4KHZA

Crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 89
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4khzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4khzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4khzA01
4R1JA 1KK0A 4L5RC 4Y7NH 1Z22A 3CXCA 2GDJA 4JYAQ 3CBQA 4DRZA 4M0LA 3TUZC 5HZHA 4LJ7A 5DYGA 4M1SA 3PVSA 1H95A 4XD7A 1XD8A 4JVMA 1H65A 4AH6A 1YEZA 1GD7A 1PVOA 2VLIA 4F7WA 4AC9A 3MEFA 3PXGA 3IGFA 4LWZA 3U3RA 4A3IH 2QUZA 1VS0A 4EX5A 1S72A 1EYGA 2C03A 4N1AA 4DR3L 1S9DA 3S1MH 1V1QA 3KJOA 1W0KD 4I1OA 4XJXA 3IPYA 2C96A 5M3MH 1I3QH 2A3RA 2ZM5A 1FJGL 1WE2A 2NVXH 3HOWG 1M1YE 2PZGA 3PR1A 4X62L 2FH5B 1FOEB 1GM5A 1LB1B 3TBKA 1LS6A 3CWZA 4IPDA 3CF0A 3ETLA 3Q9LA 5CIQA 3TAHA 3VX3A 4C7OB 1J5EL 4KN7C 4D0GA 4KKSA 3GQBA 1MJEA 2G77B 2OHFA 2ZSFA 4KLZA 4PMWA 1KI2A 5FBWB 3LW7A 5A4JA 1QVCA 4A4DA 2PCFB 1TAGA 3M6AA 2WWHA 1E1RD 1NLZA 3O8RA 2PNHA 1E2MA 1E2DA 3KF6A 1E9BA 5D3MB 4D4KA 1VCIA 1O7IA 2FFHA 5BN3A 1Z7TA 3BH6A 3LX8A 5FJ8H 3TJZA 3EX7C 5FI1B 3I62A 5FBLB 2UUAL 3LO5A 1XEWX 4JBYA 1BBUA 1YHQA 1E4VA 3FYHA 3L8YA 1IBLL 3LNNA 2QMOA 2KBFA 3AF4A 3B13B 1ZM3A 1JJVA 3STBC 1FL0A 4PG3A 2H57A 5IWAL 4BY7H 4LNQA 3TE6A 3ZIAA 3KX2A 3T51B 3ASZA 4O2LA 4DK3C 3SJCA 5KOYA 1S3OA 2ZRNA 4IDPA 1XEFA 1VQAA 4H02A 3DDCA 3WNDA 4BEBA 1KD1C 5E7JA 2JGNA 1DELA 1CP2A 4MTNA 4DIDA 4TMXA 1G17A 1O87A 1VPLA 1A7JA 1U8YA 1G16A 4RCNA 1EG7A 4OKSA 1NI3A 5KHOC 2YINC 2GHIA 2XSZD 3RAPR 1Y1VG 1SKYE 3N5CA 2IY5B 1ZMXA 2GF0A 3U3KA 4NONA 2ZSAA 4LGMA 1JJCB 3GLFE 4DIEA 1W4RA 1SVKA 3ECCA 1TF2A 2GESA 4RKEA 5H68A 1KDPA 3TW8B 3V4FA 2WAXA 2OZEA 1EOVA 3RSLA 4RZUA 4B74A 4C2MH 2YV5A 1CIPA 2OXRA 4A2WA 1Z28A 2XTZA 2Q2IA 3FKSA 2QG6A 2NZJA 4A2QA 1DVRA 2JLSA 3KFVA 2D3WA 2TMKA 1RVDA 3D3QA 2HT6A 3OIYA 4MRRA 1YR6A 1ESMA 3A8JE 1M8PA 3ZGXA 4B2IA 3WYFA 1T5IA 1D7QA 4HEJA 1YR8A 1OKKA 3E1SA 4OHWA 1GTVA 5EP4A 4MKHA 3KLRA 1V5WA 3CB4A 4G3XA 1YJ9A 3CKLA 3B7GA 2OV2A 4IJLA 2GXSA 1CJVC 2OBNA 4OJQA 2ATXA 4OQNA 3HDTA 1C9OA 1G6OA 1F2TA 2VQFL 5EP3A 2PJZA 4BY1G 1VF7A 1NJGA 3S24A 4JI5Q 1FX0B 2ZR9A 1V8QA 1VQGA 2ZJ2A 2I1VB 5IRCD 2K5HA 2IF0A 5LD2C 1F2UA 3BFKA 2NO0A 3PG5A 5FTJA 4AIIA 4LUVA 1VQPA 2N1BA 4R9UC 2PH1A 4ZKEA 2R7ZH 1PH3A 2UUCQ 3AEZA 3B1XA 4GZLA 2ZJPA 5CM8B 5CDFA 3EIHA 2D06A 2ERYA 2JDIA 4JG2A 2C9OA 2R7DA 3CX7A 4RD1A 2D5DA 3OE7A 3OTOL 5CYOA 5JSZA 2KWIA 2Z6VA 1SVWA 2VF7A 4E5UA 4QJ3A 4ZCLA 2IXGA 1P61B 4OWWB 3B9QA 4LWCA 2K50A 4DV6Q 2DN8A 4GNXB 2IWHA 1XMVA 4GP6A 4PPQA 1VDZA 2I5MX 1S1MA 4Y52H 4OI1A 5IP9G 2MSCB 4HUTA 3SR0A 1Y8OB 4BXXG 1QZXA 1ZUNB 4H9GA 1US8A 2DGYA 1N0WA 2KHJA 1VQ5A 1GAJA 1XEXB 1EWIA 1KDTA 2Z43A 1HCZA 3F2BA 3UIEA 4ASUD 3DXJC 4LJZC 4JI4Q 3EPLA 2AKWB 2RB4A 1FR3A 2VL7A 4H1UA 4HLCA 4Q66C 3SHWA 4TLDA 1TWFH 2ZJYA 2HT1A 2BMJA 1OYYA 5GAGC 4A3CG 5FLMH 2VUMG 2YWFA 1VYTA 4GOPC 3I1FA 4L5BA 2X2FA 4MGYR 1CKOA 3VX4A 1D5CA 3ZD7A 2XGJA 2EDGA 1CU1A 4JLMA 2ZRCA 4GL2A 1HTPA 3LBNA 5C4JH 1QVFA 1CJUC 4X8LA 2C98A 2QQ0A 2ZSEA 4AK9A 2GNOA 1VQ6A 2DNCA 5M5YH 5DI3A 3J81c 1SVSA 3KZ1E 4B3CA 4JI3Q 1Z6HA 3ZIAD 3B6EA 1JJ7A 3KL4A 3DKPA 3IEVA 1X54A 2F52A 2IUSA 2GK7A 2QN6A 3GLFB 4P4SB 3ZVNA 4YCWA 2OSBA 4HATA 2EFCB 3RRMA 3U61B 5DI3B 1KJWA 2ZE5A 2JIZD 3THWB 5JEEA 1N3BA 1AA9A 3F5FA 2B7BA 3GTGH 3M7NA 2FFBA 4QNRA 5FBRB 5TDHA 1FYCA 3F2DA 3CC4A 4DHEA 2JJ1D 3FHCB 1OT3A 1E2IA 1I94L 2WJIA 1QUQB 1P8LA 2PX3A 3CRMA 3U4ZA 3W8RA 5DH9A 5JCPA 5FBQB 3KFUA 1R5NA 3ERSX 1FQJA 1UE1A 1VTKA 1ZYUA 2AKYA 1Z47A 1G3QA 2EFGA 2ZANA 1HNXQ 521PA 3W1BA 1G7CA 1W2BA 5JRJA 2A19A 3QXSA 3H0GH 2Z0MA 3LBHA 1GUOA 2FXQA 2WWFA 2ZU0C 2CDNA 3CH4B 3SDZA 1QZHA 1R2QA 2NQ2C 4IJHA 2HHHL 3OW2A 1NBMD 2HLDA 4FWIB 3IKJA 3HOZH 3RNUA 4OO1I 1L0WA 2F3IA 4JI0Q 4KAXA 3RS3A 4LDJA 2GJKA 1W5TA 3CNNA 3NEMA 1IL2A 2B8WA 3KXKA 4WBSA 1T8UA 4A9AA 4DV0L 2W6JD 3V9PA 3WMFA 2NN6H 2BWJA 2ID0A 1GWNA 3WNCA 3LXXA 4QBHA 4R4CA 2KHIA 4YMWA 3CW2C 3GFPA 3RR5A 4TVAB 4JBXA 3T1YL 5FL7A 1BH2A 5AUNB 1XMJA 1ZM2A 4HIKA 1F2UB 2F9MA 4BY7G 2XEXA 1OYWA 3OEHA 4Q00A 3HOWH 1EFHA 1A2BA 2EVBA 2DHRA 3SFZA 1KJZA 3OTOQ 2CVHA 2RHMA 4RD2A 2BH8A 1E2HA 3H4MA 2OXCA 3GJ4A 4LHZA 3BJUA 1YZNA 4FMCF 3T06B 2QI9C 2OCEA 821PA 5A5GA 2GEVA 2BBOA 4JJZA 3UATA 2GAOA 2A8VA 1TEXA 2BKUA 4BRWA 4M1KA 4CEIA 4X8HA 2G9NA 5KU1A 2OM2A 3DEFA 3OYYA 3A4MA 5LMUL 2JE6I 4KV9A 1F60A 2D7DA 4XVRA 1UBEA 1MO6A 2JA5H 5DGXA 5KDOA 3T1TA 3WP0A 2ZRPA 2HDNB 4ZDKA 2REBA 2RGXA 3ZH9B 3T15A 1J90A 4P3YA 5AUQA 3GTKH 4DUZQ 4GKJL 1TU3A 2F3RA 4NCJA 5L3QB 3KQHA 1W3SA 2B29A 3WHKA 1XTDA 2VHCA 4GN5A 3BDOA 3BH0A 4NKRA 5DHFA 3FPAA 4AURA 4IOAA 2IUUA 3EZ7A 1KI9A 3W3AA 1EFRD 2WJJA 3MWLA 4BY1H 1WXQA 2YHSA 5CM9C 1AGRA 2AK3A 4KU4A 4KJZA 1PLJA 2F43B 3MMPA 5ELOA 4DCNA 3K0EA 3NBZC 3UG7A 1HPCA 1IBKQ 1C4OA 1CR0A 4J15A 1SQ5A 2XOKA 3FFAA 5G40A 1U81A 4IPHA 4R7ZA 1GFIA 1H9SA 1JXMA 1XJ0A 2B8GA 4L4UA 1VQLA 3MJHA 2PL3A 4JT4A 1QG2A 4U5XA 4ARZA 1ASYA 3V4RA 1RRPA 2Y8EA 4JLOA 1XNQQ 2BBWA 1E2FA 1NKSA 2C77A 3DZDA 5DLQC 4TTRA 2XNDD 4LYJA 2V1UA 1KRTA 2Z83A 1VQMA 2ZS7A 3JAMc 1G20E 5E4FA 1R0WA 3ZYCA 3RC8A 1JAHA 2A5GA 3AH8A 5IP7H 3CC2A 4DR6Q 4UJ3A 4A3MG 2LCFA 3KKOA 1LTLA 5M5XH 3U44B 1YJ5A 2J59A 2JEOA 3IQWA 4O3MA 1BO6A 5C0XG 4QM6A 2O8BA 2A6HC 2XAUA 2Q8IB 3S1QH 1GOTA 4QJ4A 3IRBA 3PCRB 4CT4B 4A3LG 4BFWA 1N34Q 2WKQA 1YIJA 2HF8A 1DCZA 2YOFA 3GLHB 4M8NE 3U7FB 2O8EB 3GLIA 1WYDA 1AE3A 5TARA 1Q57A 4DJTA 3U44A 2BDOA 4JBJA 2GF9A 4I81A 4QGHA 3BIFA 1KSHA 4PHTA 5HR5A 2WJVA 4DV0Q 5KPJA 3NBHB 4A6XA 5IT5A 2XZOA 1H8HD 2J7PA 5LD2B 2XITA 2HQLA 1Q1QA 1HH4A 3WHLA 2AKAB 1GHKA 3PIPA 3Q5EA 1SGWA 4B6EA 4UNRA 4LJ5A 2NPFA 1WB9A 5JMTA 3M4OH 5DLQE 2W00A 4WZ6A 1P73A 1KOFA 1HNXL 2QP3A 3CW2A 3K09A 1LTQA 3GEHA 1IJEA 1B0UA 1K83H 2WSMA 3QVVA 4HAYA 4DCVA 4B76A 4DDUA 2ZRIA 1ZJ6A 4URVR 2Q9AA 3KXLA 1IXZA 1CUKA 1QBKC 1XTKA 2YVUA 4R2IA 3REGA 3RS7A 1W36D 4Q1AA 3RHFA 2ZSBA 1E2EA 4HB4A 1DAKA 4URZR 3K0SA 3KXIA 4LSGA 2KJQA 1IY2A 2ZM6Q 4LHWA 4X66L 2EVWX 5C3EH 4B75A 1I5FA 1P6XA 1Y8NB 3H86A 1KMHA 5L3SA 3A58B 2MSDB 1L2TA 1DAGA 1JB7A 2ZAOA 1G8PA 1MOZA 5C46F 2AX4A 5CK5A 2QQEA 4LBZA 5IK2A 2DUDA 2RF4A 3I61A 5FLXc 4LJ8A 2H5EA 4V0MA 4H1VA 4UKDA 1XJVA 5L3VA 3BG3A 5GADC 1G7RA 3LV8A 1KI6B 1Z0DA 4LC0A 4DLZA 1UAAA 3PEYA 1GRRA 2CLDX 1H9RA 1W44A 4OX9Q 1W1WA 3N70A 1TWAH 2QGQA 4JI7L 2WOJA 1YVCA 1OIVA 4QBIA 3RABA 2JLUA 4JYBA 1G3RA 4X8OA 1IM2A 3M85A 3J81i 1PZNA 4EFNA 2VQFQ 5IE8A 3VU9A 2VRWA 1CTMA 4JZKA 3R9XA 1YJNA 2EJGC 3DLLA 3SJBA 3EIVA 1AZTA 4GI7A 5J5CA 5BR8Q 3MXNB 3UPUA 3IILA 2XOKD 1ZKOA 2FWRA 1YQTA 4FN5A 2GVAA 4RG1A 3QSYA 1EK0A 4ALPA 2O5JC 2YWGA 3OF5A 4BZPA 2VP2A 3UK6A 1J7KA 1OF1A 1SHZA 2GCPA 2HV8A 4DV7Q 4B3TL 2ZYWX 3QUSA 4QHYA 3T5GA 3DO6A 2KB0A 4BUJA 3PO3H 2OTJA 3GD7A 1T0HB 2P5TB 3I8SA 4MKIA 1M34E 2ZRKA 1C7YA 1Q8KA 4IKEA 1II8B 4DV2L 1ZRHA 2BJVA 5DHAA 4BBRG 2FG5A 5DISB 5KSPA 4A3EH 3RLNA 1N32Q 3P26A 2IWRA 2NZ8A 4Q4HB 2IYYA 2QSZA 4HAUA 4YDHB 3LRPA 4D4MA 2N3SA 1QHNA 5LPNA 5GAHC 4DUYL 4NXML 2FFAA 1N2CE 5DO9A 1P60A 2H16A 1W36B 1WMSA 1XRJA 4IFDJ 2IX3A 1IW7D 4JI6L 5G3YA 2VS1A 5KDLA 3SOPA 4DDTA 4YCUA 4V0NA 1AIPA 3C41J 4KHPL 1L2FA 2UZ3A 4DLXA 1P9NA 2QNRA 5HKKD 5J4LA 4MRPA 3BJIC 3BFXA 5J3BA 5C0XI 4LFBL 1DAMA 1OSNA 1Y14B 1E79D 1XP8A 5GAEC 2AL7A 2MQHA 2H7VA 2B6HA 3SC3A 5FI0B 1OKKD 5GJBA 1YE8A 2CBZA 5GADl 2QTFA 2GCOA 4LRWA 2EFEB 3C5CA 2OCBA 2ZXUA 5K8IA 2ZTCA 2A68C 5LMNQ 1BOFA 1TNDA 4HJ7A 2F1JA 2RGBA 3KTAB 3Q3JB 2KBEA 2R93G 2DWPA 5J4VA 1GKHA 3PUYA 1P2SA 1I4TD 2CVFA 1YVDA 4M21A 3AKCA 3WYGA 2OBMA 4X66Q 3CPHA 1J70A 4FXPA 4YMVA 4M53A 2AXNA 4QRHA 1R6BX 1E2GA 5TY0A 2F7SA 1R0ZA 3T34A 2FDCA 4QJ5A 2ZETA 4YCVA 4LV6A 1TU2B 1E2JA 3TLXA 3FGNA 4BWYA 4DCUA 2B63H 4JI8Q 3C16C 4Q9KA 4Z8XA 2JXMB 2Q2HA 1G3MA 1HNZQ 1H8ED 3ADDA 2J41A 2ZU6A 5UKDA 2D2EA 3TQYA 1NVUQ 4HJ5A 3E2IA 4KVGA 2QM7A 2DB3A 3S15H 1E1QA 4YMSA 4B3FX 2ODBA 3ADCA 1E3PA 3H0KA 1JAIA 4GNXA 3FPPA 1NBMA 2HLDD 3KDFA 2NOAA 4DAYB 1SKYB 1CLUA 1E69A 2D62A 5IK2D 2VP0A 1KYIA 3EIEA 1N36Q 4FMDF 5HCIA 1NJFA 2UXCL 2UKDA 3QQ5A 4XD7D 5IYCH 1E9EA 4HAWA 3HKZG 4US0R 4A0HA 3A7AB 1QVRA 3QF4A 1IYVA 1UEBA 1D2MA 1JR3A 5H70A 2UU9L 1YZGA 6Q21A 1ODFA 4LFAQ 3M1IA 1K8RA 1B7YB 1W0KA 3OEHD 1HE8B 3S2HH 3FB4A 3UXMA 4RD3A 4TYYA 4HIMA 4IO9A 2G88A 3GLHE 4JLAA 3CR7A 4ARZB 1J8YF 5IHPA 1UKZA 4IFDH 2EIFA 3OIUA 4D80A 5J47A 4B3TQ 1EESA 4L8GA 5K8TA 3UWOA 4M9XA 2VW9A 1BKBA 1Z2CA 4PSKA 4A76A 2HYIC 1L4YA 2WJYA 4ZCIA 3CF6R 5BN4A 2UVQA 3UDGA 2GN5A 2FU5C 5CB6A 1X6OA 1YZUA 1VF5C 3HFZB 1KZGB 5CIWA 4DR7Q 1RRFA 3AYHB 1NN0A 1W47A 4RFSB 3HYTA 4O2RA 3EPJA 2WBLC 2UXBL 1OH6A 2EYQA 1IYJB 4Z1MD 2PT5A 1X55A 2A6ED 3CRW1 2OT3B 1Q21A 3QY0A 2UUBQ 5C0XH 4BBRH 3AVOA 3DMNA 4UNPA 1NVVQ 3H3VI 5BR8L 1Q3HA 1FJGQ 2FSHA 3CM0A 3GFTA 4W5JA 4WZBE 2PQAA 1MABA 1HURA 2RGAA 2I3BA 1IN4A 3QBTA 3LGJA 2CQOA 2YTVA 3RLOA 1VHLA 4LFBQ 5ELXA 3HJNA 3KB2A 3RNLA 3N6RA 3I92A 5HZKA 5LB4A 5C0XJ 1F5NA 2WJHA 3SS8A 4DV7L 4AG6A 3B1ZA 4FMCB 1N6HA 2JLYA 1GKYA 3KJEA 2PQAB 3HOUH 1MABB 5EE5B 4EPXA 2RMKA 5JEAG 2JEBI 4A3MH 4KYUA 4Q9LA 4DV3L 1GNRA 4Q9HA 2IYSA 1D8TA 3UG6A 4LW1A 2ZVQX 2VH5R 1W46A 2DY1A 4LF8Q 2C9CA 5F98A 1Q22A 3I4NH 4A3BG 1X3SA 2BV3A 5JJLA 2GJ8A 4DSOA 2B21A 2JASA 2VQSA 3I32A 1HR0W 4BLSA 4GDFA 1R7RA 4V0ME 2XTIA 4PO1A 4DEYA 2R8RA 1FVIA 1HNWQ 4IDNA 3R9IA 2ORIA 1MKHA 1OFIA 5FBVB 3K70B 2YU9H 1UWVA 2FFQA 2QEQA 3ICQB 1GG2A 3K1JA 5B64A 2ZTSA 2O8FA 4I1VA 3CNOA 1GUSA 4PO9A 1HNZL 4TL8A 3PUVA 3P1JA 5C2JB 4GLAC 2Y0SE 3LVRE 3P4XA 2C8VA 3ZZTA 1NVVR 2R6GA 3JC66 1E22A 1Z9FA 5LMNW 1XBTA 4KODA 1ZU5A 2A5DA 2JA1A 2ZEJA 1B9NA 1EQQA 3W34A 4PHFA 3U2QA 1AS0A 3IIMA 3QENA 2OO7A 4J0QA 3ND9A 5AJ3Q 5LMNL 4P4UA 1M7GA 3HYRA 2CWAA 1ZUHA 4PO8A 1AH9A 3TVTA 5LDDC 3DKVA 3O8CA 1T9HA 1GUGA 3QF4B 2ZJQA 1KK3A 3K70C 4LV5B 2FGKA 4TQAA 1DPFA 3R8CA 3H84A 3U4VA 5CJ2A 1X65A 2CCKA 4Q7LA 4XOIA 3QKUA 4GT1A 1X1SA 3VR6A 4B35A 4DR5L 5DI9A 4Z51A 3THWA 4TLEA 4FCVA 4B6FA 2DNEA 1QVGA 1XTIA 3N2EA 3NHAA 4HZUA 1S96A 4ZIRA 1Q90A 1T3HA 4PAMA 3IUYA 3CRVA 3LXRA 3UANA 1GZSA 4GP7A 4KBGA 4HB3A 5M5WH 4O25A 1Y1VH 4IPGA 4DR4L 5EE3A 3ZZ0A 5J4YA 1SN8A 2GVBA 3RWMB 2WB1E 3LD9A 2PMDA 3X1YA 4NXNQ 4KBFA 4G7ZC 4M1TA 2J46A 4DNRB 2RAPA 4LOAA 3TS2A 3GJ0A 1LVGA 2PEZA 1I2DA 3VHLB 5FPKA 2BCGY 1G8YA 1Z0KA 1NIPA 1N0UA 2WPDD 2ZRFA 1NY5A 1T6NA 4RD4A 4F4CA 1G4UR 1N6OA 4P75A 2KE5A 4LF4L 1NLYA 2W2TA 5DN6A 2VY3A 3CCJA 3RS0A 2EWWA 2WIBA 4HZUB 3RVBA 1SXJE 2UUBL 3U7EB 3R8FA 4B44A 1GKIA 4L8JA 1N33Q 1LABA 3QOFA 1KKMA 4Q02A 4A8JB 2JCSA 3LBIA 2ZQ5A 4FMDB 4ZPXA 4D82A 2O8CB 1NMYA 1YHNA 3TGPA 3KKMA 5HTKA 2WVJA 4PC1A 1TKWB 4UP9A 2VQEQ 4NYJR 1OH8A 4M1YA 3X1DA 3QKRB 1PH7A 1PLKA 3ER0A 5JECA 3M4QA 3I4MG 4GNXC 4IEEA 5E7MA 4LYAA 2BBSA 2V7QA 2YYZA 4BLOA 3CPEA 2ATWA 3QE0A 4X8MA 3SJZA 1Z8FA 5EE0A 5C44H 5IDVA 4B71A 5KYKA 4TZ0A 5HE8A 1KI3A 3E0EA 4ZI3A 3GLGE 1FMJA 4Q4AA 5H1YA 3GJ3A 4US1R 4A0RA 3PIOA 4MGIR 4IFDG 2C35B 4LF5Q 1N6RA 1TADA 2B8TA 3W6OA 1N25A 4YHHL 4JBWA 2YZ2A 1E2KA 2NGRA 1E1RA 2CE7A 3CQZH 2JIZA 4NYMR 3L2PA 1R8SA 2KSQA 1FP7A 4HLDA 1BMFA 2BHRA 1FUKA 2BIFA 5AJYA 2L0XA 5FPHA 3K0CC 4NDZA 3REFA 5GVRA 2LKDA 4CEHA 2KBNA 4KLNA 4QC2A 3RS5A 4AKGA 3THYB 5JJIA 3C8UA 4IW3B 3U3JA 4F93B 4OHYA 2BBTA 4NHOA 4ME3A 4QM7A 1XZQA 2HIVA 4GN3B 1I4DD 5K36G 2YNMA 2QRNA 3EBEA 1S3GA 4GMDA 4DK6C 2QAGC 2XXAA 4JI3L 1MR3F 1RIFA 2XX3A 2J5XA 5KNCA 1VQCA 2NO6A 1TUEA 4QXAA 4W5WA 1JR3E 4CRWB 3W5OA 3J80c 1KIXA 2ZJAA 4D2IA 2BE5D 3ZVMA 4A36A 3K80C 2W2XA 1S40A 4AY2A 1G5PA 2VF8A 3G71A 2QZ4A 1CSPA 1Y1WG 2ZT9C 3HU3A 4JVSB 2BOVA 2IBMA 4PSAA 1XTJA 4UQOA 4X6AH 5EUMA 3MWKA 4NPHA 1MIUA 5GJVC 4GPTA 1A6XA 4A8JA 1JR6A 3AF0A 3HOVG 3SGIA 2IX1A 2P6NA 2VHJA 5F2EA 3A4LA 2GVZC 2H8KA 1Q81C 1E0JA 4PV1C 5FL7D 3W6PA 4LY6A 3LLUA 4GLXA 2Q21A 4C4PA 4MDEA 4A3JG 4JLKA 3BB3A 1SR3A 3NKVA 5E7IA 1R5BA 4ZKDA 4KLKA 2R7ZG 1CJMA 4BXXH 1A82A 4IOKA 2VSFA 2XJ9A 1S2MA 1XZPA 4L5SA 3VR5A 3LA6A 4C2UA 2AXPA 2J45A 1TQ4A 1JJGA 3JZMA 4D0LB 3A5UA 3L0PA 2EXDA 2XGTA 4XTCS 3RRNA 1ZU4A 2JJ8A 1CJKC 3IHLA 1GILA 4LJAA 2N8NA 2BDTA 1VG0B 4A4IA 4DR1Q 2DWQA 4AYTA 2ZR0A 4E07A 2FOLA 3SFVA 1RRGA 3AGPA 1IZ6A 4PQRA 4ZIRB 3VA7A 2W6IA 4NCIA 4W7SA 1XNQL 3GP8A 1E96A 3RZDH 1G4AE 1Y1WH 3AF3A 3K9GA 3TKLA 2PI2A 1WF3A 2JEAI 2C78A 2BH2A 4EFLA 1T5LA 1HQMC 3A8KE 2IF2A 4N0DA 3SJAA 1OJLA 5DE3A 3W5IA 5L8VA 3H15A 4Q5IA 1S4QA 3K70D 5IWAQ 1DADA 3HOYG 3HKSA 3CCLA 1NP6A 4LF6L 5HY6A 2VTKA 4QHTA 3R7WA 4D4LA 4XWOA 4IOMA 5B57C 2LXJA 2UXCQ 4KMUC 4CT5A 1E6CA 1ZNYA 4Q1DA 3FE2A 2WAQG 5IYBG 3THOA 1D8LA 4CF7A 3J7ZC 3HPRA 2NVYH 4JIMA 2P2LA 4LPKA 1OV4A 3HWSA 1XTRA 4DSNA 4LBWA 2ANCA 2DWOA 4LCBA 2QRZA 4EUNA 1GUAA 1QHGA 2R6CA 4LF7L 2G1JA 4HB2A 4KN4C 3PF5A 3SN6A 1K8GA 1ETUA 1VQ7A 2FEOA 2X1VA 4B33A 3DVLA 2G0TA 4B3XA 5CYPA 4FDBA 1CKNB 4PZ6A 2PCLA 4KO8A 3I4NG 4OGQC 1E1TA 1VCMA 4OO1G 3U4QB 1GIAA 3J81k 1EXMA 1XEWY 4AYWA 3N2IA 4A3GH 1IY1A 4JBKA 1COWD 2CW0C 3CZQA 1RPZA 1JQLB 1KY2A 3EC1A 5AR1A 3KJHA 1NMGA 5JWOA 4Q21A 4WIAA 4HUQA 1SROA 2UXBQ 4U7DA 1PUIA 4NYIQ 1GL7A 1R5OA 4FCWA 4WJ4A 2Q3FA 3I4MH 2WV9A 4A2PA 4CYMA 1MO3A 3S1AA 2IS4A 1BVSA 5JSZB 3TSOA 3VQTA 4RVCA 5M3FG 2H17A 3HU1A 3A8IE 1KSGA 2ZM6L 2YTYA 1NSFA 4LK1C 4EKDA 4HZIA 2LXKA 1NSTA 4DT1A 2JA8H 3EWSA 2JJ2A 3LDAA 4TYPA 3KB1A 1R8QA 4AIMA 2NO1A 2J0VA 3LQQA 1SULA 1UKVY 5CK4A 2IHBA 4IOLA 2IX0A 3IIKA 3EZ9A 1IN5A 1Z6TA 4FW9A 4NH0A 4OK5A 3WBJA 1LFDB 2JJ1A 3GEIA 2E2IH 4AQYQ 2BCJQ 2H18A 3EIQA 4RFSA 5SZKB 2HJGA 1F48A 2QGZA 1M1KC 3NTUA 4MRVA 4V0OA 1NVWQ 1SXJA 3MAAC 4JYCA 4B3ML 4B3GA 1VYUA 2NN6I 1YZLA 1N5IA 3D31A 3RS2A 3AQQA 3NC0C 3HR7A 4MNOA 3AB9A 1E2VA 1N6LA 3ASYA 4DXAA 4NYMQ 4MZ9A 1O3YA 1GNQA 1HT1E 2CNWD 2A2ZA 1DGSA 4G5GA 4GOJA 3TRZA 1L7VC 3MJRA 3S1AB 1DARA 2VYFA 2BJWA 3P32A 1X8JA 1Z08A 4P4TA 4IQZA 1QHSA 4QBFA 3PGZA 2QBYA 4Q9IA 4UP8A 5IYCG 2XZPA 3BXZA 4ITRC 5JS7A 3THXA 4GOPB 2GCNA 1E2QA 2W2VA 4YONB 4JKYA 3VKWA 1E0SA 2GKSA 1OH5A 1BBWA 4DLVA 1G3IA 2GBLC 3AFPA 2WJGA 2F1MA 3CRKC 4XSGA 4AKEA 3U4QA 3KUCA 1V9PA 1S1CA 1M2OB 4DV4Q 3CAMA 3E70C 1M6NA 2CL7X 2OFXA 3PEUA 3QKSB 1G8FA 4QKQA 4P73A 5F9FA 2HUPA 5FTMA 1E2WA 2RHSB 4DV2Q 4JK1C 1BIFA 1E9CA 1AGPA 3OFNA 4A75A 5LB2A 1O78A 2IC5A 1UKEA 1VYVA 4MGZR 3VR4A 3NH6A 5L3SB 4B3DA 5JS8A 5C18A 1A1VA 4DLTA 1KAGA 1KO5A 3M9BA 4KITB 1G9XA 1KKLA 2CWPA 4JLVA 4IVRA 1V43A 2P67A 2YWEA 3GFOA 4TT3A 3U7GA 1JPJA 2R92G 1XF9A 3EW9A 4C2TA 2XTMA 4PTLA 1IN7A 4P0TA 2IT1A 2IYRA 4QHSA 1LF5A 2EFDB 1TF5A 2BKEA 5EP1A 2EWVA 2KI5A 4R4OA 4IVPA 1P5ZB 4K8OA 2C2HA 5GJWC 1RFLA 3TZUA 3S17H 1NBWA 3B6YA 4Q1EA 4H13C 3AFQA 2VP9A 4JT2A 3VHXA 4YWKA 1Z63A 1GSIA 1UFQA 4LYHA 5JEAJ 5C4XG 1G7SA 1ZM9A 1IAQA 4OQFA 1TXYA 1NN1A 2Q0HA 4G01B 4OQLA 4F92B 1TU4A 3AVQA 1IN6A 3NBFA 2E1RA 1YHAA 4C7OA 1PMRA 3NH9A 1HH2P 1IXRA 1YNNC 3FKIH 1BDOA 2UUAQ 1N5JA 1VMAA 2C95A 2CLSA 3U50C 2QORA 2QTVB 1RW4A 2JA8G 4JJKA 1G3UA 1U0LA 3A1TA 4QL5A 4KFSA 4LPSA 1P16A 3A6PC 3T1QA 1DG1G 1KDOA 1MT0A 4GMXA 1AS2A 4JI8L 2ZRJA 5BW8A 2NVQH 3GLIB 2QU8A 1T91A 4RZ2A 4PQYA 3CMAA 2FN4A 3LQRA 1QZGA 5J4KA 5AWFC 4TSFD 1B23P 3S1RH 5C4MA 2N46A 2IS2A 3NBYC 1U9IA 1QHYA 1VKJA 4C30A 5KDDA 3FWYA 4NXMQ 2OCYC 3K0XA 1US8B 2PLRA 3QPUA 4B34A 1ZC4A 4P31A 1FW6A 1BMFD 4AKHA 1HZCA 3FKSD 4AD8A 2R2AA 2CLCX 4IFBA 1P75A 3CCRA 1PYBA 4JKIA 3AM1A 2YOGA 1AS3A 4V0LA 3GJ7A 1DOAA 4HDOB 2H5XA 1GUNA 1YHBA 4B3RL 2OEPA 3QPVA 4OJKA 4W9MC 1Z0JA 3EZFA 4MYUA 3UMSA 1I6HH 2HYDA 2JLVA 4I99A 2VL6A 5SZIA 3T61A 1P2VA 3AVYA 2WM9B 3KYHC 1A4RA 2VZAA 3UE0A 1GP2A 2P6UA 5JRZA 2O8DB 1H8EA 5EQTA 4DUZL 4GKJQ 1H8HA 1YRAA 2J7PD 1ZCBA 4A0FA 1W36C 3T1HQ 1KY3A 2OBLA 5F3WB 4BRUA 3H0GG 3OOCA 4HJAA 2NO9A 2OFOA 1G291 4BLTA 3BB1A 3VR3A 4LK2A 2NO7A 3SQWA 3PO2G 2RCNA 4BBSH 1Z07A 4DV6L 1YKSA 3AKDA 3C15C 4Q9JA 2WSSD 5BXQC 1ZC3A 2CCJA 3B85A 1WI5A 4GOKA 1J6QA 4NP6A 2IHYA 4OONA 5FLMG 2VUMH 2GBLA 4LHXA 2BE5C 1PH2A 2J0UB 2ZIAA 4N3NA 1S0UA 3WMEA 2QAJA 1QHHB 3B9PA 2G83A 5JHGB 4V02A 5EXPA 1KO8A 1PLLA 1Y69U 4AYBE 1GHJA 4JI5L 1N0VC 3BK7A 3C5HA 4RJLA 4DB4A 2P0EA 4MYCA 4A3DG 2X2EA 1KI7A 1LY1A 3NEJA 4JL8A 4ACBA 4FD2A 4XVUA 1WOCA 2KCMA 2P5SA 1G1MA 2ZUCA 4OWXB 4UNSA 5TB5A 5FOXA 3I56A 1ZUIA 3PQCA 3T56B 1BS1A 3HOVH 1GVNB 2CCZA 2A6EC 1SE8A 2ODNA 2RGGA 3W1GA 3O47A 1YRBA 4TL9A 5K8UA 2A7QA 2ZREA 3Q8DA 3KJPA 1L1OC 4MITA 4C0AC 1T4GA 1XMOL 2ZUBA 2C9YA 4US2R 2O8CA 2OE2A 5EP2A 5FUXA 1XPUA 3EG5A 4LUCA 3AVPA 1KI4A 4E09A 2W6ID 2QGNA 3ZDQA 5JWHA 4A3FH 1OFHA 3TRFA 3T1VA 4A0GA 4LYFA 4QGGA 3RYTC 2IW3A 4LBVA 5EJEA 1DS6A 1GL6A 2NN6G 4C3ZA 1I2MA 3TREA 3KKNA 4B43A 3PO3G 3RRZA 4ZCMA 1GO3E 1FTSA 1EX7A 3EPKA 3EARA 4O0MA 1TX4B 3CCUA 1HT2E 4GNKA 5JBQA 4ZDJA 2UXDQ 4LUZA 4DC9A 1X9NA 4PZLA 2WOOA 4C0KA 1SVMA 4G5OA 2NIPA 3OW7A 1XJCA 4ESVA 2IS6A 1PH8A 1QG4A 3I72A 4YMUA 1UBFA 1XB2A 1IY0A 1LW7A 2GXUA 5P21A 3W9YA 3K0FB 8OHMA 4TTQA 2O8DA 221PA 2J9RA 1HR0L 3I73A 4BEJA 1TUIA 5K36H 2IYUA 2ORWA 3CPJB 4JI2Q 4NCKA 1AKYA 4MRNA 3MCAA 1W5SA 3QEJA 4YWMA 2ASBA 4UXHA 1TWCH 3KLWA 3PEWA 2HEIA 1Q86C 1KXLA 4IFEA 2VP5A 3B78A 4QBGB 5CITA 2YKGA 3W3ZB 2QP4A 3VMFA 5KTYA 3OEEA 2A1AA 4R4QA 2AD5A 3G6EA 4RD6A 2JA9A 1PUJA 5E95A 3GJXC 4TL6A 1W0JD 1AKEA 4CVNA 2B7CA 1GRNA 5CLQA 3T1YQ 1OH7A 1P9RA 2QP9X 4UXJA 1QJOA 5AUOB 1UE7A 4E03A 3T1HL 1H9SB 4DB2A 1WQ1R 2PCJA 1AQYA 1Y3AA 2IUTA 4FMBB 1TQDA 4OQXA 4XWKA 2O5IC 3HKZE 3GTJH 2F6RA 3CLVA 2QT1A 3NBXX 3KQKA 5F9HA 4YY3L 2QE7D 1R4AA 4BASA 2BEJA 2VSOA 2AUKA 5C3EG 3FMOB 1UDXA 1SVLA 3F0TA 4DZZA 1TQ2A 4BFUA 1HNWL 1NE3A 3CWQA 3ZJYC 3VKGA 4JS0A 4EDHA 1TMKA 4F4IA 1DXMA 4A1FA 4P74A 4A3CH 5JEAH 1CKEA 4B3RQ 1JNYA 1G18A 2WFWA 2FMXA 3GJ5A 4IEIA 1SLJA 3UKDA 2FPLA 2N42A 3C14C 5B30A 3I2ZA 5BN5A 1N33L 1ZD8A 5FOUA 1P7CA 4PX9A 4DWJA 3L0SA 5FUVA 2QPTA 2FPMA 4MQBA 4WZAE 5FOWA 2ZSDA 2A69C 5LBIA 4X62Q 5JFGA 2ZI4A 4Q7JB 3U6KA 2GETA 2VQEL 4JBMA 2N49A 4OWTB 2XTNA 2ZS8A 4R2HA 4OHZA 4CEIB 3GTOH 4EPYA 1U8AA 5KNDA 3QJYA 3VDYA 4WXPA 3LFUA 2X19A 1VG1A 4NZYA 3KKPA 2BC9A 1NG9A 2V3CC 1XWIA 1XMOQ 2O0KA 2WPDA 4TMZA 1T5EA 2KA7A 4NCNA 3CNLA 2GTPA 1SMXA 4EJSC 1YJWA 2HXSA 4Q4JB 3VU9B 2PNRC 3H3VH 1CTQA 3K09C 1Y63A 3THXB 4PANA 1NY6A 4CEJB 1XXHB 2VA8A 1FX0A 3UDIA 4MUBA 3WWVA 4DLWA 4CEHB 4TMKA 4NBSA 4LF5L 1XCGB 4A8JC 3OAAA 4K46A 1F2TB 2R6DA 5C4XH 3ZVRA 2VO1A 4EQ6A 1OXSC 3CPFA 3CCEA 1IBLQ 1JB1A 1KI6A 1KSFX 1KNQA 3PCOB 1YZTA 2JA6H 3GO5A 2ZRGA 4MKFA 4CGZA 1W4BA 4H0LC 3JAMi 2F1HA 121PA 2V54A 2ZPTX 4RD0A 4TLAA 3SBEA 2NZHA 4RCZA 5CJPA 1KJYA 5IP7G 1KO1A 3RC3A 1IBRA 3S1NH 1SXJB 2UXDL 4BFYA 1O7LA 2WZQA 1KNXA 1IONA 3RLFA 4LHYA 5C1BA 3HPQA 5C4GB 2I5LX 1R0XA 1HTWA 1XMQL 2B92A 2I0QA 1E4YA 2CL0X 2VSXA 4Q1CA 3W8NA 2YTXA 2OG2A 5J4HA 3PFIA 3AB3A 4MH0R 3I5YA 4BA1I 2GXAA 3CF5A 2ERXA 1UEIA 1Z0FA 3LAWA 5FPSA 3X1XA 2G3YA 3LLMA 2AUJD 4PHHA 4AYBG 1UDWA 4P72A 4JLJA 1NNEA 1KI8A 4OBEA 4IXMA 3QXCA 1G6HA 4RZXA 4S2EA 3TQCA 5JI2E 4MUAA 1LF0A 3FOZA 5HGQA 3FDIA 3S16H 2WWWA 3BC1A 4A93H 1GITA 2BMDA 4B3SQ 4YDSA 4BLRA 4C3JH 1Z6GA 3BH7A 1C9KA 4DR2Q 5FR2A 4HIOA 5FOSA 3K0AA 4LUOA 3ADBA 2GJ9A 1K3RA 4KKUA 1ELOA 3KJGA 4W5HA 5GROA 1W2HA 3AVUA 4POGA 4ZV4A 4NB3A 2WAYA 3L8ZA 4YHHQ 3T12A 1HR0Q 3JVVA 5KSOA 1N36L 2JAQA 2L5TA 3K0FA 2GA8A 3NE5B 1ZNWA 3GLHA 3TR5A 1RL2A 3M3YH 3J7A5 4C0JA 2CHGA 1UM8A 3PF4A 4EQ5A 2ASEA 1J99A 2JA7G 4KFRA 3TNFA 1OW3B 2FV8A 4IDOA 2V8OA 1SXJC 4DLRA 5EE1A 2JA5G 2D2FA 2GZAA 3V00A 1HYQA 4UP7A 3HOUG 3KQNA 3CD6A 3D0FA 4AYXA 4R4TA 4OHXA 5FH9A 2E76C 4B2LA 3JVUA 2UUCL 3AUXA 3K7AH 3VKHA 3MWYW 3QNUA 2QPAA 2QENA 2W0MA 2N78A 4MA4A 2ZTEA 1GNPA 1X3EA 1P4SA 2RH5A 2FSGA 2CCGA 4G5RA 1X56A 2PLFA 3SYNA 1XXHE 1YU9A 3NEYA 3K7UC 4Y0AA 3WXMA 5H1SE 2GEDA 3DL0A 1DAEA 4JV5L 3MG9A 4A3GG 1FNNA 3BD9A 4DVGA 1Q20A 4LF9L 1Z5ZA 2JQOA 3SYKA 4TYWA 2K52A 3NENA 2Q3MA 2CFMA 1JEDA 1CBUA 2I1QA 4Q03A 2NZOA 1FPMA 2WWGA 1Q82C 2QAGB 3B60A 3B5JA 1TWGH 4QOSA 3PUZA 2ODEA 2R6AA 4URYR 5HPYB 2F1RA 3A0JA 5IF9A 4A3IG 4B2PA 1M7BA 4UJ5A 1P2UA 2CEAA 4DV1L 2VNUD 3W5JA 3ZZUA 1Z29A 1TEVA 1OFTA 3ONWA 3LNCA 4ASUA 2WSSA 1DTSA 4BQSA 2OTLA 3GDEA 2ZITA 3OAAD 3Q7QA 4QY7A 4FINA 2ZRAA 4QL3A 4JVNA 3TUIC 4BZXA 1TQ6A 4OQMA 2NPIA 2B63G 5E3HA 5DNYB 1FL9A 1QHHA 4FCTA 4A3KG 1EUJA 2ZR7A 5EE9A 5AUPB 1W48A 1EIFA 2Z0SA 1G21E 1EQRA 2HIXA 2VHUA 1GVPA 4R98A 4DCTA 3I5XA 3E9IA 1YZQA 1Z6XA 4OI4A 4PQFA 3TAUA 3BAFA 2Z6KA 4E22A 2FF7A 3EXAA 3X1ZA 3L7ZC 3GJ6A 3SZRA 4FI3C 5M04A 3BZKA 3AVXA 3QI2A 2K33A 4APVA 3K53A 1E3MA 2QROA 1RZ3A 3OHMA 4IHQA 4LHVA 4LV8B 4WW0A 1CR4A 1T8TA 4G7OC 2JK8A 3PSIA 4TSFA 5IP9H 1NJIC 2CXXA 2OFWA 2WICA 1XMIA 3IHWA 3MXUA 1GRQA 1XCPA 4DR2L 3PUWA 2FGJA 3EPHA 4DBLC 3CF2A 1S9HA 1MRNA 3NWJA 2DCUA 4DKAC 4PSVA 5BQ5A 2ZYUX 3B2EA 2A5JA 2R93H 3DZ8A 2CL6X 1YZ6A 3NELA 3U7HB 1E9DA 5KSYA 4KFUA 3RRYA 4PPGA 3PUXA 4LJ4A 4DAMA 5FFMA 4TMVA 3CPWA 4X64L 2K7VA 4JVLA 3TUJC 3NVAA 4D4JA 1CSQA 1QRAA 2FNAA 1KHTA 2VBCA 1XU4A 3Q85A 1I6VC 2NG1A 1PYSB 2LKCA 2PX0A 3RZOH 1B8AA 4DSTA 5HCNA 1VIAA 1WFQA 3VNVA 1VQHA 4FWTA 2IYVA 2FJUA 1FQKA 2Q9BA 3EWAA 2CKZB 3DM9B 4PAOA 4FIDA 2F3TA 3VFDA 4R71A 1VQDA 2Z5FA 3I8XA 5CLLA 4Q4LA 2XXAB 3ULLA 1K8MA 1N9WA 2B3GA 2DBYA 2OCPA 2W83A 1FZQA 2ATVA 3L0IB 3MSXA 3KDFB 4DKXA 3U5ZB 4TTPA 4O2DA 2QF7A 3EASA 3EZ6A 1D6JA 1NG1A 1SXJD 4JI2L 3VTKA 1DG3A 3RN5A 4D81A 2HHHQ 4JOIA 2PZFA 4JV5Q 4HDQB 1U0JA 1ONLA 1WP9A 2PMKA 3BWDD 4OI0A 3A1UA 2YOHA 3WP1B 1PH9A 1P72A 5KO2A 1E2PA 5GJCA 4LF4Q 2IYXA 2QM8A 1CEEA 3QG1A 2E2JH 1SVOA 2PZEA 2WP8J 2RGNA 1E0KA 2BEKA 3OPOA 3CCQA 1XPOA 3FFBA 1ZP6A 4I4LA 4TQUS 1JBKA 3RSOA 3ND8A 3WYAA 4A3BH 1SRUA 2BM0A 5SZHB 1OFUX 3ZVLA 3PEVA 4Q01A 4QQBX 4WOPA 5FOVA 4B3MQ 4DEXA 1MRSA 2BA0A 4C0LA 1WBDA 3HOXH 3R9WA 3AVWA 2G6BA 3VNUA 4HAXA 3BB4A 3K9HA 4TYNA 1JE5A 2JATA 4DR7L 4TL7A 4TZ6A 5FUWA 2MO0A 2R6FA 1ZCAA 2WHXA 2IXFA 4DSUA 4LJ9A 1VHTA 2ZVPX 4CIDA 4D6PA 4LF9Q 1AJEA 1L1OB 4MDFA 2OILA 4HSEA 5J40A 4KFTA 4DV5L 1XD2A 5BWMA 1XD2B 4M1MA 3T35A 2FZLA 4Q47A 4YQFA 1UE5A 2VHTA 2GRJA 1XPRA 2ONJA 1FTNA 2Q9CA 2FPKA 4YLGA 4TT3D 3CR8A 1DAHA 3QXJA 4TMTA 3T5DA 2OLJA 2RKOA 2QMUA 5G53C 4NYIR 4KVAA 2QPOA 2WTUA 4DV4L 2ZJ8A 4Z1MA 2QBYB 1CRPA 1KAWA 4GLVB 3M0EA 3I7FA 2WKRA 4IDHA 1CXZA 4TLCA 3QXHA 2QT0A 4F91B 4C3IH 5A35A 3K8AA 4L5QA 4BA2I 3M4PA 1HE1C 1II8A 5SZJA 2J0QA 2PBRA 4BFSA 1LYLA 2QMHA 3J81j 2J0SA 3A5ZB 4LFCL 4GKKL 3TK1A 3K0AB 1OXXK 2D0PA 3IEUA 3MLEA 2F4VL 3QG5A 2O8FB 3BERA 2FSIA 2ZUDA 1J2JA 5FOTA 1WBBA 4G5QA 5FTKA 5AJZA 4JI4L 1CR1A 3CX8A 2DFTA 1CJTC 3FMPB 5FTNA 2IYLD 5IY0A 2JA7H 4JLBA 3SHFA 5JEDA 1H9KA 5ANRB 2HCJB 1WA5A 3QPWA 4DDWA 1OPXA 2EQBA 1NLFA 5ELNA 4M1OA 4KXFB 4B3BA 3A36A 1JT8A 1S8FA 1LS1A 3RDPA 1OIWA 1XD9A 1XXHA 4KKTA 2ZI9A 3G82C 2V4DA 2IEYA 1KQSA 2Q2TA 1R10A 4M9QA 3TVDA 1U5KA 4B47A 1IXSB 3FKQA 3DM3A 1JEEA 1MO5A 4QGFA 1A62A 721PA 3BS4A 5JHHB 1A63A 3G4SA 4DK0A 1N6NA 4MRSA 3ZJYA 1E2ZA 1N6PA 3CMEA 2HF9A 1COWA 2ZJOA 4LF8L 2CJWB 1ZW6A 3H2YA 4ESHA 2OAQ1 3U3OA 5M3FH 4YXWD 2ZE7A 1VECA 4JYAL 4L15A 2PI2E 4RY2A 5DYIA 5CB8A 2ZRMA 1E98A 2EU8A 3OIWA 2X77A 3NDPA 1JJ2A 4M4SA 1Q1ZA 4N0EA 3A7LA 3G5UA 5A0FA 1CRQA 2Z6KC 4JCVE 4TKOB 4A3LH 1DE0A 2CK3D 3EA0A 4URXR 1KMHB 2D2CC 2GAAA 4B3SL 4JL5A 1Z6YA 1FFHA 2DFKB 3DMDA 2XZLA 1SZPA 5EZ5A 4JOIC 3GMTA 2A30A 1C1YA 2G1KA 1CKNA 2AR7A 2OUKA 1RIPA 2ZJ5A 3IBYA 3L82B 3QVUA 3U58A 2FZ4A 4PR0A 3L43A 4NCHA 1F3OA 4Q4JA 1ZBDA 4L9WA 2ZI7A 1B70B 4JI7Q 4LX0A 1XNRQ 1J5EQ 2IYZA 1ZNZA 3TQFA 2QL6A 1D9ZA 3AP2A 2IXEA 2K14A 2PT7A 4G1UC 1IBMQ 5D3QA 1VCOA 1VQKA 2NTYC 3S14H 2W6JA 2OAP1 2FSFA 2AHOB 2R9VA 4Z8YA 4CDGA 4JLPA 2V55B 2QA5A 3FTQA 4PPNA 1QHIA 3L2OB 4A6PA 1H9JA 3MFYA 1I4LD 4JLDA 4RCYA 4DPGA 1A0IA 1WJJA 4HAVA 2JLWA 1OXTA 1U8ZA 2P3SA 1OB5A 4EJSA 2IS1A 2K5NA 1XDBA 3AV0B 3U60B 3KKQA 1X3FA 1PV4A 2WIAA 1OHHD 2REXB 1CR2A 3JZAA 1XMSA 3BFVA 3PIRA 3IDQA 3Q8XB 4I1SA 4L9SA 3D6TB 5BYJA 1EFUA 5KUTA 3AP1A 2Z4SA 2QMEA 4GRAA 1NF3A 4PZ8A 1NMFA 3EA5A 4NXNL 4BFXA 3A74A 3LWNA 1OLOA 2EW1A 2ODWA 4A92A 1T0JB 2WMOB 3EAQA 1N6KA 4BFZA 4ERNA 5GQOA 1FP6A 2A68D 2O5VA 3AF1A 4UNQA 1SHKA 3WY9A 1HJPA 1II9A 4C9BA 1HQCA 3GTMH 1WDTA 2VP6A 3ZD6A 3KFXA 2ZI5A 4JC0A 1F6BA 1L1OA 4QIWE 1VCNA 3TSWA 2R62A 2ZJZA 2E74C 2ZRLA 1NY4A 1K5GA 3RWOA 4G7HC 4JI6Q 2V7QD 4AKIA 2OQKA 5KPDA 2FX3A 4HUQB 5EUQB 5L3RA 4DUGD 1NMXA 4F38A 1RC8A 1DO0A 1Q1EA 4DV1Q 3B1WA 5DIFA 3WDNA 2AFHE 5E7NA 4KSBA 3NXSA 3X2SA 3T1OA 4HLUC 1W7AA 1VQOA 1X8KA 3G48A 2CHQA 3S2DH 1K6MA 2DYKA 1Q0UA 3GCGA 1K0RA 3WRXC 5IYDG 1JPNA 2AK2A 2GILA 1XX6A 3KTAA 1ZAKA 4QGUA 1XTQA 4OK3A 3LW8A 4RMFA 1ZD1A 4K0KL 2YJTD 1VQFA 1QF9A 4OYHA 2GCOB 5JI3E 2WKPA 4BBSG 421PA 2IHEA 1PA6A 3AP3A 2K5UA 1N32L 3QF7A 1ANKA 1OIXA 2H92A 1TPZA 2O52A 3RS4A 4EJSB 2V6IA 2WMNB 3TSZA 5JWRA 1NVXQ 2A5YB 1G5TA 5L3QA 4IOJA 2WWXA 5B58C 4GFDA 4MYTA 2MMGA 3UMRA 3IQXA 2LMCB 3AKEA 2MNAA 4KHPQ 1ZM4A 4PAQA 3R7WB 1FUUA 1KDRA 3QIAA 1W0JA 2VPPA 3EC2A 4YXWA 3SYLA 4OO1H 1UJ2A 3DPUA 2J0UA 2E87A 3CO5A 1GUTA 3PO2H 2ZE6A 1H9MA 2ZRBA 3CX6A 3GTLH 3CC7A 3HOYH 3KF8B 3D4RA 1PH4A 1U0HC 1R9TH 2YWHA 5FTLA 3CCSA 3FHWA 1B9MA 1IYUA 2A5FA 1IOZA 3UE1A 4YMTA 1VG9B 3QKTA 4BLQA 5EXTA 1GJXA 2PEYA 2ZAMA 4PZYA 5K8LA 3H94A 1XFAA 2QE7A 1DAIA 4NPSA 1PH5A 3CCMA 5EXSA 1JALA 1NMZA 4RKFA 1FGUA 1JQJC 1KO4A 2ZYVX 4X64Q 4WVFA 3I4OA 3A4NA 1ONBA 4KYIB 3CRQA 1KIMA 4M2LA 2A9KA 4C0HA 3MUFA 2GVDC 2MFIA 4XWAA 4G0NA 4HI0E 3I4LA 1TWHH 3RN2A 3GTPH 4TMWA 4OHVA 4EPWA 3OFND 4Z54A 3GLIE 1X6VA 1U99A 1U9IC 2FEMA 4JSTA 1EFTA 1JXOA 1NKTA 5TXGA 4BLPA 4XTRA 1ESNA 5C44G 1N8RC 3UMFA 1G7TA 3GJ8A 4KHZA 1Q1BA 3K9LA 4Q4HA 1E9RA 2CMKA 5AJVB 5TVKA 1RJ9A 1E9AA 3NC1C 3Q5DA 2ZI3A 4GN4B 2E75C 4LI0A 1EFCA 4YY3Q 2AN9A 2K4KA 3CONA 3AVTA 2V9PA 1L8QA 1W49A 2REOA 4BGDA 1EIYB 4X65L 3GPLA 4JSYA 4GBMA 2R44A 3KOJA 1RYHA 2VIIA 1KK1A 1S3SA 4B48A 2Q3HA 1OE0A 2XNDA 4XH9B 5G41A 2X8AA 3HR8A 2F1IA 1A5TA 2CJWA 1Q3TA 1E9FA 3KF6B 3BGWA 2R92H 5D3MA 4ZI2A 1KMQA 1IJFA 4NTZA 3ZQJA 1WCV1 4JL6A 1N5LA 1VG8A 1LNZA 3IBGA 2MO1A 4OXPA 2IYTA 3D8BA 4CEJA 1X86B 3K81C 2J87A 1SVIA 1DBSA 3THYA 2ALYB 3MGCA 4URWR 4LBYA 2H1LA 2WAQE 2MMCA 1HZAA 1VQ4A 1ZIOA 2O0JA 4WA7A 4DNIA 1YR7A 4MKGA 3R20A 4M22A 2WWIA 2JLQA 2ZTDA 3F2CA 1K9MC 1LV7A 3OZXA 4HAZA 4U00A 4V03A 5JCZA 1G6PA 1UEJA 2QAGA 3G0HA 3AKYA 4PC2A 2PPBC 1ZM7A 2IYWA 4C0QC 1NN3A 5B2ZA 4RSGA 4Q48A 1IW7C 1KZ7B 3EN2A 2CHVA 1L4UA 3BBPA 4V0KA 2OESA 4RFVA 5FPYA 1BKDR 1E24A 3AF2A 1MV5A 4A3DH 4NE2A 4PC6A 3VAAA 4EAQA 4Q4AB 1RE0A 4L5TA 2LSSA 3KJIA 1SKQA 3TIFA 2HXYA 1PHJA 3TR0A 2NMVA 1OTCA 1CKMA 5AJXA 1UBGA 3QXXA 1RKBA 1UADA 3Q72A 1HZBA 4D26A 4ZDWA 1TL7C 1MO4A 2ZROA 1VQEA 2ECKA 3A1WA 3FHOA 2J3EA 3LVQE 1R0YA 4I1UA 2R65A 2IHFA 4S35A 3SQXA 1ZNXA 2ZRHA 5H8WA 4AQYL 1Z2AA 2V4ZA 1W4CA 3QKSA 1W4AA 1P62B 1W2GA 3B82A 3TMKA 2XB4A 4EPVA 4K0KQ 4Q1FA 2VHQA 4LJ6A 1AE2A 4ABYA 1I50H 4TLBA 3CIOA 2E2HH 1NTGA 4IPCA 4EPTA 2RHQB 1HY3A 2V1CC 2V1XA 1NL3A 5FJ8G 3X1WA 2RHDA 2JJ2D 4JI1L 1K8AC 2ORVA 1G5RA 4G5SA 2D0OA 3E9HA 1JI0A 3GLGB 4NU0A 4ACAA 5GVSA 2A6HD 3IIJA 2A69D 4GOPA 3MWJA 2GJSA 3OIVA 3F1ZA 1UF9A 5LMUQ 4DLYA 1RRCA 1E9SA 1ASZA 2DFNA 1I94Q 1U94A 2E8GA 3M4YA 1WCMH 3KDSE 1Z6AA 4OL0A 5EZ6B 2I4IA 4NL4H 3ZLJA 4F4JA 3CCVA 4HIDA 4DR3Q 1G19A 4WAUA 5AK0A 4M1WA 2O8EA 4ZDIA 4DR4Q 2Z4RA 2C99A 1P2TA 1VQJA 2OCAA 2D7CA 2F43A 1X8LA 1WCMG 3CH5A 2I5HA 4DCSA 1XTSA 4HB0A 4EIWA 1AM4D 2OQ0A 3SNHA 2O8BB 1IQPA 4IXNA 1XJQA 2JLRA 1CULC 4Q7MB 1PH1A 2NVTH 1HUQA 3T53B 1QHXA 3FP9A 1KC8C 4P33A 3AQ4A 3STBD 1RJ9B 2RGCA 3BORA 4P71A 2GZHA 1E1OA 4II7A 2ZS9A 3WBKA 2EJFC 2KCTA 5HE9A 4QG7A 2QY9A 2ZJRA 4DR5Q 4NYJQ 4UXIA 4DLSA 2LWIA 4PZZA 5M3MG 2GZDA 1EWQA 3DHWC 2AHOA 2XNSA 2E5LL 1E1QD 4I7ZC 3KUDA 3E5HA 2BA1A 5EXXA 1BYIA 1AZSC 2BVNA 2ONKA 4GS3A 2KENA 1SFOH 3LX5A 4IJMA 3I55A 5DN6D 2BMEA 3TH5A 1E94E 1K5DA 2V6JA 4L16A 4IVQA 4P32A 3SEAA 3A1SA 4HYYA 4MGKR 3P27A 1DO2A 1EFRA 5TV2A 3QEOA 5IYBH 1KI1A 1T3LA 1DEKA 1E2LA 4C0SA 1CI3M 2RGDA 3RANA 1G8HA 1YNXA 2Q2UA 2JDID 2W0SA 3AUYA 1JR3D 3P4YA 5DSZA 4A15A 4BPBA 3OE7D 4IDQA 4UPAA 1NBME 1YNJC 4LFAL 4TYQA 5JZVA 4BECA 2Q6TA 3UDFA 1Z83A 1Z0IA 1G8GA 3VR1A 5JLJA 2XSZA 4DT1B 1E79A 1UE6A 3EQLC 1VQ8A 3W90A 4BE7B 4LC1A 1MH1A 1AN0A 2L15A 1VIYA 1BYUA 4KCGA 2GWHA 3B8HA 1NN5A 4Q7KA 1K73C 3H1TA 4PFSA 4U02A 4YC7A 4DLUA 1Q7YC 2O0HA 1ZD9A 3SE0A 1A2KC 1VQIA 3EZ2A 3D7MA 3OEED 4LZZA 4GSYA 2ES2A 3C7KA 4EFMA 1IBKL 2JA6G 1KK2A 2DPXA 3HOXG 3DM5A 1CFMA 4HJ9A 3TS0A 1K8OA 3UDXA 3FVQA 5IYDH 4ILEA 4M9ZA 2K5VA 3NG1A 1UBCA 2K75A 4DUGA 2OLKA 2KCCA 2QEXA 1N6IA 4PXAA 2GK6A 1EGAA 1DD2A 1YR9A 4QGAA 1OXUA 3IFTA 5KNBA 3W6NA 1IXRC 2JLZA 1Q44A 3ZS8A 1N5KA 1VQ9A 4TQ9A 4A3EG 2J1LA 1AK2A 2HJVA 5FL3A 4C3HH 1YITA 4H44C 4DR6L 3ADKA 2DR3A 1FNMA 3U6BA 2AD1A 4Q1BA 1KHIA 1E32A 1HA3A 2EYUA 4MYHA 4DV3Q 4Q19A 4PPFA 3K8YA 3HOZG 1MKYA 4D0NA 1N34L 2OWOA 1UKYA 4TN1A 1G51A 3L0OA 4Q18A 3SU8A 3F3YA 3Q7PA 1A8VA 5FUYA 4OX9L 1LACA 3ZQ6A 1M90C 3PJRA 3HU2A 2SHKA 4NMMA 1QUQA 2Y0SG 1GDDA 3DOFA 4UY8C 4EPRA 2E9SA 2JJQA 2GJAA 2WWYA 1U2RA 3WMGA 1VQNA 1D2NA 4DR1L 3TW4A 1EWRA 4CW7A 1OHHA 3O8DA 4GOXA 2QSYA 3B1VA 3IO5A 3VR2A 1E2NA 3NHBA 2E5LQ 1XNJA 1Z0AA 3K9NA 4P4SA 3GLFA 1HEIA 2P6RA 1YZKA 3BU2A 1ZYRC 2FA9A 3U9SA 4ON9A 1PJRA 3BOSA 1ZIPA 2XJ4A 5BYKA 2JLXA 5AJ3L 4B73A 4POAA 4WJ3M 1IN8A 1EX6A 4IOCA 4Y0VA 3OESA 3HP1A 3SBDA 2F9LA 4HLUA 1HQYE 4DNTB 3CP0A 3ULPA 4BFTA 2ZI6A 1LUZA 4JLNA 3GTQH 2UZIR 1HV8A 2IEZA 1XMQQ 3WRYC 1ZINA 2IK8A 1MJCA 3CZPA 3AEVA 4M9SA 4C0BA 3NIBA 2W58A 1WRBA 3BE4A 3KQLA 4A3KH 4LFCQ 4GKKQ 1T3SA 1U98A 4XSHA 3NDBB 1GKUB 2K32A 4GZYC 4DUYQ 2F4VQ 1KSJA 4CZ2A 1E7ZA 2HCBA 2YC2C 1XEXA 4IRUB 4XVQA 2PJRA 5IT9c 4PZ7A 2IA5A 1TF7A 3QBVA 5KSZA 2YC4C 1D9XA 2GEUA 4KI0A 4QJFA 2F55A 1KTVA 1Q46A 1X1RA 2C5LA 3A8TA 4BZQA 2AWNA 2G0NA 2P65A 5AJWA 3IO3A 4JMPA 3ZS9A 4AI6A 4X65Q 4LF6Q 2AFIE 4URUR 3DOEA 3F8TA 4R4IA 1TTTA 1YBYA 4A3JH 1II0A 4HDCA 2EQSA 1P3JA 3AGQA 4TWZA 4A3FG 3LWUA 3O8BA 5CDFE 1KL9A 1JECA 2ANBA 1E0AA 2BMFA 1Q12A 1KO7A 3CUEF 1HZ9A 3FKIG 2CE2X 1VQBA 5JJKA 1DAFA 1GL9B 4DV5Q 2D4HA 2PMZE 2BM1A 3A37A 3QKRA 1P9WA 1FMLA 2A78A 4PHGA 3AVVA 3ULJA 4LF7Q 1M74A 2C04A 2RGNC 2MSEB 3MD0A 4JI0L 3I3SR 4OK6A 3FHTA 1ZVQA 2VP4A 1C0AA 2GXQA 1SMYC 3LY5A 4BFVA 3GEEA 2WB1G 2VEDA 3FMCA 3PITA 3A1VA 4HLQB 4PC3A 2EJMA 3BZCA 2ZE8A 4PC7A 5HKKA 2ZJBA 1J8MF 2ZYTX 1X3GA 1PH6A 4DDVA 1IHUA 1JMCA 4UNNA 1CS4C 2IYQA 2QTHA 2FE4A 4POFA 4GZMA 4A82A 1CF4A 3ICEA 4DK1A 1E99A 3LH5A 1OXVA 5FR1A 3U3MA 4EQ6B 1KGDA 5TMPA 3CRLC 1Y8PB 1UPTA 2QA4A 4HJ8A 1XNRL 1D2EA 2EFHB 5EAYA 3B1YA 3K0CA 4RZ3A 3SI7A 2AMCB 1KAOA 3P20A 1G41A 2IL1A 4AG5A 1RYFA 1AQUA 3CRRA 3UWKA 2DFLA 621PA 3PENA 3WNBA 1IBML 2RGEA 3FMFA 2B8FA 3GLGA 2R7FA 3KQUA 1YI2A 1G64A 3FMIA 2J7KA 4D25A 2AWOA 4WXRA 1EFWA 4QFMA 4AWXA 1QVAA 4OI2A 2UU9Q 4KSCA 1QDEA 4B32A 4HR7B 3J80i 2CK3A 4O0AA 3MRSA 1M7HA 4YWLA 1NRJB 1LM0A 4A93G 4LJYA 2CNWA 4QNMA 3BRWD 4IFDI 4ZO4A 5FPTA 5G3ZA 2XB2A 3HGBA 1PFSA 1U90A 4K81B 1OB2A 1EWHA 2ZRDA 3TEHB 1Z3IX 1KRSA 3PV0A 2D74A 1XCMA 4XIGS 1NIJA 3IPXA 3C4JA 1Z06A 4JI1Q
chains in the Genus database with same CATH superfamily
1KK0A 2PWZA 2Y0EA 4JOCA 1Z4MA 4I5FA 1Z22A 5SY9A 3R3WA 1Q84A 1YMQA 4NU6A 4PGHA 3ND6A 5DYGA 4I1IA 3P2YA 1BN6A 2Y27A 4R7TA 4XD7A 2AJ8A 4DHWA 3QWIA 1LQ2A 1F4VA 1ZG3A 1SCJA 2VLIA 5A7HA 3PJFA 3MEFA 1YGYA 1PR1A 3U3RA 1UBSB 4R1MA 4A3IH 2YR0A 4K88A 4EX5A 1S72A 1EYGA 4N1AA 2NU7A 1Y8QA 1ZUD1 3FI0A 3GXOA 3NBMA 4REQB 3UJNA 2QZ9A 4K9PA 4D44A 1I3QH 3IAXA 3QLUA 1L8AA 3V8BA 2NVXH 3HOWG 2PZGA 3PR1A 3ZIUA 5AI9A 4DE5A 1RXVA 2VJAA 2LCIA 2PXHA 1YNOA 4GZ6A 4B2YA 4YAGA 2L69A 2MIIA 2R60A 2AOUA 1J5EL 3HBJA 4BN0A 4KKSA 2J5QA 2BEWA 2HQBA 4ITUA 1QIIA 3IAS6 2OHFA 4NBWA 5CH3A 5CFQA 1KI2A 1OX6A 1KEEB 2CXOA 2OECA 3HADA 3OHSX 4KJXA 1Q83A 4O59O 4EI2A 2C4HA 4A4DA 5A4JA 1TAGA 1R16A 4XQCA 3FIUA 1E1LA 2WWHA 2PVPA 4EMBA 1NLZA 1YUBA 2PNHA 1E2MA 3G2OA 3K8QA 3U62A 4E15A 1WCIA 5D3MB 1FC0A 3PNLA 1QIJA 1U11A 2PGIA 2OWDA 4K7JA 1E20A 2IW1A 2NTTA 2FFHA 2XRMA 3ABRB 3NUZA 5M3FB 2WHRA 5FRDA 2OBBA 5T7BA 1Z7TA 4N5HX 3EX7C 5FJ8H 2FPPA 4A0QA 5FI1B 4DBVO 5TR9A 3I62A 4XVHA 1XZMA 5HM6A 1XEWX 4XDYA 1BBUA 1YHQA 1AQ6A 1KMNA 3M34A 2QMOA 2WB4A 3K15A 1ZM3A 1JJVA 2O1XA 2UUPA 1E3TA 1Y4UA 4JUBA 4A03A 2Z2YA 3ZIAA 1SG9A 3UMBA 1Y7PA 3ASZA 3H8VA 4OHBA 1UXIA 1MW9X 3JWGA 4CG3A 4DM3A 3GPDG 1VC2A 1XEFA 3GT4A 3DEPA 3DW3X 3PIIA 4BQIA 1UDRA 1FBNA 1JJFA 3CKYA 3WNDA 4EL0A 4II2A 5E7JA 4MTNA 4TMXA 4PIVA 1U8YA 1MG0A 2Y1DA 3IQZA 4QE3A 4BV8A 5KHOC 9GPBA 2E89A 2XSZD 3PKZA 1QJ4A 1XDUA 4P2GA 2IY5B 1ZMXA 2WHYA 5HDQA 3C45A 3H9GA 3JSXA 4DIEA 2KMLA 4CTJA 1QQ7A 2KVMA 2H1HA 2X0NA 1EZ8A 1WD0A 1U1EA 3DFIA 5CXQA 2OZEA 3RSLA 3NTIA 1C7RA 1KJNA 3H1PA 4RZUA 5LA6B 1U3TA 2ECFA 2YV5A 4IJQA 5G4KB 4A2WA 2XTZA 3H2KA 2OF1A 2IXTA 1D2AA 2QZJA 3B3FA 4WBNB 4BMOB 1J9ZA 2JLSA 1FLNA 1H4VB 1Y1KE 2TYSB 5IJ0A 5CLGA 4B6JA 3D3QA 2HMTA 1DC7A 1BVRA 1Y5MA 1M8PA 3A8JE 1BQ3A 2HT6A 4MRRA 5GONB 3W9UA 5L7WA 1G20A 2BTEA 1D7QA 4MEBA 1DHTA 1RSZA 1GTVA 4OHWA 5F2OA 5JMPA 3JRWA 3KLRA 4PE5B 2FP3A 1F0KA 1IUOA 2HTEA 3B7GA 3OY7A 4KPFC 4QGBA 2DCMA 4Q1FA 1ZJ5A 1T35A 1CJVC 3KC2A 1ODTC 2FDXA 1D7OA 2H8GA 4LI3X 1EWTA 2VF5X 1YFJA 5EP3A 4UEQA 1B42A 1MEOA 4MA5A 3AJEA 1NJGA 2FLKA 5I3CA 1PJ3A 2L82A 4OHJA 2FFKB 3LY7A 2W6QA 4NV3A 5F9MA 4GOND 2E2WA 3BFKA 1H9CA 1JJIA 4AIIA 4LUVA 2N1BA 1X92A 3AUUA 2YY6A 3ECAA 3C48A 2R7ZH 1PH3A 2UUCQ 1ARZA 3B1XA 4G1VA 4GZLA 2Q7XA 1M1UA 1MAUA 5CM8B 1VRCA 2BMAA 2ERYA 2JDIA 4I55B 4JG2A 4EGQA 1SXIA 3DAFA 4YJFA 4KIGA 3OE7A 3OTOL 3MGBA 2RKSA 5CYOA 3T3DA 4MS4A 1GPJA 1U4MA 2VF7A 4EG0A 1W9MA 1P61B 1AGXA 3B9QA 4LWCA 1KQFA 4KNYA 1V9CA 1EYAA 2CXHA 2FSVA 2XYVA 5EJIA 1WDLA 4OI1A 1LDYA 1NATA 3HFGA 3CYFA 2KUMA 1ZUNB 1US8A 2WJ6A 2XMBA 1XEXB 1VQ5A 4MGKR 1YQXA 4X91A 2CFOA 2GPTA 1YB4A 3VR6H 2P2SA 3CZMA 3WDMA 5BPFA 5CA1B 3ZDBA 1BWQA 2IIBA 2PKQP 2VQ3A 4HFJA 1ADGA 4Q66C 4TKVB 2QX6A 3F8SA 4N54A 3RTCA 1J09A 1PT5A 1UT8A 2HT1A 2YWFA 1CQIB 5GAGC 1OYYA 2VUMG 3KSMA 4PLFA 1VYTA 2VHYA 4QTXA 3QR8A 2X2FA 3VX4A 4OQYA 1D5CA 1EP9A 3ZD7A 1Z62A 3BVZA 1JE0A 1PTOC 3QVXA 3PCXA 1TYDE 1ADFA 1FMCA 3AXTA 4DGSA 1AHPA 5CCDA 1LNQA 3ILSA 2QQ0A 4OGWA 4EATA 4AK9A 2FZCA 4E2ZA 1VQ6A 1U0FA 5JVDB 2DNCA 2KYRA 3GDHA 4G4SO 1NJ5A 4WCDA 2H4ZA 1TPYA 3GFQA 4YPVA 1Z6HA 1NRIA 2JHAA 5KUTA 4XYGA 2CW0D 3KL4A 1X54A 3H83A 1ODJA 2WILA 2WSIA 3GLFB 4L8WB 5DOZA 3U61B 2B2VC 1XZNA 3GOQA 1CFJA 4MUGA 1KJWA 1PF7E 3RRMA 3U7JA 1QPZA 1RLTA 2O0LA 2ZE5A 4ABNA 3M6XA 1N3BA 4MB2A 4WA8A 2FFBA 3GTGH 5JEEA 3J80E 4DR5B 2BD0A 1FYCA 2VXBA 1ZD4A 2M32A 3CC4A 2C84A 2WWTA 3AIOA 3I0ZA 4QVIA 1CT1D 4RO0A 1ZJ4A 3FHCB 5T8KA 1ZIXA 4CTKA 4IICA 4TN5A 1JDBC 2GCEA 1R5NA 1VTKA 2AKYA 1UE1A 1A88A 2EFGA 2PZLA 1G3QA 2PYDA 1NHWA 5TSDA 3V80A 1R0RE 4HAOA 1QIEA 1EB8A 4EBBA 3LBHA 1DXYA 3ETCA 1GL3A 1ULBA 3CH4B 4UE2A 1KWKA 4F5DA 2IY8A 3O4FA 3SC4A 5C5EA 2NQ2C 4IJHA 4Z4HA 1SU7A 2HHHL 4ZAVA 3F7TA 2ORED 2O2SA 3HOZH 1Z38A 3RNUA 4QICA 1NRXA 1L0WA 4YFYA 3ZNNA 4KAXA 5FOQA 1CDOA 1W5TA 3OMCA 3CNNA 5B55A 1IL2A 2B8WA 1G21B 2RB5A 4FYJA 4TWAA 1H6DA 4I5GA 4K6LA 1JL3A 1D6NA 4FX2A 3N6XA 2W6JD 3VBCA 4IRMA 2BWJA 1RTOA 1V1JA 2ID0A 2AQ3B 1GWNA 4N3AA 2HCTA 3LXXA 2QRMA 4TGLA 1E4OA 1L1FA 3RTEA 3ZC3A 1CJBA 2BFCA 3N74A 3DHQA 4JBXA 3TB4A 7REQB 3T1YL 4U7JA 5FL7A 3NCTA 3OMLA 1NF2A 4UD2A 3TX2A 3PU6A 4BY7G 4DRYA 3N3AC 2PH5A 5C53B 3PNMA 1XMPA 3H17A 3HMQA 3PR2B 2CVHA 3K6SA 3H4MA 3JQ8B 2JFFA 2OXCA 4LHZA 1QE5A 4LWOA 3RYHA 5FKJA 1K4YA 4CM5A 5LN1A 1P4HA 821PA 2BBOA 3MRTA 3UATA 3FNIA 4PYNA 3B6ZA 3BRCA 3D4NA 1RQGA 2A8VA 4BRWA 2BKUA 1U0GA 1F4PA 2QD3A 2CLIB 2QX8A 4MUJA 2OM2A 4KV9A 3OYYA 4ZRDA 4J8PA 1KE2A 2C92A 1F60A 1YQQA 3G49A 3P5BA 2D7DA 1VGVA 2DXIA 4ZLTF 5KDOA 4V2IA 5EERA 3AWDA 1VGQA 3T1TA 1USWA 1JZQA 1GSOA 2RK6A 4LMQD 5D8DA 2XUIA 1K06A 1RCUA 1VL1A 1F9AA 1ZI8A 1DOHA 2RGXA 1J90A 3ZH9B 3BZUA 1OASA 4ZYWA 1TU3A 4DUZQ 1SYCA 4NCJA 4X6YA 1FE8A 4EM6A 1C0EA 5BVHA 3WLOA 5EGTA 1F8FA 1ZXLA 2Q5LA 3BE8A 3WHKA 3BDOA 2IX9A 1L4GA 3BEDA 3BH0A 3H7AA 3B89A 3FPAA 4NG5A 4Z49A 2BEUA 1U1CA 2NBFA 3W3AA 3IPAA 5G4KA 1L7NA 3L4BA 3BYYB 4XWTA 1NNSA 1XSEA 2I0FA 4Y3UA 3WK8A 4EEKA 1PLJA 2F43B 5KTOA 5ENDA 2HQOA 3G7LA 2XOKA 2H07A 4IPHA 4R7ZA 3RUHA 1Z2OX 5B3LA 3GJSA 2CY0A 4L4UA 2HJHA 1QGUA 3MJHA 1RP1A 3HN2A 4ARZA 1V39A 3HVKA 3R74A 4MHEA 2P7IA 2V7UA 4B45A 1LUAA 3OCYA 3T7TA 3WIEA 4B3HA 2C77A 1E2FA 1IEVA 1NKSA 4RENA 5DLQC 3QYFA 4TTRA 3RSZA 3E8MA 3CLSC 3SKVA 5IKEA 3KXDA 3NBHA 2V1UA 5TMDA 4BMCA 3HGTA 4GOMD 2CMGA 2QZZA 3JAMc 1QRRA 4X20B 4BMYA 5L51A 1JEYA 3LXMA 3ZYCA 3UH1A 4RXTA 1G8SA 1VMIA 1S2OA 4UTPA 3SXHA 4DR6Q 3B6MA 4YJ2F 4O02B 3WA6A 3VPDA 3H0CA 5COQA 1LTLA 2CXUA 5C81A 3CWCA 4E4YA 3DBOB 2A6HC 4IDGA 3P9QA 1GOTA 1V0JA 1YL6A 2AT1A 4IJUA 3ISJA 4A3LG 4AY4A 1JSXA 4BFWA 2YHBA 1YIJA 4CT4B 1LI7A 2HF8A 1DCZA 1T9CA 2CHBD 1XFDA 1AE3A 4PPYA 4JJEA 5TARA 3UMCA 5LNK6 1WBJB 4G5XA 4QGHA 2DQSA 2G9UA 1JMVA 3C1EA 2HHCA 2VWGA 5HF6A 2OYSA 3WC4A 5IJ9B 4ND8A 1A9TA 3D0OA 2DEUA 2VCYA 1GGMA 5ABPA 2TMDA 3M4JA 3VDQA 5KPJA 4LY9A 3KVNA 1RM0A 3BRWA 2F0SA 1D0VA 3OZBA 2XZOA 5LD2B 2OMKA 3A06A 1Q1QA 1SGWA 5B3JC 4LKRA 2WLSA 5IG2A 1WB9A 3P0JA 2CT8A 5DBEX 1RHMA 1ST3A 4C3IB 5DLQE 3PXBA 2MP1A 1KOFA 3SSOA 1P45A 2QP3A 2EIHA 2QYOA 1HQKA 3LRXA 3GEHA 1ZSNA 1IJEA 2NO4A 3K6RA 4HAYA 1AUOA 4FS8A 1U9ZA 3DDSA 3JQPA 3CQ9A 1NFQA 1BAPA 2Q9AA 2YFYA 3PMFA 1CUKA 1JSLA 1KBZA 1QBKC 3KXLA 3CCFA 3O9VA 4AG3A 2BEUB 3PQ8A 5KNCD 1HG0A 2N88A 2KJQA 3KXIA 4LSGA 1W76A 1GRCA 5C3EH 1MV8A 3AEKA 1I5FA 1RLMA 2V7GA 4B75A 3PJEA 5KTPA 4XR4A 4MMZB 3E6AA 3AW8A 4IDAA 2XWPA 4N9TA 3PFKA 1L4EA 5HX7A 1JB7A 4PICA 5TJHA 4EUFA 1MOZA 3WXBA 4PBSA 3JAME 4TZKA 1EEID 1D1QA 1S5DD 4CV3A 4OUDA 5FLXc 4YAJA 5J5AA 3WZMA 4ENRA 4DUYB 1MZVA 2H5EA 2PZTA 1V8BA 4UC0A 4AY5A 1XJVA 5HJ2A 5L3VA 3TZCA 1G7RA 2HNBA 1KI6B 1H2YA 1Z0DA 5ECGC 4ZTZB 1MD9A 3MS2A 3WGHA 3P9NA 1X7ZA 1W1WA 1GZ4A 3JRXA 4JI7L 2WOJA 2A4KA 1YVCA 4QBIA 5A3JA 5DM1A 4JBIA 3HNOA 4K9RA 1XQ9A 3HKEB 4JYBA 4LZJA 3Q5GA 3O2QB 1IM2A 2Q2WA 3LKDA 3J81i 1CF9A 2I80A 2HKIA 4K2AA 4MWZA 2VRWA 4G4KA 2VDMB 1CTMA 4JZKA 2JHPA 1YJNA 2B99A 4DNPA 2Q2OA 2IH4A 1GCUA 3L18A 4GI7A 1SG6A 2X22A 5H81A 5BR8Q 1L7DA 2RDMA 3ZCRA 4LOJA 1ZKOA 3OFVA 1YQTA 1GGVA 2R1UA 1I6MA 4FN5A 4GR4A 2ADFA 4NV0A 1WCXA 3V42A 1S3IA 4DRXB 3UK2A 1J7KA 3L4EA 1R1DA 3DWFA 4Y6GB 1DKRA 3QUSA 4M55A 4QHYA 1RMYA 5J39A 2KB0A 5EBDA 3PO3H 1T0HB 2QTNA 3VYSB 3T5AA 3S8YA 1XHEA 3BUSA 4IKEA 4DV2L 4XX1A 1ZRHA 5DHAA 2VHZA 1LPSA 5ELLA 5B1EA 5KSPA 4A3EH 3DHEA 1T8YA 1AHNA 4AJLA 1QO9A 2QSZA 4YDHB 4U3JA 3KZCA 4DUYL 4NXML 4UU8A 2HRZA 1SCQA 1B93A 4IJKA 4Z9YA 4YO8A 1W36B 1WMSA 4IFDJ 4R1TA 2JAHA 5GOZA 1OX4B 3FCSB 3B20A 3H9QA 1JDSA 2ACKA 2OFFA 1BE6A 2F0DA 4ZAZA 5ADUS 1AIPA 4GVPA 4KHPL 1L2FA 3BSYA 4JN6B 4X90A 1M1NA 1UKCA 2P68A 2R1TA 1JSZA 4HGYA 4JUCA 3BMOB 4R2JA 1NOIA 4DLXA 4JXZA 4MRPA 3BJIC 3BFXA 4DN6A 1OSNA 3C0KA 4YCCA 1Y14B 4UHVA 1E79D 1OC2A 3TLMA 3VO8A 3RU2A 2ZT6A 4L5CA 1PS0A 3LA8A 5T64A 1W88A 2OCBA 4YMUA 1NT2A 2ZXUA 3SC2A 1RQ7A 4DEVA 3OMGA 3VDXA 1P1BA 2F1JA 1TNDA 3KTAB 3SEQA 4IH4A 4DV2B 5TS3A 3TDQA 1O6ZA 2KBEA 2ADMA 6PFKA 4XFDA 1PL8A 4V3CA 1CHPD 3SOZA 1GKHA 5J4VA 4OHKA 1I4TD 2POQX 4UBKA 1DT3A 4WK4B 4EG7A 4EI7A 3OOSA 2BUCA 4H59A 5JNTA 1UJ4A 1SU8A 2J48A 1P17A 1XNRB 2OBMA 4PAWA 3F67A 4C2AA 5EKXA 4M53A 3WTBA 5TY0A 2XQFA 4MVJG 2EXXA 5A05A 3TLXA 2VH2A 4BQEA 3FPSA 1ZW1A 3DP9A 4RKRA 4JI8Q 4Q9KA 2P9BA 2QTWB 1VGRA 1HOXA 3DOUA 4M7WA 2BFEB 2PSEA 1H6AA 1J2RA 3PFNA 5FFFA 5DM0A 4PN7A 1YULA 3ABSB 1ONNA 2J41A 2X0RA 2ZU6A 3F6SA 2D2EA 3PFCA 3MTSA 3JQAD 1NVUQ 3KR9A 2J9FA 1V8OA 2QM7A 4RVSA 3FDFA 4CCWA 1E1QA 4Z4EA 3HQ4O 3SK5A 1IZZA 1WZEA 3OLWA 1JAIA 1NP3A 4H7EA 2JBAB 1OBVA 4DAYB 1SKYB 1E69A 2P30A 2WMYA 1DXQA 4YEDA 2D62A 1YS1X 4FJ0A 1V16B 4AYBB 1KYIA 1WMBA 5B2FA 5IK2D 1JZSA 3OFKA 3GG2A 4V190 1F1BA 1UFRA 4FBMA 3QQ5A 4UUOA 1Z8DA 4XD7D 1X32A 4HAWA 5H83A 3HKZG 2WR8A 2FWIA 4Q9NA 4M3NA 3A7AB 3RASA 5K8JB 1OI3A 2JCXA 1EMDA 1D2MA 1JR3A 2W2MA 1YZGA 4A0SA 3JXEA 2V9CA 3DQPA 2Y4OA 1IH8A 1K8RA 2H48A 5HUHA 5AVRA 1L1EA 1DIGA 1ZXXA 2Q3CA 4IQ8A 1V45E 4RD3A 1HNZB 4JLAA 3CR7A 3OLQA 1RRKA 2IDJA 1O1YA 1IHDA 1Z17A 1J8YF 5G02A 3A6EA 4U7WA 1TLLA 1Y4AE 2IY9A 4JNKA 5CDGA 1UCFA 3O3MB 4FDVA 4ZVPA 5BQPA 1TI7A 2FQXA 1DEXA 4CF4A 5A2GA 3BHJA 4M9XA 4PSKA 4OXXA 4IURA 4IHAA 5JZ9A 4CIAA 1N2GA 3CF6R 4EO9A 3H16A 3UDGA 2FU5C 3Q0TA 4XASA 3NUGA 1QTQA 2W93A 2PRZA 4DR7Q 1VE7A 1SUCA 1W47A 1GXSB 5TLSA 4WLEA 4MQ4A 2Q3JA 3ZGYA 1EWVA 2WBLC 4D3SA 3EPJA 4YMIA 2EYQA 1IYJB 4Z1MD 4LY0A 4C22A 3CRW1 3ACDA 1DRVA 2GPAA 5DOVA 4EHAA 1ZMOA 1U3VA 3UHFA 1NVVQ 5LA6A 3H1AA 1EJ0A 2PQAA 1CQVA 4JI3B 4JCOA 4LFBQ 2OCIA 1R3UA 3HTXA 3KB2A 1S2LA 4L8FA 4CV0A 3LUJA 3I92A 1YNJD 1JHDA 2WU4A 1WXWA 4KK4A 4XX0B 5E6RA 2ETXA 2D59A 1N6HA 4MGEA 4O4LB 4C4SA 2JLYA 4RKLA 2R61A 1Z26A 2XA2A 2PQAB 3FX2A 2I2AA 2VBFA 5JEAG 2JEBI 4A3MH 5ER9A 2G71A 2RHRA 1L8XA 4LW1A 4LDRA 2ZVQX 3KAPA 1Q22A 3N0TA 5KC8A 5H3LA 4EOGA 4DQDA 1X3SA 3T7AA 3NK9A 5JJLA 5B37A 4DYVA 1GXSA 1QZ3A 3SNKA 2OC9A 2B21A 1FNUA 3IEKA 3I32A 1HR0W 2EP5A 2X4IA 3D6UA 3JD1A 1Y1SA 4V0ME 4D9JA 1GQ2A 1KXZA 1U9YA 2R8RA 4TWIA 5D51S 3U4CA 4L8LA 3R9IA 2ORIA 2F67A 2Q4EA 3K70B 2FFQA 2QEQA 2WE8A 1H4QA 3NDRA 1GYQA 1YXMA 4JQOA 5G2OA 5IOCA 4AIRA 1EY4A 3EXIA 1RTTA 3LG2A 4I1VA 1O0CA 1GUSA 2AG5A 4TL8A 3PUVA 2GZ1A 5C2JB 2DUJA 5FK9C 3LVRE 3L7BA 4G09A 1PZHA 4AZWA 4QYSA 1WXFA 4BO3A 3JC66