4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
3W1BA 3DO6A 3GLGE 2XB4A 4FMCF 4HB3A 1X9NA 1R0WA 2F7SA 1ZINA 2J1LA 2WIBA 5DI9A 4PPQA 3SOPA 1HURA 4M9XA 3VU9B 1UADA 3T51B 4GOPC 4IJMA 1HZBA 2O8FB 3VNUA 2JQOA 3KQUA 2FX3A 5IP7H 4P73A 3P4YA 4KFSA 4A2WA 4CRWB 4YWMA 1PH1A 1ZM3A 5KDLA 5C0XG 3CC2A 3I4MH 4KHZA 2OO7A 3GCGA 1IXSB 4KSCA 2EFEB 4TL9A 1B8AA 2Q9BA 1AN0A 4BZXA 1Q22A 2ZVQX 5B30A 1RVDA 4GMDA 2KWIA 4D26A 1W48A 3KJOA 4ZCMA 2N78A 2HIVA 4ZKEA 3AVWA 1DGSA 5J4VA 3QEOA 1GP2A 3C15C 2KB0A 2LWIA 1UDWA 4RSGA 1G8HA 3BFKA 2B29A 4GDFA 1AKYA 3IUYA 1TWGH 2H5EA 3B1YA 1N9WA 4DR4L 4MYHA 5C0XH 2FN4A 4ERNA 3U61B 1FR3A 1TL7C 5JJIA 2ZS7A 3S1QH 4W5HA 1VIYA 2PJRA 5HZHA 4C2UA 1Y1WG 2K5NA 2HCBA 4IXNA 1KO1A 4PZZA 1L2TA 2WPDA 2E5LL 2UXDQ 2MSCB 3BORA 2WBLC 1XFAA 1YHAA 2WAQG 1XMQQ 2ERXA 2WOJA 3CLVA 4C2TA 5F9HA 5FR2A 3U60B 1PZNA 1VQOA 4LF7Q 2QPAA 1K5GA 2UKDA 4HDOB 5DE3A 1CKMA 1ONLA 2WWIA 1H95A 4IFBA 3G6EA 2EXDA 2K4KA 3HU2A 1OLOA 1G7CA 3RNUA 1N5IA 1X6VA 1Z8FA 3MMPA 5G41A 4X64Q 1QDEA 4QGHA 2ZM6L 3FE2A 2I5LX 3LNCA 4LWCA 1Y1WH 3RDPA 1UKEA 5FBRB 4RKFA 4B34A 2FH5B 4ALPA 3I4NG 1QBKC 2OLJA 2CNWA 1RE0A 3F2DA 3PO2G 4DR2Q 3CF0A 3KTAA 2ECKA 2JLRA 3N2EA 1PA6A 1XD8A 2WPDD 4KLZA 3TQYA 4WXPA 1EWQA 2ZR9A 4ZIRB 1U5KA 1M90C 1NSFA 5H70A 3U9SA 1P2UA 1U98A 2JAQA 3A1WA 5FI1B 4A82A 2N42A 721PA 3KFVA 3PJRA 1IJEA 3AGPA 2HXYA 4LF5L 1S40A 4KBFA 3F2BA 4U02A 4JI2L 3A4MA 1H9MA 4NXNL 1PYSB 1XU4A 1Z07A 4I1VA 2UU9L 4AK9A 4A0HA 5JWRA 5DNYB 3E9HA 1LV7A 3EZ9A 2VSXA 1T3HA 2P3SA 4IO9A 3I4NH 4OHWA 3PO2H 1ZNXA 4MGYR 4Q4JA 4RZ3A 2C03A 2BE5D 3UDXA 4BZQA 3ZQJA 1KI7A 2JXMB 4ITRC 3CUEF 4OHZA 4L8JA 1ETUA 1XNQQ 1HQCA 2CNWD 2IEYA 2H8KA 1UBCA 3QVUA 1KAOA 2QF7A 2F3RA 4P3YA 4RFVA 2IYRA 3I8SA 4GOKA 3IFTA 2ZAMA 1N6IA 3O47A 1U2RA 3U7FB 1SVMA 2V7QA 3FHCB 4A2QA 1E9FA 3AVPA 1HUQA 1K8AC 3NDBB 5CK4A 2A30A 2WICA 1OTCA 3KDFA 3A8TA 4IEEA 4B6EA 4OI2A 3SJZA 4B3TQ 5KSPA 1NKSA 3AUXA 5KNCA 3UANA 4P33A 1G21E 3LX8A 4CT5A 1AE2A 1HEIA 3KJPA 2WB1G 1Q1EA 1G18A 2RB4A 2EDGA 1M7HA 2B7CA 2YWGA 1NMGA 2ORWA 4L16A 3TUIC 1GDDA 3DM9B 1ZVQA 1R2QA 3S17H 3FGNA 1JJ2A 2NN6I 1HQYE 3WHLA 2J46A 3A7AB 4PX9A 2AR7A 4IVPA 4Q4HB 3TZUA 2DBYA 1NI3A 3PF5A 1BKDR 5C1BA 5M5YH 3A8JE 2V7QD 2ZYVX 1AS2A 1XTDA 2ZJOA 3C4JA 4PPFA 1O78A 1EQQA 1PH4A 2MMCA 4WZBE 1DG3A 1Q21A 5J3BA 1Z0JA 3KF8B 1G17A 3ASZA 1QG2A 4M1MA 2GJ8A 4O25A 5GJCA 1UE7A 1KJYA 1UEIA 3LXRA 2GVDC 3TH5A 3K8AA 4BFSA 3J80c 1W0KA 1ZNYA 3PUVA 3GEEA 5JBQA 2FZ4A 1RW4A 3EW9A 2QQEA 1KSFX 3THWB 3SS8A 3IQXA 1WCV1 3FPAA 4BBSG 2ODNA 3H0KA 4G0NA 1TQ2A 3Q7PA 4Q48A 3IEUA 5EE3A 2WZQA 2CHGA 2PX3A 3BC1A 3LX5A 5CDFA 1NG9A 3R9XA 3T53B 3RWMB 4DUZQ 4EPXA 2KENA 3T1YQ 5HGQA 1XTSA 2QNRA 1VCOA 2ZSAA 2IBMA 3JVVA 3IILA 4RD1A 2CW0C 3GO5A 2OSBA 4LCBA 4YCUA 4IKEA 4OK5A 3B7GA 4DBLC 4HAWA 3BDOA 1S1CA 3A58B 1GKYA 1JJ7A 4KFRA 3J7ZC 1UE6A 2DY1A 3DMNA 4QNMA 4BBSH 1A2BA 4A3LG 3SGIA 4Q66C 1BMFA 3PR1A 1I2MA 1HQMC 2QPOA 3CPWA 1UWVA 1DAFA 1JI0A 1TEVA 1U9IC 2QT0A 1G6OA 5A0FA 3DZDA 1AIPA 3GLIB 1G5PA 4QGUA 1YR7A 2EJMA 5CB8A 4A36A 2A5FA 1ZRHA 2ALYB 3KX2A 4V0ME 2RCNA 4KKTA 2EIFA 3QE0A 2ZE7A 1TWAH 3PQCA 2JLXA 4MITA 4EQ6B 3O8RA 1S3OA 5FOVA 1YU9A 4A3LH 1E7ZA 1VECA 1FL9A 1P9NA 3QI2A 4AQYQ 3AV0B 1YKSA 5JECA 2OCAA 5H8WA 1QHXA 1A62A 4PZ7A 1KIMA 4OX9L 1BMFD 3NTUA 4TMKA 5GVRA 4Q7JB 4QXAA 1HT2E 4DV6L 2OEPA 4NXML 3TGPA 1D8LA 2XTNA 1YHNA 3OIWA 3CIOA 1VQDA 4DLWA 1VF5C 3CW2C 4JI8L 1G3UA 1K8RA 1Z6GA 2JK8A 1NMXA 4BRUA 2FEMA 1W4CA 3GFTA 4LJYA 1FMLA 4XWKA 1FVIA 8OHMA 2XTZA 3HYRA 3CWQA 3A8IE 4TKOB 2E9SA 2A1AA 5CK5A 2LXJA 3AEZA 2QRZA 1SFOH 5G3ZA 3TS0A 2FSHA 2IW3A 4MQBA 4DV1Q 2P6RA 3ZS9A 1ZIPA 421PA 3QXJA 2IYWA 1DEKA 1Z29A 3GJ8A 4XTRA 4A3EG 4PHFA 4DR1Q 1P60A 2YYZA 2MSEB 2ZAOA 3MCAA 2EJFC 4IVRA 4KSBA 2ZRLA 4WVFA 4AKHA 3RHFA 4PO1A 3WP1B 4LFAQ 2ZRFA 4MKFA 3BBPA 3QQ5A 2VHQA 1GRRA 1G8PA 1DTSA 2PPBC 1AK2A 1EWIA 1IYJB 5EE1A 1B9NA 5KOYA 1Q8KA 4M9QA 1KAGA 1KRSA 3RLNA 2BMDA 4PC2A 3IHLA 4PR0A 2GTPA 4Q1EA 1ZKOA 4FD2A 4FMDB 3EWAA 2ZEJA 1H9JA 3ZZ0A 1HNWQ 1N25A 3AVOA 1UF9A 4A3EH 3HOYG 1GL9B 1XJCA 2UUBQ 3A36A 5C2JB 4EJSC 4AKIA 1KI8A 4Q9IA 5G40A 1XMSA 4LFCQ 4B3RL 4B44A 5L3SB 3SNHA 4R4OA 1XZQA 3U4VA 3S1RH 4A9AA 1TADA 1JALA 1N2CE 1A4RA 2PEZA 4JKYA 2PEYA 4RCYA 2NO6A 4PSKA 3E0EA 4K46A 2CCJA 4ZDJA 1CR0A 1QVFA 1T5EA 3OTOQ 2FV8A 2BBSA 4NPHA 5KSZA 1E2MA 1Y14B 1IBLQ 2GCOA 3NC0C 4I1SA 4MYUA 4PO9A 4Q4AA 3HOYH 1XD2B 4Q5IA 3RVBA 4RD4A 4S2EA 4JI0Q 1CUKA 1AQUA 3M0EA 3RC3A 1TPZA 1WA5A 1P61B 4FIDA 4X65L 4Q7LA 2OFOA 5FPYA 3LBNA 2ZJ8A 1IJFA 3U6BA 2FE4A 3HKSA 1ZUIA 5DGXA 4B48A 1N34L 3WHKA 4D0NA 4R1JA 3F2CA 3AQ4A 3T1HL 1MJEA 1JEEA 4X8LA 2B8WA 2JJQA 5FUWA 4Q00A 2QM7A 2WJYA 4MGIR 5HE8A 3EA5A 4RD0A 1M34E 4DHEA 4CEIB 2WOOA 1UBEA 1JR3E 4DDUA 1YNXA 3Q5EA 1Z7TA 3DVLA 2G77B 1NRJB 5IP9G 4CEJA 3P32A 3W90A 4BRWA 1AZTA 3NEMA 5AJXA 3EAQA 3ZVNA 3CRQA 1RRGA 2A6HD 2ZE6A 2ZQ5A 1PUJA 4HJ7A 1HR0L 1FX0B 3U6KA 5IWAQ 3QSYA 3ZVMA 3T12A 2VEDA 4URZR 1QUQB 3QKRB 1IOZA 2ZTSA 1PH9A 1A5TA 1SVWA 3OF5A 3HOUH 4XIGS 1KMHB 4V02A 2ZJ5A 2VYFA 3GLGB 3W6OA 3FHOA 3BZKA 1R7RA 3GEIA 2EJGC 2KE5A 1Y69U 1A7JA 1F3OA 3A4NA 3CKLA 3DEFA 1YR9A 5CM8B 1SMYC 5IP9H 1BH2A 5FL7A 3VX3A 4PC3A 2VHCA 1SGWA 5EXXA 3PUYA 5ELOA 4PAMA 1S2MA 2OCYC 3DKPA 1ZYRC 3UDFA 1A63A 4O0AA 2VHUA 2H7VA 3E2IA 3IPYA 4QG7A 5FUVA 3VHXA 2H17A 2QQ0A 3NDPA 1E9CA 4ARZA 3K0CC 3SHWA 3FB4A 1XCMA 2GK7A 2FEOA 3ONWA 1E98A 1HT1E 2JJ8A 4HLCA 4P71A 1X8KA 4OHVA 1DXMA 1LTQA 3NHAA 2HIXA 4DV4L 1F60A 1KO5A 2K33A 3T1OA 2AN9A 4NONA 4P31A 2FFHA 1F2UB 1HPCA 2AL7A 3V4FA 5FJ8G 1XZPA 5FL7D 4JL6A 1OB5A 3L2PA 1BKBA 3NEJA 1PV4A 2XITA 2KCCA 4RD3A 1W36C 3EN2A 4EX5A 4DV2L 1M7GA 4EFMA 4A3BG 5AUNB 3O8DA 2GZAA 1ASZA 3CRMA 1VQHA 2Z0SA 4D4LA 5LD2B 4TYQA 1X8LA 1IBKQ 1YJNA 3FTQA 4IFDJ 3GP8A 1J2JA 2NN6H 3DKVA 4NKRA 3HOVG 2W83A 3NG1A 3OZXA 3TMKA 4DLUA 2XZLA 4GSYA 2W6IA 4YCWA 1EFTA 1LUZA 5FJ8H 1Z6XA 3CO5A 3EIQA 4JKIA 2VZAA 4WW0A 5EXPA 4E22A 5B58C 2J7KA 5C18A 1IN5A 4L5RC 1U99A 1E9SA 2F3TA 5SZKB 1SVSA 3A4LA 4A3BH 4GL2A 1YVDA 4DR4Q 2BA1A 3S24A 2JLQA 2V3CC 1KY2A 4AC9A 4C0SA 4JVMA 1S96A 3H1TA 4FN5A 4GZLA 1Z9FA 3KQHA 2DR3A 1L1OA 1XEXA 2DGYA 5DHFA 3TW4A 1GD7A 2E5LQ 2BBTA 5JEAJ 3HOVH 2PNRC 4NYMQ 4Q18A 3W5JA 4A8JA 2WAYA 3EZFA 3R9IA 2A68C 2R8RA 4LHZA 2ATXA 4C2MH 1QVRA 4DK0A 4NYMR 3PIOA 1SMXA 5M3FG 5F9FA 2W6ID 4GN3B 4X8OA 2F1MA 4IJHA 5BN3A 5KTYA 3AVQA 3RLFA 3NBHB 3QIAA 2QMUA 1Z63A 4TLAA 3X2SA 3JC66 4TSFA 3SYKA 3HR8A 5FTNA 2ZM6Q 2O0KA 2WP8J 2R6DA 2QE7A 4B74A 1YRAA 1EFWA 4AY2A 1K0RA 5AK0A 4BLTA 3GLFA 1PMRA 5KDOA 1VTKA 4HJAA 1CF4A 1Z08A 1Z0DA 3WP0A 2QRNA 1KSHA 1NN3A 1Y8OB 3FVQA 4LK1C 2C9YA 2IYZA 3CX7A 3CZPA 5FOWA 5K8UA 2WJJA 3CRKC 1TTTA 2UXCL 5M3FH 3VKHA 3UG7A 2OQKA 1KDTA 1U94A 2G3YA 3IGFA 3PUWA 2NTYC 1FUUA 3J81j 2R2AA 2FSIA 2ZRHA 2OXRA 3KF6A 2V9PA 4LF5Q 2AMCB 1KHTA 1UM8A 5EUMA 1GZSA 5A4JA 4JI2Q 1GUGA 1NG1A 3HDTA 1CJKC 4NXNQ 1KDOA 4KO8A 3WMFA 5KNDA 5L3SA 1T0JB 1UBGA 4DV7L 1E2KA 1BBWA 4TSFD 2QY9A 1KMQA 2GETA 1OFTA 2JJ2A 3K1JA 1GUOA 1HH2P 2QE7D 3RS0A 4EIWA 2D4HA 3DMDA 4ABYA 4JSYA 2E1RA 3DXJC 4KU4A 3HPQA 3F1ZA 3AF2A 3T61A 2ID0A 4JBKA 2R6FA 4Q9LA 2GXQA 1Q1QA 2WSSD 3AVXA 4WJ3M 2FPKA 1XD2A 1FFHA 4Q47A 4PG3A 3S1AB 2Z43A 1D9XA 3HOZG 3HKZE 3ZH9B 4M22A 3ND8A 1SXJA 3Q72A 2XZPA 2HJGA 3KLWA 3L0SA 4Z1MA 1OXUA 2H18A 5J4LA 5JEDA 1G20E 1FNMA 4HDQB 2G88A 5JRJA 2EQBA 5LBIA 2JJ2D 3MUFA 1XBTA 2REBA 3NVAA 1XNJA 1OFUX 4CEIA 3K9LA 2NZHA 2CJWB 3HOZH 2VIIA 1K5DA 5GAGC 2XTIA 1W7AA 2GXSA 4A3DG 1O7IA 4PTLA 4PV1C 3AKDA 1OHHA 2LKCA 4RJLA 5LB4A 4AYXA 3QJYA 4GP6A 3W6PA 4DLSA 5CITA 4W9MC 1YI2A 1SXJD 1EFRA 1SULA 4Z1MD 2CK3A 4HB0A 5EP3A 2RF4A 2BCJQ 5TARA 1RYHA 4KHPL 1ZP6A 1ZCAA 1W2BA 1COWA 5KNBA 2QI9C 2AWOA 2REXB 4A3DH 4UXHA 4NU0A 1MKHA 3D6TB 4LYHA 3J81i 1II8A 2IX3A 3CC7A 3S14H 3PUXA 4C3JH 4LHYA 3RRNA 4HI0E 1G16A 2F43B 3C14C 1QHIA 4JIMA 4KODA 1FQKA 1NTGA 3VR6A 4JBMA 1OHHD 2PT5A 3THYB 2EYQA 3QKUA 4I81A 5DN6A 2JCSA 1XPUA 2IXFA 4D4KA 1KI3A 4IDPA 4R4QA 1T3SA 2QENA 3TR0A 3ZYCA 3GLHA 1EFRD 2QP3A 2O8EB 4UNQA 2CK3D 1E0JA 3JVUA 3LLMA 4HAYA 2HV8A 2GEVA 2WJGA 5LMUL 3PEVA 3F0TA 1P16A 1YZKA 1E1TA 1YJ9A 5GADl 4QM6A 1CKNB 3RSOA 1XTJA 4C7OB 5D3MB 1COWD 1YZ6A 5EE5B 1KJZA 1F2UA 4JI6Q 2QP9X 2GJAA 4R98A 4II7A 1HZ9A 5E7NA 3VR2A 4WAUA 2E75C 1DAKA 2MFIA 1R0ZA 1MT0A 1EX6A 1HE1C 4FXPA 3GTQH 1IM2A 5DN6D 5GADC 2HHHL 4G7ZC 4BY7G 3NXSA 4OHYA 2EVBA 5IE8A 4A76A 1K73C 4HAUA 4DRZA 1BVSA 1R5BA 2BCGY 3KQKA 4CZ2A 2A19A 5B64A 3HOWG 3F5FA 1E2QA 4LV8B 2REOA 2ZRMA 4P0TA 2GJSA 3OIVA 2GA8A 2ZRNA 2YJTD 3MAAC 3MGCA 4HATA 4HR7B 3G71A 1KDRA 4JT2A 5EXTA 2B63G 2ASBA 1KYIA 1PH6A 1G6PA 4B47A 1VQEA 4AYBG 2AK3A 3DPUA 4OX9Q 4DEYA 1X55A 1E2LA 4DV6Q 5KDDA 3BD9A 1E2ZA 2PLFA 2OXCA 2QSYA 4NXMQ 1N0WA 4DV0L 3LD9A 3VR3A 4BY7H 1AE3A 2EVWX 3ERSX 3PVSA 3CRVA 4EDHA 4JLJA 4JI8Q 1Q57A 1CS4C 2WHXA 1KI6B 2G1KA 2XXAB 4IQZA 3HOWH 2IHEA 1HR0W 4C30A 2PNHA 1J5EL 3NBFA 5JHGB 4TMTA 1YJWA 2DN8A 3I4LA 3BWDD 3EZ2A 3FMOB 5FUXA 1I3QH 2B63H 4I99A 3SI7A 4XOIA 4NP6A 1US8A 4JL8A 4S35A 4NDZA 4LF8L 4B2PA 2O0HA 3D4RA 2CMKA 1II9A 3P20A 4HYYA 1N0UA 1W44A 4TYPA 5FTKA 1Q12A 1H9SB 1SVIA 1EFHA 2QAJA 2AD1A 1WXQA 4C0LA 3AVTA 3HKZG 3MXNB 3UDGA 4X6AH 3CBQA 2QTVB 2NZOA 1QJOA 1VG0B 4BFWA 3A6PC 2A8VA 5C4JH 2PCFB 1NSTA 3E70C 1DS6A 2I3BA 2J5XA 2YWEA 2BM0A 5FBVB 1EIYB 2GRJA 3CCSA 2EYUA 4JJZA 3H94A 1XB2A 4V0NA 4M1TA 1EUJA 4XVUA 4Q9KA 3AB9A 1F2TB 2BIFA 3NE5B 1FTNA 2OQ0A 1G5TA 2OG2A 1KRTA 4LJAA 5IYCG 4POGA 3T15A 1JPJA 4B3RQ 1I2DA 4A3CG 1WDTA 5L3QA 4XWOA 3B1VA 1U8YA 1A8VA 2QGZA 4JT4A 3BXZA 1JAHA 3SZRA 1OT3A 4IOAA 1GKUB 4X8HA 2WTUA 1E2JA 4HLQB 4LNQA 1QHGA 2FPMA 3CM0A 3S1AA 1E2FA 1LS1A 2P67A 1XNRL 3I4MG 3KXLA 5F2EA 3TK1A 1VIAA 1J8MF 1XF9A 1YNNC 2NG1A 1CR1A 2FFBA 2V6IA 2GILA 4BFUA 3UDIA 5IYCH 2ZJYA 1E79A 1YZLA 4A3CH 1W47A 4Q4LA 1XX6A 3CPEA 4QIWE 4E07A 4LRWA 2GCPA 4X65Q 5AR1A 1J90A 1HCZA 4APVA 1YZGA 4V0KA 3ZJYA 2QG6A 3K9HA 3CNOA 2ZM5A 1Q20A 3E9IA 3JAMc 1N34Q 1GTVA 4PQYA 1X54A 3T1HQ 1N5KA 2P5SA 3VNVA 3ADKA 4TYWA 2QU8A 3U7HB 4KI0A 4GKKL 1VDZA 3KL4A 5FL3A 1W2HA 2IY5B 4DZZA 3ZVRA 2ERYA 3ZLJA 4PC1A 4YDSA 3MXUA 3U44A 1E9AA 4KCGA 2K75A 1DAMA 1E79D 1VQPA 5DI3B 5EAYA 4AYTA 1SZPA 1HR0Q 2VP4A 4YONB 4AG5A 5LMNL 1QVAA 3I55A 2J3EA 3PXGA 1Y8PB 3TVTA 2ZI6A 1WOCA 1T4GA 1QF9A 2ZRIA 1B70B 1NVVR 4JSTA 4KVAA 1P72A 2CDNA 3OFNA 4LPKA 1OSNA 2CCGA 3EPLA 4YHHL 4OQNA 1AS3A 3JZAA 2IEZA 3QKSA 4DKXA 4YWKA 1E96A 3B6YA 2ES2A 3L43A 5HY6A 3AFQA 2GCNA 3QXCA 2BA0A 4KFTA 5IT5A 3C7KA 5KUTA 3EZ7A 3GQBA 4FMCB 4JI1L 1DAGA 1UFQA 4V0MA 3VA7A 1K8OA 3FPPA 3DM5A 3R7WB 4IFDI 1E2GA 2DWOA 3FKSA 2O8EA 2ZR0A 1TKWB 1J6QA 3U4ZA 3EWSA 2G83A 5AWFC 2QAGA 3W6NA 1VS0A 1Z6AA 2JGNA 1N5JA 2WSMA 1CKNA 2VF7A 4DR6L 3GJ4A 4LHXA 1W49A 2RHMA 3KB2A 3CNLA 4PHTA 4DV4Q 4I1OA 2K32A 5M5WH 3B85A 3OFND 4D6PA 5KYKA 3K0SA 4DCUA 2GEDA 2FNAA 1E4YA 3W5OA 2C78A 2B6HA 1KZGB 2OV2A 1WB9A 4KN7C 1UKZA 2J0UB 4LFBL 3ND9A 2CHVA 3I3SR 4DV2Q 4LJ8A 4DCVA 4XVRA 5JFGA 5JJKA 1R0YA 1X6OA 1LY1A 2O5VA 2ZYUX 3FKSD 4IXMA 1K9MC 1M7BA 4NCHA 1R0XA 3KZ1E 4KBGA 1IW7D 4OJKA 3SFZA 4QJFA 4DCSA 4NZYA 1NNEA 5FOSA 4M1SA 1Y63A 3AEVA 3MG9A 3NKVA 4BE7B 2DUDA 4DT1B 2W58A 4DK1A 3M6AA 4GMXA 3STBD 2Y0SE 2HQLA 1L4YA 2KBFA 2QROA 1VQMA 3K0AB 3TW8B 4NPSA 2BWJA 2VH5R 3GJ6A 3KYHC 2D74A 4LUZA 3MJHA 4YMWA 1XMJA 4B71A 3CRLC 4C3ZA 5IHPA 4YDHB 5B57C 4DK6C 4FINA 4LBVA 3T1TA 2A69D 4O2LA 4AIMA 1XPOA 3FWYA 4FCTA 4BA1I 3ADDA 4DV5L 4H44C 3CCVA 1E6CA 1UPTA 1P5ZB 1ESMA 4X66L 1Q81C 4MKHA 4P75A 3P26A 3VTKA 3WMGA 5JCPA 1UDXA 3ZD7A 1AH9A 2W0SA 1HNZL 2X19A 3IIMA 2LMCB 4DR7L 2ZTCA 4F91B 4GOPB 1SQ5A 4D4MA 1OIVA 3G0HA 4DNTB 4M2LA 5JWOA 3REFA 3KJEA 4EUNA 1SVKA 2D62A 3L82B 2O8DB 3RR5A 1NMZA 2C9OA 1S72A 4URVR 1NBWA 2O0JA 2JASA 3CCRA 1AS0A 5GAHC 1IONA 1RIFA 3Q7QA 2ANBA 4LI0A 3PF4A 3AVUA 2B8TA 3QG5A 4OI1A 2OZEA 3Q9LA 1G7RA 1BOFA 1EWRA 4A4DA 2E8GA 3ER0A 2XTMA 4A8JC 4EFLA 2JA5G 5IK2A 4C0JA 3KUCA 2FSFA 3CQZH 2UXCQ 2RGEA 5J4YA 2IS1A 2UXBL 4JLAA 4BFTA 1HJPA 1SLJA 1CFMA 4DNIA 2YC4C 3AF1A 3QENA 4TYNA 3ZGXA 1QHHB 4HZUB 4L5TA 1M1YE 3ZZTA 3KQLA 2Z6VA 2K14A 1HNXL 4D82A 4GOXA 3BAFA 5BYKA 3WYAA 4DV7Q 4B35A 1IBRA 4FMBB 2CCKA 1T8UA 4CF7A 4BEJA 3K70D 2V6JA 5J4KA 3K0FB 2JA5H 2EWVA 2QEXA 5BN4A 2LCFA 1NVXQ 4XWAA 3AF3A 4BBRG 2Z5FA 2WMOB 3CX6A 4M0LA 5HR5A 2AHOB 5IK2D 4GRAA 3G82C 3WBJA 3CAMA 3TAHA 2YU9H 4LGMA 1KGDA 1NF3A 1EYGA 2HYDA 4XD7A 3F8TA 3RYTC 4TQAA 4M1YA 2NQ2C 4GNXC 1G8YA 1TQDA 2VO1A 1ZM4A 3B1XA 2V54A 2FDCA 1FOEB 4QBGB 1I94L 1LVGA 4FW9A 3VU9A 1ZM7A 4RFSB 2ZRCA 4XJXA 2RGGA 2DNCA 2O8FA 1TX4B 4LYJA 1XD9A 2Z6KA 4BBRH 3TSWA 3IEVA 2ODWA 3BH0A 3I2ZA 1ZD8A 5JRZA 3AP3A 4JLOA 2YNMA 2WWFA 3R8FA 2F1HA 4DWJA 2K52A 4JLMA 1Q7YC 1JR3D 2D3WA 1KC8C 5CLLA 4QKQA 5L3VA 1DELA 5M04A 3A8KE 2YTVA 2CLSA 2C04A 1GUNA 4XD7D 5JI3E 1KKMA 3CCJA 2R6GA 1ZUHA 3TSOA 1QZGA 3OW2A 1X8JA 2J41A 3GPLA 4RCNA 1BIFA 5GAEC 2ZTDA 3LH5A 4OHXA 4MGZR 3U3OA 1PLKA 5UKDA 3FHTA 5EXSA 1UKYA 1GNQA 3OOCA 4KHPQ 3MWYW 4QGFA 4TLBA 2QA4A 2RH5A 2RGBA 3X1ZA 1S3GA 4DLRA 1QRAA 2BMJA 5FOXA 1U0LA 3WMEA 1CKOA 1G8GA 1E2EA 1T8TA 5GJWC 5KHOC 3GD7A 3M85A 1AKEA 2BEJA 1K8MA 4IHQA 2OM2A 3IIKA 2DFLA 1OV4A 2ASEA 2BM1A 3TNFA 4URYR 1D9ZA 1KOFA 1E94E 5DLQC 1WBDA 2Z4RA 1KAWA 2XGJA 2IS4A 3X1YA 4MRVA 4EPRA 1OF1A 1G9XA 3H2YA 4N3NA 2Y0SG 4LF6Q 4FMDF 5LB2A 4QL5A 2XB2A 5E7IA 2LKDA 1O7LA 2XNDA 5LMUQ 4LWZA 3IBGA 4Z54A 4X62L 4OJQA 4JCVE 1N33L 5AUQA 4UJ3A 1NP6A 2D5DA 3S1MH 4UY8C 4WA7A 1Q82C 4RVCA 3LW7A 3EIEA 4ZCLA 2OCBA 1H9KA 4ZIRA 2CVFA 1OH8A 4I7ZC 1XWIA 2VSFA 2ZE5A 1R6BX 4GT1A 3GJ3A 3GTGH 2UUCL 1VQ9A 2DPXA 5FPKA 2CWPA 1MABB 3D0FA 3CPHA 2FF7A 3I73A 4C3HH 2GVBA 1I4LD 2RHQB 5E3HA 2HHHQ 3NC1C 1ZAKA 2G0NA 1SVLA 1GRNA 3T1VA 4CYMA 4MA4A 4DLYA 3B13B 4HDCA 1IY2A 1N5LA 2XNDD 1XXHE 2GBLC 2I5MX 1NBME 3OIUA 1BO6A 1JJVA 4MKGA 5ELNA 4JI5L 1ZYUA 4NCKA 4DAMA 3CD6A 1ZM2A 1B23P 4MUBA 2EU8A 1K6MA 1Q90A 5H1YA 1FP6A 3LRPA 3CWZA 4P4SB 1KHIA 4EFNA 4IPGA 4IFDG 2QT1A 2H92A 2V8OA 2NPIA 1X86B 1C4OA 3DHWC 2QN6A 5GROA 2AFIE 4DJTA 4O2DA 2NVXH 1G4UR 2D2EA 3C16C 2FA9A 4GFDA 2X2EA 4UP9A 4GNXB 2R92G 3UE0A 2IXEA 4RY2A 3RANA 1J5EQ 2OUKA 2W0MA 5CYOA 5LMNW 2Q8IB 4ME3A 4K0KL 1P4SA 3REGA 2IF0A 2D7CA 1WP9A 2J87A 1YR8A 3B78A 2GVAA 4WZ6A 3KXIA 2V1CC 2Q3FA 4IFDH 4LF8Q 4G1UC 4UXIA 1RRFA 4HAVA 3A1UA 3LWUA 5E4FA 4JBWA 4OO1I 3KFUA 3RRMA 3HOUG 1OYWA 2PJZA 2Q9CA 3VX4A 1WI5A 4PXAA 6Q21A 4AI6A 2VBCA 3KKMA 4DDVA 1IXZA 1ZCBA 1A2KC 4O0MA 1HYQA 4Q4HA 2R92H 1VYUA 2P5TB 3OAAA 4G5GA 5AJWA 3U2QA 1DPFA 1OYYA 1FQJA 1TF7A 4NCIA 4W5WA 2ZE8A 4D81A 3RC8A 1PVOA 3TRZA 4C9BA 3CF5A 1XTIA 3CCQA 4P72A 1X1RA 1FUKA 2BKUA 1EQRA 5FLXc 1WQ1R 2WMNB 2GAAA 2VSOA 1KSJA 3A5UA 4Z51A 1V8QA 4OQXA 2YINC 3THWA 2GF9A 2O8CB 1VQBA 4POFA 2BKEA 4BPBA 3EPHA 2D0OA 1GVPA 2RGNA 1N32L 4OGQC 1H8HA 3ZIAA 4ZV4A 4ZDWA 1E2VA 4HJ8A 5TXGA 4D0LB 1A1VA 1XJVA 1TUEA 4G5RA 3W8RA 2YTYA 4AIIA 2ANCA 3S2DH 3CMEA 2A6EC 2ZR7A 3OAAD 4PC6A 4Y0AA 4C4PA 1JEDA 4MKIA 3ICEA 4L5QA 2NO0A 3T34A 1EESA 4PO8A 5BWMA 1CSQA 4IDNA 5TV2A 2OFXA 1G64A 2WV9A 1XNRQ 2F6RA 1V43A 3BJIC 2YC2C 3M4PA 4DLZA 1R5OA 2F1IA 2NO1A 2XJ9A 2KCMA 1N6PA 2UZIR 2ZRKA 4F4CA 2F4VL 1JB1A 1G291 2QUZA 4A6PA 5AUPB 4NH0A 4MDFA 4IOMA 2KI5A 2NN6G 1DARA 2CHQA 4RFSA 2L15A 2JE6I 1S0UA 2ZI9A 4DIDA 1LS6A 4MRPA 3O8CA 1Z2AA 1XJQA 3T35A 2E87A 2IYYA 3GLIA 3VQTA 3U5ZB 1J99A 4OONA 1H8HD 3J81k 3ZIAD 5AJ3L 1YQTA 3DL0A 521PA 2AUJD 3AKCA 3W1GA 3DOFA 1XMOL 5E7MA 5P21A 4Q21A 4TN1A 1CBUA 3QY0A 3TRFA 3F3YA 1N8RC 2X8AA 4GKKQ 2VW9A 3QBTA 3A37A 4ZCIA 1NY5A 1EFUA 4HB4A 2GZHA 2Q2HA 4M21A 5FOTA 5J5CA 3T56B 4U7DA 3M7NA 2CBZA 1ZD1A 2HJVA 3B1WA 1AZSC 2HUPA 4JJKA 4OL0A 4R2HA 4EJSB 2JLUA 3N70A 2XX3A 5SZHB 1Z5ZA 3KKQA 2ZJAA 1XP8A 1E0SA 3WNBA 4DSUA 3WYGA 2VQEL 4JI7L 5HCNA 3EC2A 2MMGA 5EE0A 2N49A 4TYYA 5LMNQ 1G3MA 1E2DA 5FTMA 2C2HA 2IK8A 2N1BA 4JVNA 4KKSA 4M1OA 1Y1VG 4YHHQ 1W1WA 2ZI4A 4CVNA 4DR3L 4LJZC 1VQJA 4IW3B 5JSZB 3GTLH 2JATA 4HUQB 4MUAA 2IWRA 4GLXA 4OYHA 2XZOA 4JI1Q 1K8GA 1WE2A 4JV5L 3EG5A 4Y0VA 3FHWA 1IN8A 4OQMA 3U4QB 4D25A 1TXYA 3BS4A 3Q8DA 1QZHA 3TIFA 1NE3A 1XPRA 3I4OA 1T5IA 1Z22A 2RHDA 4NMMA 4A6XA 1P7CA 1EIFA 3N6RA 3A74A 1NKTA 1ZJ6A 2FGKA 4UNNA 5ANRB 1Y1VH 3ZQ6A 4HJ9A 4BFXA 2DB3A 2A2ZA 4DR6Q 1MKYA 5IYBG 5KPJA 2KHJA 1C7YA 1NLFA 2I0QA 1XCPA 2A3RA 2BJVA 3W34A 5CB6A 2R65A 3TKLA 4EKDA 4URUR 3VKGA 2DYKA 3KLRA 2BJWA 2VL7A 3H15A 2WSSA 1KD1C 3C8UA 2K5VA 4ZI2A 2VP5A 4DB2A 1NY6A 1RJ9B 2R7DA 4LFBQ 1VHTA 5H1SE 1W46A 1NVWQ 1PH8A 1JECA 3AVYA 3IKJA 2IUSA 3ULPA 2IS2A 1ESNA 2A9KA 1FGUA 2N8NA 4LHWA 4TLCA 1CJUC 5IYBH 2QZ4A 3V9PA 4JOIA 3FMFA 1A6XA 4GLAC 2UU9Q 3KB1A 4G7OC 4EQ5A 4B43A 3L0OA 2IHYA 1WF3A 1Z83A 1X3GA 1JXOA 1DO2A 2AKAB 2BE5C 3LXXA 4KJZA 1G8FA 4BGDA 1T5LA 5DSZA 1VF7A 3GJ7A 1TMKA 5FR1A 4DLXA 1KI9A 3BB1A 2VPPA 2KBEA 4LF9L 2VQFL 4PC7A 4DDTA 4Y7NH 1V5WA 2OESA 3GFOA 4HIOA 1Z28A 2IYQA 2BVNA 3KKNA 4RCZA 3EXAA 3TEHB 3DLLA 2I4IA 3W8NA 4LX0A 3FKQA 2J0QA 3TUJC 4LYAA 4LSGA 4XVQA 3PSIA 3TQFA 4DV5Q 4AH6A 4QNRA 4G5OA 1X1SA 1XEFA 4X66Q 4TWZA 1OW3B 1YJ5A 3R20A 2AXPA 4YCVA 1DG1G 3FDIA 4WZAE 5EZ5A 4AYWA 1HNZQ 1YIJA 4C0KA 1PYBA 4DR7Q 1E32A 1NN0A 3K8YA 2GAOA 4B6FA 4TZ6A 5CIQA 3LVQE 3W5IA 2NZ8A 4KKUA 2WWHA 1PFSA 2CQOA 1W36B 3ZD6A 1CR2A 4JLBA 3CPFA 3L7ZC 2R62A 2WWGA 3SEAA 3X1XA 3NENA 3M4OH 1WMSA 4JC0A 4LF4L 2NIPA 2WWWA 4G5QA 3IIJA 4Q19A 3SHFA 1TU4A 1QVGA 1YRBA 3K53A 3HGBA 3UIEA 1RL2A 2VRWA 2Z4SA 4OI0A 4J15A 2F55A 1FX0A 3A1VA 1Z6YA 4HB2A 1I6HH 4PSVA 4QM7A 2V55B 4Z8YA 4DLVA 3ECCA 3I62A 1QUQA 3QKRA 1IXRA 2UXBQ 5FTLA 3QXSA 2PMKA 2P6UA 2IWHA 2Z83A 1C9OA 1KMHA 4L9WA 2ZRGA 1N6LA 1OJLA 3RS4A 3VKWA 1U0JA 3RWOA 3GLGA 3CW2A 4MYCA 4Y52H 1BDOA 1E2PA 1HNXQ 1KO7A 2J0VA 2ZJBA 2GXUA 1VKJA 3V4RA 1IN6A 5CIWA 4YC7A 3K70C 2QBYB 1LFDB 5TMPA 2ZROA 2YZ2A 2WIAA 4W5JA 3PUZA 4KLKA 4K81B 3A7LA 1DO0A 4EQ6A 2KHIA 1I5FA 1MV5A 4MGKR 1Z2CA 1PUIA 1Z6TA 4ASUA 5JS8A 2V1UA 1DAEA 1CEEA 4F38A 1CIPA 1VQLA 1AM4D 3ZDQA 1YVCA 1E9DA 3GTJH 4DPGA 3H4MA 2WFWA 2CL6X 1YHBA 2RGXA 3Q85A 1PH5A 3NWJA 1W0JD 2VF8A 2I1VB 3I56A 4B3XA 1VQ5A 1WBBA 1I94Q 5GJVC 4B3SL 4WJ4A 3LWNA 4O3MA 1NLZA 2VP0A 4PPGA 2OLKA 4Q02A 1FP7A 1LTLA 1HE8B 2WAXA 4LJ5A 1N6KA 5TVKA 4DCNA 2GWHA 4F93B 2QL6A 2GNOA 1SR3A 2ATWA 1XTKA 2QMHA 3HPRA 3AFPA 4WIAA 2L5TA 1YZUA 2ZRAA 4ASUD 1JT8A 3IDQA 1N6RA 4DV1L 4BASA 2R7FA 1G6HA 2EFDB 1IBML 3MJRA 5HCIA 4ZI3A 2IYLD 2PH1A 2VTKA 1E3PA 2TMKA 3AKEA 3CCMA 1HZCA 3OE7A 1R9TH 1MO4A 2DFNA 1SHKA 4JL5A 1W4RA 1IY0A 3ETLA 3NIBA 1XTQA 1GUSA 2VL6A 5JJLA 4BECA 2BDTA 1R8SA 2CEAA 3L8ZA 3NBXX 5KSOA 3N5CA 3S15H 2Q2TA 3KTAB 4JMPA 4OK3A 4RZUA 1RIPA 3MWKA 1T3LA 5CLQA 1P6XA 3BH7A 1M2OB 1QZXA 3MLEA 1VCNA 5BXQC 3A5ZB 3HU3A 1PH2A 2XSZD 4JLDA 2O5JC 4KYUA 4CIDA 1E69A 5JSZA 3K0EA 4A93G 1NIPA 5M3MG 4HUQA 3WBKA 2ZSFA 2WAQE 5HZKA 4XSGA 1HTWA 3LV8A 1X65A 4PQRA 1DD2A 1GNPA 1E9RA 1S4QA 1T9HA 3U3MA 4DSTA 3U4QA 4U5XA 4KN4C 4YMTA 1KJWA 1WRBA 4CGZA 4DV3L 3OE7D 3C41J 3DM3A 2ORIA 1KSGA 3CR7A 4Q4JB 3GLFE 1J8YF 5CJ2A 5F98A 3OTOL 5C4XG 1GSIA 1FZQA 2HT6A 3I5XA 2RMKA 1XXHB 4JVSB 4PZ6A 2ZVPX 3BFXA 4US0R 1KTVA 4DAYB 4A93H 4X62Q 5M3MH 3J81c 1II0A 2ONKA 1E0AA 1N33Q 3SFVA 2GN5A 1CRQA 3GJ0A 4BLSA 1TU3A 5KPDA 4L5SA 3HOXG 4QL3A 2BH8A 2GKSA 2J0SA 1RJ9A 2A5DA 1W5SA 1F48A 2Q3MA 3KJGA 2ZITA 1FYCA 4KVGA 2UUCQ 4M4SA 5A5GA 3W3AA 3IO3A 1CRPA 3LFUA 1BYIA 4R4CA 5C4XH 2OILA 2GVZC 1KXLA 4KFUA 4NCNA 4FCWA 2OCPA 4LV5B 4B3BA 4BY1G 1GHJA 1VG1A 3SJBA 2ZRJA 5IF9A 4V0OA 3SE0A 1UAAA 3KUDA 2L0XA 1NJGA 3HOXH 2A5YB 1SROA 2O5IC 3PITA 1P8LA 4HLUA 1LACA 2DHRA 1PLJA 2QMOA 3K0XA 3H86A 4X8MA 4ZDIA 4LPSA 1TEXA 1Z0KA 1XJ0A 1ZNZA 3SBDA 1ANKA 4IPHA 4IDQA 4BY1H 2GHIA 4TL8A 4DUGA 1W2GA 5K36G 1RRPA 2C77A 3B5JA 3WNDA 4N0EA 3THOA 4HJ5A 1TU2B 4K0KQ 2BMEA 2WJHA 5CM9C 3AP1A 3VHLB 5HPYB 3I72A 3LAWA 5JWHA 1IYVA 4LHVA 2B8FA 3CH5A 2H1LA 2BV3A 2ZI3A 2ZJ2A 1KK2A 1JB7A 5C44G 3MWLA 4IOJA 3AF4A 5DLQE 4HZIA 3BU2A 4TQ9A 3RRYA 2CJWA 2QTHA 4IJLA 5DH9A 2B7BA 4BLQA 1EOVA 1UEBA 3FP9A 3I8XA 4MDEA 1KQSA 4HLDA 1FNNA 2JEBI 5DISB 1VQGA 4A75A 5K36H 4LUVA 4UP8A 3TREA 2PZFA 4RZXA 4BQSA 3AVVA 2LXKA 1I4DD 1AGRA 1VYVA 4TT3A 4LDJA 2G0TA 3VAAA 2A6HC 2CLDX 4QFMA 4Q1DA 2NPFA 2ZI7A 4DUGD 4A92A 4A15A 2OT3B 1NVVQ 5EQTA 2ONJA 4B76A 1N36L 3GTMH 1UBFA 2DFTA 2AKWB 3QBVA 4M8NE 4MRRA 3EX7C 4PZ8A 2AKYA 4A0GA 5C44H 4LY6A 4A2PA 4EAQA 1L8QA 2QM8A 1TQ4A 2E2JH 1Z06A 1VPLA 4JYBA 5BQ5A 2GDJA 1W36D 4G7HC 4U00A 3PCOB 4YMVA 4UP7A 1IQPA 1TQ6A 3KFXA 2QBYA 2Q6TA 3EPKA 3GLHE 5JS7A 3ZZUA 2F43A 1IBKL 3ADCA 1ZC3A 1LF5A 3THYA 4A3GG 1N32Q 2KCTA 4LW1A 3VR4A 3EPJA 4L9SA 3TAUA 3GTPH 4TT3D 3K81C 5FLMG 3KOJA 3GJXC 2JLVA 1YNJC 1Q3HA 4B3ML 4B3CA 1Y8NB 4A3KG 4M53A 3THXB 4A0FA 2PI2E 1V1QA 4R4IA 1KO8A 2VHTA 3PIRA 4LJ4A 2RGDA 3GFPA 2Q2IA 4C7OA 3E1SA 5D3MA 4BLOA 3TS2A 3CCLA 2F4VQ 1VCMA 2ODBA 2IUTA 2HF9A 3BK7A 1IL2A 4IOCA 1M1KC 4A3GH 2ZRDA 2BOVA 4DVGA 3KKPA 4IDHA 1CXZA 2RGNC 2YOGA 5FLMH 4IDOA 5L8VA 3B9QA 1WJJA 1M74A 1VQNA 2IUUA 5AJ3Q 1QHNA 4B75A 1KNQA 2A68D 2PL3A 1XMOQ 2C9CA 2JLSA 4A3KH 1H65A 1KI2A 4EPWA 2JLYA 4GNKA 1GUTA 2DFKB 5TDHA 3CR8A 3QF7A 4N1AA 4PAOA 1IY1A 4B33A 1E2IA 2D2CC 2OCEA 2JA8G 2AK2A 1H9RA 1G3QA 2WJIA 2E76C 2WJVA 4JK1C 4UNPA 4LV6A 3J80i 2BHRA 3NBYC 1DE0A 3O8BA 3QPVA 4LUCA 4B2LA 2ZRBA 1FW6A 1GL6A 3EA0A 3RZOH 3D7MA 3TQCA 4GS3A 5F3WB 2VQEQ 1YITA 4JI7Q 1JNYA 4NE2A 3OEHA 1SKYE 3I5YA 5GJBA 2FU5C 1E24A 3THXA 1EFCA 4GN5A 1C9KA 2G1JA 3PGZA 3EIVA 3KJIA 4DCTA 2FXQA 4JI4L 3IRBA 1VMAA 2F1JA 1JQLB 1KI6A 3A0JA 221PA 4Q01A 2XXAA 2JA8H 3BRWD 4R7ZA 3LBIA 121PA 4JYAL 1RFLA 4DR3Q 1VQKA 3WDNA 2PLRA 1HV8A 4RMFA 1FPMA 1R5NA 1YZNA 3M1IA 3CH4B 5FBQB 1P2TA 2ZIAA 3AH8A 4GLVB 1GOTA 3QEJA 1GAJA 4BEBA 4JV5Q 3UG6A 3SJCA 2C99A 4D2IA 1IHUA 3K7AH 4W7SA 1B9MA 2FFAA 1H9SA 1WYDA 1XXHA 4DR5L 3OEHD 5JHHB 1NBMA 1UKVY 1RPZA 2KJQA 3S16H 2ZANA 4GN4B 1GKIA 1ZUNB 2GCOB 2J7PA 4BFYA 4Q4AB 1HH4A 2OBLA 3U3RA 1L1OC 3IQWA 4G01B 1IN7A 1ZC4A 2WWXA 2ZI5A 5C0XJ 2NVTH 3OHMA 4QBIA 2GEUA 2A78A 2B8GA 3WRXC 1CSPA 2MO0A 3U7EB 2ORVA 3CMAA 1L0WA 4H1UA 1NL3A 4OI4A 4HIDA 4TTRA 1CJTC 1KNXA 2K5UA 4R71A 1F2TA 1KDPA 4D80A 2HLDA 4RD2A 3H3VI 4UNRA 2QORA 4PANA 3G5UA 1TWHH 3K9GA 4KYIB 3R9WA 5SZIA 1Q86C 4C3IH 1E99A 3K80C 1U90A 4C0HA 4DUYL 2VNUD 1NBMD 4DKAC 4PZLA 4B3DA 3VDYA 1ZBDA 4TQUS 2CL7X 1NIJA 3SYLA 2V4DA 1NMYA 3RS2A 4QQBX 2J7PD 2ZU6A 1P2VA 4GOJA 2VA8A 1T0HB 1XEWY 2ZETA 3IO5A 4TTPA 4F4JA 2YVUA 3UE1A 3CRRA 1CULC 4E03A 4ESVA 5AJVB 2EFHB 4LF9Q 2VQFQ 1U81A 1JR3A 1VQ8A 1JXMA 2R44A 4DB4A 2IX1A 2QEQA 3SR0A 4AURA 4ZO4A 1CR4A 4QJ5A 4JLKA 2VY3A 1XCGB 3PEWA 2YKGA 1OKKA 4RKEA 5FUYA 3HP1A 2HLDD 3QF4B 1RRCA 2GJKA 3CB4A 4I4LA 2K50A 4JOIC 4KLNA 1QHYA 3VMFA 4CDGA 3PG5A 2J9RA 2UUAL 1UEJA 4HAZA 2BBOA 3HFZB 1Q44A 4HEJA 2WKRA 3K09A 2O8BB 3B9PA 1FJGL 1LB1B 2Q9AA 4I1UA 1GL7A 3LGJA 2YOHA 1GG2A 1VCIA 3AP2A 3PEUA 4MRNA 4WOPA 4Q9HA 4JBXA 2R6AA 1S1MA 5FI0B 3V00A 2OTLA 1PH3A 1BBUA 4DNRB 1E1QA 2P2LA 2ZJZA 4TMXA 1Q3TA 5EE9A 3GDEA 1E9BA 4LF4Q 2AXNA 1Z3IX 3VR1A 1A0IA 4QBHA 2MO1A 4A3IG 1G51A 1SXJC 2NGRA 4RZ2A 2JA9A 4GZYC 5DI3A 4L5BA 1OKKD 4TVAB 1XRJA 1W0KD 3DOEA 4JI6L 4QC2A 3H84A 3SDZA 5FPSA 1EG7A 4PMWA 1H8EA 1JMCA 3BIFA 5EP2A 2ZYTX 2ZXUA 1NJIC 1EX7A 4TMWA 1OXXK 1GWNA 3OPOA 1DBSA 2V4ZA 3NH9A 4HUTA 1EWHA 2OWOA 3FMCA 1G41A 4LBYA 5BW8A 2CCZA 2FFQA 1B7YB 1TAGA 3T5GA 3W3ZB 4CEHB 1MO5A 1E1QD 4A3IH 1TNDA 1J70A 3FKIG 3U3JA 1MRSA 2NOAA 1ELOA 3R7WA 3LQRA 3AKYA 4Q1FA 3A1TA 2ZS9A 4QHYA 1MJCA 4PHHA 2I1QA 3QKTA 2V1XA 4B73A 2A5GA 2BDOA 4E09A 3MEFA 1KI4A 3OYYA 4ARZB 1TWFH 1IAQA 2FZLA 4GI7A 1IXRC 1VG9B 5JLJA 2HXSA 4QJ4A 3RABA 3VR5A 1H8ED 1I6VC 2OHFA 3OW7A 1D6JA 2IYSA 2D06A 3EASA 4OBEA 4QBFA 4ZDKA 3CRW1 5K8IA 1DAHA 2FOLA 1R8QA 4GKJL 4DC9A 3OIYA 3FKIH 1CP2A 2ZT9C 3D31A 4HAXA 3SC3A 4B3SQ 1L1OB 3U50C 1XEXB 2ZJRA 5EP4A 1K83H 3CX8A 3SQWA 4A8JB 4ACAA 4BLPA 2J0UA 4NTZA 3L0PA 4JLVA 4K8OA 3EBEA 4XSHA 2KSQA 3RRZA 5ELXA 3KJHA 1OFHA 2IYXA 4FDBA 2P65A 2XGTA 1E4VA 2Q3HA 1E2HA 2WKQA 5EJEA 4URXR 3QOFA 3GJ5A 4LUOA 1OIWA 2RHSB 4YMSA 1IBMQ 2K5HA 1D2MA 1UE5A 2K7VA 3CF6R 2KA7A 1ZM9A 3LQQA 4TLDA 3J7A5 3T1QA 4DT1A 4F4IA 2C96A 4G5SA 1IYUA 2BMFA 2C8VA 1OXTA 3I92A 1T91A 3AB3A 3KQNA 2JLZA 3P1JA 3RS5A 3GLFB 3K0AA 5FOUA 5CJPA 3GMTA 4NCJA 1IZ6A 2QGNA 5BR8L 2IHBA 2R9VA 3KXKA 3MSXA 1C0AA 1E1RA 1G7TA 3B60A 4D4JA 3RS7A 3D8BA 1FTSA 2Q2UA 1VYTA 4DXAA 1UJ2A 4NHOA 2F9MA 4B3FX 4DV0Q 4M9SA 3QNUA 5FH9A 1KO4A 1PHJA 2ZUDA 5LD2C 2FG5A 3QXXA 4Q1CA 3KF6B 5DHAA 1O87A 2EW1A 4AKGA 3Q5DA 3RN2A 3X1WA 3K7UC 3BH6A 3BFVA 1FMJA 4RG1A 1A82A 2AX4A 1LW7A 1MH1A 2VLIA 4GOPA 1YZTA 4JI3L 4YY3L 4DV3Q 3M3YH 3BB4A 1JR6A 1N6NA 4DDWA 2GXAA 5JEAG 2YHSA 2NO7A 2PCJA 5G3YA 2O8DA 2FPLA 4US2R 1E1RD 5A35A 1P62B 1Z0IA 1D8TA 1MO3A 2X2FA 1Z0AA 3NHBA 1W4BA 3EZ6A 1SVOA 4OWWB 1JJGA 1GUAA 4DEXA 3RNLA 1GO3E 4H13C 2Q21A 3S2HH 1NN5A 3TR5A 4V0LA 3S1NH 3I61A 1L4UA 5IYDG 4A3MG 3GTKH 1XTRA 3TVDA 3KDSE 1SXJB 1C1YA 3AF0A 4HIMA 1E2NA 1MO6A 4TL7A 5EP1A 4DIEA 3AUYA 3T5DA 4CT4B 5IDVA 1U0HC 5IT9c 4MZ9A 3CF2A 3DZ8A 4MTNA 4NL4H 5JEAH 1QHHA 2C98A 4HZUA 5CDFE 2QMEA 1NJFA 1P73A 2IXGA 4LYFA 5DYGA 1NLYA 4Q7KA 2FGJA 4B2IA 1M8PA 4POAA 5BYJA 3JZMA 3UWOA 2H5XA 4Z8XA 5IYDH 2Z0MA 4A3MH 3WYFA 3K0FA 4JBJA 3PO3G 2EWWA 2QPTA 4C0QC 5C46F 4KAXA 4PZYA 3LW8A 1VQFA 1U8ZA 4OK6A 2RGAA 1X3SA 2JA6G 2GJ9A 2AHOA 2PQAB 2CE7A 3A1SA 3CCEA 3BERA 4LJ6A 5E7JA 2WWYA 3Q8XB 1YBYA 2P0EA 3SQXA 3RS3A 4LK2A 3LDAA 2JIZA 5D3QA 4C0AC 1G7SA 5JEEA 5KU1A 3AM1A 3Q3JB 3QF4A 5AJYA 2IYTA 2EFCB 3WY9A 5L3RA 3LNNA 4GBMA 4LJ7A 4WBSA 1PLLA 3MFYA 1KKLA 1P2SA 2YV5A 3PO3H 1ZNWA 2NZJA 1VHLA 2YWFA 2JLWA 3SYNA 4BUJA 2UXDL 4G3XA 2D7DA 4EPTA 1XMQL 4DK3C 1II8B 4WXRA 2IC5A 4YXWA 4IPDA 2O8BA 3U7GA 4MYTA 4LF7L 5IY0A 2JA6H 2J45A 3BGWA 1HY3A 5C4GB 4F7WA 4TZ0A 1ZU5A 1DOAA 4NYJQ 4Q1BA 1GIAA 4BXXG 3OEEA 4HLUC 4PSAA 1MR3F 4QGGA 5BN5A 1GKHA 1EXMA 2N3SA 2AWNA 5GQOA 5FBLB 4AG6A 2FJUA 4YMUA 3GLHB 4ON9A 1W4AA 2IX0A 4X64L 2IHFA 5HKKA 1DCZA 4NYJR 4URWR 1B0UA 2CFMA 1OIXA 2GF0A 3M4QA 1MOZA 2JIZD 3H0GG 3QXHA 1R4AA 4AKEA 2CKZB 1S3SA 3C5HA 4KMUC 1DAIA 4JYCA 4PAQA 1KY3A 4IEIA 1S9HA 1GHKA 1YR6A 4DR2L 1N36Q 5B2ZA 4JS0A 4BFVA 5J4HA 1P9WA 2JA1A 3LLUA 5C3EG 3TBKA 3ZJYC 2HT1A 4BXXH 4BA2I 4YXWD 1K3RA 4CEJB 1TWCH 4Q9JA 1N6HA 3I7FA 2ODEA 3H3VH 1O3YA 4JVLA 4HSEA 3OEED 4CEHA 2YOFA 5FBWB 4BLRA 2H57A 1ZMXA 4UQOA 3H0GH 2OBNA 3I32A 3QG1A 3W9YA 2A7QA 3PEYA 5HKKD 4LBZA 2C35B 1RZ3A 3OESA 4XH9B 1SE8A 4N0DA 1R10A 5DIFA 1OXSC 4P4TA 5SZJA 4OQLA 2JEAI 3AGQA 4M9ZA 3QVVA 5C3EH 4B3MQ 3RAPR 1CKEA 2BBWA 2VP2A 2XJ4A 1XNQL 2UVQA 2HYIC 2C95A 2CXXA 2PMZE 4UPAA 2R93G 1ZU4A 2J59A 4Q1AA 3MWJA 2WVJA 2MSDB 2HEIA 1J7KA 3CZQA 4QOSA 1KK0A 2XNSA 3N2IA 4UKDA 5LDDC 1JAIA 3PIPA 3NEYA 1NN1A 2QA5A 2HF8A 3VFDA 3U3KA 1SKYB 3HYTA 3WXMA 4CW7A 1Q1ZA 3MD0A 2IS6A 3UMRA 2IT1A 4LC0A 1MABA 4QJ3A 1YZQA 2E2IH 1PH7A 2C5LA 4B3TL 2PZGA 2F9LA 2ZYWX 4EPVA 1VG8A 1RC8A 3TJZA 5G53C 1I50H 3M9BA 1W3SA 5HE9A 3CCUA 1AQYA 4QHSA 1US8B 1YHQA 2R93H 2PMDA 3TSZA 1OH6A 3BZCA 2OFWA 1IW7C 1X3EA 1I4TD 4XTCS 2QAGC 2OAQ1 3CONA 2X1VA 3UK6A 2JJ1A 4A4IA 2JDIA 3ULLA 4YLGA 1KZ7B 2CE2X 1RKBA 3ASYA 2F1RA 4TLEA 5EZ6B 4UNSA 3STBC 2XOKA 1HA3A 3LVRE 2VS1A 4GZMA 1TUIA 4P4SA 2G6BA 3PENA 2ZTEA 4AYBE 4IVQA 2W2VA 4BZPA 3L8YA 2ZREA 1D2EA 3X1DA 1ODFA 2GESA 2OTJA 2F3IA 1G3RA 2A69C 1XMVA 5C0XI 4JI4Q 5EUQB 3TE6A 3UATA 4F92B 2VUMG 5IRCD 2GZDA 2KBNA 4GNXA 1QG4A 3IBYA 4AD8A 4JYAQ 1DADA 1U8AA 3L0IB 1VQAA 2DWQA 1WCMG 1Z47A 2IA5A 3P4XA 1G19A 3SBEA 5FTJA 3B82A 2JJ1D 3P27A 2JDID 1AGPA 2SHKA 3G4SA 1U9IA 2N46A 2ZUBA 3EC1A 4IRUB 4LJ9A 5JCZA 5L3QB 621PA 2QP4A 2YWHA 5KSYA 1ZIOA 2IL1A 2XOKD 1F6BA 3SN6A 4DUZL 4A3FG 2I5HA 2A5JA 3T1YL 1S8FA 2ZU0C 1E9EA 1KI1A 1S9DA 1ZW6A 2W2TA 3B2EA 4L15A 3QPWA 4DR5Q 4M1KA 2VUMH 1N6OA 2F52A 2NVYH 2ZJPA 821PA 1Z0FA 3FMPB 1KK3A 4H0LC 1WCMH 4L8GA 3I1FA 5FPHA 2NVQH 2DNEA 4OWTB 2ATVA 4UXJA 2CVHA 3EIHA 1ONBA 3MRSA 1CLUA 3D3QA 5TY0A 1SHZA 4TL6A 1OB2A 4A3FH 4US1R 1G1MA 1T6NA 3FMIA 4FCVA 2QGQA 1W0JA 3PFIA 4R2IA 1VQ6A 1CTQA 3B8HA 3EQLC 4M1WA 4A3JG 2O8CA 1MIUA 4A1FA 1ZD9A 2EQSA 3ULJA 1G5RA 1OXVA 4DUYQ 4TMZA 1WFQA 4LZZA 1XMIA 1G3IA 2JA7G 2FMXA 1NMFA 1YE8A 2H16A 5HTKA 4PQFA 1GILA 4JLPA 4A0RA 4AWXA 3ZVLA 4AQYL 2XAUA 2PQAA 4QHTA 4ACBA 3U44B 3ZS8A 2ZSBA 1VQ7A 3UXMA 2G9NA 2B92A 3BE4A 4B32A 2B3GA 5AUOB 3LBHA 1JQJC 1JE5A 2W2XA 2WKPA 2ZRPA 4FWIB 1CJMA 4JBYA 4TMVA 3M4YA 4OO1G 3RLOA 4A3JH 1OE0A 1NY4A 1GITA 2PT7A 3GLIE 5K8TA 5KO2A 1CJVC 4OQFA 3T06B 1F5NA 1EK0A 2OE2A 1FL0A 5TB5A 3B1ZA 1VQIA 2OAP1 2CLCX 3U58A 4HIKA 2JA7H 2IYUA 2IF2A 1Y3AA 2O52A 3QKSB 4IOKA 3SU8A 2UUAQ 2ZS8A 4GPTA 3FFAA 2VQSA 4ESHA 1DVRA 2XSZA 1X3FA 1OH7A 1M6NA 1FJGQ 1KK1A 2D0PA 2HCJB 3GTOH 3ADBA 4LF6L 2D2FA 4OO1H 1JJCB 4MNOA 1PJRA 3HJNA 2WM9B 3LO5A 4NBSA 4BFZA 1GM5A 3HR7A 3UPUA 1W5TA 1SN8A 5K8LA 2QAGB 3E5HA 4BWYA 4EJSA 2CL0X 2XEXA 4DR1L 2GBLA 3HU1A 3BG3A 1YEZA 1V9PA 3TUZC 3G48A 4LFAL 3CXCA 2CWAA 1LABA 2B21A 2BC9A 2VP6A 4IPCA 3C5CA 1Q0UA 2PI2A 1HZAA 4QY7A 3PV0A 1D5CA 2P6NA 2Q0HA 1GFIA 2NO9A 4OWXB 3LA6A 4PPNA 3L2OB 5DO9A 3RSLA 3UMFA 1GJXA 4KITB 2Z6KC 1E1OA 2AFHE 3WRYC 3WWVA 3BOSA 3K09C 4R9UC 1N0VC 5C4MA 4JLNA 1AA9A 4JG2A 4TTQA 1Q1BA 1HNWL 1QVCA 4LC1A 5CYPA 1XDBA 4DSNA 2UUBL 2RGCA 1CTMA 2ZJQA 1SKQA 2ZPTX 3CPJB 4ZPXA 4LFCL 2BH2A 1P9RA 3K9NA 2E2HH 2VHJA 4H1VA 1GRQA 4IOLA 3FYHA 1L7VC 4OKSA 4PHGA 4H02A 2YTXA 4UJ5A 2HDNB 1Q46A 1JBKA 3EARA 5J40A 1IN4A 2W6JA 4MRSA 3KKOA 4V03A 1E2WA 2AD5A 1SRUA 1OPXA 1QHSA 3GEHA 5FPTA 3UMSA 3FOZA 4P4UA 4O2RA 3JAMi 2FWRA 1GVNB 1E0KA 1LNZA 1IBLL 1E3MA 4Q03A 1BYUA 2PX0A 4NYIQ 4C0BA 5H68A 3SJAA 4GKJQ 3CP0A 5JI2E 2AUKA 2OBMA 4JI0L 4KXFB 3LY5A 3QUSA 4NB3A 1KIXA 4QRHA 4NYIR 3R8CA 2IYVA 4J0QA 3ICQB 1LF0A 1RYFA 4MH0R 2JEOA 1E22A 3KDFB 2GK6A 3DDCA 1VQCA 3TLXA 1N3BA 4EPYA 4E5UA 1X56A 4QGAA 2RKOA 4KV9A 1Z6HA 2W6JD 2LSSA 3CNNA 5M5XH 1TF5A 1L2FA 1XEWX 3RN5A 1OFIA 2UZ3A 2R6CA 4P32A 4ZKDA 1OH5A 1P75A 4PFSA 4YWLA 5FFMA 4FWTA 2QTFA 3UKDA 1UE1A 1JPNA 3K70B 2PCLA 2BEKA 4JI5Q 1P3JA 1BS1A 3BJUA 3CC4A 2PZEA 2ZUCA 2ZSDA 3BB3A 3HWSA 3IPXA 3NBZC 3QPUA 3UWKA 4YQFA 3FFBA 1TF2A 5E95A 5BR8Q 1SXJE 1VQ4A 2PBRA 1LYLA 4OXPA 4H9GA 1EGAA 5IWAL 2Y8EA 5LPNA 5GVSA 2EFGA 2NMVA 3IHWA 1LM0A 4P74A 1D2NA 3K0CA 4B3GA 1HTPA 1MRNA 4LOAA 4GP7A 3NH6A 5DYIA 5JZVA 1KL9A 4FI3C 2MNAA 4IFEA 3AQQA 5JMTA 4Q7MB 4DSOA 2R7ZG 2DCUA 1CI3M 2QSZA 1G4AE 2E74C 2DWPA 3B6EA 4L4UA 2ZSEA 2X77A 3AYHB 4YY3Q 4JI3Q 1CU1A 3NELA 4D0GA 2WB1E 4DLTA 1AJEA 5AJZA 2A6ED 5IP7G 3RZDH 1ASYA 2VP9A 2W00A 4LBWA 4R4TA 2RAPA 4JZKA 1GNRA 2MQHA 4RD6A 3WNCA 3PCRB 1D7QA 2FSGA 1NVUQ 2R7ZH 4ILEA 5J47A
chains in the Genus database with same CATH superfamily
3DO6A 1T4DA 1X9NA 3AXTA 4L75A 5BMOA 1L7DA 1ZD5A 1N33B 2JQOA 6PFKA 4DG8A 2NTTA 3ZD9A 2KWIA 1IXYA 3REOA 4BO7A 4ZKEA 2O2LD 1G8HA 2OO5A 1SXPA 1W581 5HZHA 4FN4A 4PZZA 3OCXA 5JAQA 4RXUA 3T0IA 2C1XA 3HVHA 3DTYA 3HU2A 1N5IA 4ZC8A 4TWIA 1KVRA 3LNCA 3PXXA 1OQAA 1J22A 3C8HA 2QD4A 4M89A 4DR2Q 2HA4A 1V3QE 4ZIRB 4U4AA 5FNVA 3U9SA 1JUDA 3A1WA 3FPBA 4EYQA 5B6PA 3HJTA 4EGCB 5JWRA 4LQCA 5CXUA 3PO2H 2C03A 3NTLA 1XNQQ 3QVUA 1CUEA 1XLWA 2ZYSA 4OQYA 4FF1A 1U1EA 3U7FB 2V96A 4AYBB 1E9FA 2FEAA 1U2TA 1EB8A 3LPLA 2AFIA 2N3ZA 1Y9JA 5DWQA 1FLVA 3ZV6A 1XZIA 1ZVQA 3S17H 3LPMA 2J46A 4PX9A 4Q4HB 3PF5A 1AS2A 4IXWA 5FKJA 4JNCA 4UVIA 3HKZB 1RADA 3TH5A 4L0DA 3NPPA 1SUSA 4BBZA 5FLXE 5EE3A 2PX3A 1JILA 4Q0MA 1Y3BE 4EB8A 2A0WA 1UUFA 5CD1A 3SZMA 4Q66C 4UD6A 5NLLA 1I2MA 1HQMC 1P7PA 2QPOA 4KN6A 2VDVE 2K1BA 4CM5A 1V0JA 3B2NA 1UODA 3LKZA 3SWWA 1TWAH 2Q5LA 3ZEIA 3DP7A 3S2EA 2VZ8A 3IBSA 4DV6L 1OVGA 4MV5A 1PTOB 2I2XB 4JI8L 3PXCX 2WFLB 4UDUC 4O42A 3JRNA 1W4CA 3AJ9A 1VLJA 3JV7A 1BQ3A 1JWBB 1P4RA 1L4GA 3OZWA 3AEZA 1BHSA 4LX8A 5DT2A 4D9EA 1DEKA 1Q1AA 1M9NA 2IVZA 3GK3A 3AWDA 5F7ZA 3K20A 3GB9A 3IE0A 3L6DA 3G2HA 2DJ5A 3IELA 4LE1A 5GM1A 1UM9A 3RTAA 2XUJA 1HNWQ 1QANA 3MUEA 4KQFA 3E82A 1CUWA 2EFJA 1JBQA 1EMDA 4OHMA 4EUFA 4XM2A 2GCOA 3RS0A 3UUGA 2JAXA 4WKOA 1WA5A 1LSSA 2YJ3A 3W5AA 4RK4A 3EVGA 3WHKA 1PJCA 3EA6A 3DEOA 5F35A 4Q00A 2QM7A 2WJYA 5HE8A 1YL7A 1UBEA 1CSEE 1WUJS 3OWFA 4C22A 3EAQA 2NU6B 3WMXA 1QUQB 3WMWA 2FMIA 4HS9A 1IHOA 2VYFA 3L5OA 3Q8WA 2G5CA 3ROTA 4C2AA 3VX3A 3OOHA 1BH2A 1WD1A 4XXEA 4EVRA 4OH1A 5F73A 3NDPA 3JAMA 4MIUA 3X1KA 2QS9A 4TRNA 1EK1A 4D0SA 3JYHA 1V1PB 4KXWA 1YA6A 1Q84A 4QPZA 4DAVA 4OQZA 3NTQA 4DQKA 1J2JA 2JAOA 4UBMA 4NV3A 1LUZA 4QECA 1D0IA 2VJOA 5CB4A 2L11A 4IDGA 1S89A 2K01A 2FZKA 3ZV3A 1RLIA 2Q5FA 3JATB 4X1IA 3EZFA 4H3KB 2R8RA 4LHZA 5CDTA 4C2MH 2VDWB 1RJTA 1Z63A 4TSFA 1VBFA 5IDYA 3RYHA 4B74A 2HD4A 3HEJA 1GUYA 2QEJC 1XZDA 3WK5A 1ISSA 3COYA 3GAAA 4CBVA 2IYZA 4MS1A 1U94A 4RQBA 2Q49A 4GSKA 2AEFA 5KNDA 2XB6A 1E2KA 1CUZA 5I7UA 4J90A 4QUEA 4ABYA 3IQHX 3H4TA 1EUCA 3AF2A 2GAIA 1C4XA 3VC3A 1Z4KA 5EMHA 1JLSA 3O1LA 2EKLA 1SXJA 2ZULA 5LYYA 1G20E 4HDQB 5K6AA 2BT4A 2REBA 3K6OA 2PAAA 1J24A 2GXSA 4ROTA 1UC5B 2LKCA 4C3JG 1I0ZA 2PGAA 4P38A 1V35A 3Q3VA 5EP3A 3RI3A 4G5XA 1ZCAA 4A3DH 2FWNA 3B52X 1JDSA 3PPVA 2HK8A 3HZRA 3GQBB 4F84A 4JQSA 1EFRD 2QP3A 2O8EB 3PEVA 5IMSA 4TKVB 1R5JA 5IFKA 1L5NA 2P5ZX 1GXSA 3NTKA 5E2AA 1XAJA 4II7A 4G67A 4E30A 2XMSA 3NP7A 2E75C 3O8NA 4NJOA 1K2WA 3G0BA 5THKA 3ROXA 2WTBA 5T57A 4ZJPA 1HUNA 1GPUA 2WWRA 2O7SA 1JSZA 4JT2A 1KDRA 4U2FA 2AK3A 3DPUA 2DETA 4LTMA 1E2LA 1RYMA 4DXDA 1AE3A 3O74A 4X7BA 3RH0A 3N58A 1NHGA 3FWPA 3LC7O 2E85A 2V5UA 4BTEA 4NP6A 2P78A 3I58A 5ERGB 2CMKA 3FVTA 3FDZA 2FEPA 2Z56A 4RW0A 3BWVA 3D4NA 1VG0B 3E9YA 5FBVB 4G84A 4E4TA 2GK3A 3N74A 5EHGA 2Z6AA 3JASB 3MSCA 3UF0A 4R9WA 4WK4B 2QGZA 3R8BA 3E6AA 3NW9A 1E2FA 4AW9A 5T64A 3ZKWA 3BJZA 3UV3A 1VL5A 4APVA 5IXYA 2QG6A 2ZKLA 2VT2A 3GDOA 3T1HQ 5BSFA 4AZ3B 2QU8A 3KL4A 2PSDA 1ZMOA 4EHKA 2Z4IA 4KCGA 5T4EA 5I3CA 2CLFB 3BIXA 1Y8PB 3TVTA 4JI5B 1WOCA 1X1CA 2H52A 1FP4A 3BTOA 3OWOA 3OFNA 2CCGA 4HXFB 4OUKX 5CH3A 1QDLB 1MC5A 5TT1A 1H22A 1PT9A 5KVCA 4KV6A 1NURA 3GJTA 1NSNS 1N5JA 2RA4A 2CF5A 3CNLA 4CFSA 5C53B 1NJ6A 1MQ9A 2RIRA 4C7VA 3SIWA 5FLXL 1KEEA 3VNBA 5JFGA 3L4BC 1I4XA 4OHRA 5HDQA 5LYJB 5I7FA 4NZYA 3S15B 4ZAWA 1D1SA 1EUYA 3CR3C 2YDYA 1AGNA 2OGTA 2BWJA 2VH5R 3GZNB 3EGEA 4YR9A 2BEVA 4IILA 4B7AA 2JGEA 4GX5A 1PDVA 1UPTA 3L4JA 3L7DA 4MKHA 3U81A 3F4BA 2XNHA 3DMRA 4CIWA 3V1NA 3BDCA 4ZVPA 1DQSA 2ATCA 2I71A 1VBKA 2JASA 3CZAA 3Q7QA 1DC4A 5BOSA 1A2OA 2OZEA 1BSVA 3Q9LA 3S2ZA 3KUCA 2C4NA 2IS1A 1KPGA 3AF1A 4TYNA 2Y1OA 3BAFA 3PTAA 4NJMB 5JJZA 3NOXA 4GYJA 4BY1B 2GPSA 1EY9A 1G5IA 2Y1LA 4JV5B 1NF3A 2ENUA 1K06A 1RI2A 2V54A 1POWA 1SCIA 2RGGA 2Z6KA 2CW5A 4NKLA 5HFAA 3AR2A 2V98A 2R1VA 4C5BA 3MPOA 3FHTA 1GNQA 5G0SA 4KDFA 4C4ZA 1JE4A 1DKQA 2YNMD 1T8TA 1NQOA 3PXAA 4FJ1A 1NW9B 4QZVA 4CUKA 2YFYA 3QEBZ 5DLQC 2AE2A 2XGJA 1BGXT 1G9XA 5JJCA 4AMYA 2NYVA 3B5IA 3AXSA 4P7BA 3DXYA 3LW7A 2OCBA 4KN9S 4CM8A 3D6UA 4JOBA 4EAAA 4EMBA 1U8UA 5K0LA 2PTHA 1RHQA 2ZTHA 1IMJA 1Y1LA 4HDCA 2P9JA 2IU0A 3IA2A 4FYKA 3CD6A 2ZGVA 2QW7A 1K6MA 4WN9A 4QVGA 3H5LA 1ULUA 4UULA 2QN6A 3C16C 1WB5A 2XH8A 1FFEA 4K0KL 4IWYA 4IFDH 1RRFA 4Z3OA 3BCUA 4B3SB 4ZK9B 3VNAA 1EK5A 3RRMA 3HOUG 5IN4A 4E5VA 4N9TA 1IZYA 10MHA 2AT1A 2PWYA 3L9XA 3DT9A 5A9SA 4U673 4WLNA 2VSOA 1KSJA 3AETB 3ADOA 1ECJA 2UYCA 4QIWB 4WHMA 4N76A 1GGNA 1N2GA 4G5RA 2FUKA 5I48A 4YALA 2Z04A 1DLJA 1A8HA 1XZKA 3E9MA 1NVKA 4RA9B 3CS3A 4TRJA 5BSMA 3ENQA 2L15A 1DPGA 1W0CA 4HVAA 4YPFA 1XMOL 5KX5B 1O7YA 3OT1A 4U7DA 3GAMA 2AJLI 1J07A 3COPA 2XX3A 3PUHA 3WYGA 1GZ7A 2N49A 4U7GA 2RAUA 3IURA 3DFIA 4PXYA 3TLJA 1UFVA 4CVNA 3WWZA 1PJTA 2Q41A 4GLXA 2CLKB 4D25A 4C4XA 4JCCA 1Z22A 3FKIB 2FGKA 4Y9RA 1ZRSA 4OIJA 2JI9A 2VL7A 1Y8ZA 3GH1A 1RJ9B 1EQ2A 1TT7A 3PHGA 4W6QA 1H1DA 4JOIA 5LWHA 5H83A 1X3GA 3ABIA 1GLGA 1EUDB 2PS0A 1AK9A 4ZOBA 4DCPA 2YICA 4XKJA 1YHYA 3LBYA 1M8JA 3LF1A 4MW2A 2ZWOA 3MPUA 3OEWA 2I22A 1YC2A 4JR1A 2A1TR 1E3LA 1ZUWA 2QRJA 5CMLA 3SEAA 4OVKA 5BY2A 1XHLA 2I67A 4YBZA 1NUUA 1Y9EA 5G3LF 2HMAA 1NONA 3RLIA 3JZDA 4S12A 3DLCA 4AX8A 3JSAA 3W2EA 4ASUA 5JS8A 2QRLA 1VQLA 5LZ2A 1E9DA 2AC2A 4V24A 1R6XA 4NBWA 2WFWA 1ZHOA 3P9KA 5JPIA 1HDRA 5F1PA 1K28A 1JQ3A 5TVKA 4MVJA 1A15A 1A76A 2VL6A 3UAZA 4KXUA 3L8ZA 2EF1A 4JWTA 1FQWA 1CR6A 1IPEA 1VRCA 4PSCA 5C81A 2ZSFA 5C3EB 3RRJA 1QWYA 4F2GA 5A2QE 2AR9A 3WBBA 2H06A 3IAS6 2DR2A 4FCCA 5AW7A 4I4TF 5DNAA 3N0VA 3VOAA 4L5SA 3HOXG 5T6BA 4M0MA 5BXYA 3NWSA 4LYYA 2FRDC 3GMSA 2VT6A 2Y0EA 4INAA 2FPIA 3IESA 3OZAA 4QOIA 2PX2A 1UJCA 3RVLA 4REQA 1R00A 3W3AD 1D7OA 1WMAA 3RB8A 4HJ5A 3A3OA 1J6UA 4FILA 3KELA 3S8YA 3LM8A 2AVDA 5B30A 4DLNA 4IJLA 1EOVA 3IVXA 1KQSA 1I4DD 1VYVA 4S0XA 4H3HB 3WYEA 1NVVQ 2F0GA 2ONJA 3IEKA 1XUOA 1VPLA 5EAIA 4G7HC 4U00A 3BILA 5DYNA 2J3LA 2F43A 3JQDA 3ADCA 1ZC3A 3EIUA 4ZOQI 3ZXYA 4YXFA 3DKRA 4QUKA 5FYDA 4GI5A 4A3KG 2Q5CA 5D3MA 4YCLA 2IUTA 2RHHA 3E3OA 4B0OA 4DVGA 2GNAA 5FLMH 1QB8A 3DQQA 5KWEA 1M6VB 4X65B 3WLHA 3CLHA 3HS3A 1SXTA 2E76C 4WWHA 4J8PA 3J80i 4CR6A 1DE0A 2YV1A 4LUCA 4RTLA 3O4IA 1EIHA 2XVYA 3ZWVA 4PGGA 2FXQA 3W2GA 1V45E 4RCOA 4JVZA 5KVQA 1PBTA 4IDBA 2VRCA 2EWMA 3ZBPA 5M3MB 1NUTA 5A7GA 2VYVD 4LIPD 2H7XA 3AESA 2QU7A 3VYUA 5GTDA 5B3KA 4OOEA 1L1OC 3U09A 1W2WB 2CFIA 5H02A 1KL7A 4D80A 1RS0A 3K9GA 1Q86C 1JICA 1GN8A 4MQLA 1RWVA 4F4JA 5J43A 1BS9A 3RFTA 4K6KA 1XCGB 2J6IA 2QVCA 1OKKA 4Z4GA 4I4LA 4U0KA 1CUXA 3B9PA 1E89A 2QJRA 1S1MA 4TMXA 2XYRA 2MO1A 4QC2A 1PXUA 4F1JA 1NVDA 4KE7A 3BIFA 1QKJA 1W25A 1E1QD 1TNDA 3P0HA 4Q1FA 4J2HA 1I80A 1CVRA 5MHTA 4GKJL 3REQB 4L6TB 5K3CA 4ZQCB 3U50C 1XEXB 3DNFA 1K83H 2F0SA 4P08A 3SQWA 2AFHB 4NQZA 2KSQA 3RRZA 1MHPA 1P33A 1B26A 3BMQB 3WIUA 2XZDA 3D0OA 1YVEI 1QDUA 4KX5A 1D2MA 5C5EA 2C96A 1V41E 3RS7A 2D5IA 2ZBQA 1VYTA 4DV0Q 3QIVA 1KO4A 1J9EA 1NNLA 4G25A 3LDUA 1B3BA 4RG1A 5IJ0B 2Z1CA 2HWYA 2B1IA 1MGOA 4NS1A 4D8XA 1BX3A 3A9TA 4KNVA 1NN5A 4XM0A 4LF6B 2WD8A 5YASA 3QLVC 3NJ8A 4BQRA 4EGFA 2CYAA 4PZYA 1Z5VA 5E7JA 4G57A 1GGJA 4O4HA 2X69A 4P3XA 3LY9A 3WY9A 4GBMA 1ZNWA 2O3JA 2UXDL 1XMQL 4D8WA 4RMIA 4LF7L 1ZH6A 4QGGA 4P4NA 4R83A 4TXHA 5HKKA 3ECSA 5ESRA 1BW9A 4IH9A 3DO8A 1CY0A 3A10A 3P8ZA 4OM8A 2RHLA 1Y82A 4S1TA 4E1BA 2WDZA 1DINA 4R81A 4R7TA 1XCBA 4HNRA 2I4LA 5JZMA 1NAIA 3QVJA 2H1EA 5CFQA 3TDMA 2R93G 2NZVG 4BYGA 3I1JA 1HI9A 1PWEA 3CZQA 3QV1A 2H2IA 3MD0A 1QB5D 5G2OA 1W3SA 3CCUA 3OQJA 2X1VA 4BNTA 1SMKA 3STBC 1ESDA 2XOKA 1OXMA 4HNHA 3L8YA 1NYTA 1D2EA 2GESA 3TLAA 1QLJA 2CV2A 1TT5B 1Z47A 4HGNA 4HH1A 4ZAYA 2CB9A 3WDSA 3SKYA 3B2EA 1DXQA 4M1KA 2BHTA 5I9SA 2ZJ0A 1KK3A 1K66A 4KY5A 4PONA 3WOVA 4IIEA 4TL6A 4XWGA 2B2TC 4OBBA 4A3MB 4U8GA 5ER9A 4C4RA 1U7WA 5A2QL 1WFQA 4OCZA 4JLPA 4OOFA 1QFYA 2JGKA 3OM9A 1NY4A 2PT7A 2G07A 5BRJA 2F3WA 4LKOA 2ZS8A 4P86A 4GPTA 2YHIB 5FKAC 1DVRA 4ND1A 1OH7A 2WMYA 1ML3A 2GBFA 1G98A 4UW9A 1KEVA 5E9JA 3GAZA 4YEDA 1XK6A 4WOJA 1BJRE 2BC9A 2B21A 4WZZA 2ADOA 4HUTA 4KQ6A 2X2OA 5C4MA 4ZOAA 2EKBA 2RFLA 1AUPA 3LHIA 1XDBA 4DSNA 1VZ3A 2ZPTX 3G2MA 3F9RA 1JAZA 3E0JA 1TO6A 1PNTA 1E3MA 3O9ZA 3ISVA 4FW8A 4RMHA 2I80A 2MUYA 4PHCA 3LY5A 1A7UA 4HFJA 3ICQB 1T1SA 3KDFB 5HMMA 2EHJA 2IDJA 3Q7TA 2RKOA 4EKNB 2PIDA 1EQVA 4OSPA 4YWLA 1N5DA 1A77A 3T3PB 4G36A 2EY5A 2M32A 1H4TA 3IPXA 4K1XA 3U7IA 2J67A 2PBRA 4DM4A 2WVHA 4DKJA 2Q3DA 2QN9A 2AOUA 1KL9A 3WV4A 4AO7A 1YS1X 3AQQA 4EY3A 1STNA 1NXVA 2PYDA 4XASA 4EJ6A 5ALUA 1JOKA 2R3SA 1BCPB 3UN1A 1U3FA 4GH5A 4OFZA 2FX3A 4P73A 2V5VA 4DBVO 1XA3A 1Y1KE 1W5AA 3EZYA 3DBRA 2UUCB 3CA8A 4ZHQB 3VPFA 2N78A 3SSOA 4FO2A 3SSMA 1GP2A 3AHHA 1GTMA 4RC9A 1JG1A 3BFKA 1KEPA 4C3JB 1Y6RA 5CCBA 1K4MA 2WAQG 1GA4A 5PNTA 4DZRA 3HSKA 3N28A 1K7YA 4FNMA 4I50F 3C2PA 1G7CA 1L7MA 5G02A 4HWOA 4DTCA 4BGVA 3AMVA 1PA6A 1XD8A 3ND7A 2PMZB 1B41A 4WXPA 1M2OA 1FYVA 2QQGA 3AEQB 2CXUA 4KBFA 1Z07A 2BTQA 1LV7A 2H00A 4NW2A 2NM0A 2XUQA 1W30A 5SYNA 3P5SA 3ZQJA 1K68A 1G2OA 3PGKA 1HQCA 2IP2A 2H8KA 4GIBA 3MT7A 5J5AA 1I3QB 1SVMA 2V7QA 3F2UA 1JKXA 3OUTA 1FMCA 2UUOA 2I99A 1R6AA 5CNMA 1XI2A 2PZAA 3AUXA 1PG0A 4CT5A 4KBYA 2PZWA 3C6ZA 3OJFA 1H2BA 3FGNA 3QWIA 1XDUA 2AMLA 1H2ZA 2LY7A 1WSWA 3CEPB 2PKWA 3KF8B 2FPSA 1EFAA 1KJYA 2GVDC 3BEDA 4LE2A 2NSLA 2PGNA 2D0OB 4BZWA 2ZSAA 2AQKA 3UUEA 2VPQA 2XF8A 1CERA 4AJKA 4YCJA 3VR6H 3T3MB 1QS0B 4V1CB 1II3A 1DAFA 4KWEA 4OA8A 1EBUA 4FSXA 2KPOA 1NYLA 4YLEA 4FZRA 5K51A 2DPGA 2ZYIA 2YY5A 2RARA 3HCOA 3V7NA 2NZYA 1V37A 2ISCA 5GVRA 2C5AA 3GT3A 1IY8A 1PN3A 4IMIB 2QL9A 4DJ5X 2QD5A 1U6KA 2WJ4A 4PYMA 4HAOA 2FMTA 1EJ6A 4DR1Q 2YYZA 4WVFA 2WA1A 4OHJA 5H4HA 2A1UA 1RXVA 1EBFA 5JTUA 1ZKOA 2VHZA 4NU8X 1KRWA 4PFQA 3PQ5A 1H9JA 3BYTB 1BU5A 1AKVA 1JE1A 1ZUD1 2NO6A 3OTOQ 1SBTA 1ZUNA 5B1HA 3EVCA 1N0HA 1RHMA 1P6QA 5FPYA 4HSPA 1WLYA 2I6XA 1MAUA 3VM6A 1E5TA 4WZAA 3E3MA 1DOZA 5IP9G 4RMGA 3NEMA 5CTAA 2ZE6A 1FX0B 4OGWA 3AFOA 3OF5A 1UK8A 5I7AA 1YI1A 1C9DB 3A4NA 1A3UA 1QGOA 4PC3A 2PMFA 1F2DA 4XYLA 1A63A 3FTEA 2IKSA 3IT1A 3W9BA 5FWDA 4KI7A 2DQYA 3HV0A 2PRJA 2AG8A 1JLLA 2CMHA 3C1AA 3Q15C 3WZ2A 1WBJB 1LPMA 2VJAA 4KFCA 2Z0SA 3CGGA 1SZCA 4GGPA 1XJWA 4FQ8A 3PDIA 3OLWA 4E22A 3W1EA 3IP6A 2G8NA