4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
1IW7C 3DPUA 3M4PA 3ZDQA 4PAMA 4P0TA 4R98A 1AK2A 2N49A 2V6JA 5JSZB 3T61A 4UP8A 4WZBE 3ZQJA 5GJCA 2WWYA 3SNHA 3IILA 1W0JA 4B3DA 4AYXA 2RHSB 3GO5A 4DUZQ 3GJ4A 3OIUA 5SZKB 3K0FB 3EA5A 4L5SA 4NCJA 4LHXA 2J0UB 2P6NA 2F1IA 1GUSA 4LF4Q 4P71A 5TXGA 2VZAA 5E95A 1VQIA 2VQEL 4F38A 4UXIA 1HQMC 3CRRA 1EIYB 1YITA 4GN3B 3KJOA 3WBJA 4I1SA 4BFUA 3FKSA 1O87A 5TDHA 2BJWA 4PZLA 3GJ0A 3HP1A 1KAOA 4DIEA 4HB2A 3FVQA 4JCVE 2FZLA 3NEJA 1UE1A 3U5ZB 1AGPA 2PI2A 4QGFA 1U90A 4YONB 3OZXA 1MRSA 4JBYA 2K75A 1CKOA 1SROA 5FPTA 3L0IB 1P4SA 1F2TB 5DNYB 4WW0A 3SHWA 2PCJA 1W0KD 4ACAA 4IPHA 3LFUA 1IQPA 2HJVA 3NIBA 3GLIB 4O2LA 2UUCL 1E2NA 1ZMXA 4CF7A 1KK3A 3IIKA 1G3MA 3QQ5A 2O8FA 2ZU0C 1VQLA 4LF5Q 1AZSC 1X56A 3I8XA 3QPVA 4LY6A 5JLJA 1V43A 3N2EA 1H95A 2PMZE 1GDDA 2NN6H 3IGFA 3NWJA 1OB5A 1VYUA 3KL4A 4RD3A 3CW2A 1ZNYA 3BJIC 3CF2A 1KQSA 3AVVA 3S17H 3CD6A 1E2VA 1IN6A 4PTLA 3TJZA 3B8HA 1NVVR 5EXXA 1FFHA 1KY3A 1IN4A 4K8OA 5IP7H 3BRWD 2ATXA 4MUAA 3ZD7A 1WCMH 5KNBA 1CIPA 2GCOA 2R6CA 5BWMA 1A5TA 4B6FA 621PA 1C0AA 4A75A 2CLCX 3K0CC 1OXTA 1YKSA 2QAGB 1CTMA 3EIHA 3WYAA 721PA 3A4LA 4JI5L 1LF5A 4DT1A 2CQOA 3UDFA 2GTPA 1M6NA 1RYFA 4JV5L 2CE2X 1OFHA 4URWR 4DC9A 5ELNA 3STBC 4BXXG 3OEED 2VP0A 5CYOA 2R92H 1J8MF 4OHYA 1CRPA 4OGQC 1LFDB 5FBVB 5KTYA 1XXHE 3FPPA 1BMFD 1GL6A 2F7SA 1MRNA 3AUXA 2AHOA 2KHIA 4YLGA 4YXWA 1CSQA 4BFTA 3VU9B 2QPAA 3DOEA 4A0RA 5HZKA 4GNXC 4IW3B 2AX4A 2JLRA 3Q3JB 1Z83A 1N33Q 2FGJA 2RGNC 2ZVQX 4JIMA 1IBML 3LBHA 1XXHA 1IBKL 1IONA 1E1QA 3CNLA 4MRVA 3EZ7A 1VQGA 4RSGA 5BN4A 4UXJA 2NZ8A 4XTRA 1E6CA 4G5RA 5L3QB 1BBUA 2NN6G 1RRPA 1S3SA 1XEFA 1N36L 2CL0X 3T06B 3X2SA 1L7VC 4U7DA 2FEMA 3IEUA 2ZYVX 4YWMA 5HCIA 1UBFA 1VYTA 3K9HA 4YDSA 5BW8A 3BH6A 5L3SA 5IP7G 2NZJA 3I92A 2I4IA 1M34E 4LW1A 1WCMG 4A4IA 1V8QA 4HIDA 1PH7A 1YEZA 1KOFA 1T8TA 3OFNA 4RJLA 3MJHA 5FL7D 1HZ9A 2ZQ5A 1PH8A 2HF8A 3K8YA 3U6KA 4DBLC 4DWJA 5EE1A 4ZIRA 2R6GA 5CIQA 1BYUA 3G4SA 2JLVA 2B8WA 3K1JA 2UUBL 2GZAA 1AE3A 4GLXA 2CEAA 3CAMA 3P32A 3THOA 1SZPA 1CS4C 3UIEA 4TN1A 5TV2A 4A8JB 3R9WA 4LDJA 2IHFA 2QAJA 3KKQA 5G53C 4D4LA 4DDVA 2ZJ2A 5DISB 4EAQA 1VYVA 4DDUA 1KMHA 3ZLJA 4M21A 1CJVC 2R92G 1E9BA 1QHHA 1YHQA 2XNDA 4LWZA 1CUKA 1KZGB 4P4SA 3U3OA 1DAMA 1ESNA 4GZLA 2OQKA 1E2MA 1X6VA 4A3GH 5C0XI 3KXLA 2IYWA 4DUYQ 3B7GA 4MYHA 5H1SE 1AS0A 4DV0L 4DV3Q 1SKYE 2BIFA 2O52A 3D8BA 4LSGA 1VCIA 1TU3A 4PPFA 3THWA 1IW7D 2C95A 1HY3A 1HR0Q 1NBME 2J1LA 4NCKA 4LJAA 1W1WA 2W6ID 4NPHA 4BRWA 1UEBA 4HJ9A 1E1RA 2EFEB 2UU9Q 2G83A 3MWLA 3E0EA 4EPRA 4ESHA 1NMYA 4XSHA 3DM3A 1H8EA 3B1XA 1MO4A 2RHQB 2JA5H 5DN6A 1SQ5A 2A7QA 4A3MH 3I3SR 3RS2A 4L9SA 1SXJE 4D0GA 1NY4A 3LO5A 1VQBA 3EC1A 1C9OA 3NVAA 4RZ2A 1II8A 2WM9B 2DR3A 4FD2A 1VF7A 1K8OA 3E9HA 2WZQA 1FX0A 4IVPA 4OQMA 1NVUQ 2P0EA 5M5XH 2RGBA 4RFSB 2ZIAA 4GZYC 2WFWA 4B3FX 2FNAA 3HYTA 2JDID 4IHQA 1A1VA 2IF2A 3SQXA 1SXJA 4E09A 3AYHB 2QG6A 3C5HA 3DO6A 1N5KA 4TSFD 3W90A 4LV6A 1G6PA 2KB0A 3CRQA 2B29A 4PV1C 3LAWA 3M3YH 1OLOA 2CBZA 2QMHA 4DLZA 3S16H 4A3DH 2HLDA 3P4YA 4HJAA 2EWWA 3CONA 1KO7A 1LF0A 1TUIA 1XEXB 2YTYA 2JXMB 1G51A 4TMVA 5BR8L 3BFKA 1UF9A 1U0HC 2QI9C 4BFSA 1GUOA 4D80A 3PUYA 4IJLA 1NI3A 4BLRA 3TQYA 3CH4B 4M1SA 2YWGA 4Q4AB 5FPSA 2WBLC 3EZ9A 2UUAL 3JZAA 4NXMQ 1L0WA 2YU9H 4A3GG 4DNRB 3GLHE 4KXFB 3FFAA 1T91A 2OQ0A 1WI5A 2CKZB 1T0JB 2PEZA 3ZVLA 1E7ZA 1Z6HA 4HR7B 4OWWB 4Q4JB 1J90A 3P1JA 2QMOA 1J8YF 4JVMA 1ASYA 5J5CA 5EE3A 4F7WA 5AUOB 3RS4A 4JI8L 1UE5A 3ER0A 1CJMA 3UWOA 3W34A 2VTKA 1X6OA 5DGXA 1K3RA 1E9RA 1KXLA 1XJCA 3GLHA 3T12A 2WWHA 2DFKB 3PEVA 2JA5G 3RZOH 1KKMA 4A3MG 1VQKA 1SVWA 2GAOA 2WWXA 4PG3A 4M1MA 2WKPA 4D0LB 2DY1A 2FFBA 1YVDA 2A5DA 2BA0A 1E9SA 1AKYA 4NZYA 2IX0A 2V9PA 3GTLH 1RZ3A 3STBD 3GQBA 5FBRB 4LHZA 1OW3B 3QF4A 4GSYA 4MGYR 3WNCA 2NVQH 4PZ8A 2YYZA 4N3NA 5DE3A 2F3TA 4MDEA 2FFAA 4HLCA 4LFCL 1BOFA 1O3YA 1DG3A 1L1OB 3NKVA 1XMQL 2V4ZA 4LFBQ 3I2ZA 4H02A 2JJ2A 2R9VA 3GEIA 5DIFA 2WOJA 4UNSA 2IS2A 1QG4A 1E4VA 4A3DG 2GEUA 3RS5A 1RKBA 2HXSA 4BLOA 2IS6A 1Z07A 4XTCS 4BLQA 1Z6AA 2PCLA 2MSDB 4NYJR 5FOSA 1NY6A 3CLVA 2OM2A 3J81i 4LF8L 4US0R 1K8AC 1XJVA 3SN6A 3HWSA 3VKWA 3F2DA 1QVGA 2PJZA 2CJWB 1EWIA 1KI8A 2WAXA 1XMOL 1Q21A 3B1VA 2PCFB 3GJ7A 5SZHB 3L2OB 1Q44A 4G7HC 4EDHA 1UWVA 1JI0A 3LX5A 2IHBA 2ZRFA 1M7GA 2E2JH 3D31A 2ZI4A 2NO6A 4GKJL 4M1TA 3UE0A 1Z3IX 1O7LA 3U9SA 1LUZA 3CM0A 3DHWC 3PIOA 3AGPA 2JLQA 2NPIA 1ZVQA 2W0SA 3A1VA 3C16C 5CK4A 3T5GA 5HR5A 2Z83A 2QM7A 5FBQB 1KO5A 4ME3A 3JAMi 4LF6Q 2QUZA 1K8MA 1Z0DA 3RRNA 2ZUDA 1H9KA 1MKYA 4DR3Q 3G5UA 3KF8B 2DFLA 2J9RA 3NELA 2I1QA 4DR7Q 5E7IA 5FI0B 2I3BA 1HZCA 2BM1A 2PT5A 1VMAA 1YR8A 4Q5IA 2IEZA 4LNQA 3WNBA 3DLLA 3KJGA 1VQ7A 4L5RC 3PUWA 3K7UC 4X62L 2H5EA 3U7HB 3MJRA 2FEOA 1PYBA 2VF7A 1NMZA 1KAWA 4KFSA 1FUUA 4CEHA 1YR6A 4B76A 1IN5A 3AF1A 3I73A 1GSIA 2QEXA 4WXRA 1NIPA 3QXHA 1GRQA 5HKKA 1I94L 4TWZA 2FA9A 4IFDG 1EQRA 4A6PA 4OHZA 5UKDA 3KKOA 4WJ4A 1SLJA 1KGDA 2BE5C 3SDZA 1E22A 5IY0A 1ZIOA 2R6AA 1I3QH 2PBRA 3ADKA 4LC0A 4AIIA 1RIFA 3A4MA 4TT3D 4TYPA 5DI3A 5AJZA 5KO2A 1H9MA 3J81j 2ZM5A 3ERSX 4DDTA 1QHYA 2CNWA 4PQYA 1OFIA 3NH6A 1OJLA 4LHVA 1G5PA 1UJ2A 4LK2A 3CNOA 4QHYA 2UXCQ 5GVSA 3J81k 1N34L 2C04A 3PFIA 3RRMA 5FJ8G 1TU2B 1CR2A 1YU9A 3MFYA 2C8VA 2ZEJA 4HB4A 1OT3A 3RYTC 3NBHB 2BWJA 3CWZA 3A8TA 1U8ZA 4DXAA 1IYJB 3KKMA 1DO2A 1OIWA 2XTIA 2GXAA 1NBMD 3HOWH 1W47A 3UE1A 4DDWA 4GOPC 2XOKD 2NO9A 3FMPB 1WDTA 4MKGA 3TQCA 3OHMA 3W5IA 3SBDA 4AG5A 3MXUA 2L15A 1ASZA 2KCCA 3GD7A 4Y0VA 5DYGA 3HOYH 5TARA 4AYBE 1VIYA 4DSTA 3GLIE 2KWIA 4A3JH 4X64L 1HPCA 1AA9A 1D5CA 4LPKA 5FTLA 4LJZC 4YQFA 5J47A 2WMNB 1NL3A 3AGQA 1J2JA 4I1OA 4JI2Q 4L5BA 4Q02A 2FV8A 4KLZA 5GADl 5LB2A 5TMPA 4KHPQ 3LWUA 3RLOA 2WJIA 2RGAA 3I32A 3EPKA 1VQ5A 3H0KA 4HLUA 2FSIA 1KI7A 4XD7D 4ITRC 1OH6A 2ZRNA 4G0NA 1CR4A 3FB4A 2GK6A 1GOTA 1CSPA 3I4LA 4B35A 1E2IA 4A2QA 3OYYA 4K0KL 4JKYA 5FUWA 4A1FA 1EFCA 1P2UA 1KSGA 2ONJA 2A19A 3GTOH 1XTRA 2UXBL 3LX8A 3R8FA 1XJQA 3AKCA 3ICEA 4FI3C 2GXSA 3CMAA 3IQWA 1JR6A 3CRW1 3MMPA 1CI3M 1RRFA 2XB4A 1JXMA 3QKRA 1KZ7B 2FSHA 4B48A 2PNRC 2Q21A 1NJGA 2O8FB 2AK3A 3PV0A 2Q2UA 3WNDA 3T1YQ 1MABA 2D2EA 4YMTA 3QSYA 2NZOA 3NH9A 1IN8A 3HOWG 1JT8A 4FN5A 4UXHA 4TYWA 4DAYB 4JI4L 2BM0A 1ZNZA 1TF7A 1QZHA 2F1JA 2QN6A 4A6XA 2I5HA 1HNZL 1I2DA 2KJQA 1N6RA 1MO3A 4C3HH 2GCOB 4TMKA 3A5ZB 5BXQC 1HTWA 2VW9A 3CC7A 1YJ9A 1SVSA 2FMXA 3PJRA 3HR8A 1VG9B 1GUGA 2ZUBA 2QZ4A 3MSXA 2NVTH 4FW9A 3HOYG 1XNQQ 3I4MH 4M9ZA 3HKZE 2WSSD 1CR0A 4DV2Q 2ZYUX 4TYYA 2K50A 3BH0A 1G8YA 2W2XA 5G3YA 2CWPA 4KLNA 4U5XA 1MV5A 2JEOA 1GIAA 2FN4A 2LKCA 4XVUA 2F4VQ 2AK2A 3H2YA 4LWCA 1N25A 3QEOA 4KKTA 4OXPA 3KJIA 3KUCA 3LBNA 2IYLD 4QOSA 1T3LA 2QAGC 4AYTA 3KZ1E 3CPJB 2HQLA 1W48A 2E8GA 4MQBA 2OT3B 2AHOB 4U02A 4LF9Q 1DBSA 3PEWA 2AWNA 4DV6L 3K0XA 3TS0A 4LFAL 1YHAA 2IX1A 3KFVA 1SGWA 4Q7LA 2Z6VA 5FFMA 4C0AC 2R7DA 3RS7A 3FPAA 5ELXA 3TE6A 1U9IC 4LYFA 1UPTA 2ZJ8A 1XXHB 1Y69U 4LV5B 4OO1I 3I8SA 3QIAA 2EYQA 4MKFA 3C14C 1Y1WH 3OOCA 1JAHA 2W6JA 3WWVA 4WBSA 3GPLA 4LC1A 3QKUA 1DXMA 4X66L 1DO0A 4A4DA 3EQLC 4URZR 4F92B 3H3VI 3WY9A 4AKEA 5L3SB 3L2PA 2V8OA 5LMUQ 2R93H 2JEBI 5IYDG 1R7RA 2P5TB 1FMLA 4A3LH 2J45A 3B6YA 1HYQA 1T3SA 1KIMA 3AF4A 1S9DA 1TAGA 2H16A 1Y8OB 2ZSBA 2AD1A 1N32Q 4M22A 4BEJA 2D0PA 4Q4HA 4ZIRB 1EFRD 3LY5A 3I4MG 2G1JA 1DAIA 2Z4SA 2O5IC 1WA5A 4B2PA 4QJ3A 1RC8A 5H8WA 4OJKA 3A1TA 1TX4B 1CBUA 1ZU5A 2GBLA 2J3EA 3I4NH 3RWOA 4POFA 3SYLA 5GAHC 1KMHB 4DUGA 5E7JA 1KJWA 4KFUA 1QHHB 2IF0A 5GJWC 4JL8A 3L43A 1E2QA 4P4SB 4YMSA 4DUZL 4UY8C 3TKLA 1E2DA 5LMNW 3Q7PA 2EFGA 5IK2D 4B32A 4QBFA 4A8JC 3CRLC 4WZAE 1IXRA 1AGRA 3THWB 1EUJA 4JI0Q 1E79D 1G1MA 3EC2A 1HT2E 1FUKA 1EFTA 3OEHA 2EXDA 1XD2A 2G0TA 2QE7D 4NKRA 2ANCA 5KPDA 1Z0AA 3KB1A 5JCPA 4NTZA 4TL9A 1DELA 5JEAH 1XMSA 4OK6A 4PC6A 2IT1A 4ZCIA 4US1R 5LMNQ 2C98A 1Z6TA 2IA5A 1IY0A 3W5OA 3KB2A 1RE0A 1DPFA 1FNNA 4Q1DA 2IWHA 1SKYB 3SBEA 4CGZA 5IWAQ 1K8GA 1G3QA 2CVHA 3REFA 4BLTA 2J0SA 3VNVA 4P72A 2QEQA 2GESA 3B9PA 4QFMA 5C4XH 3TAHA 3TR0A 3GFOA 2OSBA 3AB9A 1II8B 1Q57A 3IO5A 5AJXA 3LQQA 1FX0B 4TTPA 1NLZA 1ZM2A 1X54A 4ESVA 1GJXA 1QDEA 3LGJA 1TEXA 4NXNQ 4A3LG 2E2HH 1DAKA 2ERYA 3QNUA 4C3ZA 3J7ZC 3WMEA 2OHFA 2ZRAA 4LF5L 1KSFX 1XCGB 4JVSB 1SXJB 3IO3A 1A63A 4BBSH 1LW7A 1P16A 4IPCA 1NLYA 2F3RA 3GTJH 4IOCA 5FOTA 5JI3E 4F91B 3CR7A 2VP2A 2ZR0A 1NN1A 3LW7A 4NE2A 2ZRPA 3D7MA 2XSZA 3ZS8A 1CU1A 1G3RA 1XB2A 4C0LA 4HSEA 4P33A 2OFXA 3J80c 3I4NG 1Q1EA 1SMXA 3ZJYC 1DS6A 1D2EA 2E9SA 5JEDA 1EESA 3HOVH 2VP6A 2H5XA 2IXFA 2VLIA 1TWHH 1YIJA 2OBLA 3O47A 3K53A 2Q8IB 2CE7A 4Z8XA 2NPFA 4Q48A 2QGQA 4URVR 1IZ6A 2K32A 3NC1C 4OKSA 3VR2A 3AEZA 2GAAA 3C5CA 3SEAA 3U60B 3J7A5 1T5IA 4LRWA 4OQXA 3VR4A 3VHXA 2O5JC 4UJ5A 5FOUA 5A4JA 4D25A 2GEDA 3AFPA 3FDIA 1G41A 1JQLB 3KQNA 1HA3A 1GD7A 3MXNB 2JA6G 1RFLA 2HV8A 2VPPA 4MRRA 1ETUA 4KYIB 3TAUA 3FP9A 1K9MC 4OWXB 1V5WA 3TUIC 1Z9FA 3GLHB 4DK6C 4B33A 1A62A 1E1OA 3HOZG 2O0KA 2X1VA 4IVQA 3SFVA 3IRBA 3OESA 2IS4A 4OI0A 2EVBA 3BG3A 1TADA 5M3MH 4Q19A 3VX4A 4JLPA 3CH5A 3HFZB 2A78A 3NHAA 4LPSA 4NHOA 3SQWA 3QF4B 1U0JA 2BBWA 1G18A 1WBBA 1SVLA 1N33L 4L5TA 2CL7X 4CYMA 4I7ZC 3G6EA 3EIVA 4E03A 1P73A 5C4GB 1Z0KA 3OTOQ 3NENA 1II9A 1E9FA 2OLJA 2XTNA 5LB4A 2DNEA 1WRBA 4AKIA 5KU1A 1B70B 1J5EQ 1UDXA 3ICQB 2PPBC 1VDZA 3I61A 3DL0A 3L82B 3ZIAD 3THYA 1CLUA 3MGCA 3CMEA 4L9WA 2D4HA 2YC4C 1OHHD 2A9KA 2GF0A 1JBKA 4GOJA 2CWAA 2HHHQ 1L1OC 3A74A 3GEHA 4C0SA 4ZKEA 2AD5A 1IOZA 1VHLA 4DSUA 1YNNC 1R2QA 4A2WA 2VF8A 4M2LA 1Y1VH 4DK1A 1IYVA 2I5MX 2VEDA 4C2MH 3VAAA 3CCLA 3FMOB 2V4DA 1I4LD 2Q2IA 1B9NA 1X86B 1Z0IA 2NTYC 4BUJA 2YKGA 4K81B 1QUQA 1G20E 4Q7MB 1TMKA 1ESMA 4Q03A 1ZIPA 1A8VA 5EZ5A 3AV0B 4DB4A 5FOVA 1QZXA 1HZAA 4M1OA 4NYMQ 3AEVA 4JBXA 1AKEA 3QXJA 1V9PA 1VQMA 1N0UA 4PSKA 1N8RC 4XVRA 1ZINA 4Z1MA 3K70B 4C4PA 3SU8A 4NP6A 2WB1E 4DV3L 2I1VB 2Z0MA 4ERNA 5M3MG 2GDJA 2YWFA 1HR0L 3MAAC 1JPNA 2GVAA 3CCVA 4DV7Q 1A82A 4P4UA 4TLBA 2N3SA 4TMTA 2GJ8A 4IFBA 1YZ6A 2OBNA 1LV7A 3M7NA 2GF9A 3CZQA 3AVXA 3HOXH 4PAOA 2ZE8A 5KOYA 1MO6A 2RH5A 4R4QA 1XWIA 4AWXA 4RFVA 4V02A 1GAJA 2A6HC 4C3IH 1KDRA 1JECA 3U50C 1F2UB 2H17A 2JAQA 4MA4A 1QVCA 4GLVB 4GN5A 1NMXA 2VHTA 2JIZA 4LV8B 4PZYA 2RGEA 1NVWQ 2REXB 4E5UA 3OE7A 2JA7H 1G19A 2JATA 1GRNA 4CEHB 3CPWA 1VQOA 2C78A 4FWIB 4ZDIA 3PEYA 1G8FA 4B44A 4IJHA 2ES2A 1X8LA 1G7CA 2GXUA 1R0WA 3SOPA 1J6QA 3W1GA 1WE2A 1Y1VG 1SKQA 3PVSA 4HI0E 3AVUA 1KK1A 3PENA 2ZJPA 5BN3A 1KJZA 3CR8A 1E2JA 4TMZA 4HUTA 4XJXA 4OX9L 1ZC4A 5DI3B 4HEJA 3KJHA 1G17A 2V55B 2VSOA 3KDFA 1HV8A 3QXCA 4KKSA 1UFQA 3OIVA 2XB2A 2GHIA 3CX8A 4NXML 3BAFA 4RCZA 2ZPTX 1GITA 2UZ3A 4A9AA 2N8NA 1ZRHA 4JLVA 3E9IA 1S0UA 3FMCA 3S1NH 2ZANA 4L5QA 4MNOA 2DYKA 4J0QA 5KDOA 2PQAA 1HE8B 4C30A 1JPJA 1Z6YA 4WZ6A 2PI2E 3HOXG 3V00A 4BLSA 4BPBA 2KA7A 3RLNA 2K5HA 1PH2A 2RB4A 3QOFA 2A2ZA 4QBGB 1HNXQ 5A0FA 1KI3A 3OIWA 5LPNA 4HYYA 1W3SA 2K5UA 4JSYA 5FPYA 1W7AA 4PZ7A 3RS0A 3AQ4A 4ZDKA 4D4KA 3M4QA 1QJOA 1YBYA 2AKWB 2JA7G 1VQFA 1VF5C 2RAPA 5KSPA 3IFTA 3GMTA 3NHBA 3CC4A 2UXDQ 1WF3A 5FI1B 4MGZR 1W5SA 2IYZA 2FPMA 1WMSA 2JLXA 4TYQA 1GG2A 1KI9A 4LFBL 2MSCB 3A4NA 3BB1A 3CRKC 4LK1C 2ZYTX 4C0QC 1CFMA 3K8AA 2Y8EA 2VRWA 2ZUCA 4A0HA 4PQFA 1N3BA 4KSBA 4DR5Q 1E69A 2ORVA 2FPLA 1SFOH 3RN5A 3K80C 1PMRA 2JJ8A 4QRHA 1PUJA 4DCNA 2EFDB 2XZPA 3BERA 1OXVA 1TL7C 1T6NA 2WJGA 3DOFA 3PITA 2J5XA 1FMJA 1MJCA 3VR6A 4PZZA 2AL7A 3QKRB 4D4JA 1G7RA 2FOLA 4LI0A 4QM6A 1WYDA 2ZE7A 2YINC 2KSQA 1IBRA 1P2SA 1MABB 4GMDA 4B2IA 4QBHA 5KSZA 1ANKA 4JLAA 4CVNA 5FUYA 3W8RA 1S8FA 4A15A 5EQTA 2E87A 3T51B 1BBWA 5LD2B 4RCYA 1KK2A 3A36A 3SJZA 3PG5A 3BDOA 2R7FA 1L4UA 5IYCH 1XEWX 1Y63A 3KUDA 5K8LA 2H7VA 4LF6L 2X2EA 1GM5A 3ZVNA 5KNCA 1GO3E 1VQJA 2KCTA 1II0A 4DR3L 4LHWA 4RKEA 3K81C 1LY1A 3WRXC 3OW7A 3CW2C 1Z6XA 3R7WA 4C0KA 2B3GA 3THXA 3EASA 4DR7L 3ULPA 2ZJ5A 2C9YA 1JB7A 1OTCA 3GCGA 1BVSA 4WAUA 4GLAC 2ODEA 5H1YA 1CF4A 1KKLA 2WSMA 4GP6A 1I6VC 2GJAA 1Q12A 1B8AA 3JVUA 3DMDA 1PLLA 2KI5A 1Q22A 1LTLA 5CB8A 5KUTA 4NCHA 1A2KC 4IQZA 2QTFA 1Z2CA 1G5RA 2WKQA 3SHFA 3PEUA 4V03A 1PH6A 2OTLA 2R7ZH 3VFDA 4EJSA 1JR3D 1CKNA 3A7AB 1A0IA 2G3YA 2FSFA 4KFTA 4V0MA 3RS3A 5L3VA 2QNRA 2D62A 4A0FA 5LDDC 1K73C 4LYAA 4D82A 3KX2A 2HYIC 1F3OA 2QM8A 4MKHA 1YI2A 1WJJA 2B8GA 1YNXA 1UBEA 3VA7A 2A6HD 5GVRA 2IWRA 4Q7JB 5IYBH 1F60A 3EAQA 4JVNA 4TQUS 1X1SA 1I4DD 3S1RH 2OTJA 3X1WA 1G16A 1Q0UA 4R4IA 4A3KH 3GLFE 3VNUA 4GKKQ 5CK5A 2VHQA 3TUJC 5KYKA 4TLEA 4KU4A 2G9NA 3TW4A 4CIDA 4KVAA 1ZC3A 2Q2TA 3HOUH 2ZU6A 2XXAA 1E9AA 2OLKA 2VHJA 3W9YA 5F3WB 2DB3A 1NNEA 1VQEA 1XZPA 2UXCL 1QVFA 1G21E 1KI1A 3GFTA 4R4TA 5TY0A 3GLFA 2Z5FA 1HR0W 3ZZUA 1HT1E 4IDOA 4IO9A 2O8DB 5FTNA 2OO7A 3K09A 3ADBA 3E1SA 4Q4HB 3KKPA 3AVYA 1VQNA 3LVRE 3B1WA 2ZRMA 4URUR 5E7NA 4DR2Q 1S72A 1X3FA 3CPFA 1JJ2A 4LJ4A 1H8HA 4AG6A 3H0GH 2BJVA 1E0AA 1AE2A 2BOVA 4ZDWA 3SYNA 4B2LA 1GTVA 2ECKA 4QL3A 2VSFA 2J46A 3H84A 2ID0A 1FZQA 1E96A 5DI9A 4GBMA 2R7ZG 1X1RA 2Q6TA 1E0SA 2QGZA 1SRUA 1FJGQ 1QG2A 3EIQA 4HIOA 1DARA 3MUFA 4ZCLA 4EIWA 2PMKA 4MRNA 3AF2A 3R8CA 5C0XH 4OI2A 4RY2A 4AURA 3FTQA 1E2WA 1XD2B 4QL5A 4JI2L 1NSFA 2QT1A 3CPHA 3QBTA 2O8EA 2AN9A 2CCJA 4DR4L 5IYBG 1G9XA 4IPDA 4R9UC 2LMCB 3TQFA 4M0LA 3S1MH 1MH1A 2KE5A 3FKQA 3EBEA 1IJFA 4QXAA 2NVYH 1D2NA 2OESA 3C4JA 1ZUIA 3AKEA 4MYCA 2MO1A 2YOGA 3G82C 1HNWQ 3N70A 2GXQA 4JK1C 4P31A 2Y0SG 3HOUG 5JRZA 3EPHA 5BYJA 3EZ2A 2JA8H 5K8TA 1W0JD 1W5TA 5C4MA 4QM7A 4MZ9A 1P3JA 2O0HA 2JJ1A 2FSGA 1Z6GA 1QRAA 2UZIR 3U4QA 1JJCB 2VL6A 2GVZC 4X6AH 2P2LA 3EWSA 1XPOA 3AM1A 4KLKA 4Q1BA 1E9EA 2J0QA 3T1YL 2K4KA 4QGGA 1TF2A 1ZU4A 5GAEC 3FKSD 1W2GA 2IEYA 4AK9A 1T9HA 3H0GG 4M1YA 3BWDD 3B6EA 3Q5DA 1X3SA 4EQ6A 4HDCA 2N78A 5KNDA 5ELOA 3B78A 1DAGA 1SXJC 2PL3A 2XEXA 3EA0A 2FFQA 4DB2A 2VYFA 5CIWA 3KQUA 4OK5A 5J40A 2QTHA 1JE5A 2ZJBA 1NKTA 3C8UA 5A5GA 1XNQL 1N6HA 1OYWA 4EX5A 2NO0A 5C0XG 1Z47A 1C4OA 3W6NA 4B3CA 3CNNA 1JXOA 4IOLA 4UQOA 4KAXA 2ZI5A 4YMVA 2GJSA 2F4VL 2DN8A 1DD2A 2HT1A 3N6RA 2KBNA 3FHWA 1UEJA 1ZBDA 2FGKA 2H92A 2PX0A 4TMXA 4PXAA 4FCTA 2ZAMA 4NU0A 1XRJA 2A8VA 4JLMA 2IL1A 1JJVA 2E5LQ 1ZAKA 1GWNA 3RVBA 5EP4A 5BN5A 4LF9L 3T1HQ 3AVPA 3T1QA 2ORWA 3AF0A 5IT9c 3F5FA 2JA8G 2KCMA 1NVVQ 4XSGA 2D74A 2CXXA 3F1ZA 2HUPA 1H65A 2PMDA 3REGA 1GVPA 1L4YA 1QHXA 1DCZA 1LYLA 2IHYA 4KCGA 2PZFA 5IHPA 4LBVA 3UK6A 1XDBA 2B63H 2PEYA 4BASA 4XWKA 2JLZA 4P73A 4TVAB 1XEWY 2XZOA 3THYB 3PF5A 2GWHA 2QORA 3DZDA 3ONWA 1YHNA 5JHHB 1Q81C 2OUKA 5LMUL 1CXZA 3KOJA 3K9GA 1Q3TA 1J70A 4RD6A 4JBWA 1I5FA 1CP2A 1NLFA 2QTVB 4Z51A 5CITA 4NYIR 1P2VA 1EFUA 1K6MA 1FOEB 1K8RA 2OEPA 5EUQB 1N32L 1XPRA 1P7CA 4YXWD 2G77B 1VS0A 3ZZ0A 4BY7H 2R6DA 1O78A 4A3CH 5SZJA 3RDPA 3SGIA 1IXZA 4IFEA 1TQ2A 1VQPA 1QUQB 1E1QD 3NEYA 1QVRA 3W6OA 3KFXA 1LS1A 5JI2E 5J4KA 2WOOA 1W36B 1M1YE 2CL6X 4B3TL 3KF6A 1XNRQ 4B3RL 821PA 1R6BX 3S2HH 3S14H 1Y8PB 4M53A 3EN2A 1P75A 1DADA 4JI0L 2Q2HA 1R5BA 3GJ5A 1SN8A 4B3ML 5IE8A 3G71A 4Y52H 1AS2A 2PLRA 3OFND 4QBIA 4XH9B 4YY3L 5L3RA 4DCSA 4E07A 4UP7A 2QA5A 4YMWA 4UNRA 3K9LA 1OB2A 4DPGA 1ZD1A 2EWVA 3KFUA 5LMNL 3GJ3A 4JBMA 4JMPA 1J99A 1FYCA 4KVGA 4LUCA 4C0HA 4A93H 3K70C 3TVTA 5IWAL 1T4GA 3ZYCA 1PYSB 4EPXA 1GUNA 4IEIA 2WIBA 1COWA 5D3MA 3D0FA 4IOMA 2ZJYA 3UMFA 1LM0A 1XP8A 3IKJA 1GKYA 5D3QA 421PA 1Y8NB 5C4JH 1NTGA 2E1RA 3OAAA 2HDNB 4JT4A 3I5YA 1GUTA 4HJ5A 1X3GA 2ZI9A 3HR7A 3P4XA 3PF4A 2YTXA 2OCPA 2XNDD 1VG8A 3OPOA 3W1BA 4NXNL 5AJ3L 1P9RA 2XNSA 5FPHA 1OH8A 2WAQE 1FW6A 2QP9X 2QSZA 4LUZA 3D3QA 1GHJA 3S2DH 1IBMQ 1Z5ZA 3FWYA 4DIDA 3LD9A 3NDBB 2F52A 2IBMA 1KD1C 4KHZA 2LSSA 4A3CG 1P9NA 1E1RD 2HEIA 5JJKA 4KMUC 2QENA 2MSEB 3K0AA 2EDGA 1H8ED 3I5XA 1IBLQ 2HJGA 1N6PA 5DN6D 2ATVA 3KDFB 2BVNA 2ZS9A 4F4JA 1HE1C 3ULJA 1D8TA 1VQ9A 2MFIA 1RVDA 5P21A 1F5NA 4KBFA 5EP2A 3L0SA 3B9QA 3T34A 2F6RA 1OKKA 1R10A 2WVJA 3IIMA 2C03A 4BGDA 2PQAB 4UNQA 3FMFA 3CXCA 4R2IA 1SXJD 2A68C 3QUSA 3IBYA 1S40A 3AH8A 5KPJA 1FQKA 4GN4B 3QG5A 3EX7C 2DCUA 2HLDD 5F9FA 1YJNA 3QPUA 4XIGS 1PVOA 5EE9A 4ALPA 2CVFA 4RKFA 2EW1A 2NO1A 4URYR 2OFWA 4O2RA 4DV0Q 1C7YA 3BZKA 1LS6A 4LBZA 4Q4LA 4QHSA 5CLQA 2FZ4A 1Z8FA 1HUQA 1ZUHA 2XTMA 5C3EH 4ASUA 3OTOL 3T35A 3LXRA 1NMGA 2FG5A 2IXGA 2HCBA 3RSOA 1J5EL 2WWWA 2OCEA 5AUNB 4HAWA 3CX7A 2IW3A 2V7QA 3LH5A 3D6TB 4OBEA 3DKPA 1EGAA 4Y0AA 2VQFL 3DVLA 1R8SA 3AP3A 2HHHL 2YWEA 4QJ5A 3U3KA 1RJ9A 3WDNA 4IKEA 2IS1A 4DR6L 5JWRA 4BZQA 4HLUC 2Q3MA 5HGQA 3E70C 2DUDA 1YJ5A 3ADDA 3NBFA 5AUQA 3U7GA 3X1DA 3EW9A 3TRFA 2WPDA 4YDHB 4R4CA 3CX6A 2CK3A 3AP2A 5C44H 1TNDA 2QF7A 3A7LA 3FHOA 1N0WA 3ZH9B 5K8UA 1PLJA 3CF0A 2XGTA 1WP9A 3MD0A 3HPQA 2ZS7A 4A3JG 1JEEA 2JJ2D 3SI7A 4DT1B 2F1RA 3KQLA 1PH3A 4CEJA 2ZYWX 1PH1A 3D4RA 3AVOA 2WAYA 2DWPA 1N9WA 4HATA 4ZI3A 4C7OA 1YR7A 4G1UC 1E9CA 2PLFA 3RR5A 4KSCA 3BD9A 4TTRA 4X8HA 5KSOA 2PX3A 4EPVA 3EPJA 2A6EC 2ZI6A 4LJ5A 2AXPA 1ZM3A 4HZIA 4GNKA 3R7WB 4DV5L 1XTJA 4BEBA 3BE4A 3UDGA 2G0NA 2V54A 1E4YA 4NYJQ 3L7ZC 2JEAI 4YWLA 5LD2C 2B6HA 5C18A 2GNOA 2E76C 5FPKA 1N6IA 2ZTCA 3GTQH 3DEFA 4JLOA 3KDSE 3KQHA 1SHKA 5DYIA 2ZJZA 2XZLA 1U98A 4LBYA 3WHLA 5GROA 2KHJA 2EQSA 5IP9H 2EFHB 3N2IA 2ZSEA 4QGAA 4Q9JA 4PMWA 2OCYC 4EJSB 3M1IA 4KI0A 1HJPA 1DE0A 1ZD9A 1CKNB 1GNPA 2H8KA 2ZAOA 3A8KE 3MWKA 4CT5A 4HJ8A 1EX6A 2ODNA 1NG1A 1P9WA 1MT0A 3LDAA 4TL6A 2NVXH 1SVMA 4HAZA 3K70D 2UKDA 2K7VA 2DWQA 2PT7A 3BBPA 1QZGA 4FXPA 3N5CA 3EG5A 1R5NA 5JFGA 2J41A 1DEKA 1Z0JA 2AXNA 1G291 4L8JA 1K5DA 1N5IA 3B2EA 5AJWA 3V4FA 3I4OA 5FLMH 4JI6Q 1D2MA 4P4TA 3S24A 3P26A 3FKIH 5JEEA 1OH7A 4CEIA 1XF9A 4JZKA 4JG2A 4OO1H 1ELOA 1OSNA 4QC2A 4BECA 2QPOA 5GJVC 3HPRA 3ETLA 2ZRBA 2A5JA 2F1MA 2HT6A 3GLFB 3H3VH 3DM5A 2QRNA 1VCMA 2VSXA 4GOKA 4DAMA 3MWJA 1NBWA 3B85A 4BY1H 4DV4Q 1Z7TA 2ZE6A 5G41A 5HKKD 2RCNA 3L0PA 1XD9A 4NONA 1IM2A 2O0JA 2RMKA 5M3FH 4G01B 4Q9HA 3UANA 3LNCA 4LF4L 2ZXUA 1F6BA 2IHEA 1L8QA 2J7PA 1AH9A 2JCSA 3S15H 1NN0A 1VPLA 5GAGC 1HNXL 2FX3A 2H18A 5K36H 1EYGA 3Q8XB 1ZM9A 5KDLA 1ZCAA 4DJTA 2QMUA 1E32A 2OFOA 4YC7A 3AP1A 2CLDX 4FMBB 1U8YA 1KHIA 3PO2H 4WA7A 4EKDA 1T0HB 2CNWD 2ZETA 2GILA 2A68D 2GBLC 1TWGH 5IRCD 1A6XA 1Y1WG 4TQAA 4UNNA 4BWYA 2OILA 2D5DA 2UXDL 1IXSB 1DAFA 5AJYA 3UDIA 4ZPXA 2O8EB 2QRZA 3JC66 2W0MA 2MMCA 2R8RA 4CW7A 4PHTA 2R93G 2BHRA 1YZQA 3QVUA 4JT2A 1OXSC 3U7EB 2JLWA 1UDWA 3BK7A 2BMFA 5FLMG 1IXRC 2AKAB 2ZJOA 5FL3A 2YHSA 4F4CA 3FKIG 5DHFA 3RHFA 4DR5L 2BC9A 4MUBA 4TMWA 3RWMB 3RLFA 1KK0A 4BRUA 1X8JA 2B8TA 4H1VA 3IEVA 1G5TA 2VBCA 2JA1A 3E5HA 1DVRA 4FMDB 4RZXA 3ZQ6A 3KYHC 3L8ZA 1GUAA 3U61B 4JOIC 4DLTA 5GQOA 1O7IA 3IPXA 3U4QB 1BH2A 1I94Q 5HTKA 2W58A 3U3MA 3CC2A 2ZS8A 3QEJA 4RZUA 3RSLA 5DSZA 4OHVA 4OQNA 2PJRA 1PV4A 1FL0A 4A2PA 4PPQA 4EUNA 5H68A 2XX3A 3BFXA 1VQAA 2PNHA 4HAVA 1SVOA 4DLYA 4A0GA 5K36G 5JJLA 3CZPA 4EQ6B 2FPKA 4JVLA 4LYHA 2HF9A 2VIIA 3A1SA 4RZ3A 5JEAG 4BBRH 1N5LA 3PO2G 1N34Q 2OE2A 1OF1A 1W0KA 2E74C 1E3PA 2GZDA 1W44A 4LZZA 2R62A 2MQHA 1UE7A 3LLMA 2QMEA 2C9OA 4PANA 5C4XG 3Q5EA 4WIAA 4HUQA 1EWHA 5M5WH 4PHHA 3I62A 2O8BA 1Y3AA 5FOWA 4IOKA 4B47A 3TLXA 4R2HA 1Q1QA 2GETA 2A6ED 1M2OB 4PHGA 1YR9A 1LACA 3KJPA 4LCBA 1B0UA 2VP5A 1RW4A 4Y7NH 1SVKA 4BBSG 4W5HA 3C15C 1Z22A 4NBSA 5EXTA 1UEIA 3H86A 2BEJA 1DGSA 4C3JH 4M1KA 2I0QA 1YZLA 4LBWA 1EG7A 3A8JE 2RHDA 4DV1Q 2GA8A 3WYGA 3HOVG 3NTUA 1TKWB 2V1XA 2YZ2A 2ZR9A 3PCRB 1ZNWA 1YE8A 5EZ6B 3TR5A 1JJGA 2F9LA 2JASA 4Q1AA 4GKKL 1GZSA 2R44A 3SS8A 3BFVA 2ZRCA 2L0XA 2Z6KA 3QI2A 4AYBG 4K0KQ 2A1AA 3UMSA 1KDPA 3GTKH 3OEEA 5AJVB 4DLWA 2JLUA 1T5LA 1UKVY 2KBFA 2WWIA 4PSVA 5B2ZA 2UXBQ 2GKSA 4GL2A 1CR1A 3U7FB 1KSJA 1WB9A 3O8CA 4RMFA 4PO1A 3L0OA 3SR0A 3CUEF 1ZYUA 4BBRG 1BMFA 1D9ZA 2X19A 1OPXA 5LBIA 4BFYA 4FCVA 4ZDJA 1UKZA 1ZKOA 3OW2A 2CHQA 2DHRA 3TK1A 3ZZTA 3F8TA 5FBWB 4DR2L 4XOIA 5CB6A 4BQSA 5FR2A 1X3EA 3X1XA 1SE8A 4DUYL 3IDQA 1M1KC 2DFNA 3P27A 1KI6A 3B5JA 5FL7A 2F55A 4LUOA 5IT5A 3NEMA 2VP9A 1TQDA 3C7KA 2X8AA 1US8A 2DFTA 2UU9L 4RCNA 2FE4A 2W6JD 4UPAA 1ZYRC 3KF6B 3TREA 4KITB 1UADA 1FJGL 3TVDA 2P6UA 4B3BA 1Z63A 2Z0SA 1PH9A 1GNRA 3CB4A 4DR1Q 1BS1A 2C9CA 4G5QA 221PA 1MIUA 1D7QA 1I6HH 4HAYA 4LJ6A 2GEVA 3DM9B 1GKUB 1P5ZB 4A3BH 2ZRLA 3BB3A 1Z06A 3BORA 3QF7A 4PO9A 1E24A 1W36C 5CDFA 1N6NA 5CJPA 1SVIA 4Q1FA 2E2IH 2SHKA 2GJKA 1FP7A 4HB0A 4UP9A 3X1YA 4D2IA 4H1UA 1GILA 3BS4A 1MR3F 2Q3FA 5D3MB 1HNWL 3H4MA 1E2EA 1VQ6A 3PGZA 4JYBA 1KI4A 5HE9A 4JYAQ 6Q21A 3CRVA 3HKZG 4NL4H 1S96A 4DUGD 2Z43A 4FMDF 4MYTA 2A5YB 4PR0A 2ZTEA 3KQKA 2LXKA 1OFUX 1NJIC 2P67A 4R7ZA 1BO6A 1YZNA 2DGYA 2ONKA 3O8BA 3QKTA 1I2MA 5FTKA 2A69C 1PHJA 4D26A 1D9XA 1CKEA 2JE6I 4DNIA 1E2KA 3AKYA 1E94E 3OEHD 4OI4A 1CJTC 4M9SA 5TVKA 3TUZC 1QHNA 2G1KA 2W6IA 2ZRDA 1P6XA 3AKDA 1A7JA 1IAQA 3CPEA 1VKJA 4AY2A 4XWOA 3GTGH 5CYPA 1G3IA 3K0AB 1VCOA 1N5JA 1YZKA 2ZREA 1IN7A 5C1BA 4LF7Q 1M74A 4DKXA 4BA2I 3BC1A 3GJXC 2CCKA 1G3UA 3DXJC 4EPWA 5L8VA 3R9XA 2WJVA 4Q1EA 5KSYA 3PUZA 4HIMA 3T53B 3EWAA 2UVQA 3BOSA 2BV3A 2N1BA 2VY3A 3K0EA 3CF6R 5FBLB 3W3AA 4OI1A 4A3BG 1TWCH 1OIXA 1FTSA 1YQTA 2LKDA 2JDIA 2VA8A 4JLDA 1V1QA 3ZGXA 3ND8A 4KO8A 4EPYA 1BDOA 3VQTA 2EJGC 1NP6A 1YZGA 5JMTA 4IOAA 4TSFA 1FVIA 2IY5B 4B3GA 4G7OC 3CCMA 3LXXA 3GLGE 2XSZD 4IJMA 4FWTA 3SE0A 1MJEA 2QQEA 2E5LL 4TKOB 2QU8A 3T1HL 3QXXA 4O3MA 1VQHA 3J80i 4B73A 1IYUA 3CCEA 3QE0A 4TLDA 4PSAA 5G40A 1X8KA 2NOAA 5BQ5A 2QT0A 1G7TA 1RRCA 3GLGA 2J7KA 4BXXH 4GP7A 3X1ZA 3R9IA 2AWOA 4JI3Q 1UE6A 1U0LA 2GZHA 3UG7A 2IYVA 1LNZA 5FH9A 1KO8A 3KTAA 2NN6I 1S1MA 1CRQA 3H1TA 1KL9A 2C35B 1GNQA 3UWKA 5JWOA 2HIXA 2AUKA 3K0CA 4JI7Q 2EU8A 3EARA 1RJ9B 2MO0A 3I7FA 3WMGA 3MWYW 4PFSA 5B64A 3NDPA 1NG9A 3LNNA 1OIVA 3RNLA 1KAGA 1YZTA 1YRAA 3TGPA 2VQSA 4DK0A 1B7YB 5DHAA 3F3YA 4Q9KA 3VMFA 1FTNA 4IFDJ 5B57C 1OH5A 3IIJA 2YV5A 3LV8A 2FXQA 1PA6A 2WMOB 4I1VA 2Q3HA 4W7SA 1EOVA 2QBYA 1XNRL 4JI1Q 2YOHA 1KDTA 3CF5A 4V0ME 3RRYA 2CDNA 3VR1A 4C7OB 5DLQE 2O8CA 4GNXA 1VTKA 1NSTA 3J81c 4P32A 2A3RA 4B3SQ 3RN2A 1G4AE 2RGNA 3A5UA 2X2FA 3G0HA 2NIPA 3U44A 3BH7A 3FYHA 1Q20A 4LJ8A 1KC8C 5E7MA 4ARZA 1T3HA 2ZRJA 4OL0A 4H9GA 3HYRA 3V9PA 4BA1I 1P61B 3M9BA 1L2TA 3CIOA 1C1YA 1E1TA 5EAYA 3NBYC 4IDHA 4B34A 3T1OA 4MTNA 4HLDA 4TLCA 2GN5A 1OE0A 1ZP6A 2YJTD 4FIDA 1M8PA 3CCRA 2OAP1 4A36A 3JAMc 4AQYQ 4OJQA 4WJ3M 4TL7A 2AR7A 3A58B 1W36D 1R5OA 1UAAA 2K33A 1CTQA 1R8QA 2PH1A 4Z8YA 1CEEA 1VQ4A 2WICA 3AB3A 2ZM6Q 4L4UA 1U81A 4Z1MD 2DPXA 1W4BA 2B7BA 5JWHA 2B92A 3ZS9A 4KFRA 4EJSC 5IYCG 3T15A 5B30A 1IY1A 1LABA 1U5KA 4GRAA 4WOPA 2BKUA 1VHTA 5DLQC 2WHXA 2VP4A 4GT1A 4CEIB 4B74A 3CBQA 3FMIA 1IBLL 2ZVPX 3TMKA 3PXGA 4D81A 2K5VA 1BKBA 1P2TA 3GTMH 2D7CA 3PQCA 2EIFA 2ERXA 3UMRA 1EWQA 4DNTB 1BKDR 4K46A 4XVQA 5J4VA 2JIZD 2A69D 2REOA 2WKRA 1KDOA 4PPNA 1XMIA 1H9SA 2FWRA 2KBEA 3OE7D 4AD8A 3DDCA 3WP1B 1G64A 1FGUA 2WP8J 1SHZA 4YHHQ 3TNFA 4C0JA 2C96A 1MKHA 4N1AA 4J15A 4KV9A 4RG1A 3GEEA 2JA9A 1TWAH 2JK8A 2IYXA 3PR1A 2BCGY 5JCZA 2ASEA 3RNUA 1T8UA 5E4FA 4KODA 3DZ8A 2YNMA 4PQRA 1I4TD 3B13B 1Q86C 2PZEA 3VKHA 2XITA 3RC3A 3HU2A 4DVGA 3K09C 1RL2A 4KHPL 3VTKA 2A30A 4TT3A 4HZUA 3B60A 1R0XA 3BGWA 3DKVA 5KHOC 4QHTA 1TTTA 3H94A 3FE2A 4A3KG 2NG1A 2VO1A 3B1YA 1GP2A 1AN0A 2OV2A 1ONBA 1W46A 3FHCB 3CWQA 4EFMA 2AFIE 2P6RA 4AKHA 3SZRA 1RRGA 3TBKA 2CW0C 4A3FH 4JJZA 2ZROA 3TSWA 1XFAA 2GVDC 2WWFA 4V0NA 4EPTA 1NBMA 2P65A 1RIPA 5M04A 4JJKA 2WB1G 1E2PA 2EQBA 4JKIA 2QPTA 5AK0A 3Q85A 3ULLA 2XOKA 4Q66C 1FQJA 2W83A 2ZE5A 4UJ3A 4MDFA 3AQQA 1XU4A 1ZM4A 4E22A 3O8RA 1JEDA 2VNUD 1KO1A 4OYHA 3WMFA 2OXCA 3O8DA 4QKQA 1IHUA 2CHGA 3P20A 3EZFA 4PZ6A 3LA6A 5FTMA 3PUXA 2CFMA 3U2QA 1YRBA 1S1CA 1WBDA 1PLKA 1PJRA 1W4AA 4MH0R 1DAHA 2IYYA 4FMCB 4X65Q 3U6BA 2R65A 1NRJB 1ODFA 1Z2AA 1NE3A 2WIAA 4IDQA 4EFNA 1N6KA 3LRPA 4OX9Q 4AI6A 1CULC 4OONA 2D2FA 2ZI7A 4KJZA 3SC3A 3RAPR 4DV2L 2BEKA 1MO5A 1OV4A 4XD7A 1UBGA 4PX9A 4YCVA 4AYWA 3CP0A 4HAUA 2GCPA 2IK8A 4PC7A 1XPUA 1GRRA 1N6OA 2ZR7A 4B6EA 3DMNA 2JLYA 1QF9A 2IYQA 4PC3A 4ZO4A 4RD4A 1Z29A 5ANRB 1ONLA 3TSOA 1OFTA 1A4RA 4NCNA 1NY5A 1E2ZA 1IJEA 3Q7QA 5FUVA 3PIRA 4PO8A 3A1UA 1QHSA 4QNRA 3KJEA 4BZPA 1U99A 4HUQB 3PSIA 4A3FG 3WRYC 5M5YH 2O8BB 3ADCA 1EX7A 4NPSA 2VQEQ 2D2CC 1M7HA 4MGKR 1E2GA 1XZQA 2BBTA 5EE0A 1G6OA 4ZKDA 5HPYB 2PZGA 3HU3A 5C46F 1W2HA 5CM9C 2CCZA 2FH5B 1VQDA 1S9HA 4G5GA 1VIAA 2CLSA 2HCJB 3LBIA 2DNCA 4WVFA 2IC5A 4IDNA 3VHLB 3CCJA 1SULA 3LLUA 3S1QH 3I1FA 2D06A 1Q3HA 4HLQB 1DTSA 1HURA 4JYCA 2WV9A 4IFDI 2WSSA 4JI6L 4H0LC 4JBKA 1KI2A 1U8AA 3QENA 2P5SA 2UUCQ 1XTKA 3MLEA 1QHGA 2QQ0A 4W9MC 1A2BA 1Z0FA 1XTIA 4ACBA 1CKMA 4O0MA 1HTPA 4JC0A 4L8GA 1K83H 3C41J 3T5DA 2B8FA 5K8IA 4CDGA 1SR3A 2J87A 2ZRIA 4DSNA 4IXMA 5C2JB 3F2CA 3AVWA 1Q7YC 1F48A 1D8LA 4QY7A 1GVNB 4W5JA 4IFDH 4DV4L 2F43A 3R20A 4HDOB 2I5LX 5F2EA 2Z4RA 4ILEA 1G8PA 4BFWA 4F4IA 2HIVA 2XAUA 2ZSDA 3IQXA 1KI6B 1RPZA 2BH8A 2NO7A 1TXYA 3EXAA 4N0EA 3HKSA 5E3HA 3BXZA 4JI5Q 1US8B 1CJUC 1G8HA 2BH2A 4JV5Q 1XX6A 2Q9AA 4A82A 4MITA 4YCUA 2YC2C 4UNPA 3A37A 3SJCA 5FJ8H 2FDCA 2F1HA 2BMEA 1DG1G 1EK0A 2B63G 4DRZA 4ZI2A 5FTJA 1KIXA 2FU5C 1HCZA 3GTPH 4POGA 4DEYA 3EIEA 4DLXA 5F98A 4Q9IA 1XBTA 2ZITA 3Q9LA 4HAXA 1EFRA 5AUPB 4ON9A 4CT4B 5SZIA 3RZDH 1F2UA 2XJ9A 4RD1A 3A1WA 1H8HD 5JEAJ 2IYUA 3I72A 4JL5A 5J4HA 3S1AA 2LXJA 1ZNXA 1IBKQ 4BY7G 4JS0A 1Q8KA 2ANBA 5EXSA 2F9MA 2FJUA 2X77A 1N36Q 2IYTA 2REBA 1GHKA 1VECA 4OHWA 2D3WA 5IK2A 1S3OA 4BE7B 3KLRA 3ZVRA 2ZJRA 1E79A 1VQCA 3QKSA 4QGUA 4GOPA 4OHXA 4FMCF 4GDFA 1G4UR 2N46A 2QE7A 3TW8B 1TF5A 1KTVA 4IDPA 5JS8A 4M9XA 2IUUA 4HB3A 4MRSA 4OK3A 4IOJA 4UKDA 2UUBQ 2BCJQ 2B7CA 1N6LA 4F93B 3NG1A 4DCUA 5FOXA 3Q72A 1R0ZA 3GDEA 5AR1A 1UBCA 2F3IA 4A93G 1YZUA 4IVRA 4MKIA 4EFLA 5JSZA 5HZHA 1TEVA 4D4MA 3KXIA 3K7AH 2JJ1D 1TWFH 3K0FA 3QXSA 2HYDA 4KYUA 4N0DA 2J0UA 1ZM7A 2IUSA 1M7BA 1YNJC 4JBJA 2OWOA 2ZI3A 3T56B 1P8LA 1GKIA 4PC1A 4D6PA 4YCWA 1KJYA 1H9RA 1KHTA 1XMVA 2GVBA 2JGNA 3VR3A 2E75C 4MYUA 3FHTA 5EP3A 4HIKA 4NCIA 4BFXA 3E2IA 1ZUNB 4S2EA 4AC9A 3RC8A 2OCBA 4L16A 4Q1CA 2YTVA 4LJ7A 1F2TA 1Z28A 4DV1L 4LGMA 4MRPA 3BJUA 3GLGB 2ZRHA 1TUEA 4PHFA 2GJ9A 1LB1B 4DR4Q 2D0OA 1XTDA 1Y14B 1XNJA 2RGXA 5HCNA 4JSTA 4V0KA 5KDDA 1H9JA 4S35A 1OXUA 3W8NA 4DK3C 5JZVA 3GLIA 2QA4A 3B1ZA 4KN7C 4TLAA 2BA1A 2GCNA 3KTAB 5CLLA 2LCFA 1PH4A 1R9TH 3UXMA 3NBZC 2C5LA 4US2R 1E2LA 1XD8A 5DO9A 2G88A 1E2FA 3CO5A 3I56A 1QBKC 1ZD8A 2RGCA 3VX3A 1OYYA 2L5TA 1EQQA 2YVUA 3TH5A 2QROA 1EFHA 4AIMA 5BR8Q 1W4RA 2C99A 2H57A 4DCVA 1FL9A 3B82A 4O25A 3A0JA 4G7ZC 3BU2A 1HH4A 4C0BA 2UUAQ 2W2VA 1FPMA 4RD2A 3SYKA 2V1UA 2QAGA 4G3XA 3ZVMA 1GFIA 3UDXA 4NB3A 4P74A 4DV7L 2J59A 1S2MA 4H13C 1GL7A 3THXB 1W4CA 4JLNA 1XMJA 1ZJ6A 3V4RA 4C2TA 3AVTA 4WXPA 2QBYB 5IYDH 1JB1A 4IPGA 5C3EG 1XTSA 2O8CB 1MOZA 4QG7A 3ZIAA 4CEJB 4GNXB 1NN3A 4JI8Q 2BBOA 2ZJQA 1OHHA 4DR1L 1X65A 5JBQA 3T1TA 4II7A 3ND9A 1E0KA 1TU4A 1U9IA 1D6JA 4B75A 4NDZA 5JHGB 3U44B 3G48A 1Z08A 3LQRA 4NMMA 1GL9B 2J0VA 5JRJA 3JVVA 2NZHA 4X8MA 4I81A 4G5SA 3AFQA 4ARZB 3CRMA 2V6IA 1HQCA 3KXKA 4NYIQ 1I50H 4TQ9A 5FUXA 3TIFA 3VU9A 3HU1A 3TSZA 2QY9A 4M4SA 1PFSA 3W6PA 3BB4A 4OQLA 3FOZA 4CRWB 2DWOA 4D0NA 3QY0A 2V1CC 4Q7KA 2MMGA 2Q0HA 4Q21A 4LFCQ 1E98A 1JJ7A 4JYAL 1ZCBA 2WJJA 2H1LA 4G5OA 3U4ZA 4GZMA 4NYMR 1XMQQ 5L3QA 3CCSA 2AUJD 3TZUA 5C44G 3NXSA 1VCNA 4NH0A 2VS1A 3TEHB 4DCTA 4DKAC 3QVVA 1EWRA 2QL6A 2RGDA 3GJ6A 1DAEA 2CCGA 2XXAB 1R0YA 3Q8DA 4LF8Q 3OF5A 4Q18A 4FINA 4P3YA 1UKYA 1XMOQ 4M1WA 2O5VA 3BIFA 1Q90A 4JLJA 1LVGA 4LF7L 4R1JA 4A3IH 4M8NE 5TB5A 4A8JA 3RABA 4YWKA 1COWD 2R2AA 3GJ8A 1G7SA 2V3CC 5J3BA 1NN5A 1AM4D 1BIFA 4GKJQ 1KO4A 2BE5D 2ZTDA 2CMKA 2EVWX 3OAAD 2O8DA 1H9SB 3TRZA 1NVXQ 4U00A 4DLSA 3MEFA 2OXRA 4IXNA 4ABYA 2RKOA 5IP9G 2C2HA 3NC0C 3HDTA 3M6AA 3AVQA 3CCQA 4TZ6A 3HGBA 2VHUA 2FF7A 4KKUA 3MG9A 5B58C 2OZEA 3HJNA 4V0LA 3W3ZB 5EJEA 2IYSA 2QSYA 4HDQB 3A8IE 1BYIA 3T1VA 4I99A 4B3TQ 4B3RQ 1P72A 4YMUA 4HZUB 4QNMA 2LWIA 1Q82C 4LUVA 3SJAA 3LWNA 1DOAA 5JJIA 1SMYC 1YJWA 2BBSA 4X62Q 2RF4A 4B3MQ 3GP8A 2YWHA 1OXXK 4YY3Q 4OO1G 2W2TA 5EE5B 2VH5R 3LVQE 2JA6H 1OKKD 4TTQA 3NE5B 4JI3L 1B9MA 2DBYA 3QBVA 4GOXA 4JOIA 3M4OH 4Q9LA 1J7KA 4RFSA 2P3SA 5JS7A 3HOZH 1T5EA 3I55A 2NGRA 3ZJYA 4DLRA 1PH5A 1AS3A 2W00A 2ZTSA 4XWAA 1Q46A 3WBKA 4HJ7A 2Q9BA 3U3JA 4C9BA 1FP6A 2Q9CA 4LX0A 1R4AA 4BY1G 2KENA 3WHKA 5HY6A 4JI7L 2CHVA 1GKHA 4A3IG 4X8LA 1AJEA 2WJHA 2EFCB 4IRUB 1FNMA 5M3FG 3M0EA 3M85A 1PUIA 1XEXA 5AJ3Q 1XCPA 1XTQA 3IBGA 3LW8A 2EJMA 1G6HA 5IF9A 3U3RA 1NIJA 3WXMA 1E3MA 5GJBA 2A5GA 1YVCA 4I4LA 121PA 1UM8A 4Q47A 5J4YA 4C2UA 2WJYA 5EXPA 1LTQA 1QHIA 4Q4AA 1UKEA 1K5GA 3RANA 1U94A 4ASUD 1W2BA 5J4LA 4FDBA 5F9HA 3ZD6A 1XJ0A 3K0SA 3WYFA 1YHBA 4JLBA 4Q4JA 4AKGA 1WXQA 2ODWA 4JI1L 1TPZA 3FGNA 2EJFC 2WAQG 2OCAA 2ZSFA 2V7QD 3MRSA 2YOFA 2G6BA 4B3SL 2A5FA 1WOCA 1VG0B 2N42A 4ZCMA 5EUMA 4BZXA 3SFZA 2R6FA 1NJFA 3ASYA 521PA 3SJBA 1X55A 3VR5A 3IUYA 2WTUA 3UG6A 4QIWE 3TS2A 1E9DA 3L8YA 4BFVA 3UPUA 2EYUA 2ZSAA 4A3EH 1E99A 2WPDD 2ZJAA 1AIPA 4X64Q 2CK3D 2BDTA 4LJYA 4OQFA 4PAQA 4W5WA 1CJKC 1HZBA 4APVA 2IX3A 1TQ4A 4M9QA 4JL6A 1L1OA 1M90C 3PCOB 4AQYL 1VQ8A 1WCV1 4DZZA 4QGHA 4OWTB 2IYRA 4BLPA 2RGGA 5CJ2A 2ZM6L 2VHCA 4Q01A 1W49A 4RVCA 4KN4C 3IHWA 2QP3A 3UKDA 2JQOA 2AFHE 4CZ2A 1KY2A 4LOAA 2K52A 1Q1ZA 3QPWA 4POAA 4FCWA 4QQBX 3GFPA 1B23P 3FFBA 2CJWA 1JR3E 2IUTA 1N0VC 2BMDA 5GADC 2OBMA 2TMKA 4GFDA 3MCAA 1WFQA 2ZT9C 2VQFQ 4RD0A 4I1UA 3KLWA 1PZNA 3A6PC 2ASBA 1TQ6A 2XTZA 1EIFA 4O0AA 3AUYA 1L2FA 4DR6Q 5FR1A 2ATWA 3CCUA 3UATA 2ZRGA 4DHEA 2NMVA 1JR3A 1JAIA 1WQ1R 2GK7A 2D7DA 4JI4Q 1HEIA 4R4OA 2NQ2C 2VL7A 4YHHL 1AQYA 4B71A 2XGJA 3OIYA 3QG1A 2K5NA 2Z6KC 1HNZQ 1S4QA 2F43B 2QP4A 4X8OA 5CDFE 4TYNA 1NMFA 1RYHA 2BMJA 4B43A 1U2RA 5BYKA 1KNQA 1KNXA 4V0OA 4ZV4A 4A3EG 5EP1A 2AMCB 2Y0SE 3CKLA 4DLUA 1IL2A 1AZTA 2VUMH 4IEEA 3PO3H 1C9KA 4A92A 2FFHA 5G3ZA 5JECA 4MGIR 3NBXX 1HQYE 3M4YA 1FR3A 2K14A 1G8GA 3AF3A 5CM8B 4LYJA 3IPYA 1KYIA 1VG1A 4DLVA 3W5JA 2BDOA 1KRTA 2IXEA 1NF3A 3VKGA 4DV5Q 1Q1BA 1JNYA 2ODBA 1IY2A 5HE8A 3U4VA 8OHMA 2JJQA 4JLKA 1JQJC 1S3GA 4EQ5A 1EFWA 1P60A 1QVAA 4DSOA 2BKEA 4L15A 5C0XJ 4DV6Q 4TL8A 4DEXA 4LFAQ 4A76A 4PC2A 4Z54A 2GRJA 3BZCA 4GPTA 4GS3A 2J7PD 3S1AB 1K0RA 3RRZA 3QJYA 4P75A 3U58A 4GMXA 4LHYA 4PPGA 5IDVA 1KMQA 1EXMA 3EPLA 3CQZH 1AQUA 4LJ9A 1N2CE 5AWFC 2QGNA 3VDYA 1X9NA 1ZW6A 2WWGA 2ZRKA 3K9NA 4BFZA 5DH9A 3PUVA 2XJ4A 2C77A 1KRSA 4X66Q 1JMCA 3IHLA 4GI7A 3F0TA 5FLXc 4QJ4A 4B3XA 4TZ0A 4QJFA 3QKSB 1HH2P 4URXR 1P62B 2JLSA 4GOPB 2ORIA 3JZMA 1JALA 2ALYB 4X65L 2B21A 3EZ6A 5H70A 3WP0A 4R71A 2HXYA 3ECCA 1E0JA 1KSHA 3ASZA 4O2DA 3F2BA 1XCMA 2RHMA 4KBGA 1NKSA 5A35A 3PIPA 4H44C 2VUMG 3KKNA 3PO3G 2OG2A 1E2HA 2AKYA 2OAQ1 4AH6A 4Q00A 3H15A 2MNAA
chains in the Genus database with same CATH superfamily
2LD4A 2ZKIA 3NIDB 4DRYA 1WU8A 4P71A 1IBMB 1BZYA 1D2BA 2I65A 3KJOA 5I7SA 5JFTA 2CXPA 3OZXA 3FLBA 4RACA 5FAXA 4FPXA 1A98A 1X56A 4XVCA 1I4XA 1NE2A 1T5SA 3OM1A 3SOZA 1VGVA 4TRMA 2PZTA 1JBEA 5GGYA 3UW3A 3D6WA 3EIHA 3DOUA 1C7EA 3GXBA 3I0MA 3DH0A 4DBLE 2V6MA 2PUTA 5CYOA 2PUEA 3GPDG 3GO4A 3WWCA 1CRPA 4N7RA 3RO7A 1GL6A 3EE6A 2AHOA 2QPAA 4IW3B 3T4UA 4HX9A 2FGJA 2CFOA 1IBKL 3CNLA 1Q0RA 5GPBA 3RFTA 1XEFA 3VH3A 4FEAA 3IEUA 4RWZA 1V8QA 4RJLA 1HZ9A 2B8WA 3CAMA 5ITWA 5B6IA 4ECEA 3EGIA 1CY6A 1E9BA 1U8XX 5C0XI 3NMUF 2WG0A 1IW7D 5IIFA 1HO3A 4FK8A 3OQ1A 4LOHA 1HX7A 1XVLA 4WNCA 4W8GA 3A0RB 5E1BA 1JX6A 2VP3A 3DDHA 1RQ2A 1A1VA 1WPXA 2GT1A 2B1GA 3GCDA 4GKJB 3BRQA 3DMGA 3CONA 1KO7A 2GD6A 1JE1A 1UF9A 1TWCB 5FWXB 1NI3A 2AHRA 2BI7A 3P2EA 1G6Q1 3L7CA 4KI7A 1E3TA 5AUOB 1OWPA 2P6OA 3ER0A 3FYUA 5ALNA 2P2CA 3T12A 1BFDA 2GAOA 1YVDA 2A5DA 5DTQA 3LWEA 1H1LA 3FW1A 3UCEA 2GPYA 3BSYA 3M6IA 1X7ZB 3RKSA 4NYJR 2OM2A 3D3EA 2QLMA 3K0HA 3GP3A 3LX5A 1M9NA 1NHGA 1NRIA 2DLNA 2GZRA 1RLJA 2Z83A 2A1UB 2GVNA 2J9RA 2OCGA 2AZ4A 5AIBA 1JL3A 4TVKA 4UTRA 1ADFA 1QTNA 4ZQIA 4K0KB 1G20B 1P2BA 2C2OA 1C8BA 4C43A 1BSVA 1ZRNA 1ADYA 1IN5A 1NIPA 3ZHYA 1Z3CA 1I5OA 2FN8A 5ECYA 4FGJA 4QQKA 2NXCA 1NDHA 4QHYA 1ND5A 4G6ZA 3G1WA 5FJ8G 3NBHB 3GF4A 1DO2A 4B87A 3T7IA 1I10A 2YZMA 1WDTA 3TQCA 3S7ZA 4DWVA 1B0PA 4AYBE 4IDDA 2G8NA 4OYLA 5EUCA 5ARDA 3I32A 3H0KA 1QGYA 4KIJA 2GK6A 3LM8A 4OB6A 4JKYA 5L51A 3L3OC 3TFQA 3NOOA 4ZQGA 3IQWA 3RYHB 2DF8A 2JLCA 2ESRA 4B6SA 1MJFA 4H7EA 2XUZA 4JI4L 4L5CA 2DKOA 3PJRA 1UJBA 4CHTB 4HXFB 1XZHA 2B63B 1IZ9A 4I50F 4XX1A 4JI7B 2FYTA 2Q4DA 1DBSA 2Y1WA 3TS0A 2ABWA 4MUHA 3WV4A 1U9IC 4L75A 4MKFA 5IC4A 2H2IA 7MDHA 4S1WA 3QBDA 1ICFB 3ZK7A 3SEQA 1OAOA 1HYQA 3RTEA 3NQ41 1N32Q 4ZIRB 1QH1A 1IM5A 3ACCA 3RUCA 4OJKA 3A1TA 3C3MA 3P7JA 2VJMB 3ZDFA 3TKAA 3JQAB 4D4IA 2J5KA 4DUZL 3MRXA 4GC5A 1THZA 3DTNA 2ZZMA 1MQAA 4ZK2A 5JCPA 1O6ZA 4PC6A 1I2ZA 2WABA 5EJAA 3AG5A 3QEAZ 4IUVA 1EY5A 1PVDA 2QEQA 3R0JA 4P0QB 4XQ0A 4I3FA 4BMZA 1FX0B 4TTPA 2OFPA 3U1VA 2RH9B 4AJJA 3IO3A 4BBSH 3P71T 2WA1A 3WX0A 1KAQA 1XB2A 3ZE0B 3T3PB 4DARA 3QTBA 2O20A 2QD2A 2OBLA 1N0HA 4UZSA 3AEZA 3C5CA 5IT9E 2EY1A 3AFPA 2BFDB 2HV8A 1GD7A 1G2OA 1U0RA 4IVQA 2C5CA 5I9TA 1I1NA 3SFVA 3BG3A 4N65A 3QF4B 2Q2OA 4L5TA 4QEKA 4BTEA 4AKIA 4X90A 5I9OA 1CUSA 3UMYA 4X3TA 2G25A 2DBVO 4G9EA 1Z7EA 2AD5A 1YNNC 2CV1A 1PTJA 3GTQB 4RGVA 4LYDA 3LX0A 4IX9A 3PHGA 1I4RA 1DC6A 1ZXXA 3A3YA 1I50B 5HP4A 4NP6A 3JQGB 1C3VA 4XT1B 3UNXA 3A6FA 5JAVA 3CEMA 1DJOA 2VAMA 4RFVA 4NQRA 1F2UB 3RC9A 3WQRA 1T1IA 2EY6A 4E5UA 1N7IA 2JA7H 5JVG3 3NK9A 3CPWA 3IQGX 5HQ3B 4AZWA 1KK1A 5NLLA 5BN3A 3CR8A 2AIRA 2NVUA 2VPQA 1FVOA 4S12A 1F2DA 1TWGB 3SVZA 4B79A 4G1FA 2PQAA 1X42A 3WGKA 2PI2E 4Z4EA 3WZMA 2II6A 5A0FA 3OIWA 2GKOA 3CVWA 3X2EA 3RS0A 1N36B 2IZ0A 2CLIB 4EWLA 2DGDA 1QJOA 2VHWA 4DE5A 3IVRA 5IANA 1RKVA 4J4TA 1KI9A 4X1YA 3C1TA 2QEJC 1GZ7A 3DOFA 8MHTA 1XZKA 1EQUA 4XQQA 4LI0A 2MYTA 5C8DA 2NB0A 3ONEA 3MJVA 3EJ6A 1N0IA 1S8FA 5GZ1A 1ENPA 3A36A 2BFWA 3HXPA 1L4UA 1NC3A 2O4CA 4XWTA 4C0KA 1QIFA 4BJHB 4A3SA 4GP6A 3GIDA 3AI2A 1RD4A 4A0FA 2D62A 1SUPA 1EGHA 3WHPA 4RAOA 3V7WA 4F88A 3ZK8A 5ALYA 3UPDA 3ZPXA 1Q0UA 2KEDA 4GKKQ 3Q7RA 3WB0A 1PFMA 2G9NA 6ADHA 8AT1A 1KARA 2Q2TA 2FR8A 2OLKA 4YIHA 3GFTA 4R4TA 1HT1E 4IDOA 3I12A 2ZRMA 5HGJA 2RHGB 3KTOA 1DRWA 4QL3A 1B1AA 3PWZA 3L6UA 3CPHA 3IV6A 2ZXPA 2Y2VA 4XDYA 1O03A 1MH1A 3EBEA 2AC2A 1AKWA 2LIVA 2QRVA 1D0VA 2Y0SG 3HOUG 5ITSA 4WUVA 2EEZA 2FSGA 4UM9D 2J31A 3ICCA 2IEYA 4DB2A 4AXBA 5HF5A 3QBJA 3ZWQA 2CBGA 3TX2A 2HT1A 4I4TA 3F5MA 3AIOA 3TQTA 1M2OA 1H2FA 2VYCA 1O0CA 2P79A 3T1HQ 3QWNA 4XSGA 1L4YA 1IY9A 3RU2A 1T36B 3H7IA 1DEOA 3H1PA 3DWIA 3E7FA 2K04A 3ONWA 1ZHHA 2NTJA 3FOWA 3WQQA 5LMUL 4NSNA 4JBWA 1PV1A 3NQIA 2Y1LA 3IV9A 4OOFA 1VQPA 1T35A 2PSSA 3BXXA 3K6OA 1NWCA 1NW6A 1SAYA 1X1TA 1CHDA 4B3TL 821PA 3S2HH 1OZHA 4M36A 5CV6A 3QMMA 4Z1OA 4KR0A 3FZYA 1OB2A 3QU5A 2H4OA 4GNRA 4HADA 3ACBA 4DR6B 1Y8NB 2E18A 1J06A 3OPOA 4AQDA 4KUGA 4ZC1A 3ADOA 2JFPA 4CMIA 3DEPA 1RJDA 5FHQA 4FUQA 1QCDA 1ZN9A 3DDZX 3VU8A 1GCAA 1SRQA 1D8TA 4NBUA 1CR6A 1OKKA 2QWXA 3JRXA 2IXDA 2DR0A 3EX7C 1XTVA 4YCMA 3WV5A 2R25B 5AOVA 4OMCA 4PN7A 4UEOA 1E5QA 4X66B 5FB3A 4ASUA 2OZLA 4R51A 3LXRA 3WGJA 1F9QA 5JCJA 4RQUA 1DMSA 2OCEA 2DT5A 1QX4A 2ONYA 2P5ZX 5CLIA 5LJLA 1C1XA 1M8KA 4FIZA 1RJ9A 4Q1VA 1Z36A 5AUQA 2PQ0A 7YASA 4JB2A 2FRXA 5I7FA 1DJPA 3WSVA 3MD0A 3HPQA 1L0YB 1FFSA 3V33A 1WSDA 3UK2A 1JLSA 3KLPX 1VKRA 5KYWA 1RXEA 1BDMA 1MAUA 1QGUA 4KVZA 2IJGX 1U4PA 1C0LA 3EOBI 3H9UA 2Y6UA 4ND3A 4N0PA 4F2HA 2E76C 3KCQA 3OIFA 3KDSE 2YXDA 1QIJA 4EX7A 2W8BA 2EQSA 5ESXA 3GL9A 4EJSB 2WUGA 2B69A 2ZAYA 3KV1A 2PT7A 2HIAA 4D98A 1R5NA 2J41A 3RQSA 4F46A 4JI6Q 1O94C 3FKIH 5COBA 1YVEI 5F1PA 5LZ2A 4INJA 4BKRA 1YC2A 4DAMA 3EIOA 3MWJA 1SQGA 2J7ZA 4C4ZA 3OETA 1QZ3A 4L0QA 2OFOA 1U8YA 4WA7A 4JELA 2HPZA 2HFKA 3OCUA 3PNPA 3N5KA 1Z5VA 2W0MA 3D0RA 4CW7A 3PKZA 1OXSC 1SR8A 2C84A 2ZJOA 3VAYA 4YB8A 1X8JA 5HIJA 1NYTA 2J09A 5ALVA 3IPXA 3OIQA 1BH2A 2W58A 2IHKA 4UHFA 1M1NB 1PGOA 1UKAA 1AQNA 1JIJA 3DFUA 4OXQA 3CB2A 2PR7A 3VOAA 4RY0A 3ABZA 4QQFA 4EMBA 3T4EA 4EKNB 1OUMA 2RDHA 3HCBA 2HF7A 1R8XA 3PQ8A 1R9TB 1Z82A 4DA2A 4LCBA 4B7CA 5G2OA 4NBSA 5EXTA 3TCXB 1DBIA 3AUUA 2YJ3A 5LQCA 4XXHA 1YE8A 4KD4A 4YI3A 1D5ZC 3L8EA 1JLHA 2D1QA 1OPXA 5H5JA 3FN4A 4R84A 4BQSA 1QIKA 2O23A 1V3QE 2E5FA 1C30A 4MJ3A 2VP9A 1VHQA 2E49A 4JOSA 1I4QA 1ZN2A 3M6UA 4I5IA 4KITB 3QTLA 4ID3A 4Z3DA 3GUHA 1WMBA 1P5ZB 3HGMA 5B7PA 5CNIA 1NW8A 2Q2NA 2E2IH 4D2IA 3GAMA 3ZVKA 2Q3FA 3H4MA 3MW8A 1SU8A 4GOMD 4MS4A 3OECA 1J22A 2HJSA 2LXKA 5FADA 4ZGGA 3U56A 3WDLA 2GPJA 1RLTA 5G3LF 4ZOCA 1C50A 4XX0B 2ZREA 1IN7A 1L3BA 3G0OA 1M74A 5KYLA 3KSUA 3PUZA 4HIMA 1Z33A 4JX9A 2PH7A 1C9MA 3EWAA 4GXQA 3NC4A 3NALA 3SLKA 2B5VA 3F5DA 3Q2KA 1MJEA 1XCOA 3G8BA 4B73A 4LDRA 4I8IA 5T6MA 3PTLA 4KXYA 3RSZA 2W6OA 3TIIA 1KL9A 2A0WA 3K0CA 4KY7A 2MO0A 4E2ZA 1M2JA 5FI3A 5B1DA 5B64A 4XYMA 1DKLA 1YRAA 2MDTA 5EWMA 2QRLA 2YV5A 2MJLA 1KDTA 2NAPA 3AW8A 2A3RA 1TPYA 2AEJA 3D02A 2OV6A 1X32A 2HAEA 4HLDA 3JAMc 2QMZA 4L5IA 1HL7A 3ISTA 4RHCA 1U81A 5EKLA 4HLNA 4OEHA 4CTNA 5IYCG 4IHJB 4WOPA 1OZ0A 4FMPA 4BBJA 4IZ6A 2NVOA 5EGNA 2B2UA 3FB1A 3TQRA 2EIFA 4ZVRA 2I46A 2A69D 1E20A 1ZK1A 2I3GA 2X69A 1X7YB 2YNMA 4H77A 1PDWA 4ITUA 2VH1A 2MHCA 4YLYA 3ZJVA 4LECA 2NG1A 5CGZA 1QGDA 5A05A 1U4OA 4KPUA 4V0NA 1S2OA 2V65A 3OTGA 2QPLA 2PXAA 2FPPB 2VNUD 3WMFA 3P20A 2Z30A 1POXA 3IXMA 4MH0R 2W2LD 5H81A 1NE3A 4EFNA 4OONA 2PSDA 4QXQA 2UUPA 4RPHA 4MA0A 1XPUA 2EL7A 4O4JA 2DY8A 1JQBA 4EUFA 1RI2A 2P5YA 4XQEA 1KFCB 1NI5A 1W29A 4A3FG 2VQEQ 2Y0EA 1E2GA 1TTQB 3G49A 1S5FD 1W2HA 3ADPA 3PT9A 4KQJA 2YHIB 3S17B 3O82A 1FDWA 1WSWA 3LRTA 3LPNA 5B2EA 4HGYA 2C3UA 1CZUA 4HNUA 3QXGA 1A2BA 1HTPA 4JC0A 4QBTA 4IFDH 1DIRA 1G59A 4DGSA 1LFAA 1KI6B 1X19A 1DOMA 4JV5Q 1K86A 2C4NA 3V2TA 2YC2C 1DG1G 2YXEA 5FTJA 2Q8TA 3LSTA 2P2ZA 4BBZA 3C46A 5LYJF 2C2ZA 3H3FA 2BKAA 2NU7A 3D4BA 1VJGA 1BC5A 2DFPA 4OHWA 3IELA 4KQIA 3K1AB 2QNBA 2ZJRA 1UANA 2VF2A 4UKDA 3LKBA 5CAEA 4F93B 2X4IA 3SYTA 1UBCA 2K7ZA 5HZHA 2WD7A 5CT4A 5CV4A 1BCPC 1YNJC 5BV2P 3ENNA 4UM8B 1OX4A 5AVZA 1DQRA 1BJKA 5AJUA 4DR4Q 2YU9B 3HDQA 4MIUA 4JYZA 4NLLA 2GCNA 1NMSA 3GAZA 5LU9A 2B4QA 2AW5A 4KQXA 2C5LA 2F64A 1QFMA 3VX3A 3GGDA 1JN0A 4BNGA 5BR8Q 1WVMA 3S2GA 4C0BA 4G3XA 5CT5A 5DTEA 1XCLA 1RPNA 3ECSA 1FK8A 3RROA 4FC7A 4E2XA 2CXHA 5BNWA 3C1AA 4LRYA 1HQCA 5HX7A 2JCVA 4M4SA 5FQNA 4PICA 5E0OA 1E98A 1I6WA 3AR6A 3R7BA 2G1UA 1N2BA 4ROSA 4JW0A 1EZ4A 3DVSX 4YWKA 1MTOA 5J3BA 4IXNA 2IH2A 1XZNA 4L63B 5LXTA 2ZQZA 5BR1A 1Q83A 4NDXA 2EG5A 1MD9A 3CSDA 2MYPA 4I99A 3OMGA 1Y82A 4MVJM 3ZX4A 2VH5R 1AURA 1Q0PA 2VZ0A 1NJ2A 1TR5A 3GG2A 5HY6A 1AJEA 3R6WA 4UARA 4IRUB 4LZJA 4BNFA 5AJ3Q 1CY8A 1ZL2A 4HDKB 2CLOB 2H1VA 1U4LA 2WJYA 4FDBA 5F9HA 4PLZA 1YS6A 1QVZA 3FGNA 3PPIA 1WEHA 2QN9A 4M8AA 1LTRD 5FAKA 2EIXA 1TC2A 1IKMA 3UG6A 3TS2A 4BFVA 3CLTC 3GT7A 4X64Q 5C1IA 1KMMA 2BY4A 4OWTB 4EKGA 3C6KA 1VRCA 4C3HB 3QPWA 3HBJA 2RC6A 3CEAA 2WYVA 1XKTA 5DEOA 5THXA 1EIFA 3A4VA 2XGJA 2R8BA 3OIYA 5C7YA 1HNZQ 3LE8A 4ZV4A 1IL2A 3M5DA 2R47A 1M2FA 1RYBA 5BWLA 1UEAB 2K14A 3M4YA 2RHRA 4XPIB 3DB2A 4DV5Q 5IM4F 4JLKA 1JQJC 1K88A 2PJDA 2BKEA 5LN1A 3BZCA 3PYXA 3UF0A 1ZMTA 3AHDA 2V4MA 4CIYA 2YDYA 1Z75A 3S70A 4F8EA 1N2CE 3O1IC 2X22A 1ZW6A 2WWGA 4GI7A 4CFZA 3DE2X 3J7AC 1LRJA 2I7TA 4MCHA 3KKNA 3BQ9A 3FTFA 3FCOA 5KIAA 4Q00A 5E3IA 5ELMA 3GO5A 5SZKB 3KBXA 4LHXA 3Q6NA 1NQOA 4GN3B 4ZN6A 1SBYA 3VO9A 3BX1A 2FZLA 3DMUA 3KQQA 4R2MA 3SAJA 3QLUC 1F8XA 2OWDA 1C1XB 1IQPA 3T5AA 3EFHA 4TXJA 1G3MA 1OVMA 1A7AA 2O8FA 1KE1A 1V43A 1QVVA 3BJIC 4QJBA 4BVGA 5EXXA 1IN4A 3OX4A 4FJ2A 2O59A 2ZIXA 1C0AA 2QY6A 5JVDF 2GTPA 2FWIA 4IDGA 4UW9A 4QU5A 2V6FA 3EPPA 3ND6A 4JUBA 1BMFD 1B8NA 3VU9B 4GNXC 2AE2A 4POOA 4V39A 1N33Q 4JIMA 4XQJA 4NEQA 1PS8A 5BN4A 1QLWA 1RRPA 1ESFA 1R4NB 4E88A 3BH6A 5L3SA 3INRA 4H3SA 2BJHA 5K0TA 5EE1A 1SM4A 1I7DA 3UIEA 5HKBA 2P2SA 3HBNA 5DISB 4EAQA 4MWSA 3U3OA 1TXGA 3CR3C 3PJDA 2G9HD 1G21A 1VCIA 1A3VA 3Q12A 1VHJA 4QYWA 1H8EA 5BSGA 4LHEA 1XELA 3KJXA 3J81L 1QNUA 4A5OA 3PD0A 4REMA 2HQOA 3DC2A 1UBRS 4BKUA 3DPSA 3DO6A 1G2IA 4AQ7A 2EWWA 3K58A 2YTYA 4MMXB 3M4ZA 1CHQD 3V42A 3CH4B 1B00A 4DLBA 3IODA 4EB0A 4DNRB 2PEZA 3ZVLA 3BG5A 1MBZA 4OHMA 1LT5D 4O3FA 4F7WA 1QKJA 1ECGA 3WGNA 1Q0HA 1K3RA 3GLHA 4RFLA 1VQKA 2CLHB 5FWYA 3D8NA 1U0OC 4IFIA 3DOOA 3JYNA 4HLCA 2BTOA 2AC7A 1WOMA 4QIWB 1GZ3A 1N2XA 4A3DG 2CF5A 3W9UA 3BJMA 1T2FA 3CLVA 1QVGA 1FLNA 2WAXA 4X3PA 3R3JA 4YCAA 3NBAA 1SCDA 4DAEA 4E5KA 2ZBGA 2O2GA 3PNKA 1V16A 1CY1A 5HR5A 1BXZA 1QDUA 4TKVB 3RARA 3NCHA 1WNTA 4ZZ2A 4DR7Q 2W8ZA 2RARA 1U7TA 2IEZA 1FXWA 1GNLA 1JQAA 3K7UC 3V1NA 4L6AA 2QEXA 5ICGA 3OZ7A 1CQVA 2OKCA 1MEJA 4WJ4A 1QV9A 5DFAA 1E22A 4LC0A 1S3FA 5ISRA 4ESOA 3OOYA 4O59O 1K89A 3TW0A 1NJ5A 3SF8A 3RYTC 2HDLA 3ZJTA 3A8TA 4Q0FA 4LCJA 1LZLA 2EKZA 3GLIE 2NXJA 5FTLA 5GADl 4UHEA 3LWUA 4YS6A 2WJIA 3NWSA 2JI8A 4E2YA 4HS4A 4ZYWA 1OPRA 4FN4A 4RJJA 3K5IA 5C32A 1IULA 3MMPA 1RRFA 3NHPA 2O8VA 3OLWA 2PO4A 4RA6A 5DX8A 2B34A 1SYCA 5JUWA 4JVZA 3VUFA 4RSRA 1QZHA 4RK0A 2INGX 4QICA 2VW9A 2ZUBA 2XA1A 1EFDN 1BXRA 4DV2Q 2VRBA 3SYRA 4PR3A 4U3JA 2W5UA 4DV6L 4ZLTF 2G70A 3R76A 4LYFA 2ZJ8A 2QR2A