4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
5C0XJ 1KI1A 3RRZA 1XD8A 4JI6Q 1GKYA 1MRSA 2ZUBA 3PEVA 4DJTA 2ZR0A 5ELOA 1PH9A 2BDTA 1KC8C 1VPLA 2AXPA 1XXHE 4QHTA 1UKYA 2HV8A 3B85A 4QGFA 4R71A 3TEHB 1V8QA 1SN8A 2ZM6L 3HOYG 2RHQB 1C9KA 1ESNA 1ZMXA 2D3WA 2QA5A 4JLVA 2CNWA 3THWB 3AVQA 5GADl 3PGZA 1LS1A 3KKNA 4FXPA 4P4UA 3VHLB 2K7VA 1SXJC 1EXMA 1MO6A 2XGTA 2GXUA 2HJVA 2J87A 2PMDA 3FMOB 4OO1G 2A68C 4ZCLA 3QQ5A 2CCJA 2P3SA 2D2FA 3I1FA 5EE0A 1D2NA 4OXPA 1K73C 4ZDIA 4R98A 2GCPA 1A8VA 1QZXA 3K53A 1I4LD 1TADA 1KAWA 4C3JH 2F6RA 4HZUB 4A0HA 4PZ8A 2ZRMA 4QGAA 4FMBB 5J5CA 3ZS9A 4BFTA 2GTPA 4GNXA 821PA 4AYTA 1UBFA 1R4AA 2RGBA 2EFGA 2O8DA 3ULJA 1P9RA 4GNKA 5FI0B 1XWIA 1GKHA 4CEHA 3TQCA 1G291 4B47A 5EE3A 1NIPA 1FZQA 1KO5A 2RGDA 3F2DA 2WWWA 3ZZUA 2AHOB 3HKSA 3JZAA 3CMAA 4JBKA 1KI2A 2EFEB 4B3GA 1W36D 4OWXB 2O8BA 2K33A 2R7ZG 3PR1A 3G82C 1KRTA 2UXBQ 4Q03A 5EUQB 1II8B 2V4DA 1PH6A 4DB4A 3A8KE 2P6UA 2ZRKA 3GJ5A 4XD7D 4LF7L 1P3JA 1Q0UA 3QKUA 3EPHA 2K50A 3M7NA 1WYDA 1G18A 5L8VA 1M8PA 3PCRB 1WB9A 1VQMA 3U3OA 4FMDF 5L3SA 5GVRA 1N6RA 2BEJA 1FL0A 3KQHA 1HQYE 3O8RA 1EK0A 2UU9L 4NKRA 2JJQA 1QHHA 3T1YQ 2UXDL 4IVRA 2JLYA 3J81i 1CLUA 3EX7C 2ODBA 4CEHB 3DHWC 1U8AA 1UBCA 1QBKC 1WF3A 4I81A 3ADBA 2IW3A 3G5UA 1SKYB 2QY9A 2W83A 2KBNA 4C2UA 5FJ8H 5KDDA 4GNXB 2GVBA 3UMFA 5TB5A 5E7IA 2XXAB 2O8BB 3TQYA 3AEVA 1JNYA 3AKDA 1Q81C 4JK1C 1UE6A 2ZR9A 1Y1WG 4A93G 1WMSA 5C3EG 2OXRA 2UXCL 3AB3A 3MCAA 4GFDA 4TYQA 2DR3A 4ZDJA 2E76C 1NLZA 1VQNA 4Q19A 4JYBA 4DV1L 2REBA 2VHUA 1P2VA 4AKIA 1I3QH 4KYUA 2J0UA 4TQ9A 1XF9A 1YJ9A 3KZ1E 4P4SA 4RZ2A 4LV6A 1OPXA 2H16A 2C98A 4BZPA 1ZUIA 1CR2A 3NDPA 5J47A 2IUTA 3I56A 3HU2A 4DSOA 3TZUA 5H1YA 3IPXA 4LYFA 1E1RD 1EOVA 4XSGA 4A8JA 2XZLA 4YONB 1HR0W 1YHAA 2LXJA 2IYVA 3DVLA 4K8OA 4NYJQ 1W36B 4OX9Q 3GEIA 1V43A 1SR3A 2DFLA 2HF9A 3AP3A 3QPWA 2JA7G 1E2DA 2RGCA 4PPFA 5KSPA 3RS4A 1GNPA 1AKYA 1OH5A 2ZJBA 3AVYA 1KAGA 2QBYA 4J0QA 3FDIA 4IXNA 2IY5B 2VUMG 1JALA 3KX2A 2N3SA 1GSIA 1MIUA 3E9HA 1TWGH 3CR8A 2GESA 3PUYA 1VQOA 1IBLL 5EJEA 3BB3A 2D5DA 5FUYA 4Q9LA 3ZZTA 1NBWA 5A35A 1OV4A 2VHCA 4A3IH 4M53A 1XFAA 1W5TA 3K0XA 4TT3A 1TUEA 1GWNA 3C41J 3UXMA 3ZQ6A 2P0EA 4DUYL 4D82A 1RPZA 2WMNB 1P75A 4RSGA 4YC7A 2MFIA 2CJWA 4JT2A 2Y0SG 1VHTA 2D7CA 1VQKA 1XCMA 3WXMA 3DMDA 4PXAA 2Q3FA 3VNUA 4PQYA 1NI3A 2KE5A 2WJYA 2FNAA 3FPAA 3AVVA 3FPPA 1ZNXA 1F6BA 1VQ9A 2IK8A 2PEZA 4ZKEA 4OHYA 2PQAA 3GTPH 3R9XA 1KK0A 2R6CA 4LJ7A 5DLQC 4G1UC 4B2LA 5KNDA 1C0AA 1I94L 4A3MG 2F3TA 4LJYA 4LF8L 2VBCA 4DR2L 4X6AH 5EE9A 2RHDA 3MWLA 2WSSA 4A36A 1Q20A 2QMHA 4BBSG 1HA3A 3T1QA 2UUAL 5IYDG 1CU1A 3CPHA 121PA 1OIVA 1OT3A 2AFIE 3JVVA 4GMDA 4NCHA 3SU8A 4GN4B 3A8IE 4URWR 2E5LL 1NBME 2KWIA 1T3HA 2WWHA 4YMSA 5G40A 5JBQA 2F55A 5BWMA 1P8LA 3H0GG 2WKPA 2ATVA 2IUSA 5J4VA 2WJGA 1YJNA 2R92H 3KF8B 5BR8L 5C4JH 3X1ZA 2QQEA 3T06B 2WPDA 3I61A 4HAVA 3T1HQ 1VTKA 4ZDWA 5P21A 3OTOL 1QVGA 2QL6A 4YMWA 4IVQA 3WMGA 3DMNA 3OAAA 1HV8A 3TRZA 4Q48A 4TZ0A 2BKEA 1P73A 4GLXA 5JSZB 1II9A 3UIEA 1NG9A 1L1OA 3QF4B 4L5SA 1NY4A 1S2MA 1IXRA 2NZHA 1X3FA 1TF2A 2DNCA 1ZM3A 2V54A 4LBZA 4B3CA 4IDPA 4QXAA 3GJ6A 1CEEA 4JCVE 3A1UA 1Z6HA 1XMJA 3BC1A 2GZDA 4Z1MD 4AKHA 1EYGA 4DV7L 1R7RA 5DE3A 2E5LQ 2AK3A 5FOWA 1WFQA 5IYCH 3UATA 2JDID 4M1YA 3W5OA 2G6BA 3EIEA 1NTGA 4PZ7A 1E32A 3RS7A 5JRZA 3SDZA 3CRW1 2XZOA 4PPGA 2MSDB 3QXHA 1XP8A 3OIYA 4GOJA 3PF5A 4URUR 3ZS8A 4LC1A 1L8QA 3F2CA 4A3IG 2Z6KC 4KFUA 5LMNW 2YNMA 3QPUA 3O8BA 1J5EL 1P6XA 3PO2G 2GN5A 1T8UA 2E2JH 1YJ5A 3CLVA 2V55B 4Q1CA 5FL7D 3ZD7A 2Z4SA 3S2HH 2L0XA 1RFLA 4MDFA 1BBWA 1DARA 3GLHE 5FPTA 5HKKD 2PCJA 1A4RA 4E03A 1H8ED 1K8GA 4F7WA 4C2TA 3W3AA 2VQFL 3TE6A 2JAQA 2C35B 4TMTA 1QUQA 3QEOA 1OKKD 2CHVA 3DZDA 3KUCA 4WXRA 4NDZA 4JJKA 4JL8A 1WP9A 4KSCA 1G4UR 3S1AA 3DLLA 1SLJA 3ER0A 4CT4B 2IS6A 2IS2A 3SQXA 3CWQA 1KGDA 2VL7A 2IF0A 1QG4A 3CZPA 2E75C 4TL9A 2H18A 3OE7A 1YIJA 1HH4A 1KO1A 3KXLA 3CPJB 4FMDB 3OEEA 3QBTA 4TTPA 3VKWA 1JBKA 3EWSA 2EYUA 1DXMA 3IHLA 3L82B 1FFHA 4GI7A 2DGYA 1KXLA 4HAWA 4OL0A 4UJ3A 1P61B 5D3MA 4ITRC 2AMCB 2IHFA 4ZV4A 5JZVA 2XZPA 2IYXA 1YRBA 4Q4HA 3EC2A 3AV0B 4KFSA 2ZI7A 2ATWA 1Q90A 3H3VI 1NBMA 1ESMA 3W5IA 1Z07A 3QEJA 3AKYA 4LRWA 4NB3A 5EXXA 3WMFA 1Z6AA 1BS1A 2Y0SE 3H94A 1F5NA 2WM9B 1GDDA 4JLKA 5AJVB 3X1YA 1F2UA 3PQCA 3RDPA 1SROA 1TU4A 2HT6A 3AVWA 1VQLA 3U7HB 1Z6XA 1H9SB 2EJFC 2CHQA 1B70B 3S1QH 1MV5A 3AVPA 4YQFA 1T91A 4A75A 4M1SA 4W5JA 5JJLA 1IN6A 1TAGA 1VG8A 5DYGA 1Z2AA 3SHFA 2AR7A 2ZRPA 3OFND 4HB2A 4HUQB 1JEEA 1VQIA 3THWA 4K0KL 4RFVA 3THYA 2AXNA 1HT2E 3GPLA 2WFWA 3C5CA 2GZAA 3AF3A 5DLQE 5L3VA 2O52A 1N25A 3GLFB 4TYYA 4OJQA 3A1VA 2QT1A 1JI0A 4O2RA 2LXKA 3ONWA 2IS4A 2N8NA 2ZM5A 2GBLA 4C0KA 2JA5G 3CF6R 2HCJB 2I5MX 1K5DA 3K0FB 1ZNWA 5IP9H 4QNRA 3NG1A 1AIPA 3RWOA 2E87A 3TSOA 2QTVB 2OWOA 3ZVNA 1QUQB 4KKSA 2FPKA 3W1BA 1F2UB 1QHGA 5AWFC 4GL2A 1I6VC 1RRPA 2F7SA 3MUFA 3U61B 4DEYA 5E3HA 5AR1A 3I3SR 5IYDH 1MOZA 3CRMA 2HQLA 2K5UA 5IHPA 2O8DB 1DAEA 1CR1A 3HDTA 3R8FA 2YTXA 4H1VA 1RJ9A 1GOTA 3B60A 3R7WA 5JS7A 4HB3A 2ZI4A 4QHYA 3CO5A 4AYBE 4A3CH 1JJVA 4O0AA 3GTLH 1MO4A 3K8AA 3AF1A 4B3BA 4JBWA 4GOKA 4GLAC 4DV1Q 4ILEA 3DZ8A 4RFSB 3CC7A 1S9DA 3T34A 2PBRA 2F43B 3V4FA 5C2JB 5J40A 4NBSA 5FL3A 5FPSA 4DNIA 2C99A 2QGNA 2J7PD 1ZNZA 1KIXA 4URVR 8OHMA 1EX6A 4AYXA 3BZCA 1VCIA 3HR7A 3MXUA 2SHKA 3CX7A 5AJZA 4QG7A 5DI3B 3VU9A 1KYIA 3NBFA 1E3PA 2VP5A 4IFBA 4O25A 2H5EA 4BWYA 2RGXA 4IOKA 2DWQA 3FMIA 3CCMA 2AKAB 4IVPA 2IX1A 1GFIA 3WBJA 4Z8YA 2WAXA 1IW7C 2R92G 621PA 1S3GA 4JI8Q 3CQZH 3ADKA 2ZI5A 3QXSA 4EAQA 2QZ4A 5C0XG 3ULPA 4G7ZC 4PSKA 2A6HC 3PUWA 1CKNB 3ND9A 4L5TA 4X66L 2OHFA 1Q1QA 3O8CA 3HOXG 1M74A 1M90C 1N32L 4A4IA 4PAQA 4KVAA 2N46A 3GLFA 4UP9A 2V7QD 3JC66 4A3KG 3VR4A 4U00A 1FX0B 2FSIA 1YR8A 2ZJQA 3LXXA 1XRJA 3LNCA 1KDRA 1SXJD 1G1MA 1S8FA 4HR7B 3M4QA 2GA8A 3HFZB 4LF5Q 1S3SA 2GCOA 3H84A 4HI0E 4HLCA 4MKGA 4DV2L 4UY8C 2EYQA 5FOVA 4GT1A 4JLNA 2WSMA 4EPXA 4PO8A 2V1CC 3G6EA 3J80i 1LACA 1XNQQ 4IOCA 4X8HA 5AJYA 3CH5A 3T5DA 1D9ZA 3CCQA 2GDJA 1D7QA 3CCRA 3B7GA 4TMVA 3LLUA 2OSBA 4GMXA 4LHXA 2RMKA 4TQAA 1IN8A 2BVNA 4AD8A 3ZVLA 5EQTA 2A5JA 1NKTA 1OW3B 2CK3D 2WV9A 3H0KA 4V0OA 1OB2A 3B1VA 4NXMQ 5CB6A 1KL9A 1ASYA 4M9SA 1W0KD 2OZEA 2ZREA 3LV8A 4Q1AA 3AVUA 2ZRDA 2B8GA 2FFHA 4OQXA 2FGJA 2ZRNA 4Q18A 1IJEA 4M2LA 3RS2A 4DUZL 1KKLA 4BUJA 1W1WA 3LW8A 4HUTA 1FX0A 1KSFX 2ZRLA 1NKSA 4JSTA 3TAHA 1W4AA 3Q9LA 3RRMA 4YHHL 4LF5L 1VIYA 4JLPA 1BYUA 1W2HA 4AH6A 1G3QA 1ZP6A 3FFBA 3OTOQ 5GJCA 4DT1B 2ZI6A 2K52A 3AM1A 4TVAB 4DR1L 1Z0AA 3HU3A 2RGNA 3HU1A 5J3BA 1NLFA 3N2IA 2FE4A 2A5DA 2ZS7A 2KI5A 3T15A 1DPFA 4KITB 3CCUA 1ANKA 2IL1A 1JJ7A 2WZQA 3TKLA 3GCGA 3SGIA 2BE5C 4O2LA 3WMEA 1WOCA 3RNUA 1X3EA 4A3FH 1WQ1R 4BA1I 1EIFA 2QM8A 1HNZL 3BRWD 5BYKA 5JEEA 2GVZC 1UEBA 2ASBA 3F0TA 3B9PA 3SZRA 2ALYB 3G4SA 2FN4A 2ZYWX 3IKJA 1PLLA 5GADC 2UUCQ 2XTZA 4DHEA 5A4JA 2QP9X 3QENA 1Z63A 2JLSA 4DDVA 3MFYA 4GPTA 2OBNA 2LKCA 3T12A 4ZI2A 1YZKA 4DR5L 1NJFA 1T5IA 2BM1A 2FEMA 4TLDA 3EPJA 1NBMD 3L0SA 4MRSA 2A1AA 4BEBA 1YR7A 3VX4A 3QKRB 4G5QA 3SJCA 1VG0B 1HNWL 5GAEC 3IRBA 1IY0A 3U4VA 3UDIA 1ZD1A 2XB4A 3EA0A 3A1TA 1Y63A 4X64Q 2A9KA 1NVVQ 2CEAA 2DBYA 3K09C 3QKSB 2XNSA 1DEKA 3RWMB 1QHSA 4EPRA 2GXAA 3U3KA 2O8CA 2B8WA 2R6GA 2ID0A 4CGZA 4A93H 3B2EA 1LM0A 2WWGA 1LFDB 1SVIA 1L7VC 2MSCB 1K9MC 4BEJA 2Q21A 4LYAA 3SC3A 1AS0A 1NF3A 1PH3A 3GTOH 1O78A 1AH9A 1W44A 2PJZA 2GHIA 2XJ9A 4IXMA 4YMVA 3I5XA 1XMQQ 1BOFA 1NY6A 2BBTA 3B1YA 3HPQA 2PLFA 4BE7B 2X2EA 1Z83A 2W00A 5L3QB 1PMRA 2O0JA 5IE8A 2UXBL 1X56A 4IOAA 1ONBA 2RAPA 1BDOA 2E74C 2RHSB 3GTMH 1W0JD 2I1QA 2RB4A 2AD5A 5CK5A 1VQFA 4Q1DA 3G0HA 1F3OA 3LX8A 3DPUA 2WPDD 3PIOA 4A3JH 1VHLA 3OIVA 4BY1G 3CD6A 3MJHA 4JVLA 3CCEA 1XPOA 2CL6X 2OO7A 1OFIA 1XMVA 4UP7A 2B92A 2IHYA 3AVOA 3OAAD 4I1SA 1X8LA 5JRJA 2AKWB 3MEFA 4QBIA 2Q9AA 1IOZA 4P73A 3PENA 5TV2A 3GLIA 2VSFA 1E24A 1T8TA 1U98A 221PA 2NGRA 3BORA 2AN9A 3RZOH 3BXZA 4BFSA 1KHTA 1WBDA 2KJQA 1GIAA 1ZM7A 4RCNA 2FFQA 2Z4RA 3GJ8A 2E8GA 4GKKL 3U44A 2WB1G 4KMUC 2O8CB 3CM0A 1E9BA 1JEDA 4MRPA 3RN2A 2VO1A 4P4TA 1IN5A 2YOGA 4AI6A 4C0QC 2NO9A 1IXZA 2NO1A 3C14C 5DSZA 1QF9A 2EFCB 2HXSA 4KU4A 4POAA 3Q85A 2WKQA 4TLAA 4QJ3A 4PAOA 4WZBE 4DAMA 1NP6A 2PL3A 1ZU5A 1E3MA 1VYVA 2K75A 1GP2A 4APVA 1VF5C 2B63H 1D9XA 5IDVA 5C44H 4HAYA 3DEFA 1QVAA 3M6AA 4JJZA 1ZKOA 4A3GG 4HLDA 5FR2A 5B30A 5KSZA 3TMKA 2VQSA 4B44A 3MWYW 1Z6GA 5AJXA 2BIFA 2QUZA 3MLEA 4LW1A 4NCNA 3L0PA 1XPUA 1HR0Q 3BH6A 3RZDH 2NN6H 2I5HA 1XNQL 2EXDA 4L5BA 3OE7D 4IW3B 4LHZA 3ND8A 2DFNA 4MGZR 4DK6C 1T3SA 3IEVA 1Z6YA 2RHMA 5FPYA 5L3QA 4V0ME 5AJ3L 1PZNA 1FNNA 4M21A 5FBQB 5CB8A 1GVPA 1R8QA 4DB2A 2B3GA 2UUBL 1JJCB 4YMTA 3I4MH 2A6EC 2VSOA 5D3QA 1CSQA 3HYRA 4CIDA 1LTQA 1G41A 5E95A 3BGWA 1NJGA 2EDGA 2CQOA 3VDYA 4HJ7A 1CXZA 2AFHE 2WWXA 2X77A 4PSVA 4HIDA 1GNQA 4JI4L 3A6PC 4Q1FA 1XBTA 3RS5A 1XTIA 3W9YA 1AGRA 2G9NA 4A3FG 1DE0A 4GZMA 3T1VA 5TDHA 3AF0A 1XEXB 1LB1B 4TMWA 1LTLA 1B9MA 1Z0DA 4IEEA 1DAMA 1OH7A 1G8GA 5AJ3Q 1FR3A 1EWHA 3VU9B 3BBPA 4V0KA 3NBZC 3PO3G 1DO0A 2F9MA 4HATA 2C8VA 1J90A 3NBHB 4IFDJ 2C77A 2OFXA 1OFTA 3AB9A 3FVQA 1TQ4A 3QNUA 1K8MA 2QE7D 4Q1BA 3NBYC 4RD6A 1GD7A 3KKOA 2GNOA 4HB0A 1O87A 1XX6A 2LCFA 4PANA 1E7ZA 4JG2A 3A7LA 3D31A 3B6YA 5C4XH 3QPVA 5FOXA 4F4JA 1KI6B 1IXSB 1ZINA 2ZSAA 4A6PA 4W9MC 3U4ZA 4KV9A 3SJAA 3EARA 2OQKA 3DL0A 4HJ8A 1MABB 4DK0A 1P16A 3L8YA 2ZTSA 3LVQE 3MSXA 3A74A 3REGA 2IEZA 3QI2A 3M9BA 4JI7L 1OTCA 3S1RH 1J2JA 4NXML 1Q1ZA 2G3YA 2YC4C 3HOVG 1RRGA 3IILA 1CP2A 3H4MA 4LF6L 1GVNB 4PO9A 2QE7A 4DDUA 2VHQA 1MKYA 4G7HC 1NMFA 2GZHA 1P2UA 2P65A 3CB4A 4B3ML 2NG1A 4QRHA 1N0UA 4ESVA 1HZ9A 2R8RA 1Z7TA 1IQPA 5CYOA 1VQBA 4V0NA 1X3SA 2CFMA 2OTLA 1BO6A 1Z2CA 2AD1A 3NHBA 1W7AA 1KJYA 3THYB 2J7PA 1U9IC 2BBSA 1AS3A 2WIBA 2Q2HA 2MNAA 2EQSA 1X8JA 2ZRCA 2Z6KA 1T6NA 1SULA 4FCWA 4M22A 4H13C 1AE2A 4OO1I 1HNXL 2DYKA 2J45A 2VHJA 5SZJA 4AIIA 4HJAA 1II8A 4JI7Q 4JBMA 5CITA 1IBMQ 3PSIA 2IT1A 2HXYA 5FJ8G 1KNQA 3H2YA 1OXTA 2R7FA 5C4XG 3OZXA 4QOSA 1PYSB 2JA8H 3CCSA 3U6BA 4LF4L 2FZ4A 3U50C 4POGA 1N0VC 1X6OA 2WMOB 1EWRA 3I72A 2W2VA 4PQRA 1G17A 3KOJA 2FSGA 1TPZA 2GXQA 3GTQH 2R65A 3PUZA 1OF1A 3IFTA 3HOZG 4MDEA 3SEAA 5C18A 1TWCH 3ADDA 3KJEA 1AZSC 2R2AA 3Q7PA 3AUYA 4DR5Q 3JAMc 2JA7H 5EP3A 4D6PA 3S17H 2QBYB 1UAAA 3THOA 3VR6A 4WJ4A 1UE5A 1NN5A 1ZYRC 1B9NA 2ONJA 3U3RA 2HUPA 4HDQB 1U8YA 3BG3A 3K7AH 4YCUA 5JEAG 3KJHA 5LBIA 3TR0A 5LPNA 5C46F 3KQUA 2YWHA 3UPUA 5H8WA 1E79D 3Q8XB 5TY0A 4DV3Q 2AX4A 2GK7A 2GXSA 3P26A 1WBBA 1JR3A 1LUZA 2PZFA 2ZJZA 5LD2C 3FKSA 4MGIR 1I4DD 1VQCA 1P2SA 2ZEJA 3IHWA 3TSWA 2BDOA 1P7CA 2J0UB 1N33L 1G7RA 2BMJA 2ZTEA 2C04A 2ZUDA 4ARZA 1PLKA 2ASEA 2BM0A 2A5GA 4YCWA 4QL3A 3LA6A 1ETUA 5ELNA 3THXB 4DPGA 2JDIA 2GILA 3KKMA 4JBYA 2ZU6A 1WCMG 2GKSA 4YXWA 4KXFB 1DAKA 2QEXA 1XPRA 1BH2A 1KI9A 1Z06A 1ZC4A 2B6HA 2QAGA 4PC6A 4GOPB 4PHGA 1A62A 1VQHA 3M4PA 4US1R 3VKHA 1JR3D 1X55A 3UDXA 1D5CA 2HEIA 2QN6A 1E0KA 4FMCB 2BH8A 1P60A 4QM7A 1I2DA 3H1TA 3HOUH 3VKGA 4DLWA 2IYLD 3LY5A 2JEBI 2X1VA 1JECA 2OG2A 4B74A 3ZZ0A 3L0IB 5EXTA 2ZJ8A 3L7ZC 3M1IA 3FTQA 1OXSC 1XTQA 1H9JA 2FSHA 2QT0A 4X62L 3CCVA 2XNDA 3CNOA 1N33Q 4NYJR 1V9PA 5GQOA 5HCIA 1W36C 1NMGA 1YHNA 2AWOA 1HTWA 4YDSA 1H65A 3GLHA 1OXXK 3ZIAA 2EFDB 1HCZA 3E0EA 5HE8A 2ZYTX 1RYHA 1XJQA 1C1YA 1KDTA 4IO9A 2PNRC 2NZJA 4PO1A 2CLCX 1W46A 5DNYB 2IXFA 1XCPA 3I92A 4JT4A 2GJ9A 2QRZA 1H9MA 3K0AA 2Q8IB 3EC1A 5CJ2A 5AJWA 2PMZE 1S3OA 1KSJA 1OYWA 4GNXC 1MJEA 3HJNA 5KNBA 1XEWY 4B3FX 2QTFA 1GRNA 2WVJA 3OEED 1I5FA 3D0FA 3PIPA 1YZLA 1ZW6A 3BE4A 2RCNA 1GITA 1L1OC 2Q3HA 1FUKA 3QVVA 1EIYB 1XMOQ 1IXRC 4IEIA 2F9LA 2GAAA 3Q8DA 3MAAC 2CVHA 2GF9A 1FTNA 3QBVA 4HYYA 2OFWA 3BERA 4I1UA 4DLVA 3CW2C 4EUNA 1YHBA 3J7A5 3A8TA 4TKOB 3RVBA 2ZE6A 5KNCA 3BD9A 4DCUA 4JI3Q 4KI0A 2QORA 4NPHA 5M3FG 1N8RC 4YCVA 5GROA 3I4NH 3MRSA 4FW9A 3U5ZB 2J3EA 1PUJA 4N0DA 1M1KC 1UE1A 2Q9BA 1I94Q 1NN0A 4DKXA 2NZOA 3UDGA 3PUVA 3HOYH 1OYYA 3FKIH 3STBD 4Q00A 1Y1VG 3NENA 1NIJA 4PV1C 4NHOA 3GEEA 2QQ0A 2IYTA 1PHJA 4NL4H 3NHAA 2D4HA 4A3MH 4R4QA 1NVUQ 1OH6A 4F38A 2Z0SA 1LW7A 1Z3IX 2PT5A 3K0AB 3LWNA 1UFQA 4ZCIA 521PA 4C30A 4DLTA 3I4OA 5BR8Q 1TQ6A 4L4UA 3GMTA 2NQ2C 2KBFA 3EQLC 1N36Q 2PH1A 2IBMA 2P5TB 4DCSA 1CI3M 2BA0A 3WNCA 4M1TA 2WWYA 5GJWC 1DCZA 3PITA 2JJ2A 4LJZC 5EE1A 2YTVA 1DELA 5FBRB 3VX3A 1GL9B 4X8LA 4PC7A 2H92A 1CIPA 5JJIA 3BH7A 3PFIA 4GSYA 3GEHA 2P67A 4IFEA 1Y69U 1FOEB 3GTKH 4QQBX 1JAIA 4HB4A 2AKYA 2XOKD 3IGFA 4JYAQ 3CRKC 4FN5A 3EWAA 4A8JC 1SE8A 2ZETA 1RRFA 2ZI3A 4BBRH 1FTSA 1KTVA 2VP2A 4BQSA 4BFWA 1EFRA 2R62A 3C15C 4B2IA 1U2RA 2CDNA 5CLQA 3G48A 2G88A 4HIMA 4R1JA 2A30A 1NSTA 5DISB 4C7OA 2FF7A 2BKUA 4Y7NH 4YWLA 2WJVA 1HQMC 1TU3A 4K46A 5IYBH 1N5KA 1ZIOA 3OIUA 4P74A 1JMCA 1X3GA 3P1JA 4M9QA 5TVKA 4ZDKA 3UANA 1SXJE 1FPMA 3TJZA 5IK2D 1XTKA 3NH6A 2VQFQ 1CJUC 1A2KC 1W49A 2BWJA 4LF6Q 2WJHA 1HNZQ 1EFRD 1IHUA 2P6NA 4M1WA 5DIFA 4JYAL 3X1DA 1Z29A 2CL0X 2Z0MA 4TTRA 1IJFA 1OIWA 4XTCS 5C3EH 2ZVQX 4BLTA 2IYZA 1V5WA 4LPSA 4R9UC 4B3SL 4LX0A 2IX3A 1E79A 4MNOA 1XCGB 3LWUA 2JA8G 1R10A 4A0GA 5LD2B 5G53C 1X1SA 1VKJA 3K0FA 1XNRQ 3ZQJA 4D4LA 3EPLA 1U90A 4IHQA 4RD3A 2ZIAA 2A69D 4ASUD 1NVWQ 2J0VA 2WAQE 2C9YA 4LC0A 3D7MA 5C0XI 3T35A 1E0SA 1G19A 2E2HH 3QXXA 4HUQA 4RFSA 3NC0C 3FGNA 5EP1A 1F48A 1GUNA 1XXHB 2VYFA 4LUOA 1G4AE 2ZRIA 3EG5A 4OQLA 2YZ2A 3HKZG 4DSUA 4MKFA 1CR4A 2YC2C 4LHYA 2GF0A 1EWIA 5M04A 3GJ4A 1EFHA 1XTJA 1I4TD 4OO1H 1FP7A 1E6CA 2ECKA 5HR5A 4A3EH 3A58B 2WP8J 3F3YA 4E09A 1Z08A 4BY7H 5C4MA 1W4CA 3A4NA 3S2DH 5J4LA 2JA1A 3SQWA 2HHHL 4DR7Q 2CL7X 4K0KQ 2JIZD 2A5YB 1E2WA 3FKQA 4FD2A 2AWNA 1OH8A 5FUXA 2O0KA 4ZCMA 1KSGA 2WAQG 2ZAMA 1GUSA 2JK8A 2Q6TA 4A4DA 3SJBA 4B73A 4EQ6B 3OFNA 2PZGA 4P75A 3GTJH 3GJXC 4G5GA 2OQ0A 4B48A 4XWKA 5KPJA 1UDWA 4DLUA 4YLGA 3IQWA 3ASYA 3LQQA 3WYFA 5K8TA 4A9AA 2JXMB 2DY1A 4M1MA 4BLRA 4QC2A 3T51B 4OI0A 4LGMA 1KMHB 1NJIC 2OAP1 1LNZA 4B76A 2PX0A 1T9HA 4H44C 3J7ZC 2FH5B 2GCNA 2JLXA 3K70C 4PHFA 3OW7A 4WW0A 2JIZA 2O5VA 3BAFA 1G8PA 3NC1C 3W5JA 1RL2A 1E1QA 5AUQA 1Z6TA 2HHHQ 1MR3F 3BOSA 5JMTA 2F3IA 4LBWA 3NTUA 3U7GA 5EZ5A 2V6IA 1O7LA 4US2R 2R7ZH 2V3CC 4Q9HA 3QIAA 1Q12A 4IOMA 3P20A 1SVOA 1E96A 1H8HA 1OFUX 4AC9A 2A6HD 1ZNYA 4DR6L 1G21E 1W4BA 4LSGA 4B33A 2EQBA 3K9LA 3LBIA 1CS4C 4NZYA 4LYHA 3U7EB 4E5UA 2AHOA 1RIFA 3ZD6A 2R6AA 1ZJ6A 1HY3A 4KN4C 1E2KA 1II0A 2GEVA 1VECA 4TSFA 4UJ5A 5DN6A 3TLXA 3DDCA 5J4YA 3PF4A 3KB2A 2ZU0C 1KDPA 1YZQA 4PHTA 2O5IC 1JPJA 3H3VH 4TQUS 4TMKA 5EAYA 1TKWB 3IO5A 2UXCQ 4F4IA 4QGGA 1EFCA 4BZQA 4K81B 3B8HA 2QP3A 1EG7A 2ZAOA 1A6XA 4JVMA 2HCBA 3CONA 1COWD 4L8JA 4N3NA 1Q1EA 3VR2A 3PEWA 3CIOA 3W1GA 3C16C 2FZLA 2VIIA 3CBQA 2NIPA 2PI2A 2WWIA 2ZJRA 3PIRA 4BRUA 2CE2X 1FW6A 1G8YA 1HJPA 1TF7A 3GO5A 4XOIA 3L2OB 3S14H 1VIAA 1KIMA 1XTRA 5FTKA 4JI4Q 1DAGA 1MT0A 5BN3A 2OLJA 1NE3A 3AYHB 2JGNA 3T1HL 2ZSEA 4PZZA 4A82A 3EZ7A 4PPQA 1KDOA 5FUWA 1JQJC 5CLLA 3KUDA 3K70D 1SRUA 1G16A 4A2WA 1UKEA 4M1KA 4A2QA 1CKMA 1C9OA 4Q4LA 3FHWA 3AKCA 3R8CA 2CVFA 5M3MH 2FGKA 2JATA 3V9PA 4BLPA 4N0EA 2GBLC 3I8XA 1YZ6A 2ZVPX 3OEHA 4KCGA 1ZC3A 4DCVA 1ZM2A 3C4JA 5FH9A 3X1XA 2FDCA 3CAMA 3LNNA 3KYHC 4JL6A 4L15A 4TL8A 4BECA 1T0HB 4YXWD 2XGJA 2BE5D 4DR4Q 2ZM6Q 2LKDA 1UBGA 4MQBA 1JXMA 1CULC 3T56B 2FXQA 1IM2A 1OLOA 3K09A 1TX4B 3RLOA 1VG9B 3QKTA 4OI2A 2GJSA 4B3SQ 4CEIB 4Q7LA 2IXGA 3GTGH 5IK2A 2ZANA 3Q3JB 1WE2A 4JL5A 5FTJA 2JLUA 3MWKA 4G0NA 1UKVY 4EX5A 1EQRA 3I32A 1F2TA 1CJMA 1E9CA 4D0LB 1SVKA 2OCBA 2OCAA 2ONKA 1Q46A 2QSZA 1IBRA 3Q7QA 3RC3A 3BB1A 2QNRA 1KJWA 2VP9A 5EXPA 2EW1A 4KJZA 1HYQA 4Q4AB 1Q3TA 3RNLA 4A3GH 2HLDA 3AH8A 1GNRA 3A4LA 2IYWA 2B21A 3MMPA 3ZYCA 2ZJOA 2RF4A 2GCOB 4OK5A 2H7VA 4PC3A 4TTQA 5M5WH 1VCMA 2IYYA 1M7BA 2OBMA 3U3JA 4PMWA 1GJXA 1U0JA 4DV6Q 1DGSA 2CJWB 2V4ZA 4MUAA 5HY6A 1ZD8A 3STBC 1VQ8A 3TS2A 2ERYA 5K36H 3CRQA 3IEUA 3IIMA 4YDHB 4A6XA 2VP6A 5B64A 4TWZA 1KK3A 1UADA 4GKJL 3TAUA 4DV5Q 3VR3A 4OK6A 4J15A 3B1ZA 3BIFA 3OW2A 1KZGB 4LPKA 1FNMA 4TN1A 4DK1A 2OT3B 1R2QA 2NO7A 2O8EB 3OYYA 4L5RC 4BRWA 1W2BA 1UEIA 5JCPA 1GAJA 5C1BA 3CUEF 3P4YA 1RVDA 2H17A 4LF9L 4IFDI 1TNDA 4MA4A 3U44B 4L8GA 1UKZA 1XB2A 3GLFE 4KHZA 4WOPA 2C9CA 4X8OA 5G3YA 4JI6L 3SYKA 2FOLA 3NEMA 4CRWB 5F2EA 2XXAA 5SZKB 2EIFA 3T1YL 2UXDQ 4TLCA 5DHFA 1E2EA 1GZSA 3BU2A 1DBSA 4A0RA 2X19A 4PR0A 1BIFA 2QAGC 5JFGA 3KQKA 5DGXA 2LWIA 2EFHB 2Y8EA 4DNTB 5FLMG 2CLSA 1N9WA 4D81A 4M0LA 1R6BX 1OSNA 4V03A 3NWJA 1VMAA 4O2DA 2JASA 1NG1A 2GWHA 1N5IA 2DPXA 2ZJ5A 3FE2A 4BLQA 1JQLB 2R44A 4E22A 3NH9A 3OOCA 3TUJC 4YY3Q 1US8A 5FBVB 5KDOA 4GOPA 1E9AA 1KOFA 2QGQA 1PH4A 2FPMA 3E2IA 1SGWA 4XVRA 1K8OA 3K9GA 3PVSA 4DV3L 2W6JD 4DCNA 3BFXA 2ZITA 3O8DA 2ZXUA 3TVDA 1XMIA 3OF5A 1J8MF 1Q22A 1KQSA 2L5TA 1U0LA 3EA5A 4OHVA 3S1AB 1B23P 2XOKA 4PAMA 2C5LA 4PFSA 2TMKA 4UXJA 3MXNB 4G01B 2Q0HA 1SVLA 1E2IA 3TW8B 1P4SA 4B43A 3CH4B 4II7A 2HIVA 2QU8A 4B2PA 3WRYC 1G6PA 2ANBA 5KYKA 1A82A 2OCEA 4IFDH 1R0XA 2ZYUX 4L9SA 2QPOA 1R5BA 1R5OA 3W90A 4EFNA 1AZTA 4KAXA 2C9OA 5BYJA 4LWZA 1CR0A 1E1TA 4YY3L 3PEUA 4URYR 2G1JA 4I1VA 4AWXA 4MRNA 1XZPA 4QJ4A 4WJ3M 2W6JA 1HEIA 3TREA 4LV8B 4MITA 5HE9A 3NELA 4BBRG 2CCGA 2ORWA 1CF4A 3U9SA 3T53B 4UP8A 3AF2A 3RABA 1CUKA 3U4QA 3GFPA 4UNSA 3U60B 2DCUA 5B58C 3ETLA 1NSFA 2ZSFA 4F4CA 4WZ6A 1Z28A 2I5LX 4UNRA 1E4VA 2D0PA 2WKRA 1P5ZB 3CPWA 1XJCA 2ZI9A 3DXJC 3S16H 2ZRGA 4GP6A 4NYIQ 1G6OA 4PX9A 4CT5A 3CCLA 4FWTA 3DM3A 1WRBA 1U0HC 1E22A 4Q21A 4WAUA 4B75A 1H95A 1DVRA 2Z83A 3K0SA 5TMPA 1LY1A 5AUOB 2K4KA 1PLJA 4LUCA 3EIHA 4B3DA 3WDNA 3S24A 2D74A 4BY1H 3K8YA 1Q44A 3OIWA 4OKSA 1OB5A 2E1RA 1PJRA 2CXXA 3U7FB 5LMNL 2NTYC 1L0WA 2ZROA 1VDZA 4LJ4A 5FPHA 2CK3A 3N6RA 1FL9A 1OHHD 5JHHB 1VCOA 2MO0A 4X66Q 4Q4HB 1VQPA 1GL6A 5KHOC 3X2SA 1D8LA 2ZYVX 1YNNC 1QHXA 3N70A 5EE5B 2G0TA 2ZRHA 1EFUA 1OIXA 4LV5B 4IDNA 1VS0A 2R6DA 5KUTA 4HIOA 4Z1MA 5KO2A 1E2HA 4BXXG 3K0CC 4HIKA 1Y8NB 1TWAH 4A3LG 4JI1Q 4DAYB 1FMJA 2UZ3A 1WA5A 3T61A 4DV2Q 1JJ2A 1JJGA 4KKUA 4HJ9A 1HQCA 3LX5A 2JLWA 3P32A 4JI3L 3BK7A 4IPDA 2H1LA 4C0LA 3ZVRA 1BKDR 1N5LA 4AYBG 2OEPA 1HZBA 3LH5A 5AK0A 3D4RA 4W7SA 2YJTD 4RZ3A 1R8SA 1ZBDA 1GHJA 3F2BA 2JJ8A 4C0SA 1UE7A 1DAIA 1EQQA 3EPKA 4XJXA 2K5HA 4DR3L 3NXSA 5FL7A 4HZUA 4HSEA 1XMSA 2ODEA 1WI5A 4DUYQ 1LF0A 5IT9c 2VLIA 2ZRAA 4JLBA 5FLMH 4RD0A 2PI2E 1HH2P 3ZJYC 1VCNA 5JHGB 4GBMA 3GJ0A 2KENA 4BFVA 2K5VA 5IY0A 5M3FH 4DV5L 1E4YA 1UPTA 3MJRA 3KJOA 4AKEA 2JLVA 2Z5FA 2IS1A 2VQEQ 2VF8A 4AIMA 4JYCA 4O0MA 1N6OA 4W5WA 5JS8A 1LF5A 4NU0A 4JV5L 3QXJA 3K0CA 4GP7A 1FJGL 4TT3D 3RSLA 3J81k 3M4YA 1T3LA 3VAAA 3K9HA 5F98A 2DB3A 3AVTA 4DR2Q 2JEAI 3DKVA 2PEYA 2NN6G 2IXEA 3RSOA 3DKPA 4DR3Q 1IY2A 1CTQA 1NN1A 4DLRA 3ERSX 1H9KA 4OK3A 3FHTA 2IYSA 2MMCA 3TSZA 3TUIC 1A5TA 4TYPA 5JWOA 3EZ2A 5K36G 1CJTC 1S1CA 3KF6B 5HPYB 1WCV1 5GAGC 1P72A 2NO0A 2D2EA 1JT8A 2QRNA 1AN0A 1YR6A 2PX3A 3BB4A 1MKHA 3M3YH 1X9NA 2JCSA 3JVUA 5CIWA 2F1RA 1SMXA 3SHWA 1YNJC 2B63G 4ACBA 1AJEA 3WBKA 1FGUA 3ECCA 3BS4A 3UWOA 1W0JA 1K6MA 4C3IH 4KKTA 1KZ7B 5BN5A 3S1MH 4DEXA 1YVDA 5H68A 4BFZA 4MUBA 2OE2A 1UF9A 1EFWA 1I6HH 2KCCA 2QSYA 3N2EA 4TSFD 5KSOA 4IPHA 1IBML 3B78A 3FOZA 5DH9A 4Z8XA 2KB0A 2KBEA 4H1UA 3K70B 3FMCA 1IZ6A 4AQYQ 3UG6A 4A2PA 4QY7A 2QPAA 2GVAA 3I2ZA 4DUZQ 2ZE5A 3KTAB 4HLQB 4HAUA 3W6OA 1XNJA 2O0HA 4DBLC 3GQBA 1RC8A 1X86B 1VQ7A 2F4VQ 4JBXA 4F93B 1COWA 1YZTA 1LV7A 2QEQA 2UZIR 3IBYA 4ESHA 4D0NA 4P31A 1QZGA 4Q47A 2Z43A 1E2FA 4JZKA 4DR1Q 2W6IA 2BEKA 4YWMA 4OI4A 1XEFA 1TMKA 5DHAA 1KD1C 3HOZH 4M9ZA 4CEIA 5FUVA 1TF5A 4RZXA 4QJFA 2IHBA 3HR8A 4EIWA 2DHRA 2B7CA 3K81C 2QPTA 2HT1A 4G7OC 1HT1E 5L3RA 5JWHA 4KBFA 4FDBA 2REXB 2YWEA 5HCNA 2N49A 2JJ2D 2IWRA 2DFTA 4CVNA 4I4LA 1CTMA 3W6NA 3RLFA 2XAUA 3NIBA 2DUDA 2OTJA 4GZLA 3RYTC 4O3MA 2YHSA 3RANA 3KKQA 3DO6A 4DWJA 2UUCL 4KLNA 1TUIA 4NXNQ 3VHXA 1OFHA 3P4XA 3V4RA 4B6EA 4MGYR 1E99A 3L43A 1KO8A 1RIPA 4DT1A 4TYWA 1PV4A 1TL7C 1X54A 1YQTA 2QG6A 4NYMQ 3WWVA 1Y8OB 4P33A 1HNWQ 3S1NH 3BDOA 1HZAA 1IYVA 2BCJQ 1QVRA 4MKIA 4NCJA 1SHZA 2C78A 5ELXA 4LFAL 4LOAA 4C2MH 3LQRA 2IHEA 3BWDD 3CWZA 3RHFA 3NE5B 5EP2A 1LVGA 4BZXA 1LABA 4AG6A 2JE6I 4RCZA 1HURA 2G1KA 1T0JB 2PT7A 2OILA 5IF9A 3IUYA 2BBWA 3SFZA 1S9HA 1KMQA 1L2FA 3BZKA 1Q3HA 1N6PA 2FSFA 3A8JE 2D0OA 3UE1A 4R4IA 2EJMA 4JI8L 4PZYA 2VH5R 1YHQA 2V8OA 4KYIB 5H1SE 3RR5A 3VNVA 2L15A 2WHXA 1AA9A 3A4MA 1SQ5A 4PG3A 2VP0A 4A3LH 5ANRB 5EUMA 1XMOL 2WWFA 3QVUA 4DNRB 3H86A 1XJVA 1IYJB 2QAGB 1P9NA 4NYIR 3UMSA 1S0UA 2ZRJA 1L1OB 2OFOA 3QF4A 4OX9L 3PXGA 2N1BA 4BFYA 2XSZD 1QDEA 3KFXA 4DIDA 4C9BA 2B29A 1XZQA 2VHTA 2KHJA 2QA4A 4C4PA 1G6HA 3NEYA 4JV5Q 4LUZA 4FI3C 4IJLA 3EIQA 3CPFA 1M7GA 1FJGQ 1N6LA 2CMKA 3F5FA 4EPTA 4ZIRA 5LMNQ 1BYIA 1G8FA 2FV8A 4GDFA 2DWPA 3ICQB 2FWRA 1HTPA 1DADA 3PEYA 3FMFA 4LUVA 3NKVA 3I5YA 1EFTA 5CK4A 5JEAJ 2O8FB 4A0FA 4D4MA 4LJ5A 2FEOA 3FYHA 3A5ZB 3AP1A 1PVOA 4QBFA 2J9RA 3FWYA 4DVGA 2B7BA 5HZKA 4FCVA 1R0ZA 1E0JA 4KVGA 4QNMA 1KKMA 4DLZA 4JSYA 2P5SA 2XSZA 3U6KA 4OGQC 1TWHH 2BMDA 1CBUA 2FU5C 1GUTA 3PJRA 2O8EA 2O5JC 3G71A 4JI2L 4R2HA 3TW4A 3HOXH 1QVCA 1PFSA 3CZQA 2VS1A 4QHSA 2D2CC 1O3YA 2F43A 1FQKA 5LMUL 5CM9C 3QE0A 4DXAA 2R9VA 4Q1EA 1QHNA 2OBLA 1HPCA 3IIKA 1VQ6A 4LF8Q 1W3SA 4R4CA 3PO2H 1VYUA 3O47A 1NLYA 3A1SA 3KKPA 2YOFA 4QGHA 4R4OA 1N6NA 1P2TA 2G0NA 4BFUA 3M4OH 4AKGA 3RC8A 4BBSH 1ZIPA 3WNBA 4AQYL 1XXHA 3DM9B 1RKBA 1O7IA 4PC2A 1KRSA 2NPFA 4CZ2A 1QRAA 1ODFA 5JLJA 2C2HA 1K83H 1PYBA 1AGPA 1G5TA 1Q21A 3QG5A 3VTKA 2F4VL 4DUGA 1H8HD 2VF7A 4JVSB 5H70A 3BFVA 2ZPTX 3CXCA 3QSYA 1G7TA 2OLKA 3T1OA 1CKNA 5FBLB 3S15H 1DOAA 3H15A 2EJGC 1K8RA 1ZM4A 5TARA 3TUZC 2F1JA 5LMUQ 1G3MA 3CKLA 3TVTA 1E0AA 4A76A 5FLXc 2E2IH 4HEJA 2ZJ2A 4HLUA 3SFVA 2GJAA 2ZRBA 4BPBA 4WIAA 3AFQA 1HNXQ 3EAQA 2BJVA 2ZSBA 3KQNA 1OHHA 1L2TA 4S35A 4ZIRB 3CP0A 4CF7A 2PZEA 2Q9CA 1JAHA 4UXIA 2VSXA 4OQMA 4LF4Q 1KJZA 1H9SA 2W6ID 1U81A 1G7SA 3BH0A 1R5NA 3CX8A 3QF7A 4DV6L 1E2ZA 5C0XH 1QVFA 4H02A 1AS2A 2CHGA 2F3RA 2CW0C 3EBEA 3CW2A 3I8SA 5BQ5A 3SI7A 1YRAA 1N0WA 3LD9A 2BA1A 1FQJA 4Q9IA 1J8YF 3T5GA 1S72A 1Q57A 3VR5A 1KI6A 5G3ZA 4UNNA 3W3ZB 1G64A 1RRCA 4IOJA 1R0WA 2N42A 1XMQL 4KLZA 2YOHA 4TLBA 1GM5A 2G83A 2IYQA 1XTDA 4L9WA 1AKEA 2ORVA 4JI5Q 3WNDA 2XEXA 1E9RA 4ACAA 1U9IA 4U02A 5G41A 1YKSA 1MH1A 5FOTA 2LSSA 1G5RA 3Q72A 2Q2UA 2CKZB 1GUGA 1XEWX 4Q9KA 3U2QA 1GKIA 4JLOA 4XWOA 1IN7A 2XTNA 2KHIA 2EVBA 4BASA 5CDFA 4D0GA 4KLKA 2Q2IA 4CYMA 1PH7A 1TQDA 3CPEA 3KQLA 3A1WA 4AK9A 3EXAA 4OJKA 1GTVA 2J0QA 3TS0A 3EW9A 4JKIA 2MMGA 1A0IA 2YINC 3EASA 4F92B 1A7JA 4CW7A 3ZIAD 1W5SA 4A3BH 2KSQA 4LBVA 2C95A 4MKHA 1E9SA 2A68D 5E4FA 5EXSA 1JR3E 4PSAA 4JLMA 4OWWB 1KMHA 3LRPA 4D4KA 1B0UA 2QI9C 2ZRFA 1IONA 1KY3A 4QFMA 5FTLA 3AKEA 4F91B 2BV3A 5F3WB 2QENA 3L2PA 3PG5A 4JBJA 2Q2TA 4DR7L 3LFUA 721PA 4GOPC 1S4QA 4HDOB 4AYWA 5KSYA 5FTNA 2CE7A 4A1FA 2I4IA 2FFBA 2V1XA 5JI3E 1VYTA 3HYTA 4RVCA 1E69A 3GFTA 1G5PA 3QG1A 1SHKA 2MQHA 2JJ1A 1OKKA 421PA 1KY2A 1E1OA 4A92A 3ZGXA 2VEDA 3MGCA 4LCBA 1UWVA 4P71A 1MRNA 4CEJA 4ZO4A 3EZ6A 1QG2A 3AVXA 2X8AA 2MSEB 4MZ9A 4TYNA 4KSBA 4HLUC 2ZTCA 2IYUA 2QMOA 3WHLA 4NP6A 4C0BA 4C3ZA 2WOOA 1B7YB 3TRFA 1Q7YC 3K7UC 3E70C 2DWOA 2A3RA 3KXIA 4GOXA 1IW7D 1ZU4A 3UG7A 4JLJA 1Z22A 4LYJA 4LFAQ 1QZHA 4IQZA 3A0JA 4FINA 2H8KA 4LJAA 4Q02A 2J46A 2C03A 1UEJA 2R6FA 4V02A 1Z0FA 1M6NA 1N2CE 5K8IA 3U58A 1GUOA 2MO1A 3CRLC 2UKDA 4ARZB 4C0AC 4GN3B 4DZZA 3NEJA 1GRRA 4BLSA 3HWSA 4DLXA 3CX6A 4TMZA 3VMFA 1PH2A 4JI2Q 1A2BA 2DN8A 1GG2A 4QIWE 3PO3H 2EWWA 3E1SA 3W6PA 1TQ2A 2HDNB 5FBWB 2IUUA 1W2GA 1UJ2A 4JIMA 5GJVC 1QHHB 2NVYH 4DC9A 1OXVA 3GLIB 1PA6A 5IYBG 2A8VA 1KI4A 3I4LA 1NRJB 1SVMA 4Q01A 1KI7A 4V0MA 3GFOA 6Q21A 1CRQA 3KLRA 3HPRA 4NE2A 1WCMH 1BMFD 1OE0A 4FWIB 5JWRA 2IA5A 4G3XA 5LDDC 5IP7H 2YKGA 1F2TB 2DNEA 4RZUA 1J7KA 4EPVA 4B35A 1KK2A 2RGEA 5J4KA 4Q66C 2Q3MA 3QUSA 4FMCF 5M5XH 4GN5A 5B2ZA 3JAMi 1QHYA 1V1QA 4UNQA 4C3HH 3HP1A 3FP9A 4E07A 1AQUA 1R0YA 4DSNA 2PCFB 2CCKA 2RGAA 3FHOA 4YMUA 4JC0A 1SMYC 2PLRA 4TZ6A 2ODWA 4JLAA 1E2QA 2NMVA 3IDQA 4B3RQ 1ZYUA 3CC2A 3HOVH 1ZUNB 2FG5A 4OHWA 4P4SB 2UUBQ 3FHCB 1HZCA 3ICEA 1E2LA 2IC5A 3ZH9B 4BXXH 4P32A 2FFAA 3UDFA 3KFUA 1DD2A 4ZI3A 3UKDA 5J4HA 2BOVA 2QAJA 2YTYA 4A3DH 2A2ZA 4LK2A 4A8JB 4UQOA 4AURA 1ZCBA 2VA8A 2ZJPA 2GVDC 3KFVA 1NMXA 4NYMR 2ZJYA 3A36A 2ZUCA 4QL5A 1I2MA 4DV0Q 3M0EA 4ZPXA 1E9DA 1HE8B 1DAFA 1C7YA 1IL2A 4M9XA 4ASUA 4I7ZC 2O8FA 2KCTA 1E98A 1NVVR 3B1WA 4KO8A 1DG3A 4D2IA 5JEDA 1JR6A 1PH1A 3KDFA 4POFA 2OXCA 5IYCG 2WICA 1G3RA 4BY7G 4URZR 4X64L 1WJJA 3I4NG 4EPYA 4BGDA 4WZAE 5B57C 4LK1C 4DV7Q 1RE0A 5LB4A 3ZLJA 1DG1G 2P2LA 5HGQA 2V7QA 2GJ8A 4A3CG 1Q8KA 1GUAA 1XEXA 2GAOA 2QROA 4JS0A 4M4SA 1E9EA 4NCIA 2ZE7A 3FKSD 2VNUD 3CNLA 1X1RA 1KO4A 4XWAA 1SXJA 1PH8A 4B32A 2XTIA 4ALPA 1BKBA 3CF5A 1DAHA 1RYFA 1EESA 2AK2A 1S1MA 1DTSA 1XNRL 4MRRA 2A5FA 3TGPA 2PQAB 3P27A 3IO3A 5FOSA 1CKEA 3LO5A 1J5EQ 1VQ5A 3GJ7A 1Z47A 4MTNA 1ASZA 4RY2A 3H0GH 2FMXA 2XX3A 1P9WA 2WIAA 4QJ5A 3RRNA 5KDLA 5IP9G 4FIDA 4RJLA 2HIXA 3IIJA 3THXA 1Y3AA 1E1RA 3BFKA 1CJVC 1I50H 3R9WA 2QF7A 4RD1A 3TR5A 4A3BG 4RMFA 3R20A 3AF4A 2UVQA 1G3IA 1MO5A 1KO7A 3FFAA 3ZVMA 5JSZA 3DM5A 1S40A 3AGPA 5CIQA 1ZRHA 3NVAA 4G5SA 1IN4A 4N1AA 5A5GA 1XU4A 1EX7A 2C96A 4B34A 3U4QB 1WXQA 1C4OA 1QHIA 3RS0A 3HOUG 2WAYA 1TU2B 3CMEA 1E1QD 3KJGA 4TL7A 1T5LA 1KSHA 4KHPQ 3N5CA 4RKFA 3NDBB 2BHRA 1N6KA 4Q5IA 4S2EA 1IAQA 4LDJA 2ZTDA 2J0SA 4EQ5A 1ZCAA 2YV5A 4NCKA 4DSTA 2ZS8A 4UXHA 1VQDA 3UWKA 5M5YH 1CRPA 1UM8A 4D25A 1IY1A 1VQAA 1XD2B 2YYZA 4L5QA 1JXOA 2ZJAA 3B1XA 5AUNB 3AQQA 4DIEA 4M8NE 1Y1WH 4P0TA 4DUGD 5KU1A 5F9HA 4NXNL 4DK3C 1MJCA 2VZAA 3LBNA 2A19A 5C4GB 2A69C 2NPIA 5IP7G 2V9PA 2AL7A 3D6TB 1FMLA 1EUJA 4KHPL 1TEVA 1Y8PB 2H5XA 4LJ9A 1E2GA 4R2IA 2JA6G 3RS3A 3GDEA 2J7KA 4WVFA 1JE5A 3KJPA 2CWAA 4IDHA 2D06A 1ONLA 1WDTA 4OQNA 2KCMA 2JLRA 4XTRA 1SKQA 2R7DA 2EU8A 4QGUA 5JI2E 4DR6Q 3OHMA 5GAHC 5CJPA 5DI9A 5UKDA 4LFCL 2WBLC 2ZR7A 4G5RA 3TH5A 1XDBA 1L4YA 1XD2A 3UMRA 2OCPA 3K80C 4RD4A 1US8B 4MYCA 1GKUB 3DOEA 3F8TA 1Q1BA 1FVIA 1SFOH 5GVSA 4P72A 5AUPB 1N6IA 5K8UA 3GLGB 1BMFA 4GKKQ 1GILA 2HJGA 1ELOA 4W5HA 4DKAC 1YR9A 4DDTA 2N78A 1Z8FA 5C44G 4D4JA 3KL4A 3FKIG 3ZJYA 3RN5A 2A7QA 2ZE8A 1W4RA 1IYUA 4EKDA 1T5EA 3SBEA 1UBEA 4DLYA 2RGNC 4C0JA 4AY2A 1M34E 1Z9FA 1D2MA 3PUXA 3OEHD 4B6FA 5IWAL 3GD7A 1CSPA 2REOA 3VR1A 3IPYA 1EWQA 3OPOA 4RD2A 5KTYA 1N6HA 1YJWA 4LFBQ 1E9FA 2WTUA 1OJLA 3VFDA 4OONA 2FPLA 3CF0A 4X62Q 2P6RA 1Z0KA 4MRVA 1VQGA 1VQ4A 1XJ0A 5FFMA 3GLGE 1GO3E 3KF6A 4A3KH 2CNWD 4QKQA 1GL7A 1X65A 4JI1L 1BVSA 4PZ6A 4HAXA 1QJOA 1W48A 2BMFA 2VL6A 2B8TA 3C5HA 2ODNA 5TXGA 3SS8A 2FX3A 4DCTA 2XJ4A 2E9SA 4A3JG 4LNQA 1ZD9A 3AUXA 1CKOA 3K0EA 4IJMA 2K14A 2I1VB 3B9QA 4MYUA 2QGZA 4BFXA 4BLOA 4CDGA 5HTKA 3I55A 4DLSA 2JQOA 4U7DA 1NNEA 2HYDA 4PPNA 2HLDD 5IWAQ 2PJRA 3RAPR 1DO2A 1P62B 3CR7A 2IX0A 2R93H 1ZM9A 4Q4JB 3HGBA 4LFBL 1N32Q 2FA9A 4Y0VA 5DI3A 3W8RA 4EJSC 3GP8A 1N34Q 1MO3A 4UPAA 1M1YE 2VRWA 2W2TA 3FMPB 3HOWH 1X8KA 4PZLA 3W8NA 2KA7A 4Y52H 3SR0A 4JLDA 4LY6A 1K8AC 3SJZA 4NTZA 3B13B 1R9TH 4B3TQ 2VUMH 2DFKB 4JOIA 4GLVB 5A0FA 1L4UA 4YWKA 3SOPA 4EJSB 4AG5A 4X65L 1Z0IA 3CCJA 2JJ1D 3E5HA 3SNHA 1RJ9B 3R7WB 4LZZA 5FTMA 2JA9A 3UE0A 1W0KA 4GS3A 3KTAA 5BN4A 3Q5EA 4OQFA 2NO6A 1E2NA 1TEXA 2QMEA 2WJIA 1YEZA 4B3RL 5K8LA 1JPNA 2HYIC 1Y14B 4IKEA 5CDFE 1Y1VH 3BJIC 2ANCA 2ATXA 3JZMA 3QKRA 3EZ9A 2XB2A 2ZT9C 4XH9B 2D7DA 1U8ZA 2JEOA 1IBKQ 1Z0JA 3SBDA 4Q9JA 3D3QA 4LWCA 1NMYA 4EFLA 4JI0L 3WYGA 1X6VA 3ULLA 3LLMA 3LAWA 4B3TL 2F1MA 4LHVA 1M2OB 3I4MG 4Q4JA 2JA5H 4EJSA 1LYLA 4DV0L 4Q7JB 2PMKA 2GETA 4LJ8A 4X65Q 4DV4L 2YU9H 1PUIA 3KXKA 3TK1A 3ZDQA 2CWPA 4IJHA 4IPCA 2J41A 1TXYA 4QBHA 5E7MA 3GLIE 1YNXA 4G5OA 1E94E 3K9NA 2WJJA 3IBGA 4NPSA 1XTSA 4EPWA 3CRVA 4LJ6A 4LF9Q 4D80A 1ZVQA 3MG9A 4D26A 4B71A 3IQXA 4X8MA 2QM7A 5EP4A 2VTKA 4I1OA 3LGJA 3AP2A 2RGGA 3ASZA 4M1OA 4OBEA 4CEJB 5M3MG 1IBKL 4TL6A 4B3MQ 1N3BA 3CC4A 2BMEA 1YI2A 2YWFA 2AUJD 2JA6H 3AFPA 1SVWA 1G9XA 5LB2A 1G3UA 2VP4A 1NVXQ 2XITA 4XD7A 4EQ6A 1KAOA 4OHXA 5FI1B 3AGQA 2W58A 4QBGB 2VY3A 3B6EA 4I99A 2R93G 2B8FA 3EIVA 4DV4Q 1D2EA 4UKDA 2OUKA 5FR1A 4FCTA 3KB1A 4DDWA 4JI5L 4IOLA 1EGAA 4KODA 4ME3A 3A37A 4GZYC 1AE3A 4LF7Q 3C7KA 2IWHA 4H9GA 5BW8A 3CRRA 3LDAA 3X1WA 2NN6I 1YVCA 5L3SB 5E7NA 1SXJB 3RLNA 2ORIA 4MGKR 4PC1A 3L8ZA 1B8AA 3PCOB 3R9IA 5EZ6B 1VQEA 2UU9Q 1GHKA 1JB1A 2ZSDA 1U94A 3V00A 2BBOA 3LBHA 3REFA 3UK6A 1D8TA 5JEAH 3LW7A 4JOIC 5FOUA 2K5NA 4WA7A 3I73A 3KLWA 1SVSA 2F52A 1FYCA 4GKJQ 2WSSD 3FB4A 1PH5A 2VW9A 3TNFA 4ERNA 3GLHB 5KPDA 3W34A 1G20E 2OV2A 3WP0A 4KFRA 4JMPA 3J81c 3SE0A 1CJKC 4OWTB 3RRYA 2BCGY 2K32A 1UDXA 5HZHA 2FJUA 4HDCA 4OI1A 3TQFA 1NY5A 3VA7A 3WYAA 2I0QA 2QMUA 4US0R 4IFDG 3EN2A 2QP4A 1J99A 3L0OA 2CCZA 2GEDA 2J1LA 1GRQA 2AUKA 4PHHA 4Q7KA 4R7ZA 3AQ4A 1HE1C 2IYRA 3QJYA 3QY0A 1K0RA 4GRAA 3VQTA 3WHKA 5IT5A 1FP6A 2VPPA 4PQFA 2PCLA 1H9RA 5BXQC 3QKSA 4IDOA 2RKOA 4NONA 2BJWA 5KOYA 4H0LC 1YITA 2A6ED 4JVNA 4EDHA 3SYLA 4Z54A 4A3EG 1A63A 1TWFH 2G77B 2J5XA 4KN7C 3T1TA 1TTTA 2F1HA 2GK6A 4XIGS 3A5UA 3D8BA 4IPGA 3OESA 2HF8A 4LBYA 4TMXA 1AQYA 4EFMA 1IBLQ 2V6JA 2NZ8A 2IF2A 4HZIA 2CLDX 2H57A 2YWGA 4BA2I 1YU9A 5CYPA 1KI8A 1J6QA 1KI3A 1KNXA 4HAZA 2YVUA 4KBGA 5D3MB 1KK1A 1ZAKA 1XD9A 3B82A 4RCYA 2NOAA 1N34L 2BC9A 2OAQ1 3SYNA 4C0HA 4XVUA 4LFCQ 5JCZA 1N5JA 1E2PA 4JKYA 4LI0A 1ZUHA 2OCYC 2RH5A 3HKZE 1LS6A 2EWVA 3KDSE 3QXCA 5IRCD 2CBZA 2JLZA 5E7JA 4PTLA 1NMZA 4WXPA 1E2VA 1AM4D 2J59A 4XSHA 4C7OB 3CNNA 5CM8B 1H8EA 4OYHA 1HR0L 1N36L 1T4GA 1VQJA 1KHIA 3F1ZA 1E2MA 3CF2A 3KDFB 3GJ3A 1G8HA 3SN6A 2ERXA 4NMMA 2EVWX 4TLEA 3AEZA 1E2JA 4RKEA 4ZKDA 4Q7MB 1SKYE 1VG1A 1CFMA 2GRJA 1K5GA 4ABYA 1NN3A 4V0LA 4UNPA 2I3BA 5HKKA 1SZPA 2D62A 3DOFA 2GJKA 2UUAQ 1J70A 1Z5ZA 2W0SA 3A7AB 2W0MA 1D6JA 2ZQ5A 5JECA 5DO9A 1YBYA 1MABA 5SZIA 4DR4L 2BH2A 2XNDD 2PNHA 3MD0A 4JI0Q 1HUQA 1YE8A 2A78A 4LHWA 3MWJA 1VF7A 2OESA 4MYTA 4ON9A 4Q4AA 2LMCB 1JB7A 5JJKA 1G7CA 4HJ5A 4MYHA 3WRXC 3ADCA 5F9FA 1YZGA 1W47A 2VQEL 4NH0A 1A1VA 1U5KA 2ZS9A 1F60A 1RW4A 4DRZA 4A15A 1NL3A 2GEUA 3U3MA 4QM6A 3NBXX 4OHZA 3J80c 2F1IA 1U99A 4WBSA 4A3DG 3QOFA 4IRUB 3K1JA 3GLGA 2WOJA 1RZ3A 5SZHB 1S96A 1M7HA 4B3XA 4KFTA 2ES2A 1FUUA 2QTHA 4XVQA 1K3RA 5GJBA 2Z6VA 3PV0A 2V1UA 4Y0AA 1Q82C 3M85A 2WB1E 3LXRA 4L16A 1OXUA 3I7FA 3TIFA 5DN6D 4R4TA 2IEYA 3C8UA 3Q5DA 5FPKA 4Z51A 4YHHQ 4URXR 3I62A 1Q86C 2JLQA 1DS6A 3BJUA 2NVTH 3LVRE 4U5XA 3WP1B 2OM2A 1BBUA 3J81j 2XTMA 3TBKA 4IDQA 1YZUA 3KJIA 1YZNA 1G51A 3WY9A 5DYIA 2X2FA 2NVQH 3E9IA 2PPBC 2NVXH 3B5JA 4MH0R 3EZFA 3HOWG 4RG1A 2W2XA 4P3YA 1AK2A
chains in the Genus database with same CATH superfamily
5C0XJ 2FR8C 4WZZA 2C3UA 3ZCPA 4RIHA 3D8UA 4JDPA 5IAEA 4MPJA 1Q2UA 2ZR0A 5BYAA 2AXPA 1VPLA 4JPBW 4QGFA 1KYXA 1OREA 4UM7A 4IZ6A 4WNIA 4PR0A 2VYCA 4G37A 5FNVF 1QPZA 4IDDA 3K4PA 2OKCA 3SZGA 2F1OA 1U9JA 1SNQA 3ELYA 2I2DA 3V6LA 3PTZA 1WW8A 4ISBA 3VHLB 2K7VA 1EVKA 3D2LA 4Z0PA 1AHHA 2A1TR 3PXUA 1RJEA 2XGTA 1LWOA 3VH3A 2J87A 1P44A 3OJWA 2CV2A 4U8GA 2V0NA 3QQ5A 2CCJA 1BW9A 3H8VA 1N1EA 3AETA 3JWHA 3LY7A 5LDHA 2JFOA 3HCWA 5IGBA 4Q39A 3G2PA 4UCXA 4ZDIA 4FHFA 1D6MA 1K4YA 3PNVA 2F67A 3GWGA 2QX9A 1I4LD 4R1OA 1J4AA 2R6ZA 4X6UA 2WE7A 2V59A 3TL3A 4A0HA 2HA5A 4OMDA 5J5CA 4BFTA 4W4TA 3JAMA 2ZQYA 2GTPA 4GMKA 4NJMA 2RGBA 2EFGA 5AI8A 4UTVA 1PKEA 3D3WA 4WCDA 4JMLA 1G291 1Z56C 2PBLA 2YXEA 3L8EA 3LFTA 4PYKA 4B47A 4ENWA 2AHOB 2DULA 1R6DA 3ROEA 1OLUA 3JZAA 3GJSA 3EFBA 2WILA 3VZRA 1Z4QA 1OLXB 3A2MA 3HFSA 3N2KB 1FVFA 2O2GA 4HDKB 3BULA 4AO8A 4B3GA 1QKKA 1NUQA 1T8SA 4A3MB 5IT9A 2R7ZG 2IODA 4D3YA 3ZJUA 5EUQB 3V3TA 2V4DA 2C9DA 4DB4A 1U4PA 1ICEA 2D0IA 2P6UA 2RGYA 3NC4A 4GNRA 1Q0UA 3EPHA 2VA9A 3QW2A 4MR8A 3G0BA 1WYDA 1ODLA 2X8JA 1KY5A 1WB9A 4IJKA 3CW9A 4RDHA 3U3OA 1YVUA 3AM4A 3OHPA 4FMDF 1NWCA 3WLMA 1N6RA 2IHUA 1FL0A 1K2VN 2F3QA 4V3BA 3SBXA 2UU9L 2GF2A 1IHPA 1QHHA 4V0SA 2XUFA 1D0SA 1I7PA 4G1VA 3STUA 5KINB 1PFGA 2JLYA 4CEHB 3DHWC 3GGDA 5LKAA 5J5AA 2ASVA 1UPFA 4W7HA 4R2XA 2W83A 2TMGA 1PWYE 5FJ8H 1C81A 1XL1A 4ZWNA 3K32A 2GVBA 1L4BA 1GTMA 1W2WB 3OZDA 4PG8A 2XXAB 3Q9SA 1R37A 2FRDC 3NNNA 1SRRA 4N9PA 3EXHB 3SIWA 1WMSA 4Y18A 1VE3A 2FWJA 2JCBA 3BX1A 1Y9JA 2UUBB 2DR3A 4MZXA 4ZDJA 2E76C 3I2YX 1ES9A 4NDNE 4JYBA 4X0EA 4DV1L 3IP7A 2VHUA 3MTAA 1TJ5A 1I3QH 1XRRA 2J0UA 4TQ9A 1XF9A 4RZ2A 3WSTA 1DOMA 5A5DA 2B9VA 3QFFA 2EY6A 3OP4A 3ZCVA 5D65A 5JNTA 4AXXA 4EG1A 3J80A 1UBLS 2QVGA 3TZUA 1FUIA 2FOXA 3NUCA 4LRXA 1NW5A 3JVIA 1EOVA 3K92A 2ABWA 3NRBA 2ZIWB 4XQ0A 1E6MA 3DVLA 2IYVA 4K8OA 4OX9Q 2QZ9A 1V43A 2GYVA 1WHSB 1X94A 3GEIA 4PPFA 3W2TA 1E2DA 2PZLA 2Y92A 2EX0A 2K05A 1MVOA 3PICA 3ZW9A 1FS4A 4OL7A 1TW2A 2FOIA 1USIA 2GJ4A 2IY5B 3PQ8A 1JALA 4QUDA 1KVTA 4HR7A 1YMUA 5HX7A 1A9PA 4BBRB 1IBLL 2FJ0A 3CZRA 5K6TA 5FUYA 5B1DA 2G80A 1KU6A 5J2TB 3ZZTA 1A8UA 1HGXA 1OV4A 2GLXA 4A3IH 5BV2P 3ZVMA 1FBNA 2I0FA 5CH5A 1GWNA 4DA0A 3ZXIA 4OMFG 4DUYL 5JD4A 5CCEA 4RSGA 4YC7A 2GWRA 1U4SA 1YK1A 4FLEA 5DCWA 2QRJA 3WGNA 2D7CA 1VQKA 5AKLA 1PJ3A 5FAKA 4U7HA 3VNUA 1I4GA 4PQYA 5JANA 3R7SA 3RV4A 1JDBC 3V48A 4D99A 2FNAA 1V8DA 2JZNA 2TMYA 3FPPA 4L95C 3WRWA 1GN9A 1C4QA 1E1DA 3AERA 3FUXA 5BWOA 2R6CA 4TXMA 2N0SA 5DNWA 1HLPA 3GF4A 2JB9A 1TD9A 1ENYA 2O1WA 4YRQA 1NXQA 3QR8A 3MC0B 1G0OA 2F3TA 3BWCA 5A3VA 5A5VA 5EE9A 4KQ1A 3UPDA 2I4TA 1ADFA 5FDFA 4A36A 1DQSA 2QMHA 3NRCA 5IYDG 1SEPA 4DR6B 1L4LA 3S2DB 1OT3A 1VJ0A 3JVVA 3O90A 4GMDA 4O63O 4GN4B 1A88A 2VJBA 1NBME 2WWHA 3HCCA 1SU8A 3WBBA 2PUEA 3VV3A 2YYYA 5A05A 1P8LA 1JU4A 3IVCA 2IUSA 1Z68A 5J4VA 3OT1B 2Y0PA 4RQBA 5J2UB 4LTNA 3O4GA 5KX5A 2ECFA 2HRRA 1YL6A 5C4JH 3NP7A 4MZDA 3T06B 3X1ZA 5JY6A 1L1RA 2ISCA 4G0QA 4HZGA 4ZDWA 3T1HQ 1EB9A 1WCYA 4FNAA 3L8DA 2WYVA 5BYBA 2QL6A 4YMWA 5P21A 5K0JA 6ADHA 1BF4A 1T25A 1Y8RB 2WUEA 3DMNA 3B9RA 4MWDA 1WXHA 4Q6BA 4LTMA 2BKEA 1R4QB 5D8DA 4PYOA 5CVEA 5KAMA 2DXIA 3DAOA 3BRQA 1L1OA 2PZJA 1X3FA 2V54A 2Y2UA 4F72A 2Z8ZA 3MUOA 3D1LA 4IDPA 4UUMA 2QJOA 1RTOA 4JCVE 3JAME 3BC1A 3CGGA 2GZDA 2RHJA 3D6VA 2BEVB 2Q3DA 1EYGA 4DV7L 4MWTA 4CMEC 2E5LQ 4EHAA 4YAGA 1WFQA 3BICA 4JQYA 2JDID 2GFIA 3UATA 3V7UA 5J1ZA 3W5OA 3EIEA 2EY2A 3FHJA 4LFBB 4EP1A 1L3CA 5JROA 3SDZA 2C97A 2WABA 3QBEA 4NFSA 1E3TA 5KWVA 1UZMA 4PONA 5IJZA 3SR4A 5DP1A 3MGAA 3DHVA 5TQJA 1L8QA 4A3IG 1K8ZB 2OR3A 4J0EA 1INLA 1M2VB 4DU9A 4KFUA 5LMNW 3D8HA 3PKJA 3L9WA 3QPUA 1RJFA 4MJ7A 1J5EL 1FSSA 1JVNA 1T8UA 1AOXA 2QM0A 3C46A 4QZVA 3IS3A 3UMMA 5EBDA 2ECOA 2SCUA 4EVQA 4D98A 1BBWA 3GLHE 3H7IA 1SFOB 5HKKD 2PCJA 2AJLI 4C2TA 3A56A 1EFLA 1YQEA 1Y1RA 1YTUA 4GZ6A 2BW0A 1Q0LA 3O21A 2XCSB 4TLLB 2XRSD 4FYXA 5HEKA 1K63A 1TT2A 1WCWA 2JAHA 2BUBA 1WDKA 1WTAA 1TTQB 1FSGA 1G5HA 2ZIFA 1C0PA 4PSUA 4REQA 2GM5A 5ADVA 2IS6A 3MA2B 2IKSA 2A92A 3I2GA 2XVXA 3HUFA 3SZOA 4CM5A 4DNOA 1I7QB 1PNTA 1BTOA 2VAMA 1QG4A 3UK7A 3S2YA 4KI7A 3VZPA 1WDLA 1DCFA 1TCCA 4Q9DA 4TL9A 1BVYF 1YIJA 1P6UA 1LPSA 2C4KA 3KOUA 3H13A 1N5DA 1PT9A 1WW2A 2YASA 4C3OB 4BXOA 1JBKA 3H9GA 1J5XA 2HQOA 2X69A 3A0RB 1FFHA 3H1EA 4UJ3A 4OL0A 1YACA 4YIKA 3FGOA 2CSXA 2IHFA 4ZV4A 3H87A 1LPAB 1PS8A 2NVUA 1IDOA 1QR2A 1EL0A 2VPQA 3H3VI 1GADO 1NBMA 2QK4A 2ZI7A 5G4KB 1Z37A 3QEJA 1U7UA 3G2NA 3AKYA 3D81A 3W5IA 1ZMOA 2FQYA 3WMFA 4JLKA 3RUIA 2C7RA 4ZHSA 1WMBA 1F2UA 3RDPA 1CUJA 1TC1A 5IAJA 2JAUA 1TU4A 1F9AA 1ZJZA 2HPZA 3UICA 4YV2A 1B70B 4ZAIA 9MHTA 1T91A 4A75A 1FPQA 2V0CA 4R8IA 1TAGA 4TRMA 5HF8A 3VBCA 1Z2AA 3DTVA 2AR7A 4RM3A 4DADA 4HUQB 1JEEA 1VQIA 3THWA 4K0KL 3CRNA 4RFVA 1RQPA 2JFGA 1KQOA 3CR3C 3THYA 4DQUA 4JEMA 3AF3A 4TYYA 3O83A 2O52A 4HVTA 3DDZX 4OJQA 1VMPA 2QT1A 4C6SA 4PNYA 3JQPA 1X2EA 5AI0A 4ZOLB 2QYSA 3CF6R 2PNFA 3A4VA 3K0FB 4R8NA 1NHGA 1AXEA 3HWRA 5HF6A 3LO8A 1T36B 3TQSA 5IP9H 2IUEA 2Q46A 1AIPA 4B46A 3TSOA 4BVBA 3ZVNA 3B38A 2CVOA 5EGTA 3GMDA 3W1BA 1GT91 1QIJA 3GRZA 4GWGA 4CIYA 1RRPA 3H83A 5IKMA 3PRKE 4DEYA 1Q1GA 4L72A 3SC4A 1JYFA 1IH8A 5JZBA 3CRMA 4NFYA 4EM6A 1Y1VB 4MW7A 1AFPA 3EFXD 2YTXA 2GD6A 1ISHA 2P4HX 5LMUB 5B4UA 3OJLA 4X5OA 1HDRA 3IEKA 3F6YA 3CO5A 4A3CH 2HMSA 4O0AA 4RHRA 3AF1A 4Q3CA 4B2YA 2VTBA 1SUEA 4XQQA 1PR3A 3MGBA 3QLUC 1UFRA 4LVNA 3HZHA 2F43B 2CLKB 3JZIA 1CZKA 2I1LA 3CN7A 5FPSA 4DEVA 2C99A 1A9SA 2QGNA 2J7PD 1AE1A 1ZNZA 1ZQ1A 4QSHA 3TLEA 4URVR 4YIHA 3BZCA 1VCIA 1RYEA 5D00A 2SHKA 4MCAA 5FA6A 4QG7A 1WCIA 1GKKA 2C20A 1KYIA 3NBFA 1EWYA 5LYJB 5TC4A 2GDZA 1FLAA 2RSOA 2H5EA 4BWYA 4IOKA 1K3TA 2DWQA 2ZTUA 3UV7A 3CTPA 3FMIA 2O4XA 2WD8A 3QX3A 4IVPA 3FTNA 2I71A 4LCJA 2BCOA 1TYZA 2WAXA 1IW7C 2R92G 1Z4NA 1IPEA 1T1SA 4KR9A 1K6EA 5ALRA 3ZU4A 1ND6A 2GSDA 5EMHA 2QZ4A 3ITEA 3JZDA 1RBZA 2HO5A 2PIAA 4OF4A 2C3OA 3T13A 1CETA 3PUWA 3HJAA 4XOUA 2RCFA 2OHFA 2AUTA 4PAQA 5ALXA 5J39A 4KVAA 1NNI1 2V7QD 2VWPA 2AI3A 1E6KA 3GU3A 1BCPF 2FSIA 3HB1A 3M9LA 1ESDA 1DJLA 1YB1A 3LNCA 4I6EA 2AC4A 4QVKA 5D6NA 2ZIUB 1S8FA 1W8IA 3CH6A 2BGNA 4HBGA 4JX9A 3U39A 1QIEA 4MKGA 5KJ6A 4YRBA 4DV2L 4UY8C 2PWAA 2EYQA 2W6QA 3KHTA 3MWEB 3HADA 4GT1A 3S2GA 3V1LA 3M89A 3ET4A 3GBPA 3G6EA 1XNQQ 1Y82A 4X8HA 4BLUA 2COEA 4YR9A 1A5AB 1PJAA 1GZDA 4F1JA 5HK9A 4BVEA 1WP4A 3ROKA 2BVNA 2A0YA 1EFKA 3OA2A 4TPKA 4TTSA 1XVTA 2B34A 3OCJA 1OW3B 4UM9D 3G79A 3H0KA 3IUJA 3HLYA 4V0OA 3RADC 5CB6A 3FSJX 4M9SA 3WDKA 5EJ6A 5CNIA 1NOJA 2B4KA 4Q1AA 5ICEA 4OQXA 4QX6A 3KJNA 1PK9A 4HH4A 4IALA 1DCMA 2QHXA 4M2LA 1KKLA 3QLEA 4PEVA 3RS2A 3OKCA 4BUJA 1E6EA 5I4BA 1YOVB 4JP1A 2PFSA 3NR2A 3NLLA 3LZCA 3TAHA 3GV6A 5CD9A 5KSWB 1HE5A 4MS4B 2WZCA 1SCUB 1PR0A 2O14A 1G3QA 5IYZB 1BXKA 1SB8A 1ZP6A 3OTOQ 1BJRE 3CUSA 4P2BA 3B70A 2C9BA 3N2LA 3LU1A 3O26A 1X70A 4KN8A 3HU1A 5JQWA 3UJHA 1ZJWA 4RW0A 3O9ZA 5JDCA 3Q3EA 5D2CA 3I9NA 3T15A 2FB9A 3NGXA 2IL1A 4KSYA 1JJ7A 3EXG1 3I12A 1Y37A 1QJCA 2HTEA 3SGIA 3SXHA 5J43A 1WOCA 3JX9A 4LN1A 1WQ1R 1EIFA 3DMTA 5A9SA 5JEEA 2GVZC 1PL0A 1ULUA 1ZJ5A 1A3CA 5JAVA 1O94C 4IUYA 5DSZA 2ALYB 1EOTA 1ZK0A 1SH7A 3K9WA 3H7AA 5BPFA 5GADC 1YDHA 4RHYA 3VSCA 1MX1A 1PR5A 3OLCX 1IY9A 3MFYA 3WKDA 3BXOA 2LKCA 4BNVA 5KS2A 4DR5L 1NJFA 4S04A 2BM1A 4GYWA 3QK7A 3EPJA 1PD0A 1O58A 3ABOB 4BEBA 3RROA 2AJTA 3SJCA 1VG0B 3F4LA 4BFCA 1JZQA 5HVNA 3AYZB 1YB6A 5D7NA 1WTCA 1MEEA 1Y63A 2CEAA 4TKMA 2WWVD 4TLMB 5CDGA 3RBVA 1MB2A 1DT5A 4RLFA 4EG3A 4B4DA 3RWMB 1QHSA 4KH1A 3HG7A 3SHTA 4DW8A 3Q1KA 5HRUA 2YBEA 2GXAA 2R6GA 2E4VA 2NSDA 4KREA 5MFPA 4P7GA 3RSQA 5EQFA 4A93H 1E7WA 3ITPA 1UM9B 3HNOA 2FMTA 4C2AA 5L37A 1L7VC 1SVIA 3RUCA 1K9MC 3PUKA 4BLWA 1AS0A 1NF3A 4RZSA 3VR5H 1ABBA 5CPFA 4GMFA 2XVAA 1XMQQ 1VE5A 2GZ2A 4MIUA 3G2HA 4RXUA 1Z74A 2PLFA 5CMLA 2W00A 4DRYA 1BQ3A 4NBSA 2UXBL 5DM0A 2RB4A 2H9IA 1P2BA 1G9SA 2F0KA 1TW3A 5IC5A 4KQCA 4BMZA 1RI3A 5TQVA 4QDKA 4KIWA 4H7IA 4A3JH 2BFEB 1XP5A 2OXEA 4BY1G 5KWIA 1EFPB 3TIXB 1GQRA 5SYNA 1XMVA 2H65A 4UP7A 2CXSA 2IHYA 3H99A 1B3RA 1UT5A 2V97A 5BSUA 1DP4A 3VSEA 2GYYA 3A25A 3AJ9A 3K5OA 4MAMA 2Q9AA 3W9SA 2EQAA 2R68A 4ZD6A 2VJOA 1U7WA 4YUWA 1GUZA 1T8TA 2NGRA 2MYUA 3M7GA 1DWQA 3RZOH 2VTVA 1EXVA 1KHTA 1DZIA 2FP4A 1WBDA 3SPXA 3SS9X 1L0YB 4RCNA 1SC6A 2FFQA 3NHRA 1IFXA 4BBAA 2FZKA 3U44A 2JGKA 3L8MA 4KMUC 1GLVA 3UJPA 1KZ6A 1B1ZA 4MUXA 1IN5A 1CNEA 1ODCA 2ZKIA 2KEEA 2QGFA 2HHAA 3CMMA 2CHFA 2NTJA 3Q85A 5KQLA 1HETA 1GZ6A 1E3MA 3A10A 1VYVA 2K75A 1JH8A 4APVA 1VF5C 4DDMA 3BRSA 3TTYA 4HAYA 4AW9A 1SZDA 4BQIA 2YQ5A 5T7BA 1NX9A 4YCBA 3OHXC 5F5NA 2WLSA 5E3IA 1QFMA 1WBJB 1E8DA 1VKOA 1W76A 1XIVA 3RVNA 2C7GA 3ELBA 4K9OA 4WKNA 3W5SA 5B30A 4YRGA 3DBLB 5KSZA 4AKSA 2ID9A 1KDAA 3EZLA 3MWYW 3T7EA 1LSOA 4CF5A 5EJ9A 2UUCB 3D0OA 4IX1A 5AJXA 1H4SA 2BIFA 3SVTA 1EP1B 2QUZA 2EP7A 1G6Q1 4WZAA 4BO6A 1JH9A 4GPIB 2HW8A 3AK4A 2DP4E 7AT1A 3RZDH 3VI4B 3IEIA 1XNQL 4FYIA 4L5BA 5JCJD 2CFIA 1BXRA 3BK2A 2DFNA 5FCDA 2AUMA 4DK6C 1M8JA 1T3SA 4MLDA 2E48A 4FFWA 1CUDA 3TLGA 4ZK9B 1FNNA 4CM1A 3FFWA 2QB5A 5FBQB 2B20A 4CU5A 4B6OA 2B3GA 1GUWA 1QBGA 4KPGA 4OJMX 4N4AA 3QX7A 1CERA 1SIWA 3KSDO 3I4MH 3LP6A 4NMHA 1C2TA 1CUBA 3MTSA 5D3QA 2F0HA 1TLLA 3BGWA 3UOAB 4COOA 5IJ0A 3O2NA 5DGDA 1IEVA 4IAOA 5DASA 5EC8A 3TRIA 2X77A 4PSVA 1YV9A 5KTRA 4JK3A 3TGLA 2XKKA 5IDYA 3A6PC 2ZSHA 2Q8QA 4L9AA 1XTIA 1XGKA 4BJ5A 5I7EA 4P58A 1DE0A 2YVLA 4BEVA 4YV1A 1TTHA 1PEDA 5DTQA 5EFOA 3DL7A 1T5HX 1XEXB 1LB1B 2B7LA 2F64A 4QWWA 3CH7A 3A6EA 2F0UA 3H5WA 2YU9B 4X7BA 5DRYA 4C6TB 1S6YA 1ZHOA 4I55F 2YDXA 1B9MA 2PLAA 3GA5A 4UE6A 1R18A 4A3JB 1G8GA 4E4TA 3FPLA 1UJNA 3UUFA 2WTAA 1F4LA 3NWSA 1PEKE 2A0FA 1TT5B 3A3KA 5AKYA 2QPLA 1UP6A 3PDJA 1Y98A 4QOJA 3TLYA 3D3RA 1ONNA 3W2IA 1HDCA 2GBCA 4HQKA 3FVQA 3QNUA 4OB7A 1A9TA 1IBKB 4CEIA 3KOZA 3NBYC 2DLNA 3PIO3 4HB0A 3OZEA 3FDZA 4RTRA 3RU2A 1YGYA 2GQ0A 3A7LA 4JU8A 3B6YA 3QPVA 2PN1A 1A0OA 3VI3B 4F4JA 1ZINA 2ZSAA 5DGTA 4N5LA 3U4ZA 5AW3A 5JR3A 2YJNA 2OQKA 2DFPA 3N28A 4HJ8A 3SF8A 1UAYA 2WU3A 1XA0A 3L8YA 3Q8KA 1U4MA 1Y5LA 2W4MA 4MDYA 4UBMA 4ZALA 3TNDA 3H1GA 4B0PA 1HZJA 3M9BA 3UHFA 3LUAA 3IAM6 5IN4A 1A9XB 2EG5A 1TR5A 3LHDA 4X7RA 1RRGA 3RU9A 3IULA 2WF9A 3TH5A 4LF6L 1GVNB 2R5WA 3A11A 3IUBA 3KT6A 2VHQA