4KI0F

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
494
structure length
490
Chain Sequence
b'SDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 155
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4ki0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4ki0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4ki0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4ki0F02
3TUJA 4XIGM 3TUZA 4YMWC 3RLFG 2R6GG 4YMVC 3PV0G 4KI0F 4KHZF 3PUYF 4TQUN 4KHZG 3D31C 4KI0G 3PUYG 3DHWA 3PUWF 4JBWF 4YMTB 4TQUM 3PUZF 4YMSC 3TUIA 3PUWG 4JBWG 4YMUC 3PUZG 2ONKC 4XTCN 3PUXF 3PUVF 4XIGN 2R6GF 4XTCM 3PUVG 3PUXG 3PV0F 3RLFF
chains in the Genus database with same CATH superfamily
4DR6T 4H9NC 2YDSA 5HWYA 3NVOA 2ZLYA 4HKAA 2CEAA 3ESLA 5FXZA 2N9DA 5LA6E 3K1SA 1OEDB 3M65A 2YN6A 3RGLA 3U78A 3NRYA 4OK0A 3R84B 3AA1B 3HKDE 2XQ5A 3AE2A 2V7MA 4P1NA 3UU6A 4DR1T 4UELA 4YMUC 3CK6A 4EEDA 4ANJA 2JIWA 2CM0A 2WDRA 4DUZT 3TUJA 4LFCT 3N9QA 4TV9E 2Q9QB 2VWAA 2EHOD 1Z0PA 2OV9A 4AQFA 3RIFA 2F4VT 4J2CA 2X9WA 2XZEA 2E9XD 2XQ3A 4GKJT 3C50A 3UU4A 1HX8A 4BJNA 3OJAA 3TLSA 3TUZA 1UGOA 3OPCA 3WI3A 4BJMA 2BKOA 4HFBA 2A2FX 3GMIA 4KI0G 4L5GA 5C3JA 4JBWG 1YD8G 5ADXL 1HNWT 5AFUL 3FXEB 3NRXA 2RA1A 4Z91A 2R6GF 2WCAA 1UURA 4DIDB 4GK5E 3A7MA 4ISSA 3QC9A 3T1YT 3FBLA 2BDEA 4ILBA 2L3LA 2UUCT 2V26A 3VR9A 1YQ4A 5ETWA 4H9QC 4IDOA 5AQUB 4XAXB 3IBPA 4HFDA 4QX7B 3ZT7A 5EK3A 3KDSE 4A56A 4HN9A 4TWFA 1Z8UA 2H3RA 3P8CD 5AQVB 2NWBA 3TUIA 2HPJA 3Q5DA 3KV9A 4O4HE 3IHRA 1D1AA 1O3XA 5LBQB 1IBLT 3AB3B 4YT0A 2BS4A 3UUNA 3N9MA 3AA0B 5EK2A 5J1GA 4YSYA 2B1EA 4ASKA 1MIYA 2HH7A 5LCYA 5AQOB 3RYCE 3LK42 5HEUA 2CMRA 4PK6A 2D5UA 2LHNA 4I4TE 3U3IA 2ZM0A 4TZ4C 3UFEA 2YINA 2DHRA 4GKKT 4CXXA 2YKSA 4NIQA 3LSVA 4X5TA 3N2KE 1E1HB 3LK2B 5FKYA 5ABFA 2XY8B 1IAPA 3PUWF 3PUZF 3ZN0B 4Q25A 3E0ZA 4IDPA 1E7PA 4YY3T 2CA5A 4PJJA 4JI2T 1KFYA 1HFAA 2JRKA 2HPLA 4AKHA 2C0SA 3ONLC 1XMQT 5KMGP 5LHGB 4IHJE 3I0QA 3RC3A 4LFBT 4LMKA 4HTEA 4ILAA 3CX7B 5LJNA 3PU8A 5H6QB 1N32T 5AQPB 3PUXG 2WY2A 4ZI2C 2WZHA 4TNWA 3ZJ2A 3Q5EA 4HFHA 4ILCA 4EZ4A 3PUQA 4LF9T 3AAEB 2X51A 4UV8B 4H9RC 4XTCM 4U7YA 4YMWC 4DUYT 5JRCB 3KFWX 3HL6A 2VVSA 4OHFA 3EVYA 3UUBA 1HG5A 1J5ET 2KT9A 4HWIB 3L3PA 2YDQA 2DWKA 3GA8A 3AE6A 3NZQA 3ZN1B 2ZM6T 2C5IT 3RKGA 1OXZA 1L0VA 2BVLA 2W67A 3ZMSB 3O9XA 1KF6A 2CXDA 2BBJA 4EYYR 5HEHA 3P7IA 4KBMB 1OEDA 5LHHB 4WBNE 3PUVG 3AAAB 2UXNB 4F8HA 2BS3A 5AQMB 1WYBA 4F6RC 4ZI3C 4I0UA 1OEDE 3JAFA 3OYXA 2CXFA 5FY0A 1E2AA 3ZMTB 5L2LA 3QOFA 4AQFC 4O8SA 4PK5A 4DR5T 2H88A 2Q9QA 4COFA 4YJ3E 3T8OA 4ZZBA 4TN7B 3ZKRA 4CN4A 2DL1A 4EV6A 2UXCT 4X66T 4TNVA 3P4SA 5AQRB 3NKZA 2WM9A 3ZMUB 2BKNA 3B13A 2W4XA 5L3DB 3CMLA 1NENA 4WNKA 5DJQC 4MLKA 2EHOB 4JI4T 1I6ZA 4P0AA 4UR9A 5ABHA 1IBKT 2E9XB 1KEYA 4HEAA 3PV0G 2CWOA 1VOMA 4X62T 4YMTB 1LVKA 4HFIA 5FXXA 3V5UA 3N2GE 2IUBA 3RRWA 5AQHB 4UVAB 4E7SA 1D0ZA 2I59A 4P09A 3ZCJA 4IDQA 5FL0A 1SA0E 3ZYMA 2J1DG 1XZYA 3RC8A 3FZMB 2K48A 3I0OA 1UX4A 2K9AA 4YHHT 4DO0A 5CA1E 2VL0A 1T72A 5HEOA 4DV1T 3FZHB 4M1PA 2UXDT 3AE1A 4DV2T 3RI5A 2ACZA 1HCIA 2CCQA 3ZYLA 4ZI3D 3KBUA 4DV6T 4H63H 5KXJA 1SUMB 4PAGA 4AISA 2ONKC 3OKQA 3KINB 4XIGN 3CX6B 1YKHB 1FMVA 2LT3A 3AXJB 3F57A 3M3ZB 5HEGA 2CXLA 3G06A 4FJOA 2ACXA 2VKHA 3AVRA 4QXHB 4CN6A 2CHNA 4OFZA 4AQYT 4N78D 5H6RB 3SRZA 2UU9T 4LF8T 5BMVE 5BR8T 3PUSA 1BR1A 4KX6A 4JI0T 3LBXB 5HXEA 4A98A 5L3EB 1N36T 2LLYA 4QH1A 4AQGA 1BR2A 5CB4E 2PTFA 2LSJA 2CLYC 4MHCA 4ZHQE 4NPPA 2W00A 3AE4A 3HKEE 3UUXB 4AI6A 4IL4A 3AVSA 5KX5E 2X0YA 4G2AA 3F2EA 3FZFB 1ZEEA 2IIUA 1LVFA 2V6XA 1HG2A 2UUBT 5DABA 2LRLA 1CUNA 3S4UA 3P4PA 2ZM2A 4ZOLE 1B7TA 1U4QA 3LDQB 3DJBA 2WDVA 2N2NA 5JTGA 4TQUN 5JRCA 1G8XA 4DV0T 4PNIA 5HXRA 2PBIA 5IWAT 3VU7H 4B3ST 5FVLA 1G73A 1EZ3A 4UV9B 5L3FB 2KNDA 3RLFF 5JH7E 1IJ6A 4Z8XA 2V6YA 3ANWB 1NAFA 3AE8A 4UXNB 3AA7B 1JNRA 3RRCA 2WU5A 1HTJF 5LMNT 1OEDC 4LMJA 2LJLA 2RPAA 1V9DA 1QLBA 3EHZA 3CVRA 2KWHA 3GN5A 5JDFA 4LFAT 5GONE 4UF0B 2FBWA 5LHIB 3CPZA 4MALA 3O1HA 2J47A 4QKNA 4YLHA 5LNKA 3HKCE 2JQQA 1BR0A 2YEVC 5LYJE 3PJAJ 4JLEA 4MBQA 3AEAA 3NZPA 3BQLA 4DVDA 2NTXA 5JREA 3C4WA 3K3OA 3NWIA 3VRBA 2Q9QC 5C8YE 2XHEB 4DR2T 3P4QA 3VKHA 3DTOA 4OYKA 3KV4A 4CXWA 4DR4T 4HWHA 2VQFT 2KZ7B 2IC6A 2NR4A 2ODUA 2WSSV 3BQIA 1IZNB 1NEKA 3VRAA 4CZZB 2I6HA 1N33T 3PDYA 2XSAA 2D0UA 5ABGA 3EABA 1YQ3A 2ES0A 2KWIB 3N9PA 5AQLB 4DNDA 1WRDA 2EHOA 2V5CA 3ZLIA 2PG8A 4PFOA 1MNEA 2B76A 4B3MT 4KI0F 2E9XA 3E22E 3J7Yq 5AQJB 5LB7B 4GOUA 1ZP0A 4KUMB 4DR7T 4JBWF 4HWCA 5EK4A 3KVBA 2K5BB 2X0LB 3I9WA 3ZJ1A 5AQKB 2JPFA 2X66A 2FJBA 4E7ZA 1XNRT 3PUYG 4YFSA 4LF4T 4ILUA 3TKLB 1R8IA 5ABEA 4A97A 4IDNA 3FB2A 1FEWA 4NUVA 3WAJA 4IT4A 3RYIE 3ETUA 1H7CA 2HN2A 2KXPB 1T7SA 1HF8A 5DQVA 4DMWA 4YTNA 3V5SA 4CI3B 4JEHB 2LOPA 4U7IA 3A8YC 4UVBB 5LMUT 1QSDA 2PJQA 4LMLA 4MFRA 2QA7A 3QK6A 5IYZE 3X1DA 2IW5B 2Q9QD 4O4LE 2X9HA 2IC9A 2KLQA 1OWAA 4EXTA 2XUEA 2YU1A 3KV5A 4EIWA 1ZKEA 1YKEB 3AEDA 1UK5A 3AXJA 3ZC0A 3N9OA 4YXDA 2I0MA 2C5JA 2D2SA 4CQIA 2V6YB 3O1IA 2FUPA 1WYCA 2XM1A 2LE8A 3N5LA 4H9SE 3LBXA 2KINB 3TLTA 2IMLA 3SWHA 1J5WA 2H7VC 4YTPA 1MNDA 1Y64B 3GN5B 5FYMA 1YW0A 3MXZA 2LKGA 4G63A 1CHUA 4HWFA 1N34T 4ZS2A 2JQHA 2VURA 1D0XA 5E0OA 2XAJB 5HCMA 5LGTB 1MIWA 4AKIA 2Z6EA 1NWMX 4EB6E 4ISTA 4X65T 3EAMA 4CI2B 3H37A 4EOZB 3PUXF 3AEEA 4L0RA 3ONXA 3FBZA 3UUMA 4A5XA 1KNZA 3EUHA 2VVNA 3I9YA 2D0TA 1WR0A 4YSXA 3UTKA 2BBHA 3ZCIA 2XQ7A 3ZT5A 2IDOB 3RIAA 2G0UA 5L3CB 1ZV4X 2XQ8A 2DI4A 4QH5A 3TLUA 4LF6T 4I43B 1XDOA 3HR0A 2LHRA 2W66A 2X0HA 2VB6A 2IAKA 3H3MA 2VK9A 4ZI7E 3PUAA 3ANWA 3EDUA 5AQNB 3PUGA 4JI5T 2NW7A 2XM2A 4B3TT 4QH4A 2A3DA 2XJ7A 1X9BA 4NXNT 4HWDA 2LM9A 2VKOA 3E08A 4ZI2D 1WCRA 5JR9B 2DNXA 2M67A 2LOSA 2BKPA 2WWVA 3RH3A 4TUYE 3K8PC 5LBMA 4UF0A 2X9XA 1AJ3A 3OBVE 2OLTA 3LJCA 2MTQA 3AE9A 4XZCA 4JEUB 4YMSC 5J2UE 3P50A 2Y6XA 4XTCN 3LK3B 3TLVA 3Q5XA 3P4WA 2V5DA 2BVMA 3ZPOA 4KMCA 5J2TE 3TLWA 4QX8B 4O2AE 5FY1A 3AEFA 1UCUA 2ZMAA 3QB5A 3KBTA 2WU2A 3ZEFB 5FVKA 5JDLA 1MMGA 2IHR1 1BR4A 2JMHA 2CE7A 3UQ7A 5HXCA 3RIUA 4H9OC 4PJNA 2QGSA 2EHOC 4AKRB 3MA9A 2BG9B 2PFVA 1SE7A 3PTRB 5LOVE 5IUXA 1HS7A 3UQ4A 2LKHA 2XQ6A 5AQSB 3AE3A 1HR0T 3VHLA 3RQUA 5HYAA 4U3CA 3AEGA 1W9RA 2Y8DA 2LSYA 4UEMA 4JI6T 2XAHB 4TWHA 2LM2A 1VCTA 5F5WA 5JDGA 1ZHCA 2MBGA 2KMFA 2NP9A 3HKBE 3Q2MA 4LF7T 4L9IA 2NW8A 3ZSSA 3CX8B 2FJAA 3PV0F 4EAHA 2C5KT 3VR8A 3ZC1A 4DV3T 3QB5K 3SFDA 4LF5T 3SFEA 5L4HA 4CN1A 3PJAA 5FY7A 4IGUA 3RLFG 5L4EA 4X1YE 2VKDA 2JMKA 5LG3A 3OYZA 2E5VA 2V7LA 5HAXA 5LGUB 3FZKB 4X1KE 1WR6A 2V7JA 2R6GG 3K3NA 1D1CA 2WDQA 5EZYE 4IE4A 5JDNA 5HXHA 3O4XE 1KNPA 3RX6A 4JI8T 2MOZA 5LP6E 1JNZA 2DWGA 1D1BA 4KHZF 2MPKA 1J1JA 5AQQB 1XWMA 3ZMZB 4I50E 2XTLA 5HXSA 1XNQT 1LKXA 4Z90A 5AQIB 4B3RT 3QUJA 1SHZC 2OA5A 2D9DA 2V7KA 1W09A 4WZXA 4U2ZA 2VASA 3JCFA 3Q5WA 3MJXA 5A1LA 5FMNA 4TV8E 2XASB 3B57A 2FJEA 3AECA 4HFEA 5CFBA 1XMOT 3IA3A 2YK0A 1M7KA 4IE6A 4TWDA 2DCFA 3KV6A 2NOXA 4JI1T 3CKDA 1GQEA 3UU5A 3ZSTA 3J9X1 4B6XA 1MIVA 3CWZB 4ZS3A 4YSZA 4GK0E 3VKGA 3RYFE 4GIWA 2WAUA 4ZXLA 5J0ZA 3IF8B 1KK7A 5JVDE 1FJGT 4WYVA 1US7B 4X64T 2LSGA 5JDHA 3PUWG 1HX1B 1MMNA 4C90A 3PUZG 2X9YA 4PJLA 2YDRA 1S94A 3ZT6A 3PE0A 4AKLA 3DHWA 4JI3T 4TX5A 4YJ2E 4AKGA 4CXYA 3PU3A 3N2OA 2XQ4A 2VKJA 5CJ5A 3UFGA 2HN1A 4GYSA 1Y01A 2YU2A 3JC6C 4HGAA 2QRXA 2HHHT 5FXVA 5JR9A 5FXWA 4DV4T 4YTMA 3L09A 3MKDA 4V1Av 2W62A 4DMVA 1D0YA 2XQYA 4EYUA 3QNUA 5L3BB 4K0KT 3IEEA 4HFVA 4P0BA 2RP4A 2AE9A 3W15B 4PJMA 4OYJA 3D0TA 3O1JA 1VRBA 1MMAA 2LSIA 3C98B 2LRKA 4QWNB 3CQXC 2NW9A 4HFCA 5L3GB 2UXXB 2J62A 2SPCA 4O4JE 3RIUC 4IL9A 4JI7T 2QVAA 3HA4A 1QUUA 2WMNA 3RQWA 3EDVA 1LRZA 4GYRA 5AQGB 3EI0A 5LJMA 4O4IE 3B5MA 2BG9A 4DBQA 5TAOA 2K3WA 4U33A 4WBOA 2VQET 4ZZCA 1T98A 3DP7A 4X20E 3KVAA 2VL8A 5AQTB 4EGWA 2WS3A 3K3QC 3UT5E 2CHOA 4PFPA 1W0BA 2WBLA 2BG9E 2BZBA 3MACA 3HI2A 1WLXA 3C4ZA 3AAIA 2WZIA 4IREA 2M6IA 4PK4A 3UULA 4NXMT 2XSBA 1T8BA 2WB5A 4QHOA 1DU2A 1UX5A 3Q9DA 4YMVC 3PUYF 3P4RA 2WP9A 1MMDA 3ZMVB 3JC6D 4IE5A 3ZYKA 2NTYA 4DBRA 2M6BA 3RPUA 4JYAT 3UU8A 2XPKA 3RYHE 3C51A 1XDPA 3SS1A 1HNZT 2JQ9A 3FZLB 4O2BE 4UVCB 2YOEA 2V7IA 2X68A 4DV7T 2XQAA 4HE8A 2CPTA 3OVUA 1S35A 3GWHA 3A5XA 3OTOT 2L9QA 2N1GA 2E8IA 3WAKA 3AE7A 2LEHA 2MAWA 2CBJA 5LXTE 2CRBA 2E5LT 2A72A 4IIJE 4ERRA 3AA6B 5HCJA 2GK9A 4BAYB 1U5PA 4U31A 3C4XA 4ZEYA 2UUAT 2JQKA 3LG7A 2WWUA 5M4YA 4XIGM 1W0AA 1VCSA 4BA9A 5HEJA 2XQ9A 2XAGB 5F8PA 2JJ9A 2FJDA 2LSKA 4DR3T 2WMOA 3N9LA 4X1IE 1WFDA 5JQGE 2DLRA 3BK9A 2V8SV 5FL1A 4IE0A 4QXCB 3R6NA 2UXBT 2ZM8A 4K0UA 1X79A 4ADZA 2A9UA 1FIOA 3PUVF 4AXPA 4U72A 2KSRA 3MK7C 2X67A 2H7OA 2J4GA 3RF1A 1M62A 4NUUA 2W63A 2WQYA 4H9PC 3ETVA 5L47A 2XAFB 3ABVA 4OX9T 1UUSA 3N9NA 4DV5T 4YHJA 3I1AA 3L8RA 5F3JA 4WW0A 5ABFB 2W61A 3AEBA 2P9BA 3FXDB 4AIUA 1FMWA 5FP3A 4PW8A 4TQUM 5C2TA 4UIGA 4FI5A 4H63V 5DQWA 5FNVE 3PURA 5JR9C 1IBMT 3T1HT 3H3AA 5IHYA 2QYWA 3ONJA 2W2UA 3RKOA 2E9XC 5CA0E 2V1DB 4KHPT 5JDMA 2W0GA 5CGMA 3L39A 3D31C 1I94T 5LGNB 2CLYB 3CIRA 2CWYA 3CQCB 4I55E 4C91A 5HWXA 4JUYA 1IJ5A 3FHNA 5JDQA 2MYSA 3MZKB 2XAQB 3LFMA 5KDMC 3JADA 4KHZG 2Y48B 2CBIA 5LG4A 4IDZA 4IE7A 3F31A 4U74A 3JAEA 3AE5A 3BQKA 1KNRA 1YXRA 2E2AA 2AXDS 2H89A 1HNXT 4XBFB 3CQGB 2ODVA 3UU3A 2BS2A 3RHWA 3C64A 2L8KA 3SOLA 5AQFB 4JV5T 3NBXX 2BG9C 4EZHA 4QXBB 4KP3C 1ZOYA 2K24A 4U2YA 4EEBA 4CI1B
chains in the Genus database with same CATH topology
3TUJA 4XIGM 3TUZA 4YMWC 3RLFG 2R6GG 4YMVC 3PV0G 4KI0F 4KHZF 3PUYF 4TQUN 4KHZG 3D31C 4KI0G 3PUYG 3DHWA 3PUWF 4JBWF 4YMTB 4TQUM 3PUZF 4YMSC 3TUIA 3PUWG 4JBWG 4YMUC 3PUZG 2ONKC 4XTCN 3PUXF 3PUVF 4XIGN 2R6GF 4XTCM 3PUVG 3PUXG 3PV0F 3RLFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUJ A;  4XIG M;  3TUZ A;  4YMW C;  3RLF G;  2R6G G;  4YMV C;  3PV0 G;  4KI0 F;  4KHZ F;  3PUY F;  4TQU N;  4KHZ G;  3D31 C;  4KI0 G;  3PUY G;  3DHW A;  3PUW F;  4JBW F;  4YMT B;  4TQU M;  3PUZ F;  4YMS C;  3TUI A;  3PUW G;  4JBW G;  4YMU C;  3PUZ G;  2ONK C;  4XTC N;  3PUX F;  3PUV F;  4XIG N;  2R6G F;  4XTC M;  3PUV G;  3PUX G;  3PV0 F;  3RLF F; 
#chains in the Genus database with same CATH topology
 4DR6 T;  4H9N C;  2YDS A;  5HWY A;  3NVO A;  2ZLY A;  4HKA A;  2CEA A;  3ESL A;  5FXZ A;  2N9D A;  5LA6 E;  3K1S A;  1OED B;  3M65 A;  2YN6 A;  3RGL A;  3U78 A;  3NRY A;  4OK0 A;  3R84 B;  3AA1 B;  3HKD E;  2XQ5 A;  3AE2 A;  2V7M A;  4P1N A;  3UU6 A;  4DR1 T;  4UEL A;  4YMU C;  3CK6 A;  4EED A;  4ANJ A;  2JIW A;  2CM0 A;  2WDR A;  4DUZ T;  3TUJ A;  4LFC T;  3N9Q A;  4TV9 E;  2Q9Q B;  2VWA A;  2EHO D;  1Z0P A;  2OV9 A;  4AQF A;  3RIF A;  2F4V T;  4J2C A;  2X9W A;  2XZE A;  2E9X D;  2XQ3 A;  4GKJ T;  3C50 A;  3UU4 A;  1HX8 A;  4BJN A;  3OJA A;  3TLS A;  3TUZ A;  1UGO A;  3OPC A;  3WI3 A;  4BJM A;  2BKO A;  4HFB A;  2A2F X;  3GMI A;  4KI0 G;  4L5G A;  5C3J A;  4JBW G;  1YD8 G;  5ADX L;  1HNW T;  5AFU L;  3FXE B;  3NRX A;  2RA1 A;  4Z91 A;  2R6G F;  2WCA A;  1UUR A;  4DID B;  4GK5 E;  3A7M A;  4ISS A;  3QC9 A;  3T1Y T;  3FBL A;  2BDE A;  4ILB A;  2L3L A;  2UUC T;  2V26 A;  3VR9 A;  1YQ4 A;  5ETW A;  4H9Q C;  4IDO A;  5AQU B;  4XAX B;  3IBP A;  4HFD A;  4QX7 B;  3ZT7 A;  5EK3 A;  3KDS E;  4A56 A;  4HN9 A;  4TWF A;  1Z8U A;  2H3R A;  3P8C D;  5AQV B;  2NWB A;  3TUI A;  2HPJ A;  3Q5D A;  3KV9 A;  4O4H E;  3IHR A;  1D1A A;  1O3X A;  5LBQ B;  1IBL T;  3AB3 B;  4YT0 A;  2BS4 A;  3UUN A;  3N9M A;  3AA0 B;  5EK2 A;  5J1G A;  4YSY A;  2B1E A;  4ASK A;  1MIY A;  2HH7 A;  5LCY A;  5AQO B;  3RYC E;  3LK4 2;  5HEU A;  2CMR A;  4PK6 A;  2D5U A;  2LHN A;  4I4T E;  3U3I A;  2ZM0 A;  4TZ4 C;  3UFE A;  2YIN A;  2DHR A;  4GKK T;  4CXX A;  2YKS A;  4NIQ A;  3LSV A;  4X5T A;  3N2K E;  1E1H B;  3LK2 B;  5FKY A;  5ABF A;  2XY8 B;  1IAP A;  3PUW F;  3PUZ F;  3ZN0 B;  4Q25 A;  3E0Z A;  4IDP A;  1E7P A;  4YY3 T;  2CA5 A;  4PJJ A;  4JI2 T;  1KFY A;  1HFA A;  2JRK A;  2HPL A;  4AKH A;  2C0S A;  3ONL C;  1XMQ T;  5KMG P;  5LHG B;  4IHJ E;  3I0Q A;  3RC3 A;  4LFB T;  4LMK A;  4HTE A;  4ILA A;  3CX7 B;  5LJN A;  3PU8 A;  5H6Q B;  1N32 T;  5AQP B;  3PUX G;  2WY2 A;  4ZI2 C;  2WZH A;  4TNW A;  3ZJ2 A;  3Q5E A;  4HFH A;  4ILC A;  4EZ4 A;  3PUQ A;  4LF9 T;  3AAE B;  2X51 A;  4UV8 B;  4H9R C;  4XTC M;  4U7Y A;  4YMW C;  4DUY T;  5JRC B;  3KFW X;  3HL6 A;  2VVS A;  4OHF A;  3EVY A;  3UUB A;  1HG5 A;  1J5E T;  2KT9 A;  4HWI B;  3L3P A;  2YDQ A;  2DWK A;  3GA8 A;  3AE6 A;  3NZQ A;  3ZN1 B;  2ZM6 T;  2C5I T;  3RKG A;  1OXZ A;  1L0V A;  2BVL A;  2W67 A;  3ZMS B;  3O9X A;  1KF6 A;  2CXD A;  2BBJ A;  4EYY R;  5HEH A;  3P7I A;  4KBM B;  1OED A;  5LHH B;  4WBN E;  3PUV G;  3AAA B;  2UXN B;  4F8H A;  2BS3 A;  5AQM B;  1WYB A;  4F6R C;  4ZI3 C;  4I0U A;  1OED E;  3JAF A;  3OYX A;  2CXF A;  5FY0 A;  1E2A A;  3ZMT B;  5L2L A;  3QOF A;  4AQF C;  4O8S A;  4PK5 A;  4DR5 T;  2H88 A;  2Q9Q A;  4COF A;  4YJ3 E;  3T8O A;  4ZZB A;  4TN7 B;  3ZKR A;  4CN4 A;  2DL1 A;  4EV6 A;  2UXC T;  4X66 T;  4TNV A;  3P4S A;  5AQR B;  3NKZ A;  2WM9 A;  3ZMU B;  2BKN A;  3B13 A;  2W4X A;  5L3D B;  3CML A;  1NEN A;  4WNK A;  5DJQ C;  4MLK A;  2EHO B;  4JI4 T;  1I6Z A;  4P0A A;  4UR9 A;  5ABH A;  1IBK T;  2E9X B;  1KEY A;  4HEA A;  3PV0 G;  2CWO A;  1VOM A;  4X62 T;  4YMT B;  1LVK A;  4HFI A;  5FXX A;  3V5U A;  3N2G E;  2IUB A;  3RRW A;  5AQH B;  4UVA B;  4E7S A;  1D0Z A;  2I59 A;  4P09 A;  3ZCJ A;  4IDQ A;  5FL0 A;  1SA0 E;  3ZYM A;  2J1D G;  1XZY A;  3RC8 A;  3FZM B;  2K48 A;  3I0O A;  1UX4 A;  2K9A A;  4YHH T;  4DO0 A;  5CA1 E;  2VL0 A;  1T72 A;  5HEO A;  4DV1 T;  3FZH B;  4M1P A;  2UXD T;  3AE1 A;  4DV2 T;  3RI5 A;  2ACZ A;  1HCI A;  2CCQ A;  3ZYL A;  4ZI3 D;  3KBU A;  4DV6 T;  4H63 H;  5KXJ A;  1SUM B;  4PAG A;  4AIS A;  2ONK C;  3OKQ A;  3KIN B;  4XIG N;  3CX6 B;  1YKH B;  1FMV A;  2LT3 A;  3AXJ B;  3F57 A;  3M3Z B;  5HEG A;  2CXL A;  3G06 A;  4FJO A;  2ACX A;  2VKH A;  3AVR A;  4QXH B;  4CN6 A;  2CHN A;  4OFZ A;  4AQY T;  4N78 D;  5H6R B;  3SRZ A;  2UU9 T;  4LF8 T;  5BMV E;  5BR8 T;  3PUS A;  1BR1 A;  4KX6 A;  4JI0 T;  3LBX B;  5HXE A;  4A98 A;  5L3E B;  1N36 T;  2LLY A;  4QH1 A;  4AQG A;  1BR2 A;  5CB4 E;  2PTF A;  2LSJ A;  2CLY C;  4MHC A;  4ZHQ E;  4NPP A;  2W00 A;  3AE4 A;  3HKE E;  3UUX B;  4AI6 A;  4IL4 A;  3AVS A;  5KX5 E;  2X0Y A;  4G2A A;  3F2E A;  3FZF B;  1ZEE A;  2IIU A;  1LVF A;  2V6X A;  1HG2 A;  2UUB T;  5DAB A;  2LRL A;  1CUN A;  3S4U A;  3P4P A;  2ZM2 A;  4ZOL E;  1B7T A;  1U4Q A;  3LDQ B;  3DJB A;  2WDV A;  2N2N A;  5JTG A;  4TQU N;  5JRC A;  1G8X A;  4DV0 T;  4PNI A;  5HXR A;  2PBI A;  5IWA T;  3VU7 H;  4B3S T;  5FVL A;  1G73 A;  1EZ3 A;  4UV9 B;  5L3F B;  2KND A;  3RLF F;  5JH7 E;  1IJ6 A;  4Z8X A;  2V6Y A;  3ANW B;  1NAF A;  3AE8 A;  4UXN B;  3AA7 B;  1JNR A;  3RRC A;  2WU5 A;  1HTJ F;  5LMN T;  1OED C;  4LMJ A;  2LJL A;  2RPA A;  1V9D A;  1QLB A;  3EHZ A;  3CVR A;  2KWH A;  3GN5 A;  5JDF A;  4LFA T;  5GON E;  4UF0 B;  2FBW A;  5LHI B;  3CPZ A;  4MAL A;  3O1H A;  2J47 A;  4QKN A;  4YLH A;  5LNK A;  3HKC E;  2JQQ A;  1BR0 A;  2YEV C;  5LYJ E;  3PJA J;  4JLE A;  4MBQ A;  3AEA A;  3NZP A;  3BQL A;  4DVD A;  2NTX A;  5JRE A;  3C4W A;  3K3O A;  3NWI A;  3VRB A;  2Q9Q C;  5C8Y E;  2XHE B;  4DR2 T;  3P4Q A;  3VKH A;  3DTO A;  4OYK A;  3KV4 A;  4CXW A;  4DR4 T;  4HWH A;  2VQF T;  2KZ7 B;  2IC6 A;  2NR4 A;  2ODU A;  2WSS V;  3BQI A;  1IZN B;  1NEK A;  3VRA A;  4CZZ B;  2I6H A;  1N33 T;  3PDY A;  2XSA A;  2D0U A;  5ABG A;  3EAB A;  1YQ3 A;  2ES0 A;  2KWI B;  3N9P A;  5AQL B;  4DND A;  1WRD A;  2EHO A;  2V5C A;  3ZLI A;  2PG8 A;  4PFO A;  1MNE A;  2B76 A;  4B3M T;  4KI0 F;  2E9X A;  3E22 E;  3J7Y q;  5AQJ B;  5LB7 B;  4GOU A;  1ZP0 A;  4KUM B;  4DR7 T;  4JBW F;  4HWC A;  5EK4 A;  3KVB A;  2K5B B;  2X0L B;  3I9W A;  3ZJ1 A;  5AQK B;  2JPF A;  2X66 A;  2FJB A;  4E7Z A;  1XNR T;  3PUY G;  4YFS A;  4LF4 T;  4ILU A;  3TKL B;  1R8I A;  5ABE A;  4A97 A;  4IDN A;  3FB2 A;  1FEW A;  4NUV A;  3WAJ A;  4IT4 A;  3RYI E;  3ETU A;  1H7C A;  2HN2 A;  2KXP B;  1T7S A;  1HF8 A;  5DQV A;  4DMW A;  4YTN A;  3V5S A;  4CI3 B;  4JEH B;  2LOP A;  4U7I A;  3A8Y C;  4UVB B;  5LMU T;  1QSD A;  2PJQ A;  4LML A;  4MFR A;  2QA7 A;  3QK6 A;  5IYZ E;  3X1D A;  2IW5 B;  2Q9Q D;  4O4L E;  2X9H A;  2IC9 A;  2KLQ A;  1OWA A;  4EXT A;  2XUE A;  2YU1 A;  3KV5 A;  4EIW A;  1ZKE A;  1YKE B;  3AED A;  1UK5 A;  3AXJ A;  3ZC0 A;  3N9O A;  4YXD A;  2I0M A;  2C5J A;  2D2S A;  4CQI A;  2V6Y B;  3O1I A;  2FUP A;  1WYC A;  2XM1 A;  2LE8 A;  3N5L A;  4H9S E;  3LBX A;  2KIN B;  3TLT A;  2IML A;  3SWH A;  1J5W A;  2H7V C;  4YTP A;  1MND A;  1Y64 B;  3GN5 B;  5FYM A;  1YW0 A;  3MXZ A;  2LKG A;  4G63 A;  1CHU A;  4HWF A;  1N34 T;  4ZS2 A;  2JQH A;  2VUR A;  1D0X A;  5E0O A;  2XAJ B;  5HCM A;  5LGT B;  1MIW A;  4AKI A;  2Z6E A;  1NWM X;  4EB6 E;  4IST A;  4X65 T;  3EAM A;  4CI2 B;  3H37 A;  4EOZ B;  3PUX F;  3AEE A;  4L0R A;  3ONX A;  3FBZ A;  3UUM A;  4A5X A;  1KNZ A;  3EUH A;  2VVN A;  3I9Y A;  2D0T A;  1WR0 A;  4YSX A;  3UTK A;  2BBH A;  3ZCI A;  2XQ7 A;  3ZT5 A;  2IDO B;  3RIA A;  2G0U A;  5L3C B;  1ZV4 X;  2XQ8 A;  2DI4 A;  4QH5 A;  3TLU A;  4LF6 T;  4I43 B;  1XDO A;  3HR0 A;  2LHR A;  2W66 A;  2X0H A;  2VB6 A;  2IAK A;  3H3M A;  2VK9 A;  4ZI7 E;  3PUA A;  3ANW A;  3EDU A;  5AQN B;  3PUG A;  4JI5 T;  2NW7 A;  2XM2 A;  4B3T T;  4QH4 A;  2A3D A;  2XJ7 A;  1X9B A;  4NXN T;  4HWD A;  2LM9 A;  2VKO A;  3E08 A;  4ZI2 D;  1WCR A;  5JR9 B;  2DNX A;  2M67 A;  2LOS A;  2BKP A;  2WWV A;  3RH3 A;  4TUY E;  3K8P C;  5LBM A;  4UF0 A;  2X9X A;  1AJ3 A;  3OBV E;  2OLT A;  3LJC A;  2MTQ A;  3AE9 A;  4XZC A;  4JEU B;  4YMS C;  5J2U E;  3P50 A;  2Y6X A;  4XTC N;  3LK3 B;  3TLV A;  3Q5X A;  3P4W A;  2V5D A;  2BVM A;  3ZPO A;  4KMC A;  5J2T E;  3TLW A;  4QX8 B;  4O2A E;  5FY1 A;  3AEF A;  1UCU A;  2ZMA A;  3QB5 A;  3KBT A;  2WU2 A;  3ZEF B;  5FVK A;  5JDL A;  1MMG A;  2IHR 1;  1BR4 A;  2JMH A;  2CE7 A;  3UQ7 A;  5HXC A;  3RIU A;  4H9O C;  4PJN A;  2QGS A;  2EHO C;  4AKR B;  3MA9 A;  2BG9 B;  2PFV A;  1SE7 A;  3PTR B;  5LOV E;  5IUX A;  1HS7 A;  3UQ4 A;  2LKH A;  2XQ6 A;  5AQS B;  3AE3 A;  1HR0 T;  3VHL A;  3RQU A;  5HYA A;  4U3C A;  3AEG A;  1W9R A;  2Y8D A;  2LSY A;  4UEM A;  4JI6 T;  2XAH B;  4TWH A;  2LM2 A;  1VCT A;  5F5W A;  5JDG A;  1ZHC A;  2MBG A;  2KMF A;  2NP9 A;  3HKB E;  3Q2M A;  4LF7 T;  4L9I A;  2NW8 A;  3ZSS A;  3CX8 B;  2FJA A;  3PV0 F;  4EAH A;  2C5K T;  3VR8 A;  3ZC1 A;  4DV3 T;  3QB5 K;  3SFD A;  4LF5 T;  3SFE A;  5L4H A;  4CN1 A;  3PJA A;  5FY7 A;  4IGU A;  3RLF G;  5L4E A;  4X1Y E;  2VKD A;  2JMK A;  5LG3 A;  3OYZ A;  2E5V A;  2V7L A;  5HAX A;  5LGU B;  3FZK B;  4X1K E;  1WR6 A;  2V7J A;  2R6G G;  3K3N A;  1D1C A;  2WDQ A;  5EZY E;  4IE4 A;  5JDN A;  5HXH A;  3O4X E;  1KNP A;  3RX6 A;  4JI8 T;  2MOZ A;  5LP6 E;  1JNZ A;  2DWG A;  1D1B A;  4KHZ F;  2MPK A;  1J1J A;  5AQQ B;  1XWM A;  3ZMZ B;  4I50 E;  2XTL A;  5HXS A;  1XNQ T;  1LKX A;  4Z90 A;  5AQI B;  4B3R T;  3QUJ A;  1SHZ C;  2OA5 A;  2D9D A;  2V7K A;  1W09 A;  4WZX A;  4U2Z A;  2VAS A;  3JCF A;  3Q5W A;  3MJX A;  5A1L A;  5FMN A;  4TV8 E;  2XAS B;  3B57 A;  2FJE A;  3AEC A;  4HFE A;  5CFB A;  1XMO T;  3IA3 A;  2YK0 A;  1M7K A;  4IE6 A;  4TWD A;  2DCF A;  3KV6 A;  2NOX A;  4JI1 T;  3CKD A;  1GQE A;  3UU5 A;  3ZST A;  3J9X 1;  4B6X A;  1MIV A;  3CWZ B;  4ZS3 A;  4YSZ A;  4GK0 E;  3VKG A;  3RYF E;  4GIW A;  2WAU A;  4ZXL A;  5J0Z A;  3IF8 B;  1KK7 A;  5JVD E;  1FJG T;  4WYV A;  1US7 B;  4X64 T;  2LSG A;  5JDH A;  3PUW G;  1HX1 B;  1MMN A;  4C90 A;  3PUZ G;  2X9Y A;  4PJL A;  2YDR A;  1S94 A;  3ZT6 A;  3PE0 A;  4AKL A;  3DHW A;  4JI3 T;  4TX5 A;  4YJ2 E;  4AKG A;  4CXY A;  3PU3 A;  3N2O A;  2XQ4 A;  2VKJ A;  5CJ5 A;  3UFG A;  2HN1 A;  4GYS A;  1Y01 A;  2YU2 A;  3JC6 C;  4HGA A;  2QRX A;  2HHH T;  5FXV A;  5JR9 A;  5FXW A;  4DV4 T;  4YTM A;  3L09 A;  3MKD A;  4V1A v;  2W62 A;  4DMV A;  1D0Y A;  2XQY A;  4EYU A;  3QNU A;  5L3B B;  4K0K T;  3IEE A;  4HFV A;  4P0B A;  2RP4 A;  2AE9 A;  3W15 B;  4PJM A;  4OYJ A;  3D0T A;  3O1J A;  1VRB A;  1MMA A;  2LSI A;  3C98 B;  2LRK A;  4QWN B;  3CQX C;  2NW9 A;  4HFC A;  5L3G B;  2UXX B;  2J62 A;  2SPC A;  4O4J E;  3RIU C;  4IL9 A;  4JI7 T;  2QVA A;  3HA4 A;  1QUU A;  2WMN A;  3RQW A;  3EDV A;  1LRZ A;  4GYR A;  5AQG B;  3EI0 A;  5LJM A;  4O4I E;  3B5M A;  2BG9 A;  4DBQ A;  5TAO A;  2K3W A;  4U33 A;  4WBO A;  2VQE T;  4ZZC A;  1T98 A;  3DP7 A;  4X20 E;  3KVA A;  2VL8 A;  5AQT B;  4EGW A;  2WS3 A;  3K3Q C;  3UT5 E;  2CHO A;  4PFP A;  1W0B A;  2WBL A;  2BG9 E;  2BZB A;  3MAC A;  3HI2 A;  1WLX A;  3C4Z A;  3AAI A;  2WZI A;  4IRE A;  2M6I A;  4PK4 A;  3UUL A;  4NXM T;  2XSB A;  1T8B A;  2WB5 A;  4QHO A;  1DU2 A;  1UX5 A;  3Q9D A;  4YMV C;  3PUY F;  3P4R A;  2WP9 A;  1MMD A;  3ZMV B;  3JC6 D;  4IE5 A;  3ZYK A;  2NTY A;  4DBR A;  2M6B A;  3RPU A;  4JYA T;  3UU8 A;  2XPK A;  3RYH E;  3C51 A;  1XDP A;  3SS1 A;  1HNZ T;  2JQ9 A;  3FZL B;  4O2B E;  4UVC B;  2YOE A;  2V7I A;  2X68 A;  4DV7 T;  2XQA A;  4HE8 A;  2CPT A;  3OVU A;  1S35 A;  3GWH A;  3A5X A;  3OTO T;  2L9Q A;  2N1G A;  2E8I A;  3WAK A;  3AE7 A;  2LEH A;  2MAW A;  2CBJ A;  5LXT E;  2CRB A;  2E5L T;  2A72 A;  4IIJ E;  4ERR A;  3AA6 B;  5HCJ A;  2GK9 A;  4BAY B;  1U5P A;  4U31 A;  3C4X A;  4ZEY A;  2UUA T;  2JQK A;  3LG7 A;  2WWU A;  5M4Y A;  4XIG M;  1W0A A;  1VCS A;  4BA9 A;  5HEJ A;  2XQ9 A;  2XAG B;  5F8P A;  2JJ9 A;  2FJD A;  2LSK A;  4DR3 T;  2WMO A;  3N9L A;  4X1I E;  1WFD A;  5JQG E;  2DLR A;  3BK9 A;  2V8S V;  5FL1 A;  4IE0 A;  4QXC B;  3R6N A;  2UXB T;  2ZM8 A;  4K0U A;  1X79 A;  4ADZ A;  2A9U A;  1FIO A;  3PUV F;  4AXP A;  4U72 A;  2KSR A;  3MK7 C;  2X67 A;  2H7O A;  2J4G A;  3RF1 A;  1M62 A;  4NUU A;  2W63 A;  2WQY A;  4H9P C;  3ETV A;  5L47 A;  2XAF B;  3ABV A;  4OX9 T;  1UUS A;  3N9N A;  4DV5 T;  4YHJ A;  3I1A A;  3L8R A;  5F3J A;  4WW0 A;  5ABF B;  2W61 A;  3AEB A;  2P9B A;  3FXD B;  4AIU A;  1FMW A;  5FP3 A;  4PW8 A;  4TQU M;  5C2T A;  4UIG A;  4FI5 A;  4H63 V;  5DQW A;  5FNV E;  3PUR A;  5JR9 C;  1IBM T;  3T1H T;  3H3A A;  5IHY A;  2QYW A;  3ONJ A;  2W2U A;  3RKO A;  2E9X C;  5CA0 E;  2V1D B;  4KHP T;  5JDM A;  2W0G A;  5CGM A;  3L39 A;  3D31 C;  1I94 T;  5LGN B;  2CLY B;  3CIR A;  2CWY A;  3CQC B;  4I55 E;  4C91 A;  5HWX A;  4JUY A;  1IJ5 A;  3FHN A;  5JDQ A;  2MYS A;  3MZK B;  2XAQ B;  3LFM A;  5KDM C;  3JAD A;  4KHZ G;  2Y48 B;  2CBI A;  5LG4 A;  4IDZ A;  4IE7 A;  3F31 A;  4U74 A;  3JAE A;  3AE5 A;  3BQK A;  1KNR A;  1YXR A;  2E2A A;  2AXD S;  2H89 A;  1HNX T;  4XBF B;  3CQG B;  2ODV A;  3UU3 A;  2BS2 A;  3RHW A;  3C64 A;  2L8K A;  3SOL A;  5AQF B;  4JV5 T;  3NBX X;  2BG9 C;  4EZH A;  4QXB B;  4KP3 C;  1ZOY A;  2K24 A;  4U2Y A;  4EEB A;  4CI1 B; 
#chains in the Genus database with same CATH homology
 3TUJ A;  4XIG M;  3TUZ A;  4YMW C;  3RLF G;  2R6G G;  4YMV C;  3PV0 G;  4KI0 F;  4KHZ F;  3PUY F;  4TQU N;  4KHZ G;  3D31 C;  4KI0 G;  3PUY G;  3DHW A;  3PUW F;  4JBW F;  4YMT B;  4TQU M;  3PUZ F;  4YMS C;  3TUI A;  3PUW G;  4JBW G;  4YMU C;  3PUZ G;  2ONK C;  4XTC N;  3PUX F;  3PUV F;  4XIG N;  2R6G F;  4XTC M;  3PUV G;  3PUX G;  3PV0 F;  3RLF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...