 5L3SA 3T34A 3WP0A 3OEEA 2V4ZA 2WMNB 2KBEA 1QVAA 2PEZA 3ECCA 1LM0A 3ZS9A 1JT8A 1G17A 1KDPA 5M5YH 1T3SA 3DMDA 4QHYA 2D74A 1Z22A 4LJ6A 1XU4A 3CH4B 4GPTA 4PAOA 5SZKB 1B9NA 3TE6A 3NENA 3W8NA 3L0SA 1XEXA 2YOFA 2A9KA 1DAHA 1DAKA 4GKJQ 4A92A 4NL4H 3NBYC 3FMPB 4DT1A 1TXYA 3AVQA 4Q66C 4TKOB 2ZRKA 4W5HA 2UXDQ 4JV5Q 2X77A 2AHOA 3UATA 1JE5A 4BQSA 3AH8A 1NLYA 2HXSA 4KLZA 1JAHA 1ZINA 2ZJ5A 4O2LA 2OCPA 2OQKA 4BBSG 5FTMA 1EGAA 3EA0A 2WKPA 1NP6A 2B8WA 3DL0A 4KV9A 3OEHD 1XP8A 3MWYW 5FTNA 4RG1A 1RIFA 2IY5B 2O8EA 1KHIA 1K3RA 1IBML 2OLKA 2UVQA 4KN4C 2CXXA 4A36A 2QPOA 2VHUA 5JFGA 1XTKA 5CDFA 1RE0A 2F3TA 3U44A 3OW7A 1QHSA 3HOUH 5D3QA 3GLHA 1N6RA 1E2JA 4GBMA 3RNLA 3EZ6A 4HAXA 4IPCA 2JQOA 3K09A 2WB1E 1CXZA 2R8RA 4MH0R 4PQFA 4PR0A 5KSYA 4B74A 2AL7A 2KB0A 2PNHA 2OV2A 2I1VB 4II7A 5K8LA 2XB2A 1C9KA 4G7HC 1Q90A 1KAGA 4HLQB 1OFHA 1VQ9A 3GJXC 5L8VA 2EFGA 2GCOB 4LPSA 3CR8A 2K33A 5AJWA 1TTTA 2A3RA 5UKDA 4L5SA 2N1BA 1XXHB 2NZJA 1ZJ6A 3ASYA 4D0LB 2WWGA 1J8MF 5CB8A 4B3TQ 1II8B 1IXSB 1Q44A 1DARA 1A4RA 3BZKA 1JNYA 4HR7B 4DNIA 3GTPH 2J7PA 2ZJYA 3EG5A 3QE0A 4A3CG 1TEVA 2ZRCA 5IYDH 5ELOA 1XTJA 2A5YB 3QJYA 1D8TA 4BLRA 3PIRA 3Q7PA 1O3YA 4RMFA 1KJZA 1ZNZA 4IDHA 1B8AA 2ASBA 3P26A 1N36L 1W0KD 1DGSA 1OIWA 2QQEA 5LD2C 5DNYB 1HUQA 4M2LA 3HWSA 2IHBA 4HJ8A 3BDOA 5JJKA 1HH4A 1WQ1R 3MCAA 3IFTA 2ZSAA 4BBSH 3RZOH 1WFQA 1CLUA 1UDWA 2NOAA 3PUXA 1CKOA 2C9CA 4IRUB 4KJZA 4A4DA 1E94E 4DR5Q 5EXXA 1G6HA 2ECKA 3U3MA 3ICEA 2NVQH 2G0NA 5TB5A 3D7MA 3EC2A 3FHWA 4M1TA 2E5LQ 4K8OA 2CCKA 1GOTA 4Y52H 1W2HA 3U4VA 1EYGA 1NJGA 1T6NA 1NI3A 2FPKA 2RGGA 4JV5L 3QPWA 4DSTA 3GJ5A 4BLPA 3AFPA 3HOXH 1Q86C 1KMHA 3SJZA 1FR3A 2EQBA 2JXMB 3S1RH 3EIVA 1A7JA 1G7TA 3L82B 1G41A 1N6KA 2GAAA 1TU2B 1OXTA 5FTKA 1S96A 3A5ZB 1QZGA 2G77B 4N0DA 2JK8A 4KFTA 2VL6A 4YHHQ 1FX0A 1GP2A 3RHFA 1MH1A 2J7KA 1HE1C 2GEUA 3T61A 2JAQA 3H2YA 4LV6A 1AQYA 4US1R 2RGBA 2UU9Q 3EA5A 2VF7A 1VIAA 4G5SA 4BFSA 1M7GA 1KJYA 2CWAA 1X1SA 4LHVA 3OIYA 1BO6A 1U94A 4FINA 2ZI6A 3FHCB 4LJAA 2DWPA 4DKAC 1B23P 5SZHB 4O25A 5KTYA 4LUCA 3CX7A 4FMCB 2UUCL 3TS0A 1H8ED 1VYUA 4QFMA 4Q1DA 3SFVA 1G8YA 2GEDA 2JLXA 5CM8B 1FYCA 1D5CA 2XTIA 1N33Q 2E2JH 3IPYA 5AR1A 3HOUG 1Y1WG 5CJ2A 4B71A 5FFMA 2YKGA 2GNOA 2JGNA 3PFIA 3CRVA 2REBA 1W46A 1N6PA 3GCGA 1UBGA 3U6BA 4G01B 3GJ3A 1I6HH 3L2OB 4DV0L 3IO5A 1YHAA 2GZHA 4X62Q 4A3DH 3NELA 4A3FH 2FJUA 2JJ2A 3K9HA 3Q72A 4O0MA 3FKSA 4YHHL 1RRPA 4OJKA 2FFHA 5EQTA 5FLMG 2ZSEA 4DCSA 2CDNA 4HEJA 1LS1A 2OO7A 3RN2A 2OFOA 4A3KH 3IQWA 5LMNQ 3LBHA 4PSKA 4QC2A 1E1RD 4V0NA 3LW8A 5M3MH 1EX7A 1DCZA 3S17H 1YR8A 2GBLC 4TMTA 3TEHB 1W1WA 3KKQA 2G1JA 3A4NA 5D3MB 1UKEA 1GUSA 2L5TA 1O87A 1W2GA 1IN5A 4NXMQ 1TQ4A 2G0TA 2D2CC 1DE0A 3KF6B 1E2NA 1U8YA 1XZQA 4DV2L 2VF8A 4DLUA 2OTJA 1RC8A 2FOLA 4X8MA 2KCTA 2Q2HA 1FQJA 4GNKA 1HZ9A 3ZZTA 1U0JA 4NPSA 4Q4LA 3GP8A 4OI0A 3A8TA 1PJRA 1VCMA 3PITA 4U5XA 1X86B 1ZM4A 4AC9A 3OIUA 1E6CA 2LWIA 5IYDG 2NO1A 3E5HA 4PC2A 2IX0A 4DPGA 2H5XA 1BKDR 1U8AA 4LW1A 1OF1A 2ONKA 3NKVA 1HT2E 1UBCA 5KSOA 1Z08A 4CW7A 1G3MA 2WAQE 4DV0Q 1GNPA 1LNZA 5IP7H 3QBTA 3ZVLA 3T1YL 1YJWA 2JA7H 1U98A 4D80A 1H9KA 4C30A 4EIWA 4DUYQ 2VP2A 4PO1A 1KNQA 1XMVA 5BW8A 3D3QA 4I1VA 4KLNA 4MA4A 2XJ9A 1MABB 3LX8A 4PAMA 3AP3A 5BN4A 1RKBA 3IUYA 3TW8B 4BRWA 4PAQA 1L1OC 1HNZL 1KI6B 5CITA 2QBYA 1P3JA 2RGXA 3M4YA 4HAZA 5CIWA 3KTAB 1IQPA 1FL9A 1AE3A 2VHJA 2P3SA 1R5OA 1KXLA 4NYMR 3C5CA 4LF9L 4A93G 1BIFA 4LHZA 4D6PA 3I7FA 3THYA 1D9XA 1E99A 1XD2B 2AXNA 1LV7A 3BH6A 4LWZA 4BZPA 1OW3B 3AVOA 1IXRA 3SGIA 3KXLA 4HIDA 1NMFA 2PMZE 4JI0Q 4LF5L 4JBYA 3CCUA 2IX1A 1NJFA 3ND8A 2KI5A 4RFVA 2BH8A 1Z2AA 4A3LG 3FKIH 2XB4A 3K9GA 1HR0Q 2F55A 2WVJA 1HNWL 4ILEA 2PCLA 2DWQA 5H68A 2QAGB 2IC5A 4K0KL 4Q4AA 4LBZA 4D0GA 3GLGB 2V1UA 1VQBA 3Q85A 1Q81C 3WY9A 1B0UA 1K83H 4OGQC 3U4ZA 1E79D 2XNDA 3TUZC 3W8RA 2EDGA 3SE0A 3B1ZA 2QEQA 2WB1G 4Q5IA 1TAGA 4QJ5A 1G8FA 5TXGA 4BWYA 2A7QA 3L0OA 2LKCA 4TN1A 5DSZA 1WRBA 3EPLA 4DDTA 1SLJA 3ZZ0A 2PJRA 4NCKA 3LX5A 4W9MC 1XMSA 3CR7A 4LJYA 1J2JA 5EE5B 3VTKA 3WHLA 2O8EB 4GOPA 4OQXA 4LFBL 4P0TA 3PF5A 1YHQA 4R4CA 2ANCA 2E74C 3GTQH 3RRYA 1E9DA 1JR3E 1W47A 2VP6A 2YOGA 4DR7Q 3TUIC 5C0XG 1GO3E 1PFSA 1EX6A 1H9JA 2E76C 4BECA 1X65A 5M3MG 4DAMA 5JSZB 2FPLA 3ZQ6A 1KI1A 2IX3A 4DUZL 4AYBG 1FTSA 4A3MG 2BJVA 4TMZA 4BZXA 4JI7Q 2J0VA 2CNWA 4MKFA 1E0AA 4C0AC 1TU3A 1AS3A 1TNDA 2IYRA 2FFBA 1CRPA 5C4GB 4JL8A 1RRGA 1DD2A 1AH9A 5F98A 4V0ME 1VYVA 2OBLA 3ND9A 3I62A 4JYAL 1D2MA 1YZTA 5SZIA 2ZTCA 3K7UC 1Z06A 1LUZA 3VU9B 3EN2A 2ZVPX 1Z07A 3A5UA 1D2NA 3BJIC 3TJZA 4WJ3M 2QY9A 2E87A 1EFRD 5EXTA 1E1TA 3B5JA 1Y69U 4JI5L 2QEXA 1LTLA 3GTMH 4IEEA 2NZOA 3DXJC 3VQTA 1X8LA 4EJSC 3WYAA 3G0HA 1W3SA 3D6TB 4AK9A 3CCRA 3HPQA 2IUTA 4UP8A 1NSTA 2GF9A 2WJVA 3L0PA 4M1KA 1S3GA 2Q9AA 2FGJA 1JJ7A 3SNHA 1E32A 2FN4A 4WZAE 1SXJE 3KJGA 2IYXA 3KKOA 1EK0A 5CYOA 3KXIA 3I8XA 4FN5A 3FWYA 4TT3A 2EJGC 5D3MA 4DC9A 4DRZA 3HOZH 2VQEQ 1KL9A 2ZQ5A 4OX9Q 4DBLC 4POFA 5HZHA 2ZXUA 2O8CB 1OHHA 1P73A 4AG6A 2ZAOA 4JI7L 2YTYA 4NXNL 4HJ5A 4HJ9A 1F48A 2WSMA 3KUCA 5JWHA 3DOFA 3W6PA 2RHSB 1IBMQ 4HZIA 1MV5A 5C44H 4HLUA 4MGKR 4LK2A 4A3EH 3AF0A 2B8FA 2EIFA 4LJ7A 2UXCL 5CK5A 1VQEA 2XJ4A 1Q0UA 2ZRHA 4LC1A 2O8CA 3CF5A 3AVYA 2WWHA 3DZ8A 1SGWA 1LW7A 4KKTA 1SVSA 1LF5A 1LS6A 1XD9A 1RYFA 2BM1A 2H16A 4JI2Q 1S1MA 4Z1MA 1ZAKA 4OHVA 1R4AA 4OQMA 2CW0C 1IBLL 2D06A 2GTPA 1GUGA 4JLKA 3LBIA 4OQLA 4Q47A 4BLOA 4GLXA 2WP8J 4P74A 1VQCA 4LNQA 3AUYA 4PZ6A 1G5RA 1YZKA 3EX7C 3A7AB 4KFSA 3H94A 3GFPA 2B29A 3VKGA 4JLAA 1Z0FA 3KKNA 5FOUA 2NZHA 2BBTA 4YWKA 4R7ZA 4EQ6B 3CRW1 4IOJA 3K0FA 4YY3Q 2KWIA 2O8BA 2MSCB 3FFAA 3BC1A 3O47A 2VH5R 1YBYA 4Q1EA 4OO1H 1J99A 5J3BA 4PX9A 2PL3A 2XEXA 1CU1A 2YC2C 4YLGA 5HCNA 2XGTA 3WWVA 3RZDH 1T8TA 2VHTA 2IUSA 3KZ1E 3U5ZB 1FJGQ 1IN7A 3MUFA 4IOLA 2GXUA 3PG5A 4FMDF 4C2TA 2R6DA 1ZNWA 3C16C 2JJ2D 4TLBA 5BXQC 3HOYG 1AE2A 1P61B 1N8RC 2A5FA 3KOJA 2H17A 2RKOA 2JJ8A 4E09A 1NN0A 3H4MA 1XNQL 2HIXA 1VG8A 3T5DA 3TVTA 1A2BA 2O8DB 2ASEA 4RSGA 5L3VA 2MO1A 3TSZA 4R4TA 4BA1I 4BRUA 4DDUA 3VKWA 4QIWE 2LCFA 4TYNA 4JI3L 1H65A 3BFKA 4LSGA 3QIAA 1NBWA 1Q3TA 3F2CA 1TKWB 5GVSA 3B9QA 4UNQA 1YQTA 5FBLB 2Q2TA 5JHGB 1X3GA 4B3ML 5F9FA 4LWCA 1QHYA 2GXQA 5FJ8G 1EFRA 2F7SA 1YNNC 3GLFE 1NSFA 4GT1A 3L2PA 4M22A 2ZRIA 2BKUA 4A3JG 2B6HA 2HLDD 4E22A 3RSLA 1CUKA 3K0XA 2AK3A 2CHVA 3AV0B 4MRNA 3CD6A 1VCNA 3A1SA 4X8HA 3MD0A 2H18A 3GJ8A 5FPHA 4EX5A 3TREA 2CK3A 3QKRA 1SFOH 3M3YH 3H86A 4B2LA 4TZ6A 2ZRBA 2ZR0A 2J0UB 3HR7A 1A62A 1YHNA 3SZRA 5J4YA 1GJXA 3NXSA 1ZP6A 4FXPA 4GKKQ 3NIBA 1VQAA 4HIMA 3I4NG 1S3SA 4NCHA 3O8CA 5M5XH 2C03A 1OYYA 1SHKA 3BB4A 3AQ4A 3T53B 4LY6A 2C9OA 4C2UA 3LGJA 4KI0A 3CLVA 2YWGA 4C0SA 4D4MA 1XMOQ 3VHXA 2BC9A 1IYVA 1EFCA 1Q1QA 3K8YA 1L7VC 1P62B 3EPKA 3I8SA 1E9BA 4M0LA 3W34A 1KC8C 1ZD1A 4Q4HB 8OHMA 2Z5FA 2PCJA 3I5YA 2J59A 1BYIA 1P7CA 3HYRA 4NB3A 1YZNA 3EWSA 1PH2A 2IEZA 4IDPA 5IYCG 3K0FB 4FCTA 3H0GH 1HTWA 2O8BB 3CQZH 2DFLA 2EWWA 4BFZA 1GL9B 4GNXC 3ZDQA 1YU9A 4DUGA 3EZ7A 1I2DA 4I4LA 5FOWA 4KMUC 2V3CC 1J5EL 4CF7A 2DY1A 2AD5A 2R2AA 2KENA 2LKDA 3UG6A 2E1RA 1YEZA 3UE1A 1T0JB 3QVVA 1IJFA 4GI7A 1A2KC 4CEIA 4BZQA 4DV7Q 2VSXA 5EZ6B 1R6BX 4HUQA 1VIYA 1IYUA 1D7QA 3GLFA 3U7HB 1TWAH 1A82A 5IWAQ 1HNXQ 5EE0A 4LZZA 2QG6A 1YKSA 2JLZA 4M1SA 3CZQA 2UUAQ 3AUXA 1CBUA 4MKIA 2V4DA 2HF8A 2P5TB 1F2TA 4BXXG 2W58A 1FTNA 1E9RA 1IW7D 3M4QA 1NN3A 1R5NA 1WDTA 4H1UA 3DO6A 4PSAA 2MSEB 4Y0AA 2Y0SE 4AIMA 1ZVQA 3E9IA 1HYQA 2G3YA 3IO3A 4UPAA 2IW3A 1OH6A 1OKKD 3K0SA 5EE1A 3U6KA 2A68C 2JEBI 4QBHA 3BS4A 1F2UA 1YITA 1KDOA 4GP6A 3SYNA 1J5EQ 3OOCA 2GN5A 4TL7A 4MYTA 2R93G 3GJ6A 1NG9A 3N2EA 1X1RA 1N6LA 5EUMA 5CDFE 3JVUA 1H8HA 2F4VL 4KO8A 1P75A 2ZM6Q 1NVVR 1Z5ZA 3VX4A 4JBWA 2E2HH 2AX4A 2W6IA 2ZYTX 1UPTA 4TYQA 4ZDWA 2IWHA 3G82C 2AFHE 2FPMA 5TMPA 2ODBA 3G5UA 3C8UA 3ZIAA 4LF7L 4GN5A 4A9AA 3I2ZA 3I3SR 3W5OA 4LFAQ 4KHPQ 4WIAA 2P6NA 4DEXA 4PHFA 3N5CA 3OIVA 4OK3A 4BY7G 1AQUA 2CWPA 3C14C 1A1VA 1GKUB 5DLQE 3ZH9B 4MYHA 4O3MA 1CR1A 4NYMQ 1TMKA 3KDFB 1AIPA 1GHJA 1OV4A 1XMQQ 1I3QH 3BOSA 1KI7A 2G9NA 3CNOA 4DDVA 1K5DA 2FEMA 2GK7A 3EBEA 2WBLC 1PH7A 1T91A 1EQQA 2UUCQ 4XVQA 5IYCH 1N32L 1IJEA 1SXJA 3DM9B 4C4PA 5DI3A 3PIPA 1X8JA 2Y0SG 3MGCA 5A4JA 1BKBA 3TRZA 2P65A 4NKRA 3QXHA 3REGA 4WOPA 1X6OA 3EWAA 4Q1AA 2BWJA 4JJKA 4BBRH 4B3CA 2K75A 2ZANA 1K8RA 1CTQA 1XEWX 4X66Q 4JVNA 2VW9A 4HAWA 2Z43A 3SN6A 1ODFA 1KK2A 3OTOL 3CRMA 1ZYRC 4AI6A 4JI4L 3JAMc 4JYAQ 2JATA 2W6ID 2AK2A 1TUIA 3R9XA 3CUEF 2YYZA 5A0FA 4ZCMA 1SE8A 2PQAA 1I4LD 4LFCQ 2DBYA 4GP7A 1J7KA 1V8QA 2D62A 4LUVA 1K73C 1OFTA 3S1AB 4ZDKA 5J40A 3J80c 1Q57A 1ZC3A 5JEAH 1E1OA 4ESVA 1XTRA 1N25A 4M21A 1OKKA 2I0QA 1N2CE 2YTXA 1HV8A 2RGDA 1KI9A 2IS2A 3A4MA 5M04A 3VHLB 3FPAA 4H9GA 2P0EA 3LA6A 3VX3A 4DHEA 2F1JA 3SR0A 4L5QA 3PUVA 1P2VA 2GVZC 1DAGA 3IBGA 1FUKA 3Q3JB 3RVBA 4CYMA 5FBVB 4E03A 3LY5A 4YDHB 1E1QA 3AFQA 5KNCA 1QZHA 5FUXA 4DB2A 5B30A 1II9A 2PZEA 4C0JA 4CDGA 4KAXA 1S9HA 1WCMH 4ERNA 1I94Q 3K8AA 1KI2A 4EQ6A 2W6JD 4OJQA 2ZYVX 3PUZA 3B7GA 3DEFA 3KKMA 4TSFD 2OCBA 1N6NA 4LJ8A 3TR0A 4KN7C 4B2PA 4F38A 5C4MA 1QG4A 1IBLQ 2RGNC 4HB3A 4LPKA 5B57C 1XMJA 2ORVA 2KCMA 2I5HA 3J81c 1M34E 2ZITA 3PEVA 1G18A 4JLNA 4L5RC 2W2VA 2N49A 1YRAA 5TY0A 2IHEA 3X1WA 2AMCB 4DUGD 1N5JA 1TWCH 2Q9BA 1G291 3UDIA 3SHWA 2GZDA 1KYIA 3A8JE 3UK6A 3WXMA 3U7EB 1ZU4A 3U3RA 2YWFA 3DKVA 3DPUA 4XWAA 3SYKA 5IYBH 1PYSB 2ZUBA 4EDHA 2HIVA 4YCUA 3IRBA 4C0BA 4Z8YA 1FL0A 3LVRE 2ODEA 5C4XH 3C4JA 3UANA 1NMYA 3TQFA 3HFZB 2FU5C 2ZT9C 1G21E 2CNWD 3VNUA 4OQFA 2ZJAA 2GJ9A 5FI0B 4KFRA 4XVRA 2B21A 2BEKA 3H3VH 4I1OA 2ZJPA 2NN6I 4B35A 4LUOA 3M7NA 1LABA 3F8TA 1IL2A 1BVSA 3HU2A 4JYCA 1Z6TA 5GAHC 4RY2A 5JECA 4LHYA 2V1CC 3MEFA 1ESMA 1COWA 2CVFA 2IYQA 3GLIB 1PUIA 3NEJA 1VQKA 2UKDA 1GM5A 1HE8B 1RYHA 1XTSA 1SKYE 5F3WB 3SJBA 4KCGA 3WMGA 1ZNYA 2ZE6A 4FCVA 2PEYA 1PA6A 2CEAA 1WOCA 1KO5A 5HTKA 4URVR 1BS1A 1X3SA 2AN9A 1V5WA 3NG1A 1XCGB 2ZI9A 4A2WA 1CR2A 1HURA 2QGQA 4EFMA 5GJWC 1GL6A 3GTKH 1JI0A 3TNFA 1SVOA 4DIEA 1T9HA 1OE0A 3QBVA 4URWR 4A3DG 4IJHA 1YJ9A 4WBSA 2XZLA 4AKEA 2XSZD 3CX6A 3TUJC 3WNBA 5A35A 1MRNA 4Q1BA 3ZJYA 3FB4A 4EPVA 521PA 3Q8XB 3VU9A 4QY7A 3QKUA 3PO2H 2GHIA 1SKYB 3HOVG 1G3IA 3PV0A 2I1QA 4X65Q 1KDTA 4Q1CA 1ZIPA 4UJ5A 4WXPA 4R1JA 1VQDA 2HHHQ 1G6OA 5FR1A 2RMKA 3SYLA 2AKAB 4Q4HA 3L8YA 3PEUA 3S15H 2EU8A 3LBNA 3VAAA 4DLSA 2XTNA 4NH0A 1IHUA 1CKNB 4Q7LA 4YXWA 1FMLA 4YMVA 2ODWA 2F1IA 4KKUA 4LF4Q 2WPDA 3H84A 4AYTA 4D81A 4DR6L 5LMUQ 1G7SA 3CF2A 5EE9A 1AKYA 3STBC 4JLOA 2D7DA 2VO1A 4AYBE 2VZAA 1E1QD 1OT3A 1XD2A 1W4CA 1ZM2A 2QRNA 2B63G 3TS2A 2ES2A 1DS6A 2GZAA 3IQXA 3M4PA 4A75A 1YR9A 1Z6AA 5TDHA 5B64A 821PA 1V9PA 1HR0L 1S8FA 4Y0VA 1HNWQ 5BQ5A 4AD8A 1VQ8A 2VQFQ 2O8DA 2ZR7A 2A1AA 1DAFA 1UAAA 4PXAA 2B8GA 1W36D 2C04A 3U44B 1Y1VG 4CEHA 5ELNA 3NBFA 3VR5A 2DPXA 3F0TA 3A8KE 2RCNA 4X6AH 4AQYQ 3B1XA 4FMBB 5P21A 1TF2A 1AKEA 2ZTDA 2HHHL 3KF8B 4JCVE 4PPQA 4UXHA 4QXAA 1KHTA 5KYKA 1N33L 4Z1MD 1Y8NB 3E9HA 2H92A 4R9UC 3UPUA 3I55A 3CPWA 4IDOA 4UXIA 1E2QA 3AVTA 1ASZA 4DV7L 4HDQB 5JWOA 4B3GA 2C78A 3BE4A 5DLQC 3X1DA 3T1OA 4Q4JA 1KY3A 4ZIRA 1E3MA 3THXA 1F2UB 4JC0A 3I4LA 2QRZA 3CPHA 3ZVNA 4PG3A 2I5MX 1KK1A 1GZSA 2FSGA 2O0HA 1OTCA 2DFKB 1NKTA 5DHAA 2NN6H 2MNAA 1RFLA 1E2GA 1TU4A 1XXHE 1SR3A 5AJ3Q 3T35A 1EUJA 1K0RA 2CJWB 4G5QA 2YINC 2IYWA 2ZJZA 2PPBC 3KXKA 5E7NA 1G19A 1Z9FA 4EPRA 1IBKQ 4OBEA 3KQLA 3SOPA 1DEKA 2ZRJA 3RYTC 5LPNA 1A8VA 3NE5B 3ER0A 2VBCA 4Q7JB 3WDNA 3QOFA 4P71A 3FDIA 4HDOB 3RSOA 1BH2A 1O78A 2JLQA 2W00A 2DUDA 3IHWA 5BR8Q 2A8VA 4YQFA 3IBYA 1E2ZA 5AJVB 1S4QA 4GNXA 3PCRB 4V0KA 3T1QA 3HU1A 1VQFA 4EPXA 5GADC 2IEYA 3GLGE 2WV9A 3N2IA 2GVDC 4HIKA 2FSFA 1W0JD 2CFMA 3GD7A 1KDRA 2NO0A 2ZSBA 3QXSA 2K14A 4EUNA 1G4UR 1YR6A 1P16A 4RKFA 5B2ZA 1YZ6A 4LX0A 1Z0KA 1HCZA 4YWMA 3HOWH 1VQJA 4DNRB 1QVCA 1RIPA 4O2DA 1N34Q 1SVIA 1WXQA 2BEJA 3C7KA 3FHOA 3HJNA 2QGNA 3KQHA 5EE3A 4EAQA 1TADA 5KO2A 1T3LA 4MKGA 5IT9c 2D5DA 1KSJA 1N5KA 4NCNA 4PC1A 1A5TA 2ZSFA 4RZXA 5JJLA 4TTRA 1XTQA 4ON9A 5AUPB 3N70A 4BGDA 2XX3A 3K09C 5CJPA 1TF7A 1RZ3A 2QI9C 5LD2B 1YNXA 3JC66 2WAXA 5AUOB 1U9IC 4NONA 5IP9G 3SI7A 5KNBA 1GL7A 3X1ZA 4UJ3A 2KA7A 4IXNA 2XNSA 2H7VA 1EWIA 1OIXA 4DR2Q 4IW3B 2WSSA 5GQOA 4M9SA 1VQOA 3HOZG 3PVSA 3PSIA 4AIIA 3SC3A 1CRQA 1WP9A 4IPHA 3AB9A 3QKTA 3TK1A 2GVBA 1F60A 1OB5A 2GETA 3VA7A 3JZAA 4LBYA 2OSBA 4ASUD 2WMOB 4YMTA 1O7LA 1EWQA 3GEHA 2B8TA 1PV4A 1S72A 4DCUA 1YJNA 5FBQB 4IFDG 1E9FA 3K9NA 1GSIA 2LSSA 1US8B 4RD1A 3UDGA 4TQAA 3RDPA 4B44A 4XTCS 3A8IE 1Y14B 2FZ4A 4EQ5A 4NCIA 3FHTA 1JQJC 3F1ZA 1XTIA 4JS0A 2F6RA 3FMOB 3FTQA 3MLEA 1M6NA 4D4LA 4QGAA 3R7WA 4B3DA 1VS0A 1E2MA 2CL0X 2EW1A 3NC1C 4MUAA 4XJXA 4MGZR 4B33A 1WYDA 4XD7D 4HJ7A 2VTKA 4OWWB 2OHFA 4LOAA 4JVSB 3QI2A 5DIFA 3PEWA 3Q9LA 1GUOA 5BN5A 5KSPA 1T5EA 4HLDA 4GOPB 1Z0JA 1BDOA 1ONLA 4DK6C 2ZI4A 4PC7A 4BUJA 1QHXA 1SXJC 1RL2A 1KZ7B 1Z8FA 2BCJQ 3IEVA 4DR3Q 1X54A 1F3OA 3TLXA 4BFVA 3BG3A 4IDQA 3UIEA 2Q3MA 4OWTB 2BOVA 2HXYA 5FPTA 5LDDC 4CT4B 3ZD6A 4BFTA 2WJYA 2AD1A 1KI3A 3PR1A 3D8BA 1JR3A 3U58A 1MOZA 4UNNA 1D6JA 4P4TA 3SU8A 1KKLA 3ICQB 1XXHA 1UKVY 3I4MH 3W3AA 1P8LA 4DV4Q 5JI2E 5J5CA 2ZRNA 4JI5Q 2ONJA 4DK3C 4JLDA 4R4OA 3HOWG 2IF0A 3I5XA 4JT2A 4M9ZA 5CIQA 3W1GA 1TPZA 3QPVA 3MSXA 1AZSC 1HTPA 1MJEA 2PBRA 1GDDA 3K1JA 1AK2A 4P32A 1U5KA 1EIYB 2A5GA 5E4FA 1VCOA 2K5NA 4IFBA 1COWD 1R0WA 3RABA 4K81B 2O0KA 2WIBA 4HLCA 1IY2A 2FWRA 2FFAA 3QKRB 4TQUS 1SULA 3TW4A 4DUZQ 4BFWA 1LTQA 1ZNXA 1L1OA 3ULJA 5AUNB 3ADBA 3CP0A 1DAEA 3FKIG 3CRQA 2ERYA 4DVGA 2JA8G 3RS4A 5EP3A 1Z47A 1Z29A 3CMAA 3PENA 4IDNA 1YHBA 4XH9B 1FVIA 2N8NA 1WCV1 2MO0A 3SDZA 2IL1A 2QP3A 4IHQA 1VCIA 1Q1EA 3HYTA 4MGYR 5DGXA 1YI2A 1VHLA 1W4AA 2WWXA 4U00A 3J7A5 4C7OB 2B7BA 3KJOA 4JI2L 1CS4C 1T8UA 2J87A 3LVQE 5FOTA 3W6NA 3W9YA 4OO1G 3UKDA 3WYGA 4AYWA 5FOXA 4B73A 4DCTA 4EPTA 5JRZA 4DSNA 4IOAA 1XEWY 2AUJD 2K32A 3ZQJA 1SVKA 2PQAB 1PH8A 3MFYA 1IY1A 4DCNA 3NHBA 3IIMA 4XOIA 2PT7A 4RCYA 2A69C 1HNXL 2ZTSA 3S1AA 3ZD7A 2BH2A 2GCOA 4MITA 3STBD 3TAUA 2G6BA 3TBKA 4X64L 4S35A 3CPJB 2C5LA 1RRCA 1IN6A 2QSZA 2VP9A 4V0LA 4JVLA 2A68D 2XOKA 2XAUA 3RRMA 4B6EA 5DN6D 3PEYA 3FMIA 1XPUA 3QXXA 2PLRA 1XD8A 2JA9A 2EYQA 1GITA 1W0KA 2NQ2C 4Q01A 1SN8A 1XNQQ 4POGA 2Z4SA 4BPBA 4GRAA 2Z83A 1Q7YC 3KJPA 1XJQA 2CE2X 4OWXB 1U0HC 2BM0A 1SVWA 4DV4L 1AS0A 4A76A 2CCJA 1KRTA 1WE2A 3PIOA 1QHHA 2J41A 2IYLD 2VA8A 4X8OA 3GEIA 4Q00A 3QF4B 3F2DA 5KPDA 2CHGA 4G7ZC 3JVVA 3RS0A 1XMIA 1GFIA 3UDXA 1AS2A 1NVUQ 1H9SA 4HSEA 3R9WA 1RJ9B 4AURA 4TYWA 2BKEA 3B1VA 2VS1A 3S24A 3A37A 1BOFA 4GOPC 2VLIA 4JI6Q 4A4IA 1KNXA 4EPWA 3AVPA 4H1VA 4A3FG 2UUBQ 4PTLA 1G16A 3TVDA 3KL4A 1SMYC 4JYBA 4DV1Q 5JMTA 2FXQA 1GNQA 1PUJA 2ANBA 2HJVA 1XNJA 1I50H 2ZAMA 1G8HA 2B3GA 2ZJOA 1TQDA 2E9SA 3QEJA 4NMMA 5G3ZA 4A6XA 4BE7B 1NRJB 3A1WA 4C3ZA 3THXB 1UFQA 4TLDA 1NN5A 1XEFA 2AKWB 3I1FA 5KSZA 1JR6A 4IFDH 2VUMH 1TL7C 1QDEA 3BGWA 4URUR 3WMEA 4DR5L 2OWOA 4JI1L 3T56B 1ZM3A 4LI0A 4BEBA 5JCZA 3ZJYC 1N5IA 3ULLA 1LACA 3NTUA 2GJSA 3OIWA 2OCEA 2R7DA 1YE8A 1N3BA 1XJVA 3K70B 5SZJA 4Y7NH 3NH9A 2JA6H 4ZI3A 4C3HH 2GJ8A 2QAGC 1Q82C 3KLRA 3BORA 4KYIB 3QF4A 3PXGA 4O0AA 1KOFA 1L2TA 4IPGA 3UWKA 4DZZA 2VQEL 3A1VA 3PJRA 1JQLB 4RD4A 1X6VA 4I1UA 3SJAA 4QOSA 4JVMA 2PMDA 1J70A 5C0XI 4GMDA 3A58B 2XXAB 3B78A 3IHLA 4A2PA 1PH9A 2W0MA 3THWB 3OTOQ 4IXMA 1PLKA 2CCGA 4DV5L 3LH5A 1UBEA 4JKYA 4XVUA 5JS8A 5BYKA 3D31A 4AH6A 2PI2A 5FL7D 2V9PA 1UWVA 1E0SA 2OTLA 2QMUA 4HIOA 3L8ZA 4IJLA 3T06B 2GA8A 3S16H 4ZKEA 1Z6GA 1EG7A 4IOCA 2KE5A 1MR3F 4JI8Q 4JBMA 1R0YA 4QGFA 4RZUA 4LF6Q 3K80C 5IK2A 4HUTA 2JIZD 2DFTA 4ARZA 1R0XA 5TVKA 4TTQA 1E24A 1H8HD 1PZNA 3GFOA 4KU4A 5G41A 3REFA 4A3KG 1Z0AA 4D4KA 1P2UA 5EJEA 2OE2A 5TARA 2YU9H 2IS4A 1E2PA 4DLVA 4D26A 1S1CA 4Q48A 3CB4A 1UM8A 4DB4A 1M7HA 1HQMC 4V0OA 5FL3A 4YY3L 1C7YA 1QHHB 2B92A 1LB1B 5IWAL 5IYBG 5G40A 4BBRG 1Z2CA 1E3PA 1CIPA 1T0HB 2ATXA 5JI3E 2J5XA 3VDYA 2WAQG 3J81j 1MRSA 3ONWA 2NVXH 1CR4A 1VYTA 4L5BA 3CC2A 4HJAA 4C3IH 4V0MA 1SVMA 3GLHB 3PQCA 2D0PA 4HYYA 2KSQA 1SRUA 4X65L 2Z0MA 3AF4A 4NE2A 4A0FA 1IN4A 1JALA 2DCUA 2QPAA 3BXZA 1HPCA 1OSNA 4KKSA 4PC3A 1G8PA 2RB4A 5JSZA 4DR4Q 4YONB 5HPYB 2JEAI 2ZTEA 1JEEA 1E4YA 2OEPA 3THYB 4NYJQ 2ZIAA 2ZYWX 3CMEA 1YZQA 3LNCA 3EAQA 4L9WA 4PO8A 3DDCA 5EUQB 4S2EA 2IK8A 3QQ5A 2HDNB 4OI1A 1QG2A 1NJIC 4ZDIA 4H02A 2QBYB 1FW6A 5L3QB 4L9SA 5FH9A 2PZFA 3LXXA 4KSBA 3LQQA 1GVNB 4DAYB 5AJYA 2L0XA 3QXCA 3T15A 2BE5D 2ZRDA 4WXRA 5C0XH 1JJCB 2CLDX 4WJ4A 1QF9A 1NMXA 3MJRA 2ZJQA 4DUYL 3AGQA 3NBHB 3RNUA 4OQNA 4ACAA 2OZEA 3I32A 3VR6A 1W5TA 4G5OA 1QHNA 2JLRA 4LRWA 4N3NA 2VSOA 1OYWA 1FP7A 1CTMA 5LMNW 4LBVA 5AUQA 3FMFA 2NVYH 4M1MA 4F91B 1NN1A 1ZYUA 2J9RA 3P20A 5BN3A 1PVOA 4PHTA 4TLEA 2EVWX 4ZO4A 1F6BA 5C0XJ 2ZS8A 3ZS8A 4DLXA 4OKSA 2C9YA 5JBQA 3B9PA 3RC3A 3S1NH 3J81i 2ZPTX 4TMKA 1VQGA 4DV2Q 2I5LX 2X2EA 1GKIA 4URYR 1J90A 1S9DA 5HZKA 4PZYA 1G20E 1OHHD 2BV3A 1H95A 2JLWA 2JLVA 2I3BA 2IXGA 3ERSX 4ARZB 4B76A 2CQOA 3GQBA 2B63H 1YJ5A 3UMRA 3V9PA 4L8JA 2GWHA 3BD9A 4P4SA 2ZROA 4DDWA 1OH5A 4GL2A 5IHPA 2IYSA 4FD2A 2AR7A 1G64A 3RC8A 2ZE7A 5EP4A 5HR5A 4J15A 3KJIA 2JJ1A 3CCMA 3S1MH 4YWLA 3CCQA 1I4TD 3HPRA 3HDTA 2KJQA 2OUKA 1OJLA 4LHWA 4B2IA 4AKHA 3GJ4A 3UMSA 2QA5A 4KXFB 4GKJL 1ZM9A 2R92G 4YCVA 2QTHA 3E2IA 4M8NE 1OIVA 3RS2A 4DSUA 4EPYA 4GS3A 3W1BA 2F1MA 1MJCA 1VQMA 1KK0A 1VF7A 1HZCA 1N5LA 2W2TA 2JE6I 2QP9X 3UDFA 1ZMXA 1N6OA 1YZUA 1NIPA 4LHXA 1G1MA 3HOVH 1JAIA 1JMCA 2V6IA 2ZJ8A 1DBSA 2HEIA 4NP6A 2KBNA 3I56A 3UMFA 2R44A 1WA5A 4LF5Q 1W4BA 1O7IA 4HZUA 2Z6KA 1XEXB 3BFXA 3JAMi 1KRSA 1NE3A 1NL3A 1TF5A 1X3EA 3A0JA 1XPOA 1NBMA 4QBIA 1JB1A 4LUZA 1ZUNB 4Z8XA 4L4UA 5EAYA 3B1YA 1W49A 1K8OA 3BFVA 1UE7A 1G9XA 1AGPA 2H1LA 4IKEA 1VQ4A 2ZVQX 3BIFA 3DM5A 3KJEA 1GKHA 2O5VA 4B3XA 3OESA 3T1VA 2X19A 4GKKL 4LYHA 4BFUA 3EPJA 5ANRB 4BASA 4JKIA 221PA 4Q21A 3ZGXA 4Q18A 4LFCL 1X55A 3FPPA 4OO1I 3THOA 2JCSA 5IRCD 2WHXA 4TYPA 3BBPA 4Q9IA 1LF0A 4QJFA 4LFBQ 1GD7A 1Y1VH 4G0NA 4Q1FA 2H8KA 3QUSA 3K81C 2V54A 4CRWB 2AHOB 3GTJH 2GDJA 3K7AH 2VP5A 3CF6R 1IOZA 5M3FG 5M5WH 1HT1E 4JK1C 2IT1A 1V1QA 2OESA 1KK3A 2IXEA 1YZGA 2VRWA 1L0WA 1K8AC 5FPKA 2P6RA 2ZJRA 1BMFD 1ZCBA 1T4GA 1N36Q 3RRNA 4LFAL 4X64Q 4NBSA 1OH7A 1E2WA 4B43A 2PMKA 3EIQA 5FTJA 4DK1A 5FOSA 5JEAJ 5HY6A 5JEEA 1OXVA 3HOYH 1XNRQ 1GUTA 2ZU6A 3RWMB 5FR2A 3FKQA 4I99A 2OT3B 4M4SA 1PH1A 1VQ6A 1F5NA 1R7RA 1HJPA 1P9WA 3GDEA 1XMQL 2CMKA 1ESNA 1QVRA 2GJAA 1E2LA 2WWFA 2YVUA 3TQYA 3GEEA 1NY5A 3ZYCA 3KUDA
chains in the Genus database with same CATH superfamily
1RACA 3D4BA 5JWRA 4F93B 2BFFB 5J63A 1QK4A 3USES 1RPNA 2CWDA 2Q8RE 3SK4A 1AA9A 2FMXA 2W6PA 4IIFA 3FWPA 4RTMA 3T7TA 4YACA 1KAEA 2BGMA 1P60A 3LKDA 1NI5A 4OB7A 1O8BA 3E7XA 4L1KA 2OAQ1 3BWDD 2OC4A 3GRUA 5T5QA 5JVDF 2DFVA 4IQ8A 4WGGA 1XV5A 2J9FB 1N7HA 1JG4A 1DWUA 1NYQA 2YNMD 1RVDA 2IPNA 3QTTA 2X6GA 1D3AA 3EQ8A 3C2QA 3IQHX 4Z53A 3CH5A 1RQ7A 1SYDA 4EUHA 4EM6A 2OXIA 1AQJA 2DGYA 1GRQA 4RAQA 4HQNA 2FY8A 1E0DA 3JQAD 2GHRA 3A3NA 3AUKA 4FOPA 2W5UA 4RH6A 1NJ6A 2DWUA 3TSSA 2F0FA 1A63A 3D4PA 3KAJA 3S2SA 3ZWNA 2PX4A 4X3CA 4BVFA 4RHRA 2A6PA 3EVDA 3R23A 3H87A 4FE7A 4TWZA 5I9MA 3ZWKA 5CDUA 5JPCA 3CXCA 1ZBQA 2JFNA 3UK7A 3JYQA 2EFHB 3TMYA 5CB4B 1IEXA 3FJOA 2PQ2A 2JCVA 1M6HA 1BE6A 4OHXA 1JR3D 2PANA 1Z26A 3FNIA 2D2FA 3MVEA 4IO1A 3WBKA 2NUTB 3K5LA 2Y9PB 2HK7A 4HMOA 4KXXA 4IEIA 5DXFA 4DARA 5BN1A 3RN5A 4QL5A 3CZMA 4XB2A 3P71T 4ACBA 1N2OA 2ZSKA 3HBAA 1TK2A 4G2TA 1UK8A 3GAMA 4MGEA 3MF4A 4IKPA 1QGAA 4NU0A 4ZAIA 1U9ZA 3NT2A 4TSFA 1KTVA 2EXZA 3EGEA 2JA2A 4U5QA 5F7JA 4JI6B 1LBQA 3K9LA 3TNDA 3VYTA 1E9CA 1JFLA 1M8FA 1N0WA 2AMVA 2DUUA 3OSZA 1TWGH 2VNKA 3OKAA 3RWOA 2HEGA 1O97C 4LV8B 4JI7B 4GMKA 2G9VA 1WV1A 1JJGA 2HN9A 4LJKA 4WI1A 4JL5A 4PZZA 3CE6A 3HCOA 4GGOA 4HUQB 4K6KA 3JQ9A 5JUWA 2ZBVA 3H0CA 3HUEA 1BS2A 2VYVD 4FX2A 2ZI5A 2YIDA 4DOMA 3W6OA 4A91A 4JLBA 3DBIA 3DS8A 1CUVA 3L8CA 5DYIA 2PLAA 2H4WA 5LJIA 4K26A 4NPHA 1OC2A 3LYUA 1HR0W 2F43A 2RGAA 4FC6A 4A2QA 1R18A 2D0OB 2YZMA 4RLQA 4ZV7A 4J0GA 2K5QA 4UOQA 4E08A 3CLSD 4PFSA 5IBPA 4EB3A 2G08A 1VGQA 3S15B 4ND3A 5FUBA 4A27A 3HJFA 3QX7A 4HG2A 4RV4A 1ELOA 1GCIA 1C5KA 3B1WA 1QOZA 3DO8A 1UMDA 2AEFA 3P9QA 2QUZA 4YI5A 2F03A 5I8ZA 4DJTA 1Y3IA 1LNQA 3DB2A 3HKCB 4DE5A 1D1TA 3MXNB 1YBHA 1C7ZA 3LOUA 4CM8B 3SQWA 5FLXc 2Z2ZA 2JCGA 3RIGA 1DXOA 4JG2A 1DO2A 2WZCA 3OZAA 1T6ZA 4MR7B 3FJYA 5D1HA 4IHKA 2JCXA 4JLPA 3BIWA 2JZCA 1RRCA 1G5PA 1L4HA 4M1YA 4HH4A 2VN8A 1WQ4A 1AQIA 3CC7A 3O94A 5FBWB 4EYEA 3OJOA 1BHO1 4QYIB 2QDKA 1S02A 4CLEA 1NVXQ 2YHIB 3IBTA 4F2GA 2I76A 3DCYA 2IHYA 1L5NA 4AX8A 3AHCA 3W5VA 4C78A 4JL6A 3ENNA 3ITNA 4W5TA 1P5RA 1RCVD 3RLNA 1AY0A 2W6OA 3DG9A 4LYYA 3TQTA 3UHOA 4GLVB 1BFUA 1F8UA 4LGMA 3WNVA 5CT6A 1IK6A 1L8LA 2EFDB 3BDAA 1M5UA 3KKKA 1CJTC 4B7XA 3TKLA 4XWKA 4KVGA 4TYYA 3U3OA 5BQPA 1Q95A 4XQJA 3OCVA 3A3PA 2A14A 5DO9A 3D1LA 2PUFA 4X92A 4DUYB 4CFSA 1UJNA 1FQWA 5SY9A 3K20A 4GYKA 4JFAA 3ZE1B 1WSDA 1N34L 4JQOA 5E38A 4LNAA 4HDNB 1G7RA 4LDJA 3S28A 4A6DA 1Q20A 2OR3A 4R5MA 3T3NA 1OI3A 1MIHA 4F5ZA 5C51B 5CCXA 4WN9B 3H1FA 3HB5X 2JA5G 1J0XO 1YIDA 4YJHA 1SEPA 4WZAB 4OYRA 1WB9A 4UEWA 2BBWA 3QWFA 1TM4E 4JI1Q 2YFHA 3O8OB 1M4VA 2EXDA 1X7ZA 3BU2A 1IYJB 5DU2A 2JA8H 2A4KA 3A14A 3G9TA 3N8GA 5K3AA 1C9MA 4WKNA 1SZPA 1V43A 5ADHA 1NE7A 1DXMA 3TPZA 1HUNA 1GILA 2XW6A 2RH5A 4RKRA 1RJFA 1R0SA 5HM8A 1NMGA 3HCAA 5A4FS 4F92B 1Y8ZA 5LMNB 1BJRE 1EZ4A 1SB9A 4MS4B 4FF4A 4HQKA 3FSJX 4WACA 5L3ZA 2WE8A 1FDUA 3WLHA 5J4LA 1P17A 4HATA 1DC3A 2YV5A 2WD9A 2G9RA 1XLUA 1Y5RA 1Y8RB 3QXJA 4QCLA 3LK6A 1TD9A 2WSIA 4V02A 4C1NK 1PI3A 2C3UA 4Y1RB 1CNFA 2XNDD 4Y6PA 3WB9A 4E5UA 1NYRA 4NC9A 5G53C 3H05A 1Y8CA 1NJ2A 1TX4B 1ID8A 1U0LA 1C4OA 3B13B 3HEJA 4ER7A 1S2MA 4AO7A 2NTNA 1X3QA 3T13A 5E95A 1SKMA 3LS2A 4LJ9A 1BVYF 4HHEA 2C3PA 3FI0A 4R54A 3OWFA 4BQNA 1HKHA 2COEA 3TH5A 1WJJA 1THGA 1Z4QA 2G7ZA 3BEOA 1THMA 3COSA 2ZWOA 4BOYA 5HHTA 3C6MA 3F47A 3DEKA 3IT0A 3C6ZA 3EY9A 4ZDJA 2BRUA 2XMDA 2DRIA 1DKUA 4DQVA 5MF6A 4FSXA 1H2EA 2QXTA 4FYWA 1VZ2A 2OGSA 1L5MA 1JECA 1NUSA 1PVVA 5DHSA 3SBEA 4AUNA 4PC6A 5JAIA 4KC0A 3MT7A 1O7YA 5I9PA 3RLOA 3LC2O 1SELA 2XMRA 2Y99A 1WD7A 1C41A 3A74A 5DHFA 4BY1B 1OA0A 4DLZA 2R3SA 2WJGA 3WADA 4EB6B 1ZH0A 3D8TA 4MUMA 3TKAA 2CBZA 1ZOLA 2XDQB 3T9AA 3BHIA 1DVRA 3V46A 1B0ZA 2V7BA 3DZCA 3ESZA 1DDOA 1OPXA 4JJZA 3BYZA 4Q93A 2FPIA 4D44A 2NYUA 3I34X 1VGVA 4FNAA 4HDAA 1I4GA 4W7SA 2ZCJA 3IIKA 3MG9A 1U2GC 1RZRD 4PE5B 1Y1LA 3FPJA 2VYVA 1GTVA 3H0GG 1WSWA 2AV6A 2FZLA 4EATA 4CEIB 2J0QA 2WZQA 1XPJA 3KVNA 3DNPA 4BBAA 5A5EA 1XDBA 1TM3E 1EFVA 1R5BA 2HJHA 3WAGA 4KN5A 5EZ5A 5EIFA 2K5VA 4J3NA 1ZN7A 2ZBUA 3VZCA 2A9JA 3AP1A 3JAWA 1NXSA 1ZD3A 3ZVRA 2HF9A 4URFA 3U48A 5KNCH 1F8YA 1ODTC 2G88A 1LVUA 4EHLA 1ZM7A 2XOXA 4UUAA 3KWMA 2NTSA 4IURA 2FMKA 1KKUA 1G8KA 4B79A 1GQRA 3GEPA 3O8QA 1LJ8A 1OVMA 3CUKA 2WG2A 3ZU3A 2HLDA 4LNUB 4BFYA 4MWCA 4M0UA 3BGOS 2E5LL 3ABQB 3GUUA 4P3YA 5F5XA 3VJKA 1JNXX 3OEHA 3RFXA 7REQB 1KMCA 4ZQGA 4TL9A 4D25A 4LE1A 1EP1B 1MA0A 3BMNB 4MVWA 4ZVTA 1GEEA 3L7MA 3RPEA 1JTEA 2BMJA 4RMHA 2A30A 2A6HD 3OU6A 3WC4A 4U7FA 1P72A 4FZJA 4ZV4A 4W1RA 1HQYE 3RO7A 5C5LA 4BNHA 3AK4A 2JIZA 1T2AA 2ZJ6A 3GGCA 4UVEA 10MHA 2X1MA 3IE1A 1O94D 4NXMB 4GI2A 1W5EA 3AZPA 5TC4A 5K36H 1A77A 2GRJA 5HBGA 4EUSA 1N8TA 3BCUA 1MABA 1FVHA 4GE0A 4MUKA 2DFNA 4NBWA 1BX3A 4TS1A 3WVNA 2KHJA 2PM8A 1ZUWA 4P31A 5DGIA 3UAOA 4CUZA 1O95C 2WJ4A 2ES4A 2QX8A 1AKTA 2O20A 2YNMA 1KLGD 2Z9DA 3KFVA 1ESCA 4JWKA 4UEQA 5J47A 4NOLA 4B7AA 1A9YA 2EP7A 4C9BA 1FXWA 3MJHA 2GEVA 4TTJA 4WHMA 5CMDA 3V4RA 2WJHA 3NTVA 2EBUA 4C3HB 1TVKA 2JJ1D 3MBKA 3SXPA 5KWVA 5C52B 4V190 2GTIA 4O5AA 3AWDA 5ABPA 1X1BA 3MWLA 3OLXA 1RADA 4O63O 1D6MA 3I9FA 4N8FA 2D7CA 4LISA 3DVQX 3N2YA 5EXSA 2GD6A 5C4JH 2G09A 1LI7A 1U65A 4L3WA 4QPJC 3TDMA 2MJ8A 1D1QA 4C21A 3VPDA 2C2HA 2ZRLA 1GZ7A 3M1YA 2XUKA 2JD0A 4KI7A 3A54A 1BHQ1 1O8CA 3D3EA 3KUKA 3S2DH 3DWFA 3IERA 2CKZB 3HKZE 1JDJA 5DN9A 1IN8A 1QVZA 3U3DA 3BRQA 1KEVA 1QE3A 4KUHA 2IUUA 3TD6A 2J3EA 1E2HA 5FBRB 4DSAA 3TZKA 1WTWA 2Y1WA 1L7RA 5AJ3L 3VQTA 4RAOA 5JCJD 4B3BA 4QOGA 5F2OA 3DFFA 3HZXA 3QFFA 3ZC3A 3ZN2A 2PKXA 2WOJA 4FWBA 3UGKA 4DIBA 3CNLA 1ZD9A 3C1OA 1C9JA 1UBMS 4DIDA 4F9FA 1YVCA 3JW8A 2EIXA 4REQA 1UPUA 5DLYA 4BB6A 1E2VA 3EVEA 1G3QA 4BYMA 3ZZUA 5H59A 2ZJFA 5KYVA 4ME3A 4LFBB 1ESEA 1IKMA 3IEPA 1SROA 2P27A 3JQBC 3G2KA 4UU1A 5AH0A 4G1MB 4MKXA 1AUOA 2WICA 4O29A 3G6EA 1NVFA 1VHDA 3K0CA 2J0SA 3CBGA 2XWBB 1UBHS 4LZNA 1OBFO 4ZPJA 4WOCA 5MDHA 3CJQA 4G1UC 3CM0A 1O4WA 2FFKB 2QLJA 1LBSA 4OHRA 1GAJA 4A3CH 4C6SA 1N2SA 3LQFA 4U0KA 4L72A 4GU5A 3K0AB 2FMMA 2X6LA 3Q11A 3FZEA 3Q3HA 1F2VA 3DWGA 4L76A 4UVGA 2B2UC 3AEVA 4U68A 3X3HA 1B43A 3FMCA 1Q0ZA 1E22A 1SHLA 3AI3A 2RJ3A 2JIRA 2HDLA 3BG5A 4OK5A 3Q2IA 1HL3A 2VJOA 2BP7A 4QNMA 1NQ5A 4AF7A 1Y63A 1PFBA 3A2LA 4C08A 4S2UA 1R0CA 5DSTA 5C81A 3SEZA 3OZSA 4GM4A 3PF8A 4YMWA 3NHHA 1TZKA 2GUWA 1GRNA 1DTSA 1KORA 2W8BA 1D9ZA 3IDQA 4KGXA 5DE3A 4ZVMA 1JJFA 1P5ZB 2UZ1A 3OYYA 3S14H 2PUVA 4BNDA 1HG1A 3I2HA 1N32Q 3RD4A 4PYJA 4EB8A 1ZAYA 1N33B 4N6NA 2NO9A 2B0CA 4KITB 4FS3A 4BAUA 2HHJA 2OQ0A 2PYZA 3QEAZ 5CV9A 5E4YA 1P4GA 3AXSA 3G2QA 4ZC8A 1NF9A 1NBWB 3KFXA 3UE0A 3K0EA 4MUYA 3TLMA 1KDBA 4TSKA 5P8WA 2WA2A 5CYPA 1GZ4A 1ZUD1 3O8OA 1D2BA 1I2MA 4C05A 4US2R 4DTCA 2ZSJA 5AHWA 1H4SA 3CLTD 3C43A 5H70A 2XKKA 3R8FA 4RD0A 3W3AH 3ANYB 3TTYA 4S0XA 1KDZA 3VU0A 4CR6A 1HGXA 3WYCA 4BNTA 5BNWA 3CT6A 1B70B 2XE8A 3DMPA 2P5UA 2WQZA 4R31A 2RB5A 1YQDA 4KWEA 4QRHA 1Q3LA 3HXKA 3C6KA 2B61A 4GLJA 3EARA 1JR0D 4GX1A 3MXOA 5AK5A 1HPLA 2X0DA 3LQ4A 4RVNA 3RSZA 3U31A 2GESA 3CGGA 4HOYA 1AZWA 5BNIA 3MHTA 2F0UA 3QG1A 3R7LA 1L4NA 1DKRA 3I92A 3TO5A 4F1KA 4Z2AA 3PGZA 4BO7A 3O8DA 3S81A 4IMJB 1LA2A 4R9NA 1IEVA 2C5BA 4XRRA 5CX1A 5G0SA 1TCUA 5HRAA 5C1PA 1NSNS 1QVFA 3SHFA 3B38A 3D2LA 1SUSA 3L9WA 4IINA 2UXDB 1Z7EA 1I3KA 1I36A 2JA1A 1EY7A 2IF2A 2PQ6A 3DV9A 3NUQA 4J3JA 4CMIA 4EKYA 1W75A 1MB9A 1FDIA 1XMQB 4ITRC 1RWXA 2BGIA 3BL6A 3IKJA 1FPQA 3CBQA 3HJBA 3PC8A 4F3NA 2UXCB 1AC5A 5HG0A 4D4HA 3L43A 5E6UA 3RNOA 4AMUA 3D4NA 1UDXA 4KE9A 4AKSA 1P77A 3OFND 5AJXA 4EQOA 4WEQA 1S5DD 1JPJA 1U9IA 1UM9B 1LFDB 2C99A 2MR5A 2XDYA 1L5OA 1SMXA 2ADMA 1L7DA 4QQBX 4L4RA 5BY2A 3BWBA 1F2TB 3HFRA 3LO5A 4HRXA 1QHGA 1A4UA 1PWZA 1XWIA 2WTNA 3UMVA 2W6JA 3KKPA 3E7FA 2D3WA 3WGLA 4D2IA 1E18A 4MV7A 2P2NA 1YUBA 1U1DA 2MOKA 3X2SA 1FS4A 4CIDA 4EJ2A 2JS7A 5LQMA 1P44A 3FSEA 2YCLA 1L4UA 3PDCA 2A69D 4R16A 4UTZA 4DVJA 3OLYA 5E7JA 3KSBC 4BWVA 1A04A 2H2IA 1MKYA 1XWFA 1O5IA 1NTGA 2ZI3A 3AJDA 4KL8S 3ED5A 3W3ZB 1KO4A 2IBSA 1ZW1A 3BSFA 3FOWA 2WYOA 3WLJA 1E66A 5E7IA 3ZEIA 4DA9A 1WD1A 3MPOA 5JVDA 5GV8A 3DBRB 2A19A 4J0DA 5NLLA 3SQDA 5BW6B 3JR3A 3KCQA 1PLJA 5FPPA 2C77A 4CKWA 4NABA 2DHRA 2FPSA 2BGGA 1QF6A 2AQ2B 2V7VA 3ZOKA 4ABYA 3ZJ5A 2FYTA 3MJFA 4NDZA 2O5IC 3OU7A 4Y2GA 2EJWA 2KLBA 1AHPA 4W5RA 1QYWA 1G8JA 2DGDA 4ZQ3A 1DIGA 4EVSA 3SHLA 2N42A 2C1EA 5LYJF 3L77A 2C8VA 5K9ZA 3PE3A 4B0PA 2FWMX 1SHTX 2SKCA 3O84A 2PX0A 4C1NI 3Q24A 5AKGA 4FF2A 2Q2VA 2CK3D 1UPBA 4AU1A 5U4QA 2XGMA 1YIJA 1KARA 1G8ZD 4EYGA 1DT5A 3MFGA 5BWMA 3R8CA 2IBMA 4RJIA 3PXUA 1YB7A 3NPPA 1AV7A 5KJ1A 2HMYB 4PQRA 1RYNA 1KBZA 1SN7A 4RDCA 2YUTA 4EI7A 2Z98A 2PQMA 1PG2A 3BWXA 4J94A 3QMPA 1XRNA 2L11A 4IPDA 1NQVA 1G66A 3KL2A 3KPJA 1W9HA 4R9RA 4TQGA 3PNOA 5EMHA 5AJZA 1KSHA 3UW1A 1HA3A 4DCGA 2Q2UA 1HR0B 1CJVC 2BE7A 2QE7D 3DGEC 3L6BA 1ARZA 2OBNA 3V4LA 3Q0EA 5C44B 2ORIA 2VH2A 1ANKA 4QUGA 5LQAA 3OF5A 1W35A 1C0AA 4C4YA 1UBTS 2OHVA 3NASA 3FM9A 4ZCLA 5EJ7A 1NNXA 4IIHA 1I3NA 3WLFA 4ZMBA 4GM1A 1U2RA 1G91A 2AUKA 2ZDHA 3PFBA 3TRKA 2L15A 3CW2A 2SHKA 1RRFA 2IKQA 3L4BA 4J75A 3K53A 1OBHA 1Y34E 4DSZA 2WYHA 2F43B 1EDDA 5AM5A 1SR8A 2GPYA 3QWIA 2WWIA 4QBFA 1XDWA 2QL7A 1SKQA 2FXIA 2HSWA 3SZGA 4P5EA 1GUFA 3PK0A 3HRKA 1CY0A 4KGDA 1KSGA 4I7ZC 4PZ7A 4LRQA 1T5HX 2WW8A 2ZRPA 3GJ0A 4QJ3A 4ZI7B 4TTAA 1K6XA 3JAMA 3EVQA 5IM5A 5KUTA 1PJ3A 4JVOA 5LKRA 1K3TA 2O7RA 3ANSA 4NFSA 1HUMA 5IYZA 3V4ZA 1QHIA 1G4AE 1R16A 1ZMBA 4NYIQ 4A6PA 5KNDA 1PTJC 4PZLA 1C0LA 4WFQA 4CL8A 2Z4IA 2R6FA 5KPJA 3K70D 4YCJA 1ZRSA 3QP9A 4DQUA 4MP6A 4QUHA 1T2NA 1JUDA 2QPTA 5L9AA 5ENVA 1K8YB 4HDSA 1RKXA 4CDMA 3GPLA 4FYMA 5T1GA 2ZM5A 4M6WA 3UFBA 1BBUA 1KQSA 2E4ZA 2VUMB 3C15C 1VG1A 1QDLB 4PYIA 3CCLA 4JBXA 1KH2A 5CFZA 1RI3A 4K2HA 2LDXA 2HDOA 3MXUA 1LTKA 3C5EA 1OTYA 1MO4A 5DNEA 5T64A 4F96A 3VU8A 5LXTB 3FG9A 2R65A 2BHTA 4GWKA 1ILWA 2HCBA 3QY9A 4WZBA 3T5GA 5GZ1A 4RYDA 4KPEC 5C44G 1M2OB 2NYRA 5GTDA 3ADKA 1N5OX 2C82A 4ITUA 4MI3A 2B4QA 2DE0X 2X2PA 3I83A 1ODIA 3HKEA 5DEIA 1DQRA 1MCZA 1R66A 3CCVA 4ZLTF 3H6GA 3OKPA 4HAUA 3NAZA 3UG7A 1N9KA 3TZBA 3ND6A 3M0EA 3WV4A 4F1JA 1BMFA 1N2XA 2FP4A 3KZVA 4IUQA 1UZUA 2P2SA 1PQUA 2C35B 3AF1A 3L1UA 4NK4A 4CZ2A 4DR5B 4P0PB 1ZJJA 2PU7A 1KY2A 4LF9Q 1H1DA 1BNZA 1DAMA 3PIIA 4AW9A