4KI0F

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
494
structure length
490
Chain Sequence
SDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords ABC transporter related protein
total genus 155
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4ki0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4ki0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4ki0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4ki0F02
3PUXF 3PUYG 3PUWF 2ONKC 2R6GG 4KHZG 4XTCM 3RLFG 3TUZA 4XIGN 3PUZF 4XIGM 4YMVC 3D31C 3DHWA 4JBWF 4YMSC 3PV0G 3PUYF 3PUWG 3PUVG 4KHZF 4YMTB 3PUXG 4YMUC 2R6GF 3RLFF 4XTCN 4KI0G 3PV0F 4JBWG 3TUIA 4YMWC 3PUZG 4TQUM 4TQUN 4KI0F 3TUJA 3PUVF
chains in the Genus database with same CATH superfamily
4A56A 2XQ6A 4KBMB 2CXFA 2XQ8A 4U74A 2XQ5A 4JI4T 1XZYA 4X66T 4XIGN 5ETWA 2BDEA 2XQ7A 5AQTB 2WSSV 2K48A 5LMUT 3RYFE 2VK9A 2D2SA 3K1SA 3ZN1B 5C2TA 2Y6XA 3P4WA 1BR1A 2NTXA 3PU3A 3CVRA 3RIAA 3CX8B 3P50A 2V7KA 1I94T 3ZJ1A 2A9UA 3RPUA 3L09A 4O4LE 5AQQB 1WRDA 2CLYC 3ESLA 5LGNB 2LSKA 5AQNB 2YDRA 3IBPA 5HEOA 2W61A 3UUXB 5ABGA 1HG5A 4DBRA 2XAHB 3PJAA 5JR9B 5LBQB 1Y01A 3UU5A 3LK42 3PURA 3QK6A 4TX5A 3PUWF 3VU7H 4DIDB 4B3TT 1N32T 1E7PA 1OWAA 2C5JA 2LKHA 2X0LB 3AXJB 3UUBA 2IMLA 3KV6A 4C91A 2XM2A 2LRLA 2W00A 1UCUA 2DI4A 3AA6B 3CWZB 3DJBA 2HN2A 2ODUA 3KV5A 3P7IA 4CQIA 1GQEA 4DR4T 5HXEA 2BS4A 1OEDA 1WR0A 4OFZA 3Q9DA 3WAKA 1IBMT 1XMQT 1FIOA 1MNDA 3MACA 3VHLA 5L3DB 2IHR1 3SFDA 3N9MA 4QHOA 4LFBT 3FBZA 4I43B 2N2NA 3H37A 4KMCA 4AKRB 2B76A 2VASA 3HKEE 4PW8A 3TUIA 1OEDE 3DTOA 2V5DA 4G2AA 4K0UA 4U7YA 5HEGA 3SWHA 2BKPA 2CRBA 1YXRA 2XQAA 2IW5B 5H6QB 2CM0A 4EZHA 3MKDA 4P0AA 1JNZA 4Q25A 4U33A 4AKGA 5J0ZA 1IAPA 2WWUA 4PJJA 2VKDA 2WU2A 3RGLA 1HR0T 2QRXA 3T8OA 4YTNA 5EK2A 2W66A 3AEAA 3QUJA 3JCFA 1B7TA 4G63A 4OYJA 3AAIA 2X0HA 2QVAA 4A97A 2XAJB 2ZM0A 5KMGP 3DHWA 3T1YT 1D0YA 4B3RT 4IGUA 1KNPA 3KVAA 4AKIA 3EAMA 2BKOA 4HE8A 1DU2A 2H3RA 3HL6A 4TZ4C 5LJMA 3CPZA 4PFPA 2QGSA 1BR2A 1FMVA 1NAFA 2BS2A 3I9WA 2JQKA 2XQ4A 3OKQA 5L3FB 4XTCN 4TNWA 4KX6A 4QX7B 5L3GB 3F31A 2SPCA 3ETUA 2VL0A 1XNRT 3ZMVB 2Z6EA 3T1HT 4YJ3E 2IUBA 2NW7A 2WZHA 2ZLYA 4OK0A 4IE6A 3Q5EA 4I4TE 2IDOB 4HKAA 3J7Yq 4AXPA 2LJLA 5AQMB 3KFWX 3UTKA 5AQIB 4WBNE 5ABHA 2DWKA 4BAYB 1D1CA 3KBUA 3AE2A 1QSDA 3L8RA 2KWHA 4I55E 4IDZA 3NKZA 4UELA 5FKYA 4BA9A 2CMRA 4XIGM 1VCTA 2OA5A 1KNRA 2VKOA 3HKDE 5JR9A 4UF0A 3N9PA 2I0MA 3FXDB 5H6RB 4JBWF 3R6NA 2V5CA 3RYIE 3HKCE 5HEJA 4YHHT 3AE6A 5EK3A 1M62A 5IWAT 3PTRB 3PUWG 2IC6A 3N2KE 4KHZF 2CE7A 3UU6A 1D1AA 2XZEA 4NIQA 4O2AE 4NXMT 4CXXA 2N1GA 3J9X1 5LGTB 3N5LA 2W63A 4IREA 2J4GA 2JMKA 2V8SV 4HWIB 3N9OA 3UT5E 5CFBA 3IA3A 2V7MA 3AEDA 4TNVA 3A7MA 2WMOA 2CBJA 3ONJA 1HS7A 3EI0A 4O2BE 5BR8T 4HFDA 4NPPA 3AAEB 1D0ZA 1NENA 2XPKA 3I0QA 3O4XE 2M6IA 1VCSA 3UUNA 5AQFB 2G0UA 1JNRA 3ETVA 3Q5DA 3RYHE 5KX5E 1ZV4X 3PUYG 4UVAB 3UUMA 3NRYA 4WNKA 3V5UA 3ANWA 1XNQT 1QUUA 2BG9B 4YMVC 5GONE 4HFCA 5M4YA 2JIWA 4DV1T 3AAAB 3LG7A 2KT9A 3S4UA 3QB5K 1UX5A 2F4VT 5CB4E 5HXHA 5LCYA 1SE7A 2GK9A 2HPLA 3E0ZA 3C64A 4GIWA 2H89A 3PUVG 2LSIA 4AQFC 1MIVA 2D0TA 1XDPA 3E08A 2OLTA 2C5IT 4YMUC 2FJDA 4TUYE 3RKGA 2X9XA 4BJMA 2CEAA 4EB6E 4EYYR 1NWMX 1V9DA 5LBMA 2FUPA 2YU1A 2UXNB 1YKHB 2BVLA 5F8PA 4X65T 2M67A 2UXXB 2CCQA 2KINB 4AKLA 2V6YB 1UUSA 4DUYT 4YMWC 3EDVA 5HAXA 1LVFA 2KXPB 5JDQA 4CXYA 2HHHT 4TQUN 2FJBA 3NWIA 3ONLC 3RIFA 3RQUA 1MMNA 3U78A 3TLVA 3RX6A 3ZSSA 5CA0E 3A8YC 2FJAA 2RP4A 1N36T 4YSXA 4CI3B 2WWVA 3PDYA 3RLFG 4KHZG 3AECA 3L39A 4GYSA 4JI6T 4LMJA 2ODVA 4UV8B 4HFBA 2VURA 3ZT6A 4EYUA 1MIWA 3KDSE 4U3CA 4YFSA 5FXWA 4C90A 4ZI3C 3CK6A 5JRCB 5HCJA 3AEBA 4GYRA 4YMTB 4ZS2A 1LVKA 5KDMC 3LBXB 3ZT7A 4AKHA 5AQSB 3JAFA 4ZOLE 5AQKB 2L8KA 3LJCA 2WCAA 2A2FX 4JLEA 5FXVA 4IIJE 3ZCIA 5FL1A 5HXSA 3U3IA 3K8PC 3TLSA 3PV0F 2CBIA 4XBFB 5FXZA 4ADZA 5EZYE 3CIRA 2C0SA 4LF7T 2FBWA 4YHJA 3AVSA 4GK5E 5CGMA 5LHHB 4EEBA 4KUMB 3UFEA 2LOPA 2E9XC 4BJNA 2WY2A 1ZP0A 2ONKC 4DV3T 2R6GG 2LSGA 1BR0A 2DHRA 3NVOA 1WYBA 4ISTA 5ADXL 1WYCA 2IC9A 4DV7T 3OYZA 4HWCA 3TKLB 4JI2T 1YKEB 1FJGT 4PK4A 5JQGE 3BQKA 1Y64B 3NRXA 4EZ4A 1Z0PA 3TLWA 3B13A 3RC3A 4CI1B 3AEFA 3MZKB 3LFMA 3N2GE 3UQ4A 3AA0B 2V26A 2DNXA 5JDHA 5FP3A 2NW9A 2XASB 4NUVA 5AFUL 2XQ3A 4YSZA 2LHRA 3HKBE 4HFIA 2BG9C 3LSVA 4X64T 2A3DA 5LGUB 3FZHB 4P09A 1J1JA 2JRKA 1E1HB 4XZCA 4HWHA 2UUAT 4JI7T 4FI5A 3PUZG 5DJQC 4CZZB 4DR5T 3C51A 1US7B 4JEUB 2CHNA 3AE9A 3ZN0B 4AQGA 2PJQA 3FB2A 2XAQB 3ZYLA 4DR6T 4WW0A 4LF9T 1VOMA 2XQ9A 3BQIA 2D5UA 3N9LA 1CHUA 4QXBB 4JI1T 1WFDA 3M3ZB 3QNUA 2B1EA 2LM2A 1EZ3A 3OJAA 2XUEA 4QX8B 5E0OA 1HFAA 1XDOA 2YINA 4LMKA 1UX4A 3PV0G 3GN5B 4QH5A 5AQRB 4DVDA 2UUCT 2YEVC 3OPCA 4QKNA 5FNVE 1HNZT 4ZXLA 3WI3A 1OEDC 1FEWA 2MAWA 3PU8A 3JAEA 4PK5A 4YTMA 2EHOB 4ZI2C 3RIUA 4MLKA 3ZPOA 3UQ7A 4E7SA 4NXNT 4JEHB 1Z8UA 3AEGA 3M65A 3Q5WA 2WQYA 4J2CA 3ZSTA 2UU9T 3V5SA 2D0UA 1IZNB 2V1DB 4IT4A 2LSYA 2MOZA 4L9IA 2X67A 2E2AA 4EGWA 2UXDT 4PFOA 3RH3A 2BBJA 3NZPA 2WM9A 2WMNA 4QH4A 4CXWA 3DP7A 2HH7A 3ABVA 5LYJE 4H9NC 3CQXC 2J62A 2WDVA 2V6YA 1W09A 4LF8T 5JDNA 3LDQB 4I0UA 4YSYA 2KZ7B 3FZFB 1U4QA 3EUHA 5AQPB 3K3QC 4GKJT 3MJXA 1UURA 3LK2B 1HF8A 4LFAT 3VRAA 4O4IE 4ANJA 5CA1E 4H63V 5LOVE 5JDMA 5JH7E 1J5ET 2W67A 3JC6D 3PJAJ 2R6GF 3Q5XA 5HXCA 4ZI7E 1ZHCA 1U5PA 2KMFA 3C4WA 3B5MA 3EHZA 2H88A 3F2EA 5AQOB 5FY0A 3ZC1A 4JI0T 3VR8A 5BMVE 5IYZE 5TAOA 3EVYA 4LF6T 2BBHA 3ANWB 1M7KA 3Q2MA 4N78D 1IBKT 2PG8A 2LEHA 3HA4A 1KNZA 3LBXA 2YU2A 4ILUA 3UU4A 3CX7B 3AA1B 3ZCJA 1T7SA 3ZLIA 3TLUA 4ZHQE 5FY7A 2AE9A 3E22E 2KSRA 2OV9A 4YLHA 1W0BA 1SUMB 1W0AA 3C4XA 3F57A 4LF4T 3MK7C 4OHFA 2MTQA 3H3AA 4IDPA 4DMWA 5DQVA 5FY1A 4DO0A 5LHGB 2E5LT 3VR9A 2LLYA 3RQWA 1H7CA 2K9AA 2XAGB 4YMSC 4PJNA 5L3BB 1QLBA 4DBQA 4JI3T 4TWDA 1FMWA 4DR2T 3AB3B 5L3CB 2X0YA 1T72A 3AVRA 3RF1A 2WAUA 3KINB 1X79A 1L0VA 5JR9C 1YD8G 5DQWA 3LK3B 5L3EB 5L2LA 3PUQA 4HFHA 3CKDA 3OYXA 1SHZC 5IHYA 4GOUA 3AEEA 2L9QA 3GA8A 5HCMA 2YDSA 3A5XA 3AA7B 1YQ4A 5HWYA 4ASKA 3RI5A 1HX1B 4DV4T 4AQYT 2BKNA 4A5XA 1CUNA 2WDQA 1IJ5A 4B6XA 1UK5A 4IDQA 4TWHA 4DR1T 2JQHA 4YXDA 1ZOYA 3P4SA 4IL9A 4ZI2D 4OYKA 4P1NA 5LG3A 4X1KE 3CX6B 4IE0A 4M1PA 4X62T 3PUVF 2K24A 4NUUA 1HX8A 2V6XA 4X1IE 2JQQA 2CXLA 2E9XA 2QA7A 2DWGA 3SRZA 5FMNA 3PUZF 2BG9A 2PBIA 2X9YA 5LMNT 2Q9QD 2H7VC 3K3NA 4H9QC 3ZT5A 4CN6A 5JDGA 5JDFA 4TV9E 1HNWT 3PUYF 3P4PA 3FZKB 2MBGA 2WP9A 4EOZB 2LRKA 4ZI3D 2X9WA 3I1AA 4PNIA 1XWMA 2VB6A 2W2UA 2CHOA 3O1HA 5FL0A 2HPJA 2IIUA 2XSAA 3C98B 2ACXA 2IAKA 3CMLA 2YKSA 4H63H 4ILCA 2WBLA 2RPAA 5HEUA 3ZMTB 4CI2B 3L3PA 5KXJA 5JREA 1XMOT 2NP9A 1T98A 3KV4A 3H3MA 4U72A 3AE3A 1G73A 1MMAA 4TV8E 1J5WA 2D9DA 4IDNA 4ILBA 4TQUM 3OTOT 2E5VA 4AIUA 3W15B 3UFGA 4EEDA 4F8HA 4YJ2E 3OVUA 1ZEEA 3AE4A 4PJMA 1LRZA 2X68A 2EHOD 1MMGA 2VWAA 5AQVB 3UU8A 3EABA 3ZYKA 3VKHA 3P4RA 4FJOA 4WZXA 4H9PC 3TLTA 3PUSA 2QYWA 1IBLT 3D31C 2CLYB 5A1LA 1KF6A 3KV9A 4H9RC 2XJ7A 4Z91A 2JJ9A 3NZQA 2ZM6T 4GK0E 2A72A 2AXDS 2NR4A 2WZIA 5LXTE 2Q9QC 2BVMA 4IE5A 4JYAT 1X9BA 3AE8A 3C4ZA 3KBTA 4JUYA 4QXCB 5FVKA 3RHWA 4COFA 5HWXA 5L4EA 5J2TE 2VQFT 2LOSA 2VQET 4DV5T 4PAGA 4UR9A 4QH1A 5FXXA 2E9XD 3CQGB 5LG4A 3FZLB 2WU5A 1LKXA 1WLXA 3ZJ2A 2ZMAA 3ZMSB 1KK7A 5JVDE 4AQFA 3FZMB 2XHEB 3PUGA 4PK6A 4L5GA 4K0KT 2ZM2A 3RKOA 4X20E 2UUBT 2DL1A 2Q9QB 3NBXX 4JV5T 4ERRA 2K3WA 5LA6E 1MMDA 4UEMA 4IL4A 3PUXF 1W9RA 3GMIA 4ISSA 4UVCB 2HN1A 5AQJB 2VVNA 2XY8B 3AE1A 4EV6A 4DR7T 2YK0A 4U31A 3ONXA 2L3LA 1HNXT 4CN1A 2CWYA 1UGOA 3BK9A 2W0GA 4HFVA 2X66A 4XAXB 3MA9A 2CXDA 4P0BA 5LJNA 1WR6A 4GKKT 1HTJF 2XTLA 1OXZA 5F5WA 2C5KT 2W62A 4X1YE 3IF8B 4YY3T 1N33T 3HR0A 4YT0A 4HFEA 2LM9A 3UU3A 2CPTA 2E8IA 4TN7B 3FXEB 1VRBA 2PTFA 5J2UE 2NTYA 4HTEA 4X5TA 5FVLA 5L4HA 2Q9QA 3GN5A 3RRCA 3O9XA 3VRBA 1G8XA 1AJ3A 1E2AA 3K3OA 4A98A 2H7OA 3C50A 2N9DA 3O1IA 4IE4A 4MHCA 5JDLA 4JI8T 2VVSA 3FBLA 3OBVE 2BZBA 4U2ZA 4LFCT 4L0RA 2RA1A 4O4HE 2EHOC 4KHPT 1T8BA 4ZZCA 2MYSA 3IEEA 4XTCM 1YQ3A 2YN6A 5CJ5A 2XSBA 1KEYA 2Y8DA 4O4JE 3ZMZB 4IE7A 4DV0T 4LF5T 4TWFA 1D0XA 3BQLA 2XM1A 2LSJA 3SS1A 5LB7B 4H9OC 4MFRA 4DV2T 3PE0A 5C3JA 3UULA 2K5BB 4UXNB 4AI6A 2Y48B 3N9NA 2P9BA 4HN9A 1ZKEA 4MBQA 2ES0A 3QOFA 2VL8A 2J47A 2WS3A 2LKGA 4JBWG 2KWIB 3N9QA 3P8CD 1HCIA 2JPFA 5FYMA 5HEHA 2J1DG 2V7JA 3I9YA 3GWHA 3N2OA 1R8IA 3TUJA 2W4XA 5DABA 2KNDA 5J1GA 3EDUA 2CA5A 5IUXA 4DR3T 1S94A 2X51A 4UV9B 4UF0B 5AQHB 3O1JA 4IHJE 3ZC0A 4ZS3A 4DMVA 4EAHA 3P4QA 4QWNB 5EK4A 4LMLA 4ZZBA 4HWFA 4DUZT 3ZMUB 3VKGA 4O8SA 2KLQA 3SOLA 3QB5A 2YOEA 4B3MT 2CWOA 3R84B 4Z8XA 3I0OA 5LHIB 2BS3A 4WYVA 1D1BA 3PUXG 2I6HA 4I50E 4PJLA 2E9XB 5ABFB 2JMHA 2PFVA 4U7IA 3RIUC 1MNEA 3AE5A 2XAFB 1HG2A 5AQGB 3SFEA 3RRWA 1MIYA 5HYAA 3FHNA 5F3JA 3AXJA 5ABEA 5JRCA 2YDQA 4H9SE 2NWBA 4DV6T 2VKHA 1IJ6A 4KI0F 3ZKRA 3AE7A 3PUAA 4IDOA 3IHRA 3QC9A 3KVBA 4EIWA 2X9HA 1N34T 3RC8A 5HXRA 2VKJA 5AQUB 3RYCE 4DNDA 3TUZA 2ACZA 3ZEFB 4B3ST 2UXBT 2LT3A 4OX9T 2ZM8A 3B57A 2MPKA 3D0TA 4HGAA 2FJEA 3HI2A 4CN4A 5C8YE 1KFYA 2V7LA 4U2YA 1YW0A 3ZYMA 5AQLB 5LNKA 2UXCT 4ILAA 5LP6E 3WAJA 2WB5A 2NOXA 4UVBB 1S35A 4F6RC 3CQCB 3RLFF 2BG9E 2XQYA 2NW8A 3X1DA 2V7IA 2EHOA 3JC6C 4V1Av 3JADA 4KI0G 1O3XA 4QXHB 4JI5T 5L47A 1BR4A 4MALA 1NEKA 4Z90A 4KP3C 4E7ZA 4EXTA 4ZEYA 2LE8A 2JQ9A 1SA0E 2M6BA 3MXZA 2I59A 5JTGA 2DLRA 5ABFA 1WCRA 4YTPA 2DCFA 2LHNA 4HWDA 1I6ZA 3G06A 4HEAA 2WDRA 4AISA 4UIGA 1OEDB 4WBOA
chains in the Genus database with same CATH topology
3PUXF 3PUYG 3PUWF 2ONKC 2R6GG 4KHZG 4XTCM 3RLFG 3TUZA 4XIGN 3PUZF 4XIGM 4YMVC 3D31C 3DHWA 4JBWF 4YMSC 3PV0G 3PUYF 3PUWG 3PUVG 4KHZF 4YMTB 3PUXG 4YMUC 2R6GF 3RLFF 4XTCN 4KI0G 3PV0F 4JBWG 3TUIA 4YMWC 3PUZG 4TQUM 4TQUN 4KI0F 3TUJA 3PUVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUX F;  3PUY G;  3PUW F;  2ONK C;  2R6G G;  4KHZ G;  4XTC M;  3RLF G;  3TUZ A;  4XIG N;  3PUZ F;  4XIG M;  4YMV C;  3D31 C;  3DHW A;  4JBW F;  4YMS C;  3PV0 G;  3PUY F;  3PUW G;  3PUV G;  4KHZ F;  4YMT B;  3PUX G;  4YMU C;  2R6G F;  3RLF F;  4XTC N;  4KI0 G;  3PV0 F;  4JBW G;  3TUI A;  4YMW C;  3PUZ G;  4TQU M;  4TQU N;  4KI0 F;  3TUJ A;  3PUV F; 
#chains in the Genus database with same CATH topology
 4A56 A;  2XQ6 A;  4KBM B;  2CXF A;  2XQ8 A;  4U74 A;  2XQ5 A;  4JI4 T;  1XZY A;  4X66 T;  4XIG N;  5ETW A;  2BDE A;  2XQ7 A;  5AQT B;  2WSS V;  2K48 A;  5LMU T;  3RYF E;  2VK9 A;  2D2S A;  3K1S A;  3ZN1 B;  5C2T A;  2Y6X A;  3P4W A;  1BR1 A;  2NTX A;  3PU3 A;  3CVR A;  3RIA A;  3CX8 B;  3P50 A;  2V7K A;  1I94 T;  3ZJ1 A;  2A9U A;  3RPU A;  3L09 A;  4O4L E;  5AQQ B;  1WRD A;  2CLY C;  3ESL A;  5LGN B;  2LSK A;  5AQN B;  2YDR A;  3IBP A;  5HEO A;  2W61 A;  3UUX B;  5ABG A;  1HG5 A;  4DBR A;  2XAH B;  3PJA A;  5JR9 B;  5LBQ B;  1Y01 A;  3UU5 A;  3LK4 2;  3PUR A;  3QK6 A;  4TX5 A;  3PUW F;  3VU7 H;  4DID B;  4B3T T;  1N32 T;  1E7P A;  1OWA A;  2C5J A;  2LKH A;  2X0L B;  3AXJ B;  3UUB A;  2IML A;  3KV6 A;  4C91 A;  2XM2 A;  2LRL A;  2W00 A;  1UCU A;  2DI4 A;  3AA6 B;  3CWZ B;  3DJB A;  2HN2 A;  2ODU A;  3KV5 A;  3P7I A;  4CQI A;  1GQE A;  4DR4 T;  5HXE A;  2BS4 A;  1OED A;  1WR0 A;  4OFZ A;  3Q9D A;  3WAK A;  1IBM T;  1XMQ T;  1FIO A;  1MND A;  3MAC A;  3VHL A;  5L3D B;  2IHR 1;  3SFD A;  3N9M A;  4QHO A;  4LFB T;  3FBZ A;  4I43 B;  2N2N A;  3H37 A;  4KMC A;  4AKR B;  2B76 A;  2VAS A;  3HKE E;  4PW8 A;  3TUI A;  1OED E;  3DTO A;  2V5D A;  4G2A A;  4K0U A;  4U7Y A;  5HEG A;  3SWH A;  2BKP A;  2CRB A;  1YXR A;  2XQA A;  2IW5 B;  5H6Q B;  2CM0 A;  4EZH A;  3MKD A;  4P0A A;  1JNZ A;  4Q25 A;  4U33 A;  4AKG A;  5J0Z A;  1IAP A;  2WWU A;  4PJJ A;  2VKD A;  2WU2 A;  3RGL A;  1HR0 T;  2QRX A;  3T8O A;  4YTN A;  5EK2 A;  2W66 A;  3AEA A;  3QUJ A;  3JCF A;  1B7T A;  4G63 A;  4OYJ A;  3AAI A;  2X0H A;  2QVA A;  4A97 A;  2XAJ B;  2ZM0 A;  5KMG P;  3DHW A;  3T1Y T;  1D0Y A;  4B3R T;  4IGU A;  1KNP A;  3KVA A;  4AKI A;  3EAM A;  2BKO A;  4HE8 A;  1DU2 A;  2H3R A;  3HL6 A;  4TZ4 C;  5LJM A;  3CPZ A;  4PFP A;  2QGS A;  1BR2 A;  1FMV A;  1NAF A;  2BS2 A;  3I9W A;  2JQK A;  2XQ4 A;  3OKQ A;  5L3F B;  4XTC N;  4TNW A;  4KX6 A;  4QX7 B;  5L3G B;  3F31 A;  2SPC A;  3ETU A;  2VL0 A;  1XNR T;  3ZMV B;  2Z6E A;  3T1H T;  4YJ3 E;  2IUB A;  2NW7 A;  2WZH A;  2ZLY A;  4OK0 A;  4IE6 A;  3Q5E A;  4I4T E;  2IDO B;  4HKA A;  3J7Y q;  4AXP A;  2LJL A;  5AQM B;  3KFW X;  3UTK A;  5AQI B;  4WBN E;  5ABH A;  2DWK A;  4BAY B;  1D1C A;  3KBU A;  3AE2 A;  1QSD A;  3L8R A;  2KWH A;  4I55 E;  4IDZ A;  3NKZ A;  4UEL A;  5FKY A;  4BA9 A;  2CMR A;  4XIG M;  1VCT A;  2OA5 A;  1KNR A;  2VKO A;  3HKD E;  5JR9 A;  4UF0 A;  3N9P A;  2I0M A;  3FXD B;  5H6R B;  4JBW F;  3R6N A;  2V5C A;  3RYI E;  3HKC E;  5HEJ A;  4YHH T;  3AE6 A;  5EK3 A;  1M62 A;  5IWA T;  3PTR B;  3PUW G;  2IC6 A;  3N2K E;  4KHZ F;  2CE7 A;  3UU6 A;  1D1A A;  2XZE A;  4NIQ A;  4O2A E;  4NXM T;  4CXX A;  2N1G A;  3J9X 1;  5LGT B;  3N5L A;  2W63 A;  4IRE A;  2J4G A;  2JMK A;  2V8S V;  4HWI B;  3N9O A;  3UT5 E;  5CFB A;  3IA3 A;  2V7M A;  3AED A;  4TNV A;  3A7M A;  2WMO A;  2CBJ A;  3ONJ A;  1HS7 A;  3EI0 A;  4O2B E;  5BR8 T;  4HFD A;  4NPP A;  3AAE B;  1D0Z A;  1NEN A;  2XPK A;  3I0Q A;  3O4X E;  2M6I A;  1VCS A;  3UUN A;  5AQF B;  2G0U A;  1JNR A;  3ETV A;  3Q5D A;  3RYH E;  5KX5 E;  1ZV4 X;  3PUY G;  4UVA B;  3UUM A;  3NRY A;  4WNK A;  3V5U A;  3ANW A;  1XNQ T;  1QUU A;  2BG9 B;  4YMV C;  5GON E;  4HFC A;  5M4Y A;  2JIW A;  4DV1 T;  3AAA B;  3LG7 A;  2KT9 A;  3S4U A;  3QB5 K;  1UX5 A;  2F4V T;  5CB4 E;  5HXH A;  5LCY A;  1SE7 A;  2GK9 A;  2HPL A;  3E0Z A;  3C64 A;  4GIW A;  2H89 A;  3PUV G;  2LSI A;  4AQF C;  1MIV A;  2D0T A;  1XDP A;  3E08 A;  2OLT A;  2C5I T;  4YMU C;  2FJD A;  4TUY E;  3RKG A;  2X9X A;  4BJM A;  2CEA A;  4EB6 E;  4EYY R;  1NWM X;  1V9D A;  5LBM A;  2FUP A;  2YU1 A;  2UXN B;  1YKH B;  2BVL A;  5F8P A;  4X65 T;  2M67 A;  2UXX B;  2CCQ A;  2KIN B;  4AKL A;  2V6Y B;  1UUS A;  4DUY T;  4YMW C;  3EDV A;  5HAX A;  1LVF A;  2KXP B;  5JDQ A;  4CXY A;  2HHH T;  4TQU N;  2FJB A;  3NWI A;  3ONL C;  3RIF A;  3RQU A;  1MMN A;  3U78 A;  3TLV A;  3RX6 A;  3ZSS A;  5CA0 E;  3A8Y C;  2FJA A;  2RP4 A;  1N36 T;  4YSX A;  4CI3 B;  2WWV A;  3PDY A;  3RLF G;  4KHZ G;  3AEC A;  3L39 A;  4GYS A;  4JI6 T;  4LMJ A;  2ODV A;  4UV8 B;  4HFB A;  2VUR A;  3ZT6 A;  4EYU A;  1MIW A;  3KDS E;  4U3C A;  4YFS A;  5FXW A;  4C90 A;  4ZI3 C;  3CK6 A;  5JRC B;  5HCJ A;  3AEB A;  4GYR A;  4YMT B;  4ZS2 A;  1LVK A;  5KDM C;  3LBX B;  3ZT7 A;  4AKH A;  5AQS B;  3JAF A;  4ZOL E;  5AQK B;  2L8K A;  3LJC A;  2WCA A;  2A2F X;  4JLE A;  5FXV A;  4IIJ E;  3ZCI A;  5FL1 A;  5HXS A;  3U3I A;  3K8P C;  3TLS A;  3PV0 F;  2CBI A;  4XBF B;  5FXZ A;  4ADZ A;  5EZY E;  3CIR A;  2C0S A;  4LF7 T;  2FBW A;  4YHJ A;  3AVS A;  4GK5 E;  5CGM A;  5LHH B;  4EEB A;  4KUM B;  3UFE A;  2LOP A;  2E9X C;  4BJN A;  2WY2 A;  1ZP0 A;  2ONK C;  4DV3 T;  2R6G G;  2LSG A;  1BR0 A;  2DHR A;  3NVO A;  1WYB A;  4IST A;  5ADX L;  1WYC A;  2IC9 A;  4DV7 T;  3OYZ A;  4HWC A;  3TKL B;  4JI2 T;  1YKE B;  1FJG T;  4PK4 A;  5JQG E;  3BQK A;  1Y64 B;  3NRX A;  4EZ4 A;  1Z0P A;  3TLW A;  3B13 A;  3RC3 A;  4CI1 B;  3AEF A;  3MZK B;  3LFM A;  3N2G E;  3UQ4 A;  3AA0 B;  2V26 A;  2DNX A;  5JDH A;  5FP3 A;  2NW9 A;  2XAS B;  4NUV A;  5AFU L;  2XQ3 A;  4YSZ A;  2LHR A;  3HKB E;  4HFI A;  2BG9 C;  3LSV A;  4X64 T;  2A3D A;  5LGU B;  3FZH B;  4P09 A;  1J1J A;  2JRK A;  1E1H B;  4XZC A;  4HWH A;  2UUA T;  4JI7 T;  4FI5 A;  3PUZ G;  5DJQ C;  4CZZ B;  4DR5 T;  3C51 A;  1US7 B;  4JEU B;  2CHN A;  3AE9 A;  3ZN0 B;  4AQG A;  2PJQ A;  3FB2 A;  2XAQ B;  3ZYL A;  4DR6 T;  4WW0 A;  4LF9 T;  1VOM A;  2XQ9 A;  3BQI A;  2D5U A;  3N9L A;  1CHU A;  4QXB B;  4JI1 T;  1WFD A;  3M3Z B;  3QNU A;  2B1E A;  2LM2 A;  1EZ3 A;  3OJA A;  2XUE A;  4QX8 B;  5E0O A;  1HFA A;  1XDO A;  2YIN A;  4LMK A;  1UX4 A;  3PV0 G;  3GN5 B;  4QH5 A;  5AQR B;  4DVD A;  2UUC T;  2YEV C;  3OPC A;  4QKN A;  5FNV E;  1HNZ T;  4ZXL A;  3WI3 A;  1OED C;  1FEW A;  2MAW A;  3PU8 A;  3JAE A;  4PK5 A;  4YTM A;  2EHO B;  4ZI2 C;  3RIU A;  4MLK A;  3ZPO A;  3UQ7 A;  4E7S A;  4NXN T;  4JEH B;  1Z8U A;  3AEG A;  3M65 A;  3Q5W A;  2WQY A;  4J2C A;  3ZST A;  2UU9 T;  3V5S A;  2D0U A;  1IZN B;  2V1D B;  4IT4 A;  2LSY A;  2MOZ A;  4L9I A;  2X67 A;  2E2A A;  4EGW A;  2UXD T;  4PFO A;  3RH3 A;  2BBJ A;  3NZP A;  2WM9 A;  2WMN A;  4QH4 A;  4CXW A;  3DP7 A;  2HH7 A;  3ABV A;  5LYJ E;  4H9N C;  3CQX C;  2J62 A;  2WDV A;  2V6Y A;  1W09 A;  4LF8 T;  5JDN A;  3LDQ B;  4I0U A;  4YSY A;  2KZ7 B;  3FZF B;  1U4Q A;  3EUH A;  5AQP B;  3K3Q C;  4GKJ T;  3MJX A;  1UUR A;  3LK2 B;  1HF8 A;  4LFA T;  3VRA A;  4O4I E;  4ANJ A;  5CA1 E;  4H63 V;  5LOV E;  5JDM A;  5JH7 E;  1J5E T;  2W67 A;  3JC6 D;  3PJA J;  2R6G F;  3Q5X A;  5HXC A;  4ZI7 E;  1ZHC A;  1U5P A;  2KMF A;  3C4W A;  3B5M A;  3EHZ A;  2H88 A;  3F2E A;  5AQO B;  5FY0 A;  3ZC1 A;  4JI0 T;  3VR8 A;  5BMV E;  5IYZ E;  5TAO A;  3EVY A;  4LF6 T;  2BBH A;  3ANW B;  1M7K A;  3Q2M A;  4N78 D;  1IBK T;  2PG8 A;  2LEH A;  3HA4 A;  1KNZ A;  3LBX A;  2YU2 A;  4ILU A;  3UU4 A;  3CX7 B;  3AA1 B;  3ZCJ A;  1T7S A;  3ZLI A;  3TLU A;  4ZHQ E;  5FY7 A;  2AE9 A;  3E22 E;  2KSR A;  2OV9 A;  4YLH A;  1W0B A;  1SUM B;  1W0A A;  3C4X A;  3F57 A;  4LF4 T;  3MK7 C;  4OHF A;  2MTQ A;  3H3A A;  4IDP A;  4DMW A;  5DQV A;  5FY1 A;  4DO0 A;  5LHG B;  2E5L T;  3VR9 A;  2LLY A;  3RQW A;  1H7C A;  2K9A A;  2XAG B;  4YMS C;  4PJN A;  5L3B B;  1QLB A;  4DBQ A;  4JI3 T;  4TWD A;  1FMW A;  4DR2 T;  3AB3 B;  5L3C B;  2X0Y A;  1T72 A;  3AVR A;  3RF1 A;  2WAU A;  3KIN B;  1X79 A;  1L0V A;  5JR9 C;  1YD8 G;  5DQW A;  3LK3 B;  5L3E B;  5L2L A;  3PUQ A;  4HFH A;  3CKD A;  3OYX A;  1SHZ C;  5IHY A;  4GOU A;  3AEE A;  2L9Q A;  3GA8 A;  5HCM A;  2YDS A;  3A5X A;  3AA7 B;  1YQ4 A;  5HWY A;  4ASK A;  3RI5 A;  1HX1 B;  4DV4 T;  4AQY T;  2BKN A;  4A5X A;  1CUN A;  2WDQ A;  1IJ5 A;  4B6X A;  1UK5 A;  4IDQ A;  4TWH A;  4DR1 T;  2JQH A;  4YXD A;  1ZOY A;  3P4S A;  4IL9 A;  4ZI2 D;  4OYK A;  4P1N A;  5LG3 A;  4X1K E;  3CX6 B;  4IE0 A;  4M1P A;  4X62 T;  3PUV F;  2K24 A;  4NUU A;  1HX8 A;  2V6X A;  4X1I E;  2JQQ A;  2CXL A;  2E9X A;  2QA7 A;  2DWG A;  3SRZ A;  5FMN A;  3PUZ F;  2BG9 A;  2PBI A;  2X9Y A;  5LMN T;  2Q9Q D;  2H7V C;  3K3N A;  4H9Q C;  3ZT5 A;  4CN6 A;  5JDG A;  5JDF A;  4TV9 E;  1HNW T;  3PUY F;  3P4P A;  3FZK B;  2MBG A;  2WP9 A;  4EOZ B;  2LRK A;  4ZI3 D;  2X9W A;  3I1A A;  4PNI A;  1XWM A;  2VB6 A;  2W2U A;  2CHO A;  3O1H A;  5FL0 A;  2HPJ A;  2IIU A;  2XSA A;  3C98 B;  2ACX A;  2IAK A;  3CML A;  2YKS A;  4H63 H;  4ILC A;  2WBL A;  2RPA A;  5HEU A;  3ZMT B;  4CI2 B;  3L3P A;  5KXJ A;  5JRE A;  1XMO T;  2NP9 A;  1T98 A;  3KV4 A;  3H3M A;  4U72 A;  3AE3 A;  1G73 A;  1MMA A;  4TV8 E;  1J5W A;  2D9D A;  4IDN A;  4ILB A;  4TQU M;  3OTO T;  2E5V A;  4AIU A;  3W15 B;  3UFG A;  4EED A;  4F8H A;  4YJ2 E;  3OVU A;  1ZEE A;  3AE4 A;  4PJM A;  1LRZ A;  2X68 A;  2EHO D;  1MMG A;  2VWA A;  5AQV B;  3UU8 A;  3EAB A;  3ZYK A;  3VKH A;  3P4R A;  4FJO A;  4WZX A;  4H9P C;  3TLT A;  3PUS A;  2QYW A;  1IBL T;  3D31 C;  2CLY B;  5A1L A;  1KF6 A;  3KV9 A;  4H9R C;  2XJ7 A;  4Z91 A;  2JJ9 A;  3NZQ A;  2ZM6 T;  4GK0 E;  2A72 A;  2AXD S;  2NR4 A;  2WZI A;  5LXT E;  2Q9Q C;  2BVM A;  4IE5 A;  4JYA T;  1X9B A;  3AE8 A;  3C4Z A;  3KBT A;  4JUY A;  4QXC B;  5FVK A;  3RHW A;  4COF A;  5HWX A;  5L4E A;  5J2T E;  2VQF T;  2LOS A;  2VQE T;  4DV5 T;  4PAG A;  4UR9 A;  4QH1 A;  5FXX A;  2E9X D;  3CQG B;  5LG4 A;  3FZL B;  2WU5 A;  1LKX A;  1WLX A;  3ZJ2 A;  2ZMA A;  3ZMS B;  1KK7 A;  5JVD E;  4AQF A;  3FZM B;  2XHE B;  3PUG A;  4PK6 A;  4L5G A;  4K0K T;  2ZM2 A;  3RKO A;  4X20 E;  2UUB T;  2DL1 A;  2Q9Q B;  3NBX X;  4JV5 T;  4ERR A;  2K3W A;  5LA6 E;  1MMD A;  4UEM A;  4IL4 A;  3PUX F;  1W9R A;  3GMI A;  4ISS A;  4UVC B;  2HN1 A;  5AQJ B;  2VVN A;  2XY8 B;  3AE1 A;  4EV6 A;  4DR7 T;  2YK0 A;  4U31 A;  3ONX A;  2L3L A;  1HNX T;  4CN1 A;  2CWY A;  1UGO A;  3BK9 A;  2W0G A;  4HFV A;  2X66 A;  4XAX B;  3MA9 A;  2CXD A;  4P0B A;  5LJN A;  1WR6 A;  4GKK T;  1HTJ F;  2XTL A;  1OXZ A;  5F5W A;  2C5K T;  2W62 A;  4X1Y E;  3IF8 B;  4YY3 T;  1N33 T;  3HR0 A;  4YT0 A;  4HFE A;  2LM9 A;  3UU3 A;  2CPT A;  2E8I A;  4TN7 B;  3FXE B;  1VRB A;  2PTF A;  5J2U E;  2NTY A;  4HTE A;  4X5T A;  5FVL A;  5L4H A;  2Q9Q A;  3GN5 A;  3RRC A;  3O9X A;  3VRB A;  1G8X A;  1AJ3 A;  1E2A A;  3K3O A;  4A98 A;  2H7O A;  3C50 A;  2N9D A;  3O1I A;  4IE4 A;  4MHC A;  5JDL A;  4JI8 T;  2VVS A;  3FBL A;  3OBV E;  2BZB A;  4U2Z A;  4LFC T;  4L0R A;  2RA1 A;  4O4H E;  2EHO C;  4KHP T;  1T8B A;  4ZZC A;  2MYS A;  3IEE A;  4XTC M;  1YQ3 A;  2YN6 A;  5CJ5 A;  2XSB A;  1KEY A;  2Y8D A;  4O4J E;  3ZMZ B;  4IE7 A;  4DV0 T;  4LF5 T;  4TWF A;  1D0X A;  3BQL A;  2XM1 A;  2LSJ A;  3SS1 A;  5LB7 B;  4H9O C;  4MFR A;  4DV2 T;  3PE0 A;  5C3J A;  3UUL A;  2K5B B;  4UXN B;  4AI6 A;  2Y48 B;  3N9N A;  2P9B A;  4HN9 A;  1ZKE A;  4MBQ A;  2ES0 A;  3QOF A;  2VL8 A;  2J47 A;  2WS3 A;  2LKG A;  4JBW G;  2KWI B;  3N9Q A;  3P8C D;  1HCI A;  2JPF A;  5FYM A;  5HEH A;  2J1D G;  2V7J A;  3I9Y A;  3GWH A;  3N2O A;  1R8I A;  3TUJ A;  2W4X A;  5DAB A;  2KND A;  5J1G A;  3EDU A;  2CA5 A;  5IUX A;  4DR3 T;  1S94 A;  2X51 A;  4UV9 B;  4UF0 B;  5AQH B;  3O1J A;  4IHJ E;  3ZC0 A;  4ZS3 A;  4DMV A;  4EAH A;  3P4Q A;  4QWN B;  5EK4 A;  4LML A;  4ZZB A;  4HWF A;  4DUZ T;  3ZMU B;  3VKG A;  4O8S A;  2KLQ A;  3SOL A;  3QB5 A;  2YOE A;  4B3M T;  2CWO A;  3R84 B;  4Z8X A;  3I0O A;  5LHI B;  2BS3 A;  4WYV A;  1D1B A;  3PUX G;  2I6H A;  4I50 E;  4PJL A;  2E9X B;  5ABF B;  2JMH A;  2PFV A;  4U7I A;  3RIU C;  1MNE A;  3AE5 A;  2XAF B;  1HG2 A;  5AQG B;  3SFE A;  3RRW A;  1MIY A;  5HYA A;  3FHN A;  5F3J A;  3AXJ A;  5ABE A;  5JRC A;  2YDQ A;  4H9S E;  2NWB A;  4DV6 T;  2VKH A;  1IJ6 A;  4KI0 F;  3ZKR A;  3AE7 A;  3PUA A;  4IDO A;  3IHR A;  3QC9 A;  3KVB A;  4EIW A;  2X9H A;  1N34 T;  3RC8 A;  5HXR A;  2VKJ A;  5AQU B;  3RYC E;  4DND A;  3TUZ A;  2ACZ A;  3ZEF B;  4B3S T;  2UXB T;  2LT3 A;  4OX9 T;  2ZM8 A;  3B57 A;  2MPK A;  3D0T A;  4HGA A;  2FJE A;  3HI2 A;  4CN4 A;  5C8Y E;  1KFY A;  2V7L A;  4U2Y A;  1YW0 A;  3ZYM A;  5AQL B;  5LNK A;  2UXC T;  4ILA A;  5LP6 E;  3WAJ A;  2WB5 A;  2NOX A;  4UVB B;  1S35 A;  4F6R C;  3CQC B;  3RLF F;  2BG9 E;  2XQY A;  2NW8 A;  3X1D A;  2V7I A;  2EHO A;  3JC6 C;  4V1A v;  3JAD A;  4KI0 G;  1O3X A;  4QXH B;  4JI5 T;  5L47 A;  1BR4 A;  4MAL A;  1NEK A;  4Z90 A;  4KP3 C;  4E7Z A;  4EXT A;  4ZEY A;  2LE8 A;  2JQ9 A;  1SA0 E;  2M6B A;  3MXZ A;  2I59 A;  5JTG A;  2DLR A;  5ABF A;  1WCR A;  4YTP A;  2DCF A;  2LHN A;  4HWD A;  1I6Z A;  3G06 A;  4HEA A;  2WDR A;  4AIS A;  4UIG A;  1OED B;  4WBO A; 
#chains in the Genus database with same CATH homology
 3PUX F;  3PUY G;  3PUW F;  2ONK C;  2R6G G;  4KHZ G;  4XTC M;  3RLF G;  3TUZ A;  4XIG N;  3PUZ F;  4XIG M;  4YMV C;  3D31 C;  3DHW A;  4JBW F;  4YMS C;  3PV0 G;  3PUY F;  3PUW G;  3PUV G;  4KHZ F;  4YMT B;  3PUX G;  4YMU C;  2R6G F;  3RLF F;  4XTC N;  4KI0 G;  3PV0 F;  4JBW G;  3TUI A;  4YMW C;  3PUZ G;  4TQU M;  4TQU N;  4KI0 F;  3TUJ A;  3PUV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...