4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
2ZI3A 1G6PA 4D26A 4MDFA 1MJCA 3RC8A 1C7YA 1FMJA 2WFWA 3AGPA 4Q9JA 4E03A 4MGZR 5ANRB 4C7OB 3H15A 2JA5G 2ONKA 3TE6A 2E8GA 3AVXA 4W5WA 1HTPA 4A3IH 3DDCA 1OIWA 3K8YA 4JLOA 4FN5A 3FKIH 4XVRA 4NXMQ 2GXUA 1Q0UA 1BBUA 2YTXA 4FWIB 2VY3A 2QRZA 2FGJA 1GL9B 1XPUA 2OXRA 4KODA 2Z4RA 4NCIA 2OZEA 4L4UA 4MRRA 2GEUA 4D6PA 3B5JA 1QHNA 1UBGA 2OAQ1 4D81A 3MJRA 1MV5A 2XSZD 2HXSA 5CDFA 4BASA 4FD2A 4B34A 1PV4A 4F38A 3TW4A 1E2PA 4QGGA 2PNHA 4GBMA 3WRXC 2RAPA 1NY4A 4M4SA 3BE4A 3A74A 2BVNA 1SZPA 1AS0A 2ZTDA 1XPRA 4A3LH 5KNBA 1Z6TA 3CKLA 2ZJQA 3LVRE 1RIFA 2QEQA 1V5WA 2DY1A 2ZYUX 4A9AA 5EP4A 4BFXA 4NZYA 1S9DA 5CYPA 2JA7G 4GOPB 5LB4A 2YVUA 2Q9AA 4E5UA 1UDXA 1XTSA 4P33A 3HOUG 3M9BA 1CJTC 2GF9A 3Q3JB 4Q9HA 3T1TA 1GUOA 4JVLA 4BFYA 1CKOA 2D0PA 4Y52H 1A2KC 2W6IA 3A5UA 3EX7C 1JR3D 2GJSA 2PCLA 2C8VA 5J4KA 2D62A 4EKDA 4DPGA 4HJAA 4ZI2A 3P32A 2K14A 2R8RA 2D06A 3I3SR 2WJYA 4D4JA 3IUYA 1A0IA 1KO1A 5AJXA 1TWHH 4H1UA 2J0SA 1VYVA 4C30A 3AVPA 5JWHA 2AKYA 3U61B 2VL7A 5FOUA 3X1YA 3X2SA 1NN5A 2BV3A 4MYCA 3M0EA 3QKRB 3ULLA 2LCFA 3GLIA 1E79A 4HAZA 2YV5A 1M8PA 4GN4B 2C2HA 4NDZA 4JI6L 4CDGA 1DAFA 4WVFA 621PA 2JLVA 4AY2A 3QJYA 1IXRC 1PH6A 1YRAA 4R2IA 4B3MQ 2BDTA 4HB4A 4LUCA 1GJXA 4W5JA 2YOFA 2ORIA 1GNPA 1Y8OB 1X56A 2D2FA 1MT0A 3H1TA 4KBFA 2DFNA 4AC9A 1IQPA 3EC1A 2AKWB 3AV0B 1N0UA 4RG1A 1R8QA 2CLDX 3WBKA 1YQTA 2PJRA 1IY1A 3QVUA 4K46A 5J5CA 3SBEA 4W5HA 3WMGA 1N0VC 1U90A 3QXCA 3OTOQ 4D4LA 4DAMA 821PA 2FFAA 5TARA 1B9MA 4EFLA 1FPMA 2VPPA 3QKRA 4DT1B 2VUMG 3ZQJA 4KHPQ 3K0AB 4A3MH 1KI7A 1X3GA 2NPIA 5AJ3L 3NBFA 4XH9B 4YC7A 5BR8L 1CBUA 5FOTA 1S2MA 1AZSC 4B3XA 2ODEA 1ZYRC 4DV1Q 4DV3Q 2G0NA 2ZETA 4Q19A 3S2DH 5BXQC 4QQBX 2ZRJA 1DS6A 5LMNQ 1Q21A 3KZ1E 5JECA 2RGAA 2QGNA 1TAGA 5FOVA 5H1SE 4DR5L 2PT5A 5E95A 4DKXA 2BA1A 1TU3A 2F4VL 5AUPB 1W36D 4CEHB 4JI7Q 4DR6L 2XITA 3O8RA 3FOZA 1YIJA 2BOVA 4EUNA 2GJAA 3IFTA 1Q81C 3BC1A 2BBWA 2OCAA 4A2PA 4PZ7A 5FJ8G 1KI8A 1TWAH 3EPKA 3AFQA 2J59A 3OZXA 4IXMA 2JA1A 3QPUA 4ZO4A 4JYAQ 2HCJB 1VHTA 2RH5A 1FP6A 4OGQC 1PA6A 2OLKA 2ZJOA 3V9PA 4LYFA 4Q00A 3Q7PA 2OUKA 3H3VI 3P4XA 1DGSA 1E6CA 1IHUA 4DR7L 1XZPA 2WJIA 4DV4L 4DJTA 4TMKA 1CJMA 2ZJZA 4M53A 3PXGA 2ZRBA 3TSOA 1JECA 1J8YF 4A3IG 4TTQA 3I8SA 5EP2A 3CQZH 1H65A 4AG6A 2O8EA 3QEOA 1HNXQ 4P72A 5E3HA 4XWKA 5FUVA 1VQJA 1W44A 3FKIG 5IY0A 2PX3A 3PEWA 1E2EA 4DDTA 3QXJA 3S2HH 5EUQB 2N42A 2VH5R 1KHIA 2HF8A 1CS4C 4D4KA 3F2DA 3KF6A 1N6RA 3D7MA 2ZROA 1DEKA 3E9HA 4H02A 3S1QH 4LK1C 3DM5A 4TT3D 1KMHB 4FMCB 3HOZH 2AXNA 4OHWA 4POFA 2XOKA 4ZDWA 4BFZA 3CCEA 4QJ5A 2CNWA 5FPKA 2OQ0A 2IX3A 2O0HA 3S1NH 2A9KA 1Y69U 3STBC 3KKQA 4M1OA 2QMOA 1BVSA 2QGZA 4PO8A 1Q3TA 3A5ZB 1KIXA 1WOCA 2UZIR 3GDEA 4A3LG 2QENA 4GKJQ 2VHJA 2IHEA 1IBLQ 1FX0A 4HAWA 2IYRA 1VIAA 1SE8A 2WZQA 2FV8A 5FOXA 5TY0A 4Q18A 1CR4A 1QJOA 3CIOA 5JZVA 4E22A 3GTPH 3PITA 3QY0A 4B3DA 1MR3F 2JDID 3BFKA 5GJCA 1JMCA 1NY6A 2GWHA 4UP9A 2HUPA 3IQWA 4CF7A 2A69C 2DB3A 1X1RA 2E2HH 1GKHA 4P0TA 4GN5A 1X55A 1JJVA 3FPAA 4TYQA 5G3YA 1S3SA 5IWAL 2IUTA 1N8RC 4ARZB 5SZIA 4WJ4A 4URZR 4OHYA 5E7MA 3VKWA 1Z47A 1UAAA 2IX1A 1VQGA 3RSOA 4A4DA 2ZJ2A 3K53A 4GNXB 4HB2A 2PPBC 2CCKA 1B70B 4GKKL 4B75A 4XWOA 1MRNA 3N70A 2QBYA 4NXNL 2NO7A 1H9MA 1H95A 1DAIA 1W0KA 3CPJB 3UE1A 1VS0A 3SHWA 1J7KA 2O8DB 3HU1A 4ESVA 2AFIE 1R0WA 2AHOA 5GJBA 1QVFA 5HCIA 2KSQA 4U02A 5TVKA 4AKEA 4YWKA 5LDDC 2QP3A 4BECA 2Z0MA 2ZRGA 1YJ5A 3M4PA 2F43A 4QXAA 4HDOB 1WCV1 3PJRA 1QG4A 5P21A 3HYRA 4UPAA 4JI0Q 4M9QA 1YZQA 2UXBL 4KKUA 5EXTA 1EIYB 1ZM7A 3X1ZA 4BLOA 4JLBA 4GI7A 2PQAB 2OBMA 4LOAA 1UKYA 4DBLC 5B58C 3BORA 2L5TA 2JJ1A 4AYWA 4ITRC 2WIBA 4ZDIA 4IVPA 4NXML 1ZC3A 3MCAA 2L0XA 1EESA 2G1JA 4A3MG 2C5LA 3KTAB 2O0JA 1H8EA 2SHKA 4WAUA 4AI6A 4B35A 1YR7A 1L1OA 1Z0KA 5CYOA 2O8DA 2OWOA 1E2NA 1Z6YA 2DWPA 3JVUA 3ZGXA 4HUQA 1CRQA 5C0XH 3EXAA 2ZR9A 3AP3A 5HKKA 2XTMA 3NVAA 4HIKA 1A63A 1WCMH 2X2FA 2Y8EA 3MRSA 5E4FA 3SHFA 4MGKR 4Q01A 1S3OA 1VQOA 5J40A 4BA2I 2GAOA 2P65A 1JT8A 2F6RA 3J81c 3OAAD 3RN5A 5KDOA 1HV8A 2PQAA 2IS4A 3W90A 1TMKA 1EX6A 2GEDA 4YY3Q 1S40A 3F2CA 3CZPA 1OJLA 3E70C 2QQ0A 4MUAA 2F1HA 4DIDA 3KTAA 4LJ6A 5KTYA 1BDOA 1Y3AA 3NG1A 5IP7H 5AWFC 1GUSA 1T3LA 2HT6A 3KJPA 2VQEQ 4B3SL 1W49A 3CX6A 3OF5A 3F2BA 4H1VA 3K7UC 4IPCA 2GBLA 1AQYA 2VO1A 4R71A 5AUNB 1UE7A 2B3GA 4PC6A 5CIQA 4PSAA 1XCMA 2W83A 4V0KA 1CR0A 1I50H 2GCPA 1YITA 2VP2A 4DIEA 3W6NA 5FBWB 1IYUA 2O8BA 2FPMA 5JRJA 3QPWA 3HKSA 1GL7A 4H9GA 3W6OA 4LY6A 1CSQA 4NTZA 2MO0A 3GTJH 3I4MH 1ZIPA 2P3SA 3Q9LA 1K5GA 4XSHA 2D7DA 4G5RA 8OHMA 2I1QA 4GZYC 2OV2A 3EZFA 1ETUA 4FCTA 5HPYB 4IO9A 4M1SA 2BIFA 4JLAA 1VF5C 1ZU4A 4HIOA 3HOZG 1G41A 1U81A 2D7CA 1QHGA 2VIIA 3EARA 3FDIA 3MSXA 4IEEA 3SC3A 5JWOA 3LW7A 1XD2A 5SZJA 3KQUA 2K5VA 3GTKH 3L0PA 4Q4HB 1U8ZA 3C5HA 1W4CA 1Z08A 4A3EH 5IT5A 3SN6A 1HNWQ 1Q1ZA 3PR1A 3V4FA 1OHHA 1E9AA 1T5IA 2EXDA 2OT3B 1YJWA 3LBIA 3T53B 2OFXA 3ICEA 3MGCA 1NMXA 1Q57A 4K8OA 4OO1I 3CWQA 5GADl 1KK2A 1G17A 1KSJA 1S8FA 3HYTA 4RZUA 5IP9H 2ANCA 3OTOL 4CEJB 5FPYA 4OHZA 4LF5L 2WICA 4M1WA 5JJIA 1WA5A 1WF3A 2OSBA 4LBVA 2ZI7A 3IBGA 3QOFA 3LWUA 1SXJB 4JKIA 4GT1A 4DV3L 4DV1L 2Q2IA 1VQ7A 3KDSE 3RANA 2GJKA 2RMKA 4Q4HA 1YNJC 4QNRA 1HURA 3HU3A 1V9PA 3G0HA 4DCTA 1G6OA 4OQFA 3ER0A 4OBEA 4QJFA 1Q8KA 5KNCA 3CB4A 4UNSA 1DCZA 1JBKA 2UUBQ 3KL4A 1GUNA 1Z28A 1A4RA 2K32A 1D2NA 1YNXA 1Z07A 2IUSA 3K9LA 1PVOA 2QM7A 3M6AA 4M1TA 4CEJA 3SQXA 2DNCA 2UU9Q 4FWTA 5DE3A 1P9NA 4IOCA 5J4YA 2I5MX 2GXQA 4JYAL 2R6AA 4JI3L 2VP4A 3W5OA 3I4LA 4G5QA 4DK1A 1SXJA 2CK3A 1ONBA 5FOWA 3H3VH 1MKYA 1IY0A 3GEHA 1U9IA 3VKGA 2OCPA 3TEHB 4N1AA 5GVSA 3WNDA 1NN3A 1QHSA 1HT1E 2KBFA 1A8VA 2A2ZA 2KI5A 1CR1A 2V1XA 4IDOA 4NCJA 4Q9KA 1E9DA 1HNXL 2TMKA 4TMVA 1VQPA 1PLLA 4W9MC 1G7RA 2FFBA 4US0R 5HZHA 1NMGA 4G1UC 3CR8A 4I4LA 1HA3A 4ILEA 4O3MA 1LFDB 2MSEB 1X65A 3AVUA 4HZIA 2QT0A 2ORVA 2GN5A 2QRNA 3BS4A 4R2HA 421PA 1IM2A 3ECCA 1XTQA 5JJKA 1P9WA 3F0TA 4MYTA 3CF2A 4YMSA 3TBKA 3PSIA 2MFIA 2K52A 1AN0A 5C0XG 3H0GH 1IBMQ 4A3BH 3GLGB 1KC8C 5K8UA 2WJVA 4XWAA 5FBLB 4YMUA 1XEXA 4HLCA 5J4HA 1WCMG 4EPRA 3H2YA 1I4LD 1JI0A 2ORWA 4ZKEA 2IYQA 3PCRB 3CNOA 1N9WA 1K8MA 2R44A 2ZSAA 1VCMA 4GKJL 2EVWX 3W5JA 1N33L 3J7ZC 4F92B 4U7DA 1FTNA 1TF2A 2CVHA 2Z0SA 4LFCQ 4TLDA 1KYIA 3UDXA 2O5VA 5IP7G 4OI2A 2OM2A 2JLXA 2REXB 2KENA 1E2ZA 4II7A 1JB1A 3W3AA 1W0KD 3FMPB 3CC4A 4B33A 1K8GA 1IXZA 4HAYA 4OWWB 1E1QD 3GLGA 2ODNA 4A0FA 3AQ4A 3VR6A 3TUIC 3U9SA 3W8NA 3MEFA 4M1MA 2KBNA 1EG7A 1K5DA 2GCNA 2OTLA 3I4MG 4FXPA 1P73A 2RCNA 1Z6XA 4OK6A 4EPWA 3BDOA 1SHZA 5KHOC 4JLMA 3BZCA 1EWHA 1PJRA 1EWIA 2OILA 4HATA 4L16A 4L15A 4PHTA 2GVBA 1OFUX 4YMWA 2JJ1D 1U2RA 5BYJA 5FTLA 3K0CC 1O7LA 2FFHA 1N6HA 5KSZA 1F2TA 4WZAE 4L5RC 2HT1A 2D74A 4A3EG 1Q12A 4X64Q 2BC9A 2GA8A 2NO9A 1D9ZA 5FFMA 4HJ5A 1XMIA 3T1VA 3HP1A 4LI0A 5HKKD 1RL2A 1WQ1R 3B6EA 1VQ9A 2CLCX 5IP9G 5KOYA 2F1RA 1X8LA 4ZCMA 2C9OA 1H8HA 5JMTA 3GFOA 5C4GB 2Q2HA 1EX7A 2CFMA 2B8GA 4NPSA 2J0QA 1KQSA 4C0HA 3OPOA 1GDDA 3LXRA 4M1KA 3PF5A 1N25A 4A4IA 4FMDB 3SBDA 4H44C 3KXIA 1DBSA 4IW3B 5KSPA 1Q1EA 1F6BA 2ZJPA 4JV5Q 2BBSA 1Q1QA 2ZYTX 3U3JA 2VP9A 1E1OA 2K7VA 3H4MA 4RD2A 1G8PA 3U3KA 3GLIE 2V9PA 3W5IA 4POAA 1X54A 4YWLA 2GXAA 4WBSA 3LNNA 3K09C 3IRBA 1BKBA 4C3HH 1CJUC 4LZZA 3V4RA 1YU9A 4A76A 2QG6A 4BQSA 1ZCBA 1C0AA 2D2EA 3GEEA 1GUTA 3TGPA 1Y1VH 4P74A 3KJHA 2VQEL 4LV8B 1G1MA 1DD2A 4IVRA 4LW1A 1ZAKA 3AVQA 2O52A 1GVPA 5J3BA 3S24A 2ZRHA 1SKQA 3AKYA 4KSCA 4LWCA 4XIGS 4LJ7A 3WYAA 2ZS7A 3U7GA 2BBTA 2ZI4A 4DLRA 1II0A 1OHHD 2QL6A 4BPBA 3B2EA 1ZUIA 3J80c 2H16A 1U98A 3JVVA 4U5XA 3B8HA 2D5DA 2FU5C 3HOVH 4Q47A 3D0FA 5DLQE 1E1RA 3EIVA 1M34E 1W0JD 1A7JA 2WWWA 3DOFA 1NMYA 1DE0A 2CJWB 2JAQA 3SJAA 3U4ZA 4C2TA 4KV9A 3H0GG 3KUCA 4A3BG 1KKLA 5IE8A 1P2TA 3NTUA 4B3GA 1P2SA 4R7ZA 3NC0C 1M2OB 2BMDA 4Z51A 1BH2A 2ALYB 4LK2A 1ZUHA 2J7KA 1Q20A 4AH6A 2VL6A 1R8SA 1VIYA 2D4HA 5JCPA 4L5TA 5JEAJ 1UEJA 1DG3A 2OFWA 4A8JA 4OO1H 1CKNB 1UE6A 4DV2Q 1KDRA 3WWVA 1N0WA 2X2EA 4I99A 3UWOA 1FNMA 1UF9A 3UG7A 3TS0A 1LF5A 3M3YH 3I1FA 3KQNA 4RZ3A 1OXVA 1YBYA 1IN6A 1L4UA 1QHYA 3GJ4A 3U50C 2GNOA 4PC3A 4RCNA 5DI3B 5G40A 1E9BA 2JGNA 3RHFA 5CK4A 1E32A 1G3IA 2QMUA 4PPFA 4C0QC 4DLSA 3NDBB 1KO7A 4WIAA 2JXMB 1KSGA 3FVQA 1CJKC 4MGYR 4B3FX 1PH8A 1XMQL 1NBWA 2IX0A 1GTVA 3TH5A 3TSZA 2ZAOA 4BFSA 1FFHA 3RYTC 2ZXUA 1SXJD 1P9RA 1VECA 1TADA 1VCIA 2NN6I 1UJ2A 2CK3D 2Q3MA 3L0IB 4OJQA 5LPNA 3BERA 5D3MB 4JI1Q 1R5OA 1YHAA 1PH2A 2KWIA 1CKNA 2E74C 4LUZA 4MITA 2V8OA 4TYPA 1VPLA 1ONLA 2ZREA 1HPCA 1KRSA 1E3PA 2QN6A 2ZS9A 1E22A 1NJIC 4Q4AB 3R8FA 1F3OA 5AJ3Q 1LV7A 1OV4A 1Z83A 5BR8Q 3GLFA 5DI3A 2VQFL 1JJ2A 4HYYA 2GESA 1H9SB 5G53C 2IHFA 2PNRC 2FWRA 1XJCA 1YNNC 4DWJA 2GVAA 4RCYA 2VHQA 5KYKA 3PF4A 3BGWA 1XJVA 3GTMH 3KKNA 3AVVA 4DR5Q 3QG1A 1XRJA 1YZUA 2GK6A 1E2JA 4ZDJA 5GAHC 1OH8A 4IFDI 4DR6Q 4RFSB 4NYIQ 4X8LA 4X8MA 4A75A 3LVQE 5KDLA 4EJSC 5EE5B 5D3MA 5B57C 4Q66C 2P6NA 3LH5A 1OFIA 1YVDA 4FW9A 4AURA 1T8UA 1FJGQ 4OI4A 2R7DA 5C1BA 3CO5A 4C2MH 2YKGA 2R2AA 3W6PA 5F3WB 3MUFA 3ZZ0A 2GDJA 4MDEA 4ACAA 3SJBA 1CR2A 2VRWA 3K0CA 2BWJA 2ZSFA 4Y0AA 4RSGA 1D8LA 3LFUA 4DR7Q 3BXZA 1IBML 4DV4Q 1LTQA 2ZJYA 4KFRA 2NPFA 1DO0A 4V0ME 4G5SA 3EPJA 1Q3HA 1XB2A 2A6EC 4TZ0A 4RFSA 1CTQA 3KDFB 1H9RA 3K8AA 5AJYA 3AQQA 2H18A 2NVTH 3ADDA 3ASYA 1L2TA 5KO2A 1WDTA 3ZZTA 4A1FA 2ZVQX 1WFQA 1IW7C 2FH5B 3A36A 3LAWA 2ODBA 3P26A 4DUGA 3PEYA 1KI2A 3SS8A 4LFCL 4DNIA 1KIMA 1KKMA 2XGTA 1W5SA 3I2ZA 1Y1VG 1G4UR 1W4RA 4MYUA 2XZPA 3D31A 4OQNA 1AH9A 3ZIAA 5K36H 1E2HA 4MYHA 2P6RA 1LM0A 2N8NA 1O87A 3S1RH 1X9NA 5GADC 4M8NE 3TUJC 1BMFD 3CMAA 1G5PA 5DI9A 3WXMA 3KKPA 2LKCA 3DKPA 1DOAA 3HFZB 5J4LA 1AE2A 3KDFA 3T5GA 3SJZA 2GZAA 3UXMA 3VNVA 3HOVG 4EIWA 2IYSA 2ZJ5A 2QPOA 3PUZA 4HLUC 1KZ7B 4ARZA 2C9CA 1G8HA 3EIEA 4C3ZA 1H8HD 1NE3A 2YWHA 3V00A 4NPHA 3KYHC 1KL9A 4XOIA 4YXWD 5SZHB 5HY6A 5IYBH 521PA 3VKHA 3I73A 3U4VA 5EXXA 2IEZA 2WMOB 3ICQB 4IQZA 3FKQA 2A8VA 4X64L 2NQ2C 2OHFA 4GSYA 4DEXA 2C77A 3LLMA 3NWJA 4XD7D 5A0FA 4OO1G 5HR5A 1S3GA 3LLUA 1L2FA 4Q7MB 5AR1A 1R2QA 1JEEA 4DLYA 3CCJA 3B82A 3AKCA 1X3FA 2HEIA 4HDQB 1R10A 1UKEA 4GFDA 4OONA 2CL0X 4A3GH 121PA 1UBFA 1E9CA 4KMUC 1WP9A 1S0UA 1Z0FA 2E2IH 1L7VC 4JVMA 4BRUA 3KOJA 4BBRH 1F5NA 5L3RA 3KJGA 3JAMi 1NTGA 1DAMA 4B2IA 4HZUB 1GITA 4CZ2A 1CSPA 5KUTA 3KFVA 3G82C 3KLWA 2DGYA 1L0WA 3M4OH 4JV5L 2ZI5A 4Z1MD 2UXBQ 3U4QA 3FWYA 4PZ8A 4TZ6A 1EFCA 2CW0C 4OI1A 4DSTA 4JKYA 2IW3A 3ERSX 4NYMR 5LMUL 1HUQA 3F3YA 3I8XA 2A5GA 4LC1A 3CCRA 2ZITA 1VQAA 2WTUA 4D0NA 1QZGA 2G6BA 1XP8A 2LKDA 1VQKA 4MH0R 1CJVC 4AWXA 1W3SA 4JG2A 2V6IA 1TX4B 3AP2A 2RGNA 3RABA 4M9XA 3D3QA 2J7PA 3PQCA 4W7SA 3UANA 1E1RD 3EQLC 4LJ5A 5C0XI 2Z5FA 2JA9A 4HZUA 4WJ3M 2Q3HA 2ATXA 1RW4A 1CEEA 4Q48A 1OB2A 2IS2A 1Z6HA 4DDWA 1A1VA 3CCLA 3UMFA 1KI4A 2JLQA 2BBOA 5M04A 3OEHA 4OHVA 1VTKA 1FW6A 3IO5A 3OE7A 4UXIA 1G7SA 3QPVA 1NVVR 4L5BA 4PPNA 2V1CC 4AYXA 2D0OA 1C9KA 1EXMA 3NEYA 1Z6GA 1NN1A 2JJ2A 4Q21A 3TJZA 1X8KA 5L3QB 4JI2Q 4KHZA 3GJXC 5LB2A 4B3SQ 1VQIA 1GRRA 4TYWA 1CF4A 3QUSA 1SGWA 4A6XA 2CLSA 2CE7A 1V1QA 2QP9X 4RJLA 4G7ZC 3MWLA 4JLJA 4G5GA 5FUWA 2QTHA 2WKRA 4BLPA 4YMVA 3M4YA 4JBXA 1FP7A 3SZRA 2Z6KC 3A0JA 2EFCB 4LJ4A 4JJKA 3LO5A 4EJSA 3ZLJA 4DV2L 3HGBA 1Q82C 3A8KE 2CBZA 4JYCA 1GO3E 1X3EA 2V7QA 2DPXA 2R9VA 1HH4A 3W1BA 1T6NA 1KD1C 2AD5A 2W6JD 1F2UB 3QKTA 2VP0A 2IYTA 1GRQA 3ZJYC 1SXJE 3RRZA 4B47A 5L3QA 1OXTA 1CIPA 1XTRA 4Q1EA 2F1MA 5CK5A 4YMTA 1M1KC 5K36G 1TUEA 1AM4D 1GNRA 1TQ2A 4V03A 4DV0Q 3PIOA 4Q1DA 2NN6H 4QJ4A 3RLNA 1VQLA 2AKAB 4A3FH 4DUYL 4HJ8A 3E0EA 2PX0A 3LX5A 3Q8DA 4JI1L 1M1YE 4C0LA 4EAQA 3KQKA 3NEMA 4LF5Q 2YWEA 3K70B 1CTMA 3HOWH 2KJQA 3WNCA 5KU1A 4QJ3A 2J5XA 3AB9A 3U3OA 2K4KA 1M6NA 3NELA 1XWIA 5BN3A 3DHWC 4A0RA 4DDVA 1F2UA 1C4OA 2H8KA 2RHMA 5IYBG 4NHOA 2RHDA 4PAQA 3CW2C 3T15A 3WP1B 1G5RA 3ULPA 3AYHB 3IEUA 5LBIA 1MIUA 5DHFA 5JEAH 2AL7A 2G1KA 4YDSA 1TNDA 3RNLA 1XTIA 3CF6R 3PG5A 2QAGB 2FDCA 2O8EB 4IFDH 5FL3A 2YC4C 1DAGA 2FSGA 2XNSA 4L8JA 3B13B 4GZMA 4YCVA 2NG1A 1IYJB 5A4JA 3CRVA 2GZDA 5JSZB 3VA7A 1COWD 1NVXQ 4IPDA 3WYGA 2AXPA 4AYTA 1FJGL 4QG7A 3KF6B 1NLZA 1VG1A 4A3GG 1B7YB 1JQJC 4EQ6A 3G5UA 4QFMA 4Z54A 3KKOA 1CI3M 1GUGA 1NBMA 4ON9A 1DPFA 4BBRG 1QZXA 4JI3Q 2IK8A 5FI1B 5UKDA 4OX9L 1VCOA 2NMVA 4IJHA 1SRUA 1LF0A 3FMFA 4DUGD 3GLGE 4JLKA 4TQ9A 1OH6A 2QPAA 1M90C 3A1VA 1HNZQ 2EU8A 2PEYA 2CWAA 4A15A 1J90A 3BG3A 2QAGA 2H7VA 4AIMA 2HLDA 4JBYA 3OIYA 3BU2A 1NY5A 1VQBA 4C0AC 2OQKA 1FX0B 1P2VA 2FZLA 3NH6A 4E09A 2PH1A 3UDGA 1IJEA 1E2LA 1E4YA 4AIIA 5JSZA 1GNQA 1KY3A 4YWMA 2XZOA 4DLWA 3SDZA 3RNUA 1Z2AA 4TN1A 1BOFA 2ZRDA 3R9XA 2W58A 2QUZA 2EFGA 1JAHA 2YWGA 4IRUB 4Q1AA 1OH7A 2UVQA 2X8AA 4LV6A 1GP2A 5JRZA 1KHTA 2F1IA 2JATA 2ZJBA 4ALPA 3PIPA 1GOTA 4JJZA 3WBJA 4ACBA 5JWRA 1SHKA 2WAQG 3HU2A 1TXYA 1I4DD 2A68C 1CP2A 2BH8A 2VA8A 2QTFA 1WXQA 3AGQA 4FI3C 1N33Q 4M9SA 4LJZC 2ATVA 5EUMA 2YC2C 2ZR0A 2QBYB 2LXJA 2ZE8A 5H68A 3G48A 5CLLA 4PSVA 1YJNA 3EZ9A 1I5FA 3EPLA 2AHOB 4V02A 3BK7A 3MLEA 4QBFA 3TNFA 2ZJ8A 2WSMA 2F43B 4JYBA 1J70A 2A6HD 1K73C 1VF7A 2WBLC 1N5IA 1NVUQ 1R0XA 1YRBA 5FLMH 3FB4A 4G5OA 4Q4JA 1CRPA 2K33A 3A4LA 2IWRA 1I4TD 1T3SA 2MQHA 4V0OA 3CWZA 2O8CB 2ZSEA 3TLXA 1AZTA 2OBNA 2R65A 2W2VA 1JR6A 3OW2A 1G4AE 4C2UA 3IEVA 1N6NA 2IYLD 4P4SA 4K0KL 4A6PA 1Z0AA 2R93H 2CMKA 4OHXA 1XDBA 2DFKB 3NKVA 2YYZA 1L1OB 1T0HB 2FN4A 3Q72A 3PIRA 4PZZA 3PGZA 1EWRA 3RLOA 5B64A 2GZHA 4HUQB 3I62A 1OFHA 4Q7LA 3AVWA 4Q02A 2Q2UA 1PLKA 3FE2A 2WSSA 1PH1A 2J7PD 1KJWA 2IYUA 3TVTA 2NN6G 2IUUA 2BKEA 4F4IA 3KUDA 4A3FG 4R4QA 2ZUDA 4V0NA 2LXKA 2O8CA 2YTVA 3EC2A 2Z6KA 2Q2TA 2W0MA 3G4SA 4UP7A 4A3DH 2FOLA 3HOWG 3FP9A 2H5EA 2X77A 3N6RA 3NC1C 4IVQA 3OEHD 2IYWA 2I0QA 2NZOA 1XJQA 1ZM4A 4G01B 1M7BA 5KSOA 4LUVA 3WP0A 4FDBA 1IXRA 5AJZA 2JJ2D 4LHZA 3G6EA 4UNRA 5DN6A 3U7EB 5JEAG 1QF9A 3NENA 1P72A 3E9IA 4MKFA 4PTLA 3FKSA 2GTPA 1XTDA 3A8IE 4IFDG 2W6ID 2NGRA 2O8BB 1S1CA 2P6UA 4LBZA 4RD4A 3RS2A 1N32L 2KB0A 5GROA 4OXPA 3GEIA 3CZQA 3BB3A 5JBQA 4DNRB 2E5LQ 1TF5A 2HDNB 3ZVLA 5EZ5A 4BY1H 2ZAMA 2CXXA 1EIFA 1VQDA 2FJUA 1KK0A 1BO6A 1QHXA 2ZRMA 3FFAA 3OEEA 1QHIA 4AK9A 1RRFA 4ZCIA 1XD2B 4JI2L 2WAQE 1E79D 4Q5IA 4LWZA 2WJHA 3KJOA 3LY5A 3UMSA 3CW2A 1YJ9A 2FX3A 4IOKA 4QGUA 4RY2A 4LJ9A 1GFIA 2RGDA 3SE0A 4D0GA 4PZLA 2OBLA 3Q85A 1UM8A 2O5JC 1D2EA 2QQEA 2HIXA 1G8FA 3CRRA 2IC5A 3SYLA 1UEIA 2C96A 4FCVA 3H94A 1VQ6A 4B48A 4DEYA 1OH5A 2OO7A 2PZGA 3S1MH 1YZKA 4M9ZA 2A78A 5FLXc 3BAFA 3UDFA 3TRZA 3GLFE 4QHYA 4RKEA 1Z63A 2ERXA 2EW1A 3AP1A 4FIDA 1NRJB 3T5DA 2JK8A 2N49A 1E4VA 2AD1A 1ZM9A 1AQUA 1E2KA 4UXJA 4DR2Q 2ZTEA 4BEBA 1FL9A 4R4OA 4US1R 4BBSH 3A1UA 4O2LA 4HJ7A 1ZP6A 2FPLA 2G0TA 4BFVA 2IL1A 1S9HA 2WKQA 3J80i 3B1VA 4DV0L 4IFBA 3CCUA 3REGA 2IS6A 2EYQA 3GTLH 2K75A 5IYCH 2A5YB 2I3BA 4ASUA 1OIXA 1XEWX 3VHXA 1ZW6A 1PFSA 3TZUA 3CCSA 1Y63A 3F5FA 1XMSA 3C8UA 1FMLA 1CUKA 3DMNA 2MMGA 4CT4B 4LJAA 4D4MA 4JL8A 2E2JH 1R0ZA 2HHHQ 2ZRKA 2RGBA 5FBRB 5FR2A 1T5EA 2WJGA 3L2PA 4JVSB 3L8YA 1XMQQ 5K8LA 3PUYA 3K80C 1N6KA 1NBMD 4JT2A 5FI0B 4A92A 1LUZA 4WZ6A 1GILA 2BKUA 3THWB 1G18A 1TL7C 2BM0A 2BE5D 5FLMG 3UKDA 4EX5A 3B1ZA 3GJ6A 4PQYA 3EASA 1RYHA 4OI0A 2OE2A 1VKJA 4UNQA 1YVCA 2XJ4A 5HGQA 2EIFA 4O2DA 5JCZA 2PLRA 3GO5A 4NBSA 4BFWA 2JLSA 3R20A 2R93G 5JI3E 4A3CH 2AN9A 1U5KA 1U94A 2VQFQ 1TQDA 2UZ3A 5C4JH 2QA4A 5FUYA 2Q9BA 3CRLC 3I4NH 3VR3A 2ID0A 1ASYA 2JE6I 1EFRA 1GRNA 3TIFA 3O8CA 4I1VA 2FSIA 1XEXB 2JEAI 5DO9A 3T06B 1HNZL 2XOKD 2R92H 4YQFA 3THWA 3O47A 2GVZC 2CNWD 2EJMA 4NYJR 1I6HH 1YHNA 3D8BA 4JSYA 4A2WA 1S96A 2C99A 1UDWA 4LF7Q 4A3DG 5EE1A 3CH4B 3ONWA 2GJ8A 1TEVA 3DZ8A 2XJ9A 2EWWA 2ZR7A 3MFYA 4N0DA 1FNNA 3GLIB 3A4MA 2HQLA 1UE5A 4LF6Q 1RYFA 2ZU0C 1EUJA 3K0EA 2HCBA 1LACA 2K5HA 4KBGA 2ZJAA 2EQBA 1OKKA 4LUOA 2PBRA 4NP6A 3QQ5A 1S1MA 4QGHA 2IXGA 3VFDA 5LD2C 1ZD9A 4DZZA 4Y7NH 1Z6AA 3AVTA 1SROA 4L5QA 1D8TA 1J8MF 2ZS8A 3AF2A 1G20E 2Q0HA 4RMFA 1XD9A 4AYBG 1WRBA 2KCMA 3F1ZA 1G6HA 1NLYA 4KJZA 2MSCB 4URVR 3PUWA 5HE8A 1I3QH 1GKIA 4BY1G 5J4VA 1KI1A 1PHJA 4FMCF 4O0AA 3RLFA 4AQYL 1OPXA 4HEJA 2Q9CA 1CLUA 1MO4A 4BZQA 4GDFA 4XSGA 1G8GA 2YTYA 4FCWA 4JL6A 1F2TB 3CNNA 4WZBE 4R98A 2J1LA 4QIWE 1ZM3A 4P3YA 4GMDA 1H9JA 3LW8A 4M2LA 3U2QA 2O0KA 4JOIC 2IYXA 3PUVA 2A19A 1MO6A 3B1XA 4HAVA 4RVCA 4WXPA 2WSSD 1DO2A 2C04A 5CM9C 4QBHA 2YU9H 3FGNA 3M1IA 2ZI9A 2A30A 3QF4A 4Q7KA 2IA5A 3PEVA 1TWFH 3B78A 1QG2A 1OYWA 1X8JA 4GOXA 4US2R 2VTKA 3CRMA 1IL2A 4PX9A 3X1XA 3X1DA 5EXPA 2AMCB 4MZ9A 3LGJA 1PZNA 5CDFE 3I5XA 1NL3A 1H8ED 4KVAA 2PMZE 3HKZG 4HAUA 4Y0VA 1NKSA 2AUKA 4BBSG 3C16C 4ERNA 3ZD7A 5AJWA 4GLXA 4JI4Q 5DN6D 3PO3H 1VYTA 3TAHA 1WE2A 1R5NA 3C4JA 2F3TA 3TUZC 2R6GA 2XTIA 4IOAA 2AWOA 1VQ4A 3SYKA 5IYCG 1RC8A 1SVSA 2EFHB 1SVWA 1Z5ZA 3QEJA 1DXMA 4MNOA 4LFBQ 1VDZA 1R6BX 5ELNA 2VF8A 2YNMA 3BH7A 4I1SA 3QBTA 3FMIA 4L9SA 4TL8A 4OK5A 2D3WA 1EGAA 1EFUA 3KJEA 2MO1A 3SEAA 2JEOA 3T1OA 4YCUA 1KJYA 4KLZA 3ZS9A 2ZE5A 2EVBA 3QI2A 4DV6Q 4O2RA 3CPEA 1KDTA 2FPKA 4PC1A 2O5IC 4LSGA 1D2MA 3EN2A 3VX3A 5TB5A 1W36C 1KI6B 1HZBA 4JT4A 1E94E 1X6VA 2VHTA 2XZLA 4LJ8A 1CULC 4UY8C 1KI3A 1VG0B 4GLVB 5LMUQ 3WDNA 4LHYA 3CRKC 3BB4A 5AJVB 5TV2A 3T34A 4PMWA 4A3CG 3UK6A 4GP6A 3KKMA 5C44H 4E07A 2E5LL 3OIWA 2R6CA 5FL7A 1T5LA 4CEIA 1QUQB 1YI2A 1SULA 1KDOA 4YLGA 3ZH9B 2IXFA 4CT5A 3AF4A 3I4NG 5JI2E 1EQQA 1ZJ6A 3OFNA 3TVDA 3DM3A 4PG3A 1E98A 2G3YA 5FPHA 3L0OA 2R92G 4DUZQ 4AYBE 1KI6A 4QHSA 4TMTA 4JIMA 3VDYA 2A5FA 1IY2A 4A8JB 2CHVA 1DADA 1AGPA 2Z43A 4DK3C 3X1WA 3ND8A 3L8ZA 5C46F 3FHTA 4JBWA 2BM1A 1YZLA 2QPTA 4Q7JB 1ELOA 4OK3A 1XMOL 4MRPA 5FUXA 1Q1BA 4TL7A 3CXCA 2PMKA 4GN3B 3G71A 3CPHA 1JAIA 3KX2A 2GVDC 2VEDA 3Q7QA 3WY9A 4BUJA 4EPVA 1M7HA 1QUQA 4L9WA 2QM8A 1NMZA 4QGAA 2I5LX 4JSTA 1KY2A 3ZVRA 3SJCA 4DR2L 1R0YA 3DL0A 1I94Q 1KO5A 2IWHA 2VQSA 4PZYA 5BYKA 3A7LA 1T4GA 1YKSA 1N3BA 1AKYA 4DDUA 1KAGA 2QE7A 3K81C 3VU9A 3VQTA 4R4TA 2ZEJA 4BWYA 3DOEA 2CHGA 3QXXA 1GD7A 3FFBA 1RPZA 3STBD 2DN8A 2V1UA 3GLHA 4TLCA 3IILA 1XXHB 4Q9IA 2YINC 2HYIC 4LFAQ 5M5XH 2JA8H 1E9RA 1I2MA 1NBME 5A5GA 5BWMA 3HKZE 3DLLA 1Z06A 1D6JA 3VR2A 5ELOA 4POGA 1GVNB 3VR4A 1UBEA 2DCUA 3K1JA 2EFDB 4LX0A 3KXKA 4QHTA 2HHHL 4URXR 4RD3A 4F91B 2VBCA 4DK0A 2ZE7A 2CE2X 3L2OB 1HQCA 2OEPA 4DR1L 3OHMA 2A69D 3MXUA 3L43A 3I61A 5L3VA 4DUYQ 2B21A 1N6OA 4RD0A 4AD8A 1SFOH 2N3SA 2OCBA 2ZSBA 3THOA 3O8DA 1PH7A 1R7RA 2DNEA 3ULJA 4IDQA 1XXHA 2JA6H 2GILA 2WWXA 2PJZA 3EZ6A 2OXCA 4DLVA 3CX7A 1PH4A 2ANBA 1FL0A 5DISB 1QVAA 5M5WH 2QROA 1JR3A 2DBYA 1Z9FA 1YHBA 2PI2A 4EDHA 3B1WA 2GJ9A 4DSNA 4TSFA 1E2VA 1NMFA 1QRAA 4KFUA 1B8AA 4JOIA 3PO3G 4Q1BA 4TLEA 2PT7A 3T56B 2KE5A 4J0QA 3WMEA 1S72A 1KGDA 2NVQH 2WVJA 2IS1A 3JZMA 3TMKA 1N5LA 2VSOA 3C7KA 1RJ9B 4LF9L 4LF7L 2Q8IB 1ZD8A 2QI9C 4LPKA 5D3QA 2QMEA 4YCWA 2P5TB 4GOKA 4CRWB 2HYDA 5FTKA 4QM7A 3BB1A 1XEFA 3EWAA 1E9EA 2BCJQ 4IDPA 4DXAA 2NVYH 3WYFA 4OX9Q 4QNMA 5E7JA 3QE0A 3RAPR 3IIKA 4LF6L 4WA7A 4DCUA 1E99A 1N36Q 4KO8A 1HE1C 4ZIRB 2JJ8A 3HJNA 4GRAA 2NVXH 5BN4A 1AIPA 2FG5A 4RKFA 4QL3A 3IPYA 5BN5A 2ODWA 1G5TA 1OYYA 3QBVA 5EE0A 4LBYA 2ONJA 3PEUA 4KXFB 3HOYH 1J2JA 3EPHA 1U0JA 5C44G 4JC0A 2HXYA 2QORA 3AB3A 1RJ9A 3HPQA 4KFTA 4NKRA 3BOSA 1HTWA 1KK3A 4PZ6A 1X1SA 2J87A 2QAJA 4GOPC 1P7CA 2XEXA 2VF7A 2ZE6A 4OKSA 4QBGB 5DH9A 3ZYCA 1EK0A 1WB9A 4N0EA 4UNNA 2ZRFA 3TKLA 4V0LA 4Z8YA 1EFWA 4BRWA 2BMJA 2V4ZA 5FPSA 2F7SA 3ADKA 2RHSB 2J41A 4TLBA 4ZIRA 4O0MA 2XNDA 3EIQA 1OT3A 4J15A 3CD6A 2BHRA 3C15C 1YR8A 2I5HA 4RD1A 4DR3L 1XMJA 2ZM6Q 1XJ0A 3VTKA 4B32A 4MGIR 4EPTA 2ZRCA 3WMFA 4C0BA 1TUIA 2OLJA 4H0LC 1ZMXA 4UJ3A 1NI3A 1TF7A 5F9HA 4B3TL 3EZ7A 2ZRPA 2KHIA 1W2GA 3R7WA 2R7FA 1L8QA 3QG5A 4TMWA 4CVNA 2ES2A 4C3JH 1IBRA 3AF3A 3GJ0A 3K09A 4DRZA 3ADBA 5DLQC 2IF0A 1TWCH 1EOVA 1T0JB 4F7WA 2REOA 1SKYE 4BGDA 1Q44A 3U6BA 3EBEA 1YHQA 1ODFA 4TMZA 4QKQA 1HEIA 3B60A 3U4QB 3QXSA 1OF1A 1J6QA 3CP0A 4PSKA 4B6EA 4A36A 4JI4L 4A0HA 2N1BA 1N34L 1MABB 3GJ5A 2B8FA 5B30A 1E7ZA 4KN7C 1IZ6A 4AG5A 1IN5A 4PC7A 3W1GA 4K0KQ 1DAHA 2DFTA 2JA8G 1MJEA 1XNRQ 3THYA 4LFBL 3NBYC 2Q3FA 4Q4LA 5KDDA 1W2HA 2GKSA 2FSFA 1E3MA 1P6XA 5FL7D 4I81A 5G41A 3F8TA 1TPZA 3AM1A 1MRSA 3BZKA 4I7ZC 4DV6L 3BJIC 3D6TB 1KO4A 2WIAA 1P8LA 3CMEA 2HJVA 2EJFC 3U58A 4R4CA 1B0UA 1HQYE 2E1RA 2VYFA 2W0SA 1RKBA 3EIHA 3OIUA 5HCNA 3H84A 3RVBA 2ZYVX 1MABA 3GFTA 4LNQA 2FEOA 2JA6G 4EQ5A 5KNDA 1QVGA 4KLNA 3CRQA 1U0LA 1XD8A 2V6JA 4P75A 3T51B 1E0JA 4FMDF 4DCNA 2WJJA 2C78A 3A4NA 2IYZA 4JI8L 4Q1FA 1XMVA 4IJLA 2ZSDA 4TYYA 1K8AC 1VYUA 4Q03A 1P62B 1SVIA 5IYDH 1DELA 2B8TA 1U8AA 3LX8A 3HOXH 1N6PA 1EWQA 2BJVA 4JZKA 3K0SA 3N2IA 4DUZL 1N32Q 5A35A 1AS3A 4EJSB 1WJJA 1R4AA 4OQMA 3BD9A 4BE7B 3UE0A 1G3QA 1G19A 3U3RA 2WP8J 1KDPA 2QE7D 4URYR 3RWOA 5CITA 2XGJA 5FTMA 3EA5A 4TVAB 3J81k 2HF9A 2J3EA 3HR7A 1W46A 3CPWA 2JCSA 3RRYA 4FMBB 2ZUCA 5DIFA 4A3JH 3CONA 1UADA 4JMPA 3TREA 1LYLA 3DXJC 3SNHA 2GEVA 4D82A 3U44A 1PUJA 2IYVA 2WOJA 4LGMA 4D25A 5BW8A 1K83H 3GTQH 3RDPA 1IAQA 1NIJA 1OIVA 2LSSA 2CKZB 4JS0A 3U60B 1I94L 1XEWY 1P60A 3J81i 2B29A 1G7TA 3LQRA 4C7OA 4X6AH 2GRJA 3A1WA 4R4IA 1TQ4A 3GP8A 3THXB 4LYHA 3HOYG 1RVDA 2GK7A 4LDJA 3T1HL 3VMFA 4DLXA 2F1JA 3S15H 3TS2A 1SR3A 3T12A 1W5TA 3K0FB 1Y8PB 3KQHA 4LFAL 4PHHA 1SVMA 3NXSA 3RZOH 2FGKA 4C3IH 1PH9A 4PQFA 3LNCA 3W34A 4LF8L 3RRNA 4A3KH 5KSYA 3A6PC 2ZJRA 3C41J 4QBIA 4YONB 2WM9B 4JLNA 3T35A 3GFPA 3MJHA 1NKTA 3OAAA 4NCHA 4TSFD 1RZ3A 4X66L 3BH0A 4PQRA 1RFLA 1AJEA 3THXA 1ZYUA 4XVQA 1NNEA 1ESMA 4IOLA 4GNXC 4BA1I 1FR3A 3UMRA 4QL5A 3GTOH 4GNKA 2ZRIA 1MKHA 1GHKA 4TWZA 4EQ6B 4AKHA 3K0FA 4HLQB 4GOPA 1VHLA 1L1OC 2QP4A 1IONA 1E9SA 1Y14B 4UJ5A 5B2ZA 2JLZA 3HDTA 1BYIA 1KAOA 2D2CC 1I2DA 1XCPA 1JE5A 3RS0A 2RB4A 2FSHA 4LHXA 1X6OA 2XB4A 3DM9B 5LMNW 4G7HC 3OW7A 4QY7A 1DTSA 5C4XH 4X8OA 3T1QA 2XTZA 1W1WA 2UXDQ 1O3YA 1F48A 3K0XA 2NO0A 5CLQA 4JL5A 2A7QA 2IYYA 3TR0A 1W4BA 3PENA 1EFTA 2J0UB 2NO1A 3MMPA 3GCGA 4JVNA 4GL2A 4JLVA 4GLAC 3CCQA 4HLUA 1GSIA 4HAXA 2JJQA 2QEXA 1K9MC 1G3UA 2G88A 3IDQA 3IO3A 2E75C 3NHAA 5F9FA 1UPTA 1QHHB 1QBKC 2GBLC 2BCGY 2VP6A 3Q5EA 1XTJA 1N36L 2BA0A 1N2CE 1YZTA 1PMRA 3KB2A 3K9GA 3W8RA 1FQKA 1L4YA 3ZQ6A 2BMEA 4JCVE 3R9WA 5G3ZA 3ZIAD 2IEYA 2WHXA 1FGUA 3AF0A 5CJ2A 2QGQA 2XNDD 2JEBI 4G7OC 3RS4A 1GWNA 2W2TA 5M3FH 1NN0A 4BZPA 1LW7A 1T3HA 3CUEF 2J0UA 2VZAA 4HSEA 4B43A 2KCTA 4OWTB 3AUXA 3P4YA 5J47A 4DT1A 2E9SA 3WNBA 3K0AA 1W47A 4NCKA 6Q21A 1A62A 2WWIA 3DPUA 3E2IA 3RSLA 4RZXA 1SQ5A 5E7IA 5K8TA 1Y1WH 1TQ6A 2UXCQ 4TL9A 3UATA 4D0LB 3ADCA 4DV5Q 1QHHA 5IYDG 1O7IA 1ZCAA 1VCNA 1R9TH 2IT1A 3HOXG 3TW8B 3Q8XB 1JXMA 3BRWD 5GAGC 1B9NA 3RN2A 4Q4JB 1E9FA 3MWKA 4ZPXA 3FHCB 2WAYA 4PAOA 4TL6A 4CEHA 1E2DA 1GHJA 2EJGC 3UDIA 2ZM6L 1E2QA 2GETA 1DG1G 3U3MA 3H86A 3U7HB 2XXAB 1J99A 2H57A 4AQYQ 1OLOA 4P4SB 5HE9A 4JBJA 1JJ7A 5JEEA 1Q22A 3VAAA 4GS3A 1XTKA 4A3JG 3A8JE 4R1JA 5H1YA 4DCSA 2NZ8A 4MKGA 5C3EH 2Z4SA 1OB5A 1VG8A 3LV8A 2K5NA 3BBPA 1FQJA 2A5DA 3K7AH 2BMFA 2H1LA 3MAAC 1VQEA 3R7WB 3GD7A 1G7CA 3S16H 1O78A 2NOAA 2WV9A 2OAP1 2KA7A 1OXXK 3S14H 3N5CA 1J5EQ 4KYIB 4C0KA 2UUCL 3OESA 3EZ2A 4BFTA 1JB7A 1K8OA 3NIBA 4HR7B 4NU0A 4IPHA 3VR1A 1RRGA 1KAWA 2QTVB 2JQOA 5EZ6B 5FBQB 1NLFA 2W2XA 3AVOA 5AK0A 2XXAA 2QF7A 3MWYW 1JNYA 4DR4Q 1II9A 3CCMA 1PLJA 2ECKA 3B9QA 3KXLA 3PFIA 1ZD1A 4LRWA 4NYMQ 3DEFA 1XNRL 1RIPA 2WPDA 1LABA 2DFLA 4A3KG 2DHRA 4MRSA 4XTCS 1YR9A 1KMHA 2VLIA 1SXJC 3ZDQA 2IY5B 5BQ5A 1SKYB 4DLTA 2F9MA 4TTRA 1Q90A 1U9IC 1VQ5A 2QMHA 4OYHA 3AFPA 1N6IA 1LY1A 1N5JA 3RR5A 3JAMc 2DR3A 4LF4L 2QY9A 4X65L 5EE9A 3I72A 4V0MA 2JLUA 4HLDA 5JJLA 1CXZA 1NVWQ 2F3RA 4RD6A 1E2IA 4JK1C 2FNAA 5CIWA 3M4QA 1KK1A 1VQFA 1HR0W 1OXUA 1MO5A 3IQXA 3P27A 2ZANA 4URWR 3SFZA 1W7AA 4NONA 3RRMA 1DAKA 3SGIA 3FMCA 4YHHQ 3OE7D 3IGFA 1W48A 1A5TA 1NVVQ 2VNUD 1E1QA 4PPQA 1FUUA 3LBHA 4UKDA 3ZJYA 2AK3A 5C4MA 1K8RA 1GZSA 1TKWB 2W00A 3E5HA 5TDHA 2Z83A 3DMDA 3BFXA 3FYHA 4RZ2A 3B6YA 5C4XG 4UNPA 3B85A 3N2EA 5TXGA 1WBBA 3GLHE 1HR0Q 3CM0A 3LD9A 3GQBA 4GPTA 1E24A 3I7FA 2DUDA 4M22A 1ZM2A 3DKVA 4GNXA 4PHGA 4RFVA 5JHGB 4I1UA 4LV5B 4DB2A 4G3XA 3WHKA 1YZGA 5M5YH 3ASZA 2F55A 1HT2E 3C5CA 1X3SA 4TMXA 3MXNB 4MTNA 2REBA 1HE8B 2V7QD 1AE3A 2P5SA 4KKTA 3P20A 1AS2A 2VSFA 2A1AA 2ASBA 3ETLA 2AX4A 4D80A 4F4CA 1UWVA 3IHWA 4KI0A 3FMOB 2F52A 3TQFA 2I1VB 4KU4A 4B73A 2NZHA 4DV7Q 1E96A 3PV0A 4BY7H 3DVLA 4MRNA 2FZ4A 2E87A 2X1VA 1XXHE 4X8HA 2Y0SG 5M3FG 1U0HC 1ZNZA 4ZV4A 1XMOQ 2A6ED 4L8GA 4BLRA 4EFNA 3BFVA 4BEJA 1JR3E 1ZRHA 3FHOA 3I32A 3QENA 2B7CA 2PI2E 3UWKA 4B74A 5ELXA 4DCVA 1YZNA 2RGEA 4LC0A 3LBNA 1Y1WG 3CCVA 5HZKA 1IW7D 1G8YA 2DWQA 4HB0A 4ZI3A 2F3IA 4PANA 4F93B 2E76C 5AUOB 4PAMA 1XCGB 2PZEA 5CM8B 2GAAA 1VQHA 4U00A 4CIDA 2CCZA 2Z6VA 3A7AB 2XTNA 1TEXA 5FR1A 1Z0DA 2AUJD 4UQOA 3SFVA 4QOSA 4KVGA 3RZDH 3KFXA 4KAXA 5C18A 2PLFA 4A82A 2MSDB 1MOZA 2CDNA 3GJ7A 1VMAA 1GG2A 3IIJA 1GKYA 1XNQQ 2PZFA 5IK2A 2ZT9C 2B63H 2R6DA 3NHBA 3AF1A 5C3EG 4B71A 1D9XA 4Q9LA 4HUTA 1E0KA 1TU2B 1XNJA 3EWSA 1OE0A 4DLUA 5GAEC 1XX6A 1AA9A 3B9PA 1HZCA 4B3ML 4ZKDA 5DSZA 5IT9c 4DC9A 3I5YA 4DR1Q 3R9IA 2ZM5A 2CCJA 4KITB 3S1AB 3LDAA 4TYNA 5EJEA 3NH9A 4LYAA 2WWFA 4BLQA 4B3RQ 2UXDL 1Q7YC 3CAMA 1W0JA 3BJUA 1EYGA 2BH2A 1PYSB 3I55A 1E2WA 2HLDD 2RGXA 3GJ8A 3IPXA 2XX3A 1HH2P 2H17A 3ZS8A 4DLZA 1RRPA 4GZLA 3HPRA 2RHQB 1JPJA 4KHPL 3REFA 1DARA 2NIPA 1UKZA 1I6VC 2AWNA 1W4AA 3T1YQ 4N3NA 2YOGA 4MKHA 4P4UA 2O8FB 3ZZUA 1ZKOA 1KJZA 1KMQA 1OSNA 2QT1A 5LMNL 3NE5B 3EAQA 5M3MH 3PVSA 4IDHA 1XPOA 2NZJA 4WW0A 4LJYA 5IHPA 4NMMA 3U6KA 4A93H 2YJTD 2ZRNA 1RE0A 2A5JA 4IPGA 2ZVPX 1AK2A 2ZYWX 5EXSA 4TKOB 3S1AA 5FH9A 4JI7L 3CC7A 3CLVA 4LF9Q 2C9YA 2KHJA 1NJGA 1VG9B 2V55B 2WWHA 2B92A 3VNUA 1K0RA 3TK1A 1LNZA 3RS3A 4OQXA 1UEBA 4BXXH 2LWIA 4DNTB 2NTYC 3TRFA 5L3SB 1T91A 3K9HA 2CVFA 1CKMA 2B8WA 4DVGA 2HIVA 3CR7A 1IBKQ 1G16A 3RS7A 2GF0A 2OG2A 4Q1CA 3UG6A 1ZINA 2JLWA 2O8FA 2UXCL 1IJFA 3GMTA 3CX8A 4DV5L 1YE8A 1YZ6A 1FZQA 4HIDA 4HI0E 4I1OA 4DHEA 3ZVNA 1E69A 4MUBA 4EPXA 2Y0SE 1II8B 4A8JC 4RCZA 2OCEA 1V43A 2R7ZH 4BFUA 1GL6A 2GCOB 3QF4B 5CB6A 3QVVA 1QZHA 2N46A 3H0KA 2WAXA 1NSTA 2V54A 3B7GA 5L3SA 3QIAA 3A1TA 4TTPA 4BLTA 5HTKA 1KNQA 4IXNA 1BBWA 3VR5A 1OTCA 4B44A 1E1TA 4M1YA 2OTJA 2PCFB 1IYVA 4PPGA 2WB1G 3QXHA 2WPDD 2C95A 4NYIR 3RC3A 1WMSA 5K8IA 3KFUA 1UBCA 3WRYC 1G64A 1J5EL 4HB3A 721PA 2OESA 2YOHA 1Z29A 3I4OA 4DR3Q 4BY7G 4HDCA 1II8A 4P71A 2ASEA 4X62Q 3HR8A 4GOJA 1AGRA 3IBYA 4BZXA 5JLJA 2PL3A 4LBWA 2GCOA 4B3TQ 1IBLL 3ZVMA 1CU1A 2VHCA 2V3CC 4XVUA 3MWJA 1JXOA 1D5CA 1VQMA 1JPNA 4DR4L 2IBMA 5H8WA 1E2GA 3KF8B 1Z0IA 1H9KA 4MKIA 2P0EA 4HJ9A 1SVKA 1EFHA 1TWGH 2I4IA 1B23P 3PO2H 4PFSA 1M7GA 4DSOA 4G0NA 1C9OA 5AUQA 1HCZA 2QA5A 1HZAA 1N34Q 2FMXA 1PH5A 2HJGA 5DYIA 1P3JA 3SOPA 4B3BA 1G9XA 3NBZC 3FKSD 2QZ4A 1Z0JA 3CF5A 2J9RA 1X86B 5EAYA 4JI5Q 1ZIOA 1ZNXA 2YWFA 3AKEA 2G77B 2CWPA 3M7NA 4XJXA 2GHIA 1BIFA 2B63G 2EQSA 4CEIB 1CFMA 1KO8A 4XTRA 1VQNA 1SN8A 4YHHL 2MMCA 2WOOA 3KB1A 1A6XA 5FTJA 4OJKA 2G83A 3WHLA 1W2BA 5JS7A 5SZKB 4DK6C 3OEED 4PR0A 2F9LA 1BMFA 1KSHA 5GJVC 5JS8A 1UE1A 1G51A 1E2MA 5EP3A 1Q46A 2MNAA 3CBQA 1Y8NB 1MH1A 1QVCA 2OFOA 2ZI6A 4LCBA 4JI0L 4MA4A 1UKVY 1ZVQA 1HR0L 2UUAQ 1Z3IX 4KCGA 4KYUA 1ZBDA 2OCYC 3JC66 4B2PA 1ANKA 2QU8A 2AK2A 4PXAA 1E0SA 1G3RA 3ND9A 5IDVA 4YXWA 4JLPA 4JI8Q 4P32A 4A2QA 3E1SA 1XBTA 3FPPA 3MD0A 3MG9A 1P75A 1FVIA 4IOJA 2ZRLA 1P2UA 2BJWA 3L82B 4KFSA 2X19A 4NH0A 5GJWC 3OOCA 3LA6A 4ZCLA 4XD7A 5GVRA 2Q6TA 4ESHA 3O8BA 5M3MG 1Q86C 1HZ9A 1VQ8A 3KJIA 3RWMB 4A93G 1Z22A 4R9UC 1M74A 4TQAA 3VU9B 1G291 1E0AA 4S35A 4IKEA 4DV7L 3S17H 5DHAA 4PHFA 4B6FA 2JIZA 3GLHB 4IFEA 1WYDA 2VHUA 3T61A 4A0GA 3FTQA 4NCNA 4TLAA 4F4JA 4MRVA 4O25A 4BXXG 1ZC4A 2ZTSA 3GLFB 3C14C 1KZGB 4CYMA 4CGZA 4YY3L 2EYUA 2WB1E 4ASUD 1K6MA 1U99A 4DSUA 2JASA 4KLKA 1R5BA 1KSFX 2FF7A 2IHBA 1PYBA 1PH3A 2PCJA 3LWNA 2J45A 5IK2D 4KSBA 4Z1MA 3IKJA 5CB8A 1FYCA 1NP6A 3SYNA 1Z7TA 5LD2B 4JLDA 4KKSA 5IF9A 5EP1A 1N6LA 4DAYB 2JLRA 3NBXX 2ERYA 2Q21A 2PEZA 4QRHA 3KLRA 2CCGA 3SR0A 3D4RA 2CL7X 3T1HQ 1NF3A 2R7ZG 2KBEA 2EWVA 3AUYA 1LS1A 2QNRA 1KNXA 2A68D 4LYJA 4IJMA 1GIAA 4LHVA 2UKDA 2NO6A 1ZNWA 4M21A 3KQLA 3CPFA 1IXSB 1XNQL 2R6FA 1KXLA 2YHSA 4OWXB 2R62A 3OYYA 4LF8Q 1NG1A 1P5ZB 1DAEA 2A6HC 2WKPA 2XSZA 3BIFA 1YR6A 1T8TA 4QGFA 4EFMA 2WWGA 5F2EA 5KPJA 1S4QA 1LVGA 2ZRAA 4Z8XA 1K3RA 1V8QA 2BEJA 4X66Q 3LXXA 1HNWL 5FOSA 4UP8A 1EFRD 1JEDA 5TMPA 1IN8A 2VSXA 2RF4A 1KOFA 2FA9A 4P4TA 4IFDJ 4B3RL 4EPYA 2ZUBA 4PO1A 1AKEA 5GQOA 1UFQA 3LRPA 2FFQA 4NE2A 4NYJQ 4JI6Q 2V4DA 1Z8FA 1VQCA 2B7BA 1KI9A 2DWOA 1LB1B 3K9NA 4FINA 1IOZA 4LHWA 5CJPA 1T9HA 4PV1C 2RGNC 4APVA 2J46A 3CC2A 2CJWA 3J81j 2YZ2A 3A37A 4GP7A 2N78A 1KRTA 3PO2G 1DVRA 2RGCA 4TQUS 3T1YL 1TTTA 3IIMA 4L5SA 1XZQA 3NBHB 2CQOA 1OKKD 4UXHA 1G3MA 4PO9A 2G9NA 3BWDD 3QNUA 2JA5H 4IOMA 3U5ZB 1MO3A 3NEJA 1OXSC 5F98A 5FBVB 1ESNA 4ME3A 2W6JA 2WMNB 4H13C 4IDNA 3AEZA 1XF9A 2UUBL 1SVLA 3TR5A 1GM5A 4AKIA 3A1SA 4P31A 3TAUA 2A3RA 3NDPA 5H70A 1BKDR 2UU9L 3EW9A 2CL6X 3FHWA 1ASZA 1N5KA 2IF2A 1IBKL 4URUR 2RKOA 2ZTCA 5EE3A 3I92A 1HY3A 1W36B 2WWYA 1SLJA 3CNLA 4IHQA 5DNYB 3GJ3A 1WI5A 3W3ZB 4HIMA 2HV8A 5IRCD 3CH5A 1P16A 2F4VQ 4C9BA 3CRW1 3HWSA 2VS1A 2JLYA 3UPUA 1GKUB 2ZIAA 2C98A 3DO6A 1IN4A 3J7A5 2K5UA 3VX4A 4AKGA 4C0JA 4QM6A 3EG5A 4DB4A 1SMYC 3OIVA 2ATWA 2JA7H 4Q4AA 3SI7A 2ZPTX 4WXRA 5JEDA 1JALA 4B3CA 3I56A 1E2FA 1ZU5A 2H92A 3HOUH 1H9SA 1HJPA 5FTNA 1NSFA 3SU8A 1FUKA 5DGXA 4P73A 3Q5DA 5EQTA 2EDGA 3BH6A 4M0LA 3A8TA 1ZUNB 3AEVA 4OL0A 4IEIA 1GAJA 1FOEB 1NJFA 1SVOA 2IHYA 3EA0A 5FPTA 5JFGA 3U7FB 1COWA 3A58B 5C2JB 2K50A 3IHLA 2B6HA 2XB2A 3R8CA 4D2IA 4X62L 2XAUA 4BLSA 3QSYA 1ZNYA 4NB3A 3P1JA 5KPDA 1FTSA 1NG9A 3M85A 2CHQA 1QDEA 3DZDA 3THYB 3B1YA 1RRCA 1BS1A 3PCOB 2PMDA 1A2BA 3QKUA 3UIEA 1YEZA 1IN7A 1C1YA 4OQLA 4C0SA 3LQQA 2IXEA 1LS6A 2H5XA 4WOPA 221PA 2AFHE 2ZU6A 1CKEA 5E7NA 2AR7A 3QKSB 2UUCQ 1Z2CA 4PC2A 1US8B 3TSWA 3CF0A 2KCCA 1XU4A 2VW9A 3GPLA 2BEKA 1EQRA 1LTLA 2EFEB 4NL4H 4B2LA 4KN4C 1GUAA 5L8VA 3AVYA 1TU4A 4MQBA 4YDHB 4QC2A 4JBMA 1OW3B 3K70D 1WBDA 3TQCA 4JI5L 3W9YA 3PUXA 4TT3A 2RGGA 3K70C 1P61B 4B76A 2DYKA 2VP5A 2VUMH 4JBKA 1P4SA 4DKAC 2J0VA 2BE5C 3AH8A 4ZDKA 1JQLB 1KTVA 1QVRA 2C03A 3VHLB 5DYGA 4C4PA 1D7QA 4S2EA 3GTGH 3AKDA 3L7ZC 5IWAQ 1OFTA 4GMXA 3QKSA 2L15A 4LPSA 4LF4Q 1US8A 1JJCB 3OFND 4X65Q 5C0XJ 1U8YA 4ABYA 1HYQA 2QAGC 2LMCB 3RS5A 1PUIA 3ZD6A 2P67A 2ZQ5A 3SQWA 2FXQA 3QF7A 1BYUA 1G21E 5JHHB 4CW7A 2QSZA 4K81B 3L0SA 2CEAA 3TQYA 4GKKQ 1JJGA 2C35B 2UUAL 2GXSA 4NXNQ 1NIPA 3JZAA 2JDIA 5FJ8H 1XFAA 2JIZD 2FEMA 1A82A 2QSYA 1SMXA 2FE4A 1F60A 2P2LA 3U44B 2BDOA 1HQMC
chains in the Genus database with same CATH superfamily
2ZI3A 2OF1A 1P4RA 4FUTA 1G0NA 3FUVA 1HTPA 4A3IH 1OIWA 4EI8A 4RF4A 3G8AA 1II3A 1XDWA 1VMDA 1Q19A 3HM9A 2C9DA 5CT6A 4EMUA 2WIGA 2H00A 1SK9A 2WKDA 5C5EA 4RXTA 4YECA 1NUAA 1QHEA 4KQ6A 5M5YB 3LVRE 1S9DA 2JA7G 1EIGA 3UTCA 1OAAA 3Q3JB 2DC1A 1GUOA 4UE6A 2BF7A 1CUYA 4CUKA 4Y52H 4MJLA 4ZYTA 5DLPA 1KQFA 3CIFA 3EFOB 1KO1A 3IUYA 5DNFA 1WVGA 4K6HA 3SS7X 5JWHA 4XFJA 4ZYLA 2WY2D 1DAFA 621PA 4Q6WA 1IXRC 1PH6A 2O20A 4LUCA 2ORIA 1X56A 4UMVA 3NBUA 1XRSB 4DIFA 2IXTA 4ENSA 1P3DA 1TUGA 4K46A 4Y9SA 1N0VC 2C7BA 3TWOA 1UOQA 1N78A 4JR2A 3HJFA 2GI4A 5EFOA 2OCAA 3TSAA 2WQ7A 1Y1QA 1GT91 2RH5A 4LYFA 3H3VI 5LUAA 3R5TA 5BSKA 3IAS1 5EP2A 4AG6A 1FXUA 2WW8A 2JSOA 5ICSA 1KMCA 1BJRE 3HA5A 3ELDA 4DDTA 5A02A 5GONA 3IODA 3CXRA 4HSVA 1WXHA 3HOZH 2O57A 3EOBI 1PN3A 3KHKA 3R7SA 4IIHA 4DV3B 5JNSA 4PO8A 1Q3TA 2QENA 1K2WA 2DQZA 4MWOA 3CVUA 3P9XA 2ID4A 1JMCA 1NY6A 2X2OA 3U80A 3TKAA 2PKYX 4CE6A 4EELA 5CM2Z 2J0EA 3LPDA 2C5HA 2QBYA 1J7KA 2WTBA 5IUJC 5A9SB 1N8KA 5JAQA 2Q5QA 1WV1A 4U7WA 3UZUA 3IV9A 1BXRB 2P0YA 3DUFA 5JBNA 1MJHA 2G9VA 2X9VA 3F97A 5KHAA 3GT7A 3UPDA 5BXYA 2R00C 5KNBD 3GEMA 1DJMA 3CKYA 1RD4A 3UJ8A 1S3OA 4RV9A 1L5MA 4KQ2A 1XQ6A 1TMKA 3SM3A 2W42A 3CZPA 1RQLA 3KHUA 4DS3A 4DPLA 4B3SL 4YEDA 2PAAA 4RUKA 5C8XA 3PJGA 1Z5OA 1LI4A 1HGXA 2O8BA 1N7GA 3WHPA 4NTZA 2P3SA 5B1DA 1LPSA 3MOSA 1DCFA 3MJ4A 5B3JC 3LVBA 1YAJA 4JLAA 2D7CA 3WK7A 5KVVA 3STUA 2M2LA 3U3DA 2B7LA 4R1SA 2GN0A 5IP9H 1B0AA 3CW9A 1IY8A 4KP7A 2WICA 3GVXA 3UA3A 1XKTA 1FJ2A 4ZUJA 2ZI7A 2WVGA 3KDSE 2R0QC 1YDMA 3ZX5A 4E6PA 3REOA 4DMMA 4OQFA 4L27A 1FYXA 3U49A 1JHUA 1Z28A 1Z07A 3QE4A 1W8DA 1ADBA 1OR8A 2VHEA 3KEMA 1BCSB 1K1EA 1ZG3A 3QMPA 3BD8A 3MD9A 5HRAA 4GVLA 1NN3A 1HT1E 3N2ZB 4HH0A 4NESA 2ADMA 4RXUA 4K9RA 4I4LA 2PLAA 1HLDA 3CF2A 3S28A 2GKOA 2JFWA 5HJ2A 2WJVA 2WKWA 4YMUA 3H2YA 1DRUA 3QOXA 2IYQA 2ZSAA 5JAOA 5GQSA 1W0KD 3DLPX 1K8GA 1DOKA 3HABA 3O2JA 4HAYA 3GLGA 1R6TA 4NW2A 3MEFA 1K5DA 1P73A 4OJMX 3QITA 4ZALA 5EJMA 1DDOA 5B37A 2C2KA 2QMYA 3R7LA 3IVAA 1T15A 4DQUA 2PXHA 1PQWA 2CLCX 2Y3IA 3GFOA 4JP5A 1CF9A 1IHOA 3SBDA 4JV5Q 2XE4A 3G5MA 3AIIA 4F21A 4GF5A 2EYHA 4G5XA 4PLZA 2Z8XA 3TPCA 3ZW7A 3SHLA 1CJUC 3M33A 4KK3A 2WJZB 1ZL2A 5JAIA 4P74A 4BNMA 1LVHA 4LW1A 1GVPA 3CR3C 1XVIA 4QEKA 1IIRA 2BBTA 4U5XA 1TS2A 4Q47A 1E1RA 1AXGA 2R8PA 2PX4A 4O4HA 2FR8A 3V7UA 1X7ZB 1Q20A 3KDPA 1RAFA 4DV2Q 3WWVA 3ABRB 3I1FA 3GV0A 5CK4A 1ENZA 5EPEA 4F9GA 3OCWA 3BERA 3LPMA 5DNVA 2HQOA 1RLOA 5KWSA 4E5SA 3CO0S 4LHEA 1H9AA 1LTKA 4WADA 1WTRA 1OH8A 1FZTA 1VSQA 3DD1A 2P6NA 1YVDA 4QAJA 3JAKB 1Y9ZA 3EH1A 5EJ2A 2R96A 1ZKMA 4ABTA 2MSWA 4OUDB 3W2IA 4PY2A 1RQ7A 3PTLA 4X1YB 4JI1B 2FZ5A 4C3HG 2ODBA 2UZ4A 1KI2A 1TLLA 2RE8A 4O02B 3KLOA 1LM0A 4H7EA 2LFNA 1X9NA 2Q6VA 4DR5B 1CS0B 5ECYA 4MIUA 1SU6A 4XXEA 4YV7A 1FP4A 1W87A 2C5GA 1F2YA 2IUFA 3IT1A 2JCVA 1HQKA 3OOWA 3TZDA 2A8VA 2NQ2C 2OHFA 5DX1A 3T3DA 1X3QA 4XD7D 2X1HA 2I78A 5KYWB 1GPUA 2DJGC 1R2QA 4IUPA 4LGVA 3HMQA 1Y34E 1CT9A 4I9GA 121PA 1WP9A 1NTGA 1NYQA 2PMZB 4UDXX 5B2EA 2QZSA 1L0WA 4Z1MD 1YIDA 2UXBQ 2IYFA 4C7KA 3PQ7A 4TZ6A 3CGGA 4POOA 1MNAA 2GD0A 3NNNA 5ES4B 3OLQA 1HSZA 3ELWA 1OB2A 2GK3A 3TG8A 4JB8A 1NLMA 4K0RA 3OEHA 3IO5A 1VPWA 2WJPA 2V1CC 5DB4A 2I66A 1M76A 1YBHA 3SR4A 2VH2A 5FP0A 1WCMB 4PX2A 2P9QA 7AT1A 3NKFA 3SJ7A 3CLSD 2ILVA 4EJSA 1UMCB 2CNLA 3I39X 4B47A 4RVHA 4HBGA 2F1MA 5BVHA 1GNRA 2JAXA 3U1TA 4DMRA 4V03A 4DV0Q 1F0NA 1ICFB 5AK3A 2XVAA 1ABFA 3AB9A 4TUYB 4DDVA 4O3FA 5LBIA 2JK0A 1KFBB 2CYCA 5I2YA 2RHGB 2FMUA 2O8EB 3GA5A 3K9BA 5KS2A 5B7PA 4JUIA 3ER9A 3G5UA 1NBMA 1CZWA 1JXAA 1QZXA 1VCOA 1LF0A 4ONEA 3GLGE 1PDOA 3M6VA 1ZSNA 1NUCA 1E3IA 3T9DA 1Y5IA 4AUEA 3NUGA 2J31A 5AJHA 2OR3A 3I45A 3AO0B 1XTUA 4M3NA 2AQ3B 4LF5B 2DQKA 4JJZA 4ACBA 3PRHA 1I4DD 1MOPA 5IW8A 4MR7A 4LJZC 2ATVA 1KFKB 4JUCA 1T43A 4HD8A 3AHIA 5AVTA 2WSMA 4L0QA 2Z6QA 2WBLC 3FB4A 1E62A 1TZBA 4V0OA 2OBNA 1TPYA 4P4SA 1H5UA 4HUQB 2AZMA 2L69A 1CIJA 2B69A 1NQXA 3B2QA 2V6GA 1ZONA 1G8MA 4A3DH 1T36B 1SE4A 4FDBA 1G8JA 2Q0XA 1QF9A 4H7HA 1Y4ZA 1RBMA 4R2KA 1S1CA 1W35A 4RD4A 4KTTE 4OQQA 5LCXA 1E79D 3KJOA 4RHUA 1U3UA 2FW7A 3DBOB 2RGDA 4LWQA 3Q85A 2HIXA 4FFLA 1VQ6A 2AG8A 5BUSA 1TECE 3E8XA 5ER6A 5KAPA 5BV0A 3O3CA 5B3KA 4N54A 4R4OA 1ODIA 4ARBA 4BBSH 3JQFA 5HQ3A 4HJ7A 1LA2A 5FD8A 1LZLA 3ENNA 2CXHA 3B1VA 3HOVB 3N3BC 5TC4A 1RM0A 3PUKA 1CUKA 2A1TS 3C43A 3LS2A 4KK4A 4JVSB 3BGDA 4A92A 1EP9A 4LJRA 4H6VA 2VSNA 4YUZA 3JYHA 3ECAA 3THWB 2BM0A 3V9AA 2XMZA 4ND8A 3HCWA 3CMCO 2ACEA 2P5ZX 1GTZA 3CRLC 5EC8A 3DLHA 4C7BA 5JRDS 1PWEA 3C6YA 3LWEA 3CH4B 1ONOA 3PC4A 2IV3A 2XJ9A 1E7SA 4M0FA 3WSWA 3X3NA 3CLUD 1YQUA 5D65A 1EEID 1OKKA 1QKIA 5IAJA 4LTDA 5LD2C 1DKRA 4Y7NH 1M0WA 2Q0HA 1J9ZA 1XD9A 4AYBG 2HF7A 4CM4B 5L4LA 4I19A 1G8GA 2V3WA 1L4BA 4QIWE 1H9JA 4YDQA 1XO1A 2P11A 4RPJA 3HK2A 5J2UA 2ALJA 1WPXA 1UK7A 3D64A 1JHXA 5IJ0B 2CSUA 3F96A 2DFPA 5A1TA 4HNUA 5L4SA 4M7OA 1OBHA 5IS2A 3WOVA 2JEYA 4LF6B 3VC2A 2N47A 2ODAA 1GGJA 3LYUA 2PS0A 1VL5A 4C3JB 2YNMA 5ELNA 1KIAA 1O96B 3ZS9A 1PTOD 4YJFA 2PGJA 4XT1B 3JTEA 5K3BA 3RSHA 4LSGA 1E94E 3U1VA 2VHTA 2OZVA 1JHOA 4PMWA 4UC0A 5ICFA 4A3CG 4KQHA 4GP6A 4BBRB 4GAEA 3I4NG 1QG0A 1NR1A 2ETVA 4QZVA 3RVDA 2R92G 3MCUA 3W6ZA 1AGPA 3OY2A 4BN5A 1XMOL 4MRPA 4FS3A 4HH1A 3OJWA 3RTAA 2IE0A 3IE1A 4TT8A 3FDTA 1Z73A 4XYQA 1EFKA 2BUBA 3K5HA 3D8NA 1GZ4A 1NBME 4J1TA 4RK7A 4LX0A 4D5EA 3GV3A 4F91B 4DK0A 1VJTA 4ZAGA 1DJLA 3WKEA 3KTFA 1IZ0A 2JA6H 1UJMA 4FYDA 2H48A 1PZEA 3WYDA 1XV5A 4DSNA 4UMFA 3B53X 4CKXA 2HWXA 3GTOB 1RT9A 3DKIA 4C56C 4FHGA 3K4QA 1C48A 3L79A 2QMEA 5ALSA 1Z9BA 3QLUA 2ZYAA 3I70A 4YP5A 3ET5A 1X15A 1IQRA 1STGA 1GARA 5DBOA 4QASA 1YB5A 3MWDB 2HXYA 1F06A 1RJ9A 4OCZA 3ZYCA 4QBGB 4P3KA 1WB9A 5LLTA 2BMJA 2V4ZA 2V6MA 2J41A 3THSA 1WY5A 3X2FA 1XMJA 4B32A 3I2IA 4H4EA 4YRTA 4C0BA 1K3UB 3D6UA 4DIMA 4CVNA 1C9DB 3K09A 3IJRA 1EOVA 2BAGA 1ODFA 4A36A 3PEFA 1XRMA 4YLYA 2F3WA 3JWIA 1QK3A 4M55A 3S14B 4GWKA 3HCEA 4DV6L 2WIAA 1HQYE 3UJBA 3GFTA 2OOSA 2BE9A 4EQ5A 1QE6A 3JQ9A 4MGEA 2IXDA 3JASA 4Q03A 4QXPA 2F3VA 3HOXH 4JT8A 2CUNA 1WTOA 1VMCA 4O4HF 4FFVA 5T6MA 5DIFA 3EF1A 3QTLA 1G2SA 2GAJA 1X1QA 3H3VC 4OQDA 2WOJA 3N8GA 2CKZB 1G7TA 1KOGA 1TQ4A 3HOYG 1QH9A 2F1JA 3TVYA 3ZOKA 1JKJB 4LFAL 4E2FA 2C4WA 3GJZA 4CMIA 1LPNA 2KLHA 1GGNA 2CNBA 4KL8S 2YJ4A 1RZ3A 3R09A 1WSWA 1EEFD 1RMYA 4EHLA 4EQ6B 3IXLA 3NI2A 4HLQB 3UT0A 5I48A 3RMHA 2FSHA 2TS1A 1ZN7A 3GTLB 2IEDA 4D6XA 2WJAA 3A6LA 2B63B 4O4JA 1P1CA 4GL2A 1VXRA 4GLAC 1LLRD 3WB0A 1K9MC 2J9XB 1L5GB 2QX6A 4R7GA 2OGUA 1FQKA 2ZWPA 4OHKA 1WTXA 1XZBA 1F2MA 1YFJA 4ZI7A 3UJPA 4L22A 1Q7GA 3RN2A 4ZPXA 1GHJA 4PO3X 3UDIA 1K8ZB 5I9TA 4IXWA 3U48A 1Q22A 2QG9A 5KJEA 4DCSA 3LIPA 5B7QA 1EU3A 2K5NA 2PQ2A 4IMPA 4FLMA 2UV8A 2OL4A 4W7HA 4CNQA 2FQQA 3NCTA 3OLZA 4LQCA 5IWCA 4YP7A 3C39A 4OH7A 4ZO7A 1YL6A 1ZD1A 4BZWA 4A3KG 2F1KA 4YA6A 5BQ5A 4RGTA 1SKYB 2F9MA 3E82A 5KYXA 4QOEA 2B9VA 3FPJA 2HDMA 5H9WA 4GR9A 3NUQA 1HOXA 3LT4A 1OXUA 4B5LA 4U63A 3FMCA 3IGFA 2VNUD 4UKDA 1N0IA 3ZJYA 1JDUA 1V1MB 2N9UA 1J5EB 5LQJA 5ITSA 3LZCA 1A8SA 4GPTA 1GQSA 4YT2A 5D6OA 1RAHA 4GNXA 4PHGA 5C34B 2XCTB 4KXNA 2REBA 2IHVA 4HNVA 3IJPA 3TQIA 2VSFA 2A86A 3H1PA 1JS1X 3CEMA 3FUTA 4KOEC 2E87A 3FMVA 4N5NA 4RA9A 5CA1A 1Z35A 1U7HA 2DWQA 5IDWA 3JWHA 4DLLA 4PAMA 1E1MA 4TWAA 4BMXA 5JAHA 4MUKA 1MOZA 2R1VA 2ZUTA 1ZXTA 3B9PA 4ZLTF 1KAMA 3QU4A 2UVDA 2FZKA 4U2CA 4LYAA 3EJIA 3CAMA 5B3AA 1YBMA 1PNQA 4F11A 2XX3A 4JU8A 2O8FB 4N3NA 1ZKOA 2B4RO 4LF9Q 3URKA 1UEBA 2DH6A 3USZA 5L3SB 2NTYC 2FMKA 3TLCA 3PHHA 2HIVA 2ZIZA 2GF0A 3TEJA 2VK2A 4XDZA 1II8B 5EBCA 3MLBA 1ZOSA 1FVOA 3QIAA 1GUZA 5HTKA 1KNQA 1OTCA 1VL8A 1MXHA 2C95A 4QQ8A 1SNOA 1PGOA 2OESA 3V4ZA 3CZMA 4GOJA 2VVTA 1S5PA 4OHOA 1IBLL 4DIKA 5H8WA 4B6GA 2O05A 4OLAA 1TWGH 2I4IA 2C4VA 4XCQA 4AYTA 1HA6A 2QA5A 1PH5A 4AJ4A 3LF1A 4OM7A 4OREX 3C3JA 3UAOA 4WK6A 2EQSA 1GKLA 1SN8A 1E3SA 4GEGA 3NYRA 3B8EA 4O29A 1Y8NB 1FFXA 1NXOA 4DMKA 1GDHA 4X84A 1HXYD 1T2AA 3GEGA 3SYRA 4INZA 4JLPA 1MRZA 4O2BF 1F51E 2X7HA 4IKEA 2YV3A 3C14C 1C2YA 2WB1E 4K8JA 3R24A 1KDZA 1XZCA 3FKIB 2B2TC 1SA0A 2KBEA 3UAXA 4N12A 2YHSA 3OYYA 4JI8B 2QD3A 4UARA 5B58T 3DR5A 1WZNA 1EFRD 1JLKA 2VSXA 4UEOA 4V1CI 1C1DB 1X2EA 1B41A 4LWOA 1LI5A 3X2EA 5JY6A 2A33A 1KRTA 1YJAA 2XWBF 2BLNA 3GP7A 1Y1LA 3H0EA 1XDZA 3GPIA 1CJCA 3MHBA 4MROA 1IBKL 4LZWA 4W9NC 1JQEA 3QPAA 4RO0A 4TWIA 1IBCA 4B0PA 4JROA 2JPDA 3J7A5 1DEHA 5J2UF 2CLMB 1H9SA 3KWJA 1E3JA 4IEIA 1GAJA 3WA7A 3U7FB 1PQYA 1P2BA 1BX0A 3P1JA 1AV7A 1Y1WB 2I9KA 4CM3A 3FCOA 2H5XA 4WOPA 1R4ZA 3V8NA 4DSZA 4YDHB 4TV8A 1K3TA 1Z7BA 2DYKA 1LTID 4B76A 2VP5A 3ZHUA 3ETJA 4HADA 4G0VA 1US8A 1JJCB 1GQQA 5C0XJ 1NM5A 3B3GA 2G7MC 1PUIA 3SQWA 2QZJA 4GKKQ 2Y71A 1H2RS 1O54A 3HGQA 2QSYA 4KVZA 5KX5F 1C7YA 3T9BA 4E03A 3RODA 2JA5G 1W581 1RAIA 3T5AA 1ULZA 1V2HE 2VTEA 1VIVA 4NXMQ 3LWZA 2HLPA 2Z4RA 2PSDA 3TEMA 4D6PA 4JXJA 1B3RA 4WZAA 3VR2D 1JF8A 1E2PA 4D92A 3V6LA 3UMGA 5G4KB 5FWXB 4TGLA 1F9RA 1J24A 2Q3LA 2YVUA 3I6MA 4JB0A 1D6NA 2J9ZB 3L4BA 1BQ3A 1KL7A 3P32A 2WJYA 4QUEA 1AVTA 1L4EA 1UDRA 2JFVA 3NT5A 4IWNA 2J7ZA 4R2IA 2D1QA 2Z9DA 4HB4A 1WXIA 4Y3UA 1XYYA 3ZE9A 1GPKA 4PFJA 1AQIA 3FR7A 3PX2A 3D8GA 3ZQJA 2HWKA 2NPIA 4XH9B 1I7LA 1ZYRC 1AD2A 4WJWA 4MRAA 3G2MA 4RMIA 1Y3HA 3NETA 1XR3A 3ZUGA 3IFTA 4A2PA 4PZ7A 1JFFA 3AUUA 2IHTA 4ER6A 3H04A 1FP6A 3L0YA 1ZIDA 1T24A 1V26A 2FDCA 1HNXQ 4XWKA 1VJ0A 3PEWA 2V5AA 4ENRA 5BN1A 3HJUA 4POFA 1X13A 4DVJA 4WECA 4RGQA 1WLSA 3PGVA 1D7AA 3LCRA 4JI7B 2XOXA 4E22A 4BNNA 2WDZA 1HFJA 3O82A 3FPAA 1X55A 1JJVA 1T2VA 5IWAL 1DINA 1NDHA 5A7GA 1Z47A 3Q0TA 5ISMA 1D2GA 1M2HA 1S89A 4J0CA 1EVQA 3ZCQA 5GOTA 1CDOA 2AFIE 4MWSA 4TVBA 1V0JA 3OPYB 3PJRA 5P21A 2AYZA 1SQ0A 4LOAA 5DOZA 4ZREA 4DBLC 2H9YA 2PRSA 3BORA 4LOIA 2JH3A 3I8OA 4B35A 1OX4A 2B39A 1ID1A 4OQPA 2AJTA 2O2HA 1ML0D 4BA2I 4BCCA 3QTBA 4N5MA 1QS0B 3PNBA 5IP7H 1ICIA 5DW3A 4KWEA 2IJ0A 2Z30A 3K7UC 1G63A 1GPMA 4PC6A 2W83A 2VP2A 3ZD8A 3H9EO 2KOLA 3NALA 3CLRC 3WMRA 5IYZB 5EJGA 1PKEA 4XSHA 3V7FA 4LDAA 1M0SA 4UPDA 2DPGA 3I2FA 3AOEA 4MV8A 5IEJA 1SC6A 4JA2A 4RZSA 3RFTA 2IZ7A 2HQRA 1NJ8A 3QOFA 1SXJB 4MIEA 2GT1A 1S3IA 2C29D 1HURA 4NBUA 3FCAA 3KQTA 1QYXA 1VA5A 1Q8KA 1R8JA 3A26A 4ZI7F 2PSFA 5AW4A 3C97A 4OB6A 3FNBA 5K5EA 5J4YA 2XQJA 2CK3A 5AQEA 1MKYA 4MDYA 5BWBA 1JAXA