4KI0F

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
494
structure length
490
Chain Sequence
SDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSINWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 155
structure length 490
sequence length 494
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component
F PF14785 MalF_P2 Maltose transport system permease protein MalF P2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3720.10 Mainly Alpha Orthogonal Bundle MetI-like fold MetI-like 4ki0F04
1.20.58.370 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 MalF N-terminal region-like 4ki0F01
2.40.430.10 Mainly Beta Beta Barrel Periplasmic binding protein-like II D-maltodextrin-binding protein, MBP 4ki0F03
3.10.650.10 Alpha Beta Roll MalF N-terminal region-like MalF N-terminal region-like 4ki0F02
3PUVF 3PUZF 4YMUC 3RLFF 3PV0F 3PUXG 2R6GF 4JBWF 4KI0G 4TQUM 3TUZA 3PUWF 4XTCM 3TUJA 4YMVC 4XIGM 4KHZG 3PUYG 4YMTB 3D31C 3PUXF 4YMWC 4KI0F 4YMSC 4TQUN 3PUVG 3PUZG 3RLFG 3PV0G 4XTCN 3DHWA 4KHZF 2R6GG 4JBWG 4XIGN 3PUYF 3TUIA 3PUWG 2ONKC
chains in the Genus database with same CATH superfamily
3N9OA 4HEAA 4J2CA 4ZZCA 2HPLA 4N78D 4JI7T 1KF6A 3ZSSA 3CX7B 4XIGM 5LHHB 2BS4A 4TQUN 4TNVA 4CI3B 4JBWG 4NXMT 3PJAJ 3H3MA 2OA5A 2X9YA 2DNXA 3GN5A 2A3DA 3F2EA 2HH7A 3HA4A 1VRBA 2ACXA 3VR9A 4Z90A 1T7SA 2E9XC 2W0GA 4GKKT 2A9UA 3NRYA 3T1YT 4DO0A 3D31C 3SFDA 3AAAB 5IHYA 4QX7B 1N33T 3FZKB 2BVMA 3KFWX 4TQUM 3KV6A 2XAGB 2LEHA 3P4PA 5DQWA 3PUYG 2UU9T 1IAPA 3Q5EA 3IHRA 1W09A 3WI3A 4PFOA 3P7IA 3JAFA 3UU4A 4H9OC 4O4LE 2X9HA 4HN9A 3ZN0B 3Q9DA 3DP7A 3LBXB 3QUJA 4U33A 4IGUA 3FZMB 4TX5A 3CWZB 4NPPA 4HFHA 1LVKA 2LHRA 2ZLYA 1FJGT 5KMGP 3UUBA 2M6BA 3JADA 4YLHA 3ZC1A 4U31A 1NAFA 1S94A 4DV5T 5AQRB 5C8YE 3RRCA 1CHUA 4ISTA 2VWAA 4X65T 1MNDA 1D0XA 2M67A 2I6HA 4H63H 3N9PA 2PTFA 5JDHA 5CA1E 2WMNA 3UFGA 2XAJB 4O4IE 4IE0A 4LFAT 3EAMA 4YSZA 3ZYLA 1FMWA 4JI0T 3Q5XA 4AIUA 3I0OA 3EVYA 4JI4T 4PJLA 4WBOA 4F8HA 3WAJA 3FZLB 1I6ZA 1J5ET 4PJMA 5HEHA 4O2BE 5ETWA 3RC8A 4FJOA 4QH4A 3B13A 2F4VT 4LF4T 1M7KA 5L2LA 5LGNB 4QH5A 4IDPA 3ZKRA 2W61A 3CX8B 3Q2MA 5HEUA 2VL0A 4WW0A 3QNUA 2L3LA 2LSKA 2W4XA 2DL1A 4DMVA 2XQ6A 3JC6D 4OHFA 2DHRA 2NTXA 2BDEA 1KK7A 5FY1A 3PUXF 4BJNA 4UR9A 4DBRA 3I1AA 1LRZA 4AKRB 3LK3B 1W0AA 2WSSV 3CQCB 2D2SA 4JEHB 4JI6T 1FIOA 4DV2T 4EYUA 4X5TA 5J1GA 5AQSB 3PUQA 2RP4A 1KNZA 3A5XA 3QB5K 2UUBT 3ONXA 3WAKA 4HWFA 2MAWA 5IUXA 3JCFA 4CQIA 3B5MA 2DI4A 4TWDA 5LHIB 3PUWG 3KV9A 4LF7T 2LRKA 5EK4A 5JDNA 3IEEA 4OYJA 2CLYB 2CXDA 1V9DA 2ODUA 4KMCA 4E7SA 2YINA 3AE1A 3NVOA 1GQEA 3P50A 3PV0G 1MNEA 2XASB 4AQYT 3N9QA 5AQPB 2CXFA 2ZM6T 2KWHA 4AKIA 1IBMT 5CJ5A 3EUHA 5FKYA 2CEAA 3ZSTA 4ANJA 5L3BB 3ZLIA 3ZMTB 3QC9A 3R6NA 4JYAT 2V5CA 3ZMSB 5FXWA 3RYIE 4IL9A 2NW8A 1SUMB 2BKNA 2XY8B 2L8KA 3LFMA 1JNRA 4UVBB 3SOLA 4DR4T 4JI8T 3VKHA 3UULA 2KWIB 2LSGA 3KVAA 4B3ST 2Y6XA 1HNWT 2YEVC 3K8PC 2XQ4A 2QYWA 2E5VA 1SA0E 2UXCT 4WZXA 3N2GE 5LA6E 3T1HT 2V7IA 5LNKA 5FXZA 5L4HA 3CPZA 4Z91A 4EEDA 2W66A 1BR4A 3P8CD 2UXXB 4COFA 3P4QA 5FYMA 2V1DB 4LMJA 2RA1A 2JIWA 3RHWA 3OBVE 3FHNA 3NZPA 3VKGA 4HWIB 3BQLA 2BS3A 1MMGA 2WZIA 2XQ8A 4UVAB 3P4SA 3O4XE 4DMWA 4YSXA 3VRAA 3D0TA 5JH7E 3TLTA 2UXBT 3UU8A 2UUCT 2VQET 2CWYA 4ZI2C 4G2AA 4YMWC 5C3JA 2KT9A 5LCYA 5FXXA 3VR8A 4ZOLE 4KBMB 3SFEA 3N2KE 4PFPA 1D1BA 3TLUA 4YMVC 3AAEB 4IDOA 4GK0E 4DV6T 2J1DG 5AQTB 2JQ9A 3MJXA 3PUZG 5JDQA 2WAUA 3I0QA 5HEJA 3O1JA 4DR2T 5L3GB 5EZYE 3P4RA 4A56A 3C4ZA 2XHEB 4BJMA 2LKHA 2AE9A 4ISSA 5BR8T 3AE8A 4UV9B 4QX8B 3KVBA 2YK0A 3TLSA 1QSDA 4CI2B 3KINB 2WM9A 1XNRT 1FEWA 3EDVA 3GWHA 2XJ7A 5F3JA 5AQFB 2K48A 5LOVE 2NP9A 2XM1A 3OJAA 2VVSA 5LJNA 4G63A 5AFUL 1MIWA 5CA0E 3G06A 3PUXG 4U7IA 2XSBA 3ETVA 4QH1A 5AQOB 4IE5A 3A8YC 2LKGA 4I43B 1MMAA 1T8BA 1IBLT 2WU5A 1NENA 1EZ3A 5J2UE 5HCJA 2K9AA 4YHHT 2LJLA 1MMDA 2WU2A 2Y8DA 5L3CB 3PUVF 5ABFB 2P9BA 5DABA 3Q5WA 2BBJA 3ZYKA 1Z8UA 3F31A 4U74A 3ZEFB 1D1AA 4B3TT 5LGTB 4XZCA 2H88A 3E0ZA 4LFCT 3BK9A 2JQKA 3AVRA 3RIAA 3S4UA 1HG5A 5AQKB 2CBJA 2ZM2A 4EOZB 3EDUA 2QVAA 4XTCN 4V1Av 4MHCA 4IE6A 2Q9QD 4U2ZA 4GIWA 4DV7T 3CMLA 4UF0B 3RPUA 4YTPA 2XQ7A 2C5IT 4JI5T 5L47A 4HFCA 5L3FB 3O9XA 2IDOB 5LG4A 1XDPA 3UUXB 1R8IA 4X1YE 4IREA 4YT0A 4QKNA 2V7LA 1J5WA 1ZP0A 3OVUA 4XTCM 3N9NA 2V7MA 3U78A 4EZ4A 5DJQC 2KNDA 3ZPOA 4GYSA 4JUYA 4CN4A 4UELA 2WBLA 4P09A 3R84B 2WDRA 1W9RA 4EB6E 2OV9A 3RLFF 3O1IA 3L09A 1XMOT 1UX4A 2E8IA 4AKGA 3C50A 2LSIA 4HWDA 2J47A 5HXCA 2WCAA 1D1CA 2X0LB 2LSJA 3AEEA 2MTQA 1HX8A 4EGWA 2CHOA 2AXDS 1L0VA 2DWGA 2PBIA 4KHZG 2H7OA 1Z0PA 3UQ4A 2VKOA 4WNKA 3P4WA 5AQUB 3AE2A 2BBHA 3L39A 4P0AA 5CFBA 2BG9B 1YXRA 3OKQA 1IZNB 5LGUB 1ZKEA 4IL4A 3ZMZB 3AEAA 5FXVA 4AI6A 3HKCE 3C64A 4U7YA 3N2OA 4TN7B 1W0BA 4YTNA 2H7VC 4I4TE 5ABHA 2R6GF 3CVRA 5JR9B 4EEBA 3NKZA 5HEGA 5AQMB 4OK0A 4TWHA 4PJNA 5AQNB 1Y64B 2CCQA 3V5UA 2C0SA 4LMKA 4LF8T 3IF8B 2YOEA 1X79A 3AE3A 5AQJB 2H89A 4KI0G 5A1LA 1IJ6A 5HXSA 4HGAA 2CRBA 4MBQA 1QUUA 4H9PC 4YTMA 5KXJA 1D0ZA 5LBMA 1XNQT 3GN5B 3DHWA 4A5XA 2Q9QC 5JDFA 3N9LA 4QXCB 3PU3A 3T8OA 4JBWF 4M1PA 2XUEA 2WWVA 3TLVA 4YJ2E 4ERRA 3RRWA 3AE9A 4ZI2D 4U72A 3DJBA 1KFYA 2NR4A 1WR0A 2CA5A 1WFDA 1YQ3A 3RYFE 1WLXA 1KNPA 2LM9A 4IIJE 5JVDE 4AKHA 2VB6A 2CXLA 3PUYF 4PK6A 4O2AE 1UGOA 3U3IA 1XZYA 5AQIB 4HFEA 4AKLA 5KDMC 4CXWA 2FUPA 5JTGA 4XAXB 2V6YA 2HN1A 2Q9QA 1AJ3A 4L9IA 2E9XB 2LOSA 4TV8E 4QHOA 5FMNA 3HL6A 2MYSA 2LE8A 4JLEA 3PURA 3ZN1B 3RIUC 4PJJA 3MK7C 4DV0T 4YJ3E 1QLBA 3LK2B 5HCMA 5FL0A 2JPFA 4I50E 2B76A 3NZQA 2D0TA 1WRDA 3ZT6A 3ANWB 2V7KA 5AQHB 4DR6T 2LHNA 3FB2A 3AE6A 2W62A 3RIFA 3TKLB 3ZCIA 4I55E 2XTLA 2BVLA 3K3NA 5ABFA 3SS1A 4IDQA 3L3PA 5JQGE 4E7ZA 4EV6A 3PUAA 4KUMB 3CIRA 1UK5A 4ZS3A 1HNZT 2KMFA 2JQQA 1MIVA 2K24A 5LMNT 1HS7A 1US7B 2BS2A 2WMOA 3Q5DA 4DNDA 3PUGA 2D5UA 4UXNB 3AXJB 1BR1A 5FL1A 2VL8A 3K3OA 4P1NA 2LLYA 3QOFA 3MXZA 4U2YA 5FNVE 2EHOB 3RIUA 4P0BA 4NUVA 5AQLB 2YU1A 1YD8G 2KXPB 3RF1A 4BA9A 2NW9A 2XQ9A 4X1IE 4ASKA 4KHPT 2DWKA 4UF0A 4UEMA 3ESLA 4A98A 4CXXA 5HXHA 3LBXA 3AE4A 5LP6E 5EK2A 1E7PA 2SPCA 4B6XA 1OXZA 3L8RA 4AQGA 4H63V 3OYZA 2BG9C 5J2TE 3IA3A 4CXYA 4TV9E 2NOXA 3ABVA 2KINB 4HFDA 3TUIA 4CZZB 2ZM8A 2NWBA 4H9QC 1NWMX 4WYVA 5ABEA 3MKDA 2X66A 4I0UA 2YN6A 4KP3C 1HNXT 4O4JE 4EZHA 5LHGB 5LBQB 3BQIA 2LRLA 3AVSA 3EABA 1XMQT 2BG9E 3CKDA 5JR9C 2CBIA 3ZMUB 4KX6A 3LDQB 4K0KT 4TZ4C 5DQVA 2XQAA 4PW8A 1OEDB 2G0UA 1BR2A 4H9RC 5L3DB 3LK42 4ADZA 2EHOD 4X62T 2JQHA 4AXPA 5AQVB 2BG9A 2X68A 4QXHB 3PUWF 4DR1T 2HHHT 1MMNA 2A2FX 3AECA 4C90A 5LB7B 3RI5A 2WB5A 5LJMA 2IC9A 2Y48B 4ZEYA 3C98B 3N5LA 3PV0F 5HXRA 3AA7B 4UIGA 4ZI3D 5JR9A 2FJBA 2YDQA 3LJCA 3A7MA 2J4GA 4OFZA 2CLYC 5ABGA 1HF8A 4GYRA 4DBQA 3BQKA 2E5LT 1H7CA 2W63A 5KX5E 2W00A 2VASA 3RKOA 3HKDE 2Z6EA 2V6XA 4TUYE 5FVKA 2CWOA 3DTOA 2BZBA 2XAFB 2D0UA 1X9BA 2XQYA 2X67A 4HFBA 4ILAA 5ADXL 3K1SA 3E22E 4JEUB 4YSYA 3ZT5A 1U4QA 4BAYB 5HAXA 1LVFA 1HFAA 3SWHA 4NIQA 4OYKA 1VCSA 5JDMA 5TAOA 3PDYA 5JDGA 5LMUT 3TLWA 2YDSA 3UTKA 3PTRB 5JREA 5L3EB 4YMTB 1IJ5A 5LG3A 2ZMAA 3MACA 5FY7A 4HE8A 3CQXC 4IHJE 2IUBA 2IAKA 2FJDA 2W67A 3RKGA 2XQ5A 2PJQA 3FBLA 2LSYA 4PNIA 4YXDA 2N9DA 4LFBT 3CK6A 3LSVA 4YY3T 4DV3T 1YKEB 5F8PA 4DUZT 1YW0A 2E9XA 2I59A 1WYCA 4ZS2A 2K5BB 2VURA 2CMRA 3PE0A 3OTOT 3TUZA 3JAEA 1VCTA 2IC6A 1HCIA 2EHOC 1BR0A 3AB3B 4MFRA 3RH3A 1UX5A 3ZYMA 2ZM0A 1U5PA 2C5JA 5F5WA 4XBFB 3UFEA 3F57A 4O4HE 1NEKA 4U3CA 3ANWA 2X9WA 2CPTA 1T72A 1N36T 2WP9A 1O3XA 2YKSA 5H6RB 4HFIA 2MBGA 3AA1B 2V5DA 5AQQB 2GK9A 3UU5A 2VKHA 1YQ4A 4B3MT 3B57A 4YFSA 3ZCJA 2V7JA 2ONKC 1XWMA 4YHJA 1IBKT 3ETUA 3PUZF 4ILBA 5C2TA 2X0HA 4ZI3C 2UUAT 3EI0A 3NWIA 2JMKA 4LF5T 5JRCB 3GMIA 4PAGA 2HPJA 3RQWA 3SRZA 2CHNA 3X1DA 4C91A 3AXJA 3AA0B 1N34T 3CQGB 2V8SV 2EHOA 2WY2A 3HR0A 3AAIA 1WYBA 3MA9A 2YU2A 2NTYA 4QWNB 4PK4A 3UUNA 2RPAA 4ILUA 1DU2A 1OEDC 2PFVA 5CB4E 2VVNA 1B7TA 3RYCE 1SE7A 4MLKA 2FBWA 4IDZA 4JI2T 4CI1B 4A97A 1S35A 1MIYA 2WZHA 4DR5T 2VKDA 4GOUA 2QA7A 2XSAA 3UU3A 3K3QC 5EK3A 1SHZC 2LT3A 1OEDE 2HN2A 5FY0A 1M62A 5J0ZA 1N32T 3J7Yq 3MZKB 4NXNT 4HWCA 2W2UA 2VQFT 1CUNA 5IWAT 3AEDA 4YMUC 1WCRA 4IT4A 3GA8A 4JV5T 2ODVA 4TWFA 3OYXA 4QXBB 1OEDA 5LYJE 5FVLA 1XDOA 2J62A 1FMVA 2KZ7B 2MOZA 1E2AA 2LM2A 1VOMA 3RX6A 4OX9T 4Z8XA 2A72A 4ZXLA 5HYAA 4ZZBA 2XAQB 1KEYA 3RYHE 4EAHA 2N1GA 3I9YA 2PG8A 3AE5A 3PJAA 2XZEA 2ES0A 1UCUA 4B3RT 1HG2A 5GONE 1D0YA 2VK9A 2XAHB 2M6IA 3KV4A 4HWHA 3QB5A 3ZMVB 1ZOYA 1HTJF 4YMSC 1KNRA 2KLQA 3PUVG 5H6QB 4IE7A 2KSRA 3ZT7A 2IHR1 3M65A 4FI5A 2UXDT 4WBNE 3H3AA 4GKJT 5IYZE 3V5SA 3KDSE 3FXDB 3KV5A 2E2AA 5L4EA 3IBPA 3AA6B 1E1HB 4L0RA 2FJEA 4DR7T 2VKJA 4Q25A 4DIDB 4UV8B 1J1JA 3PU8A 2DLRA 4X1KE 4DV1T 4ILCA 4IE4A 4LMLA 2X9XA 1YKHB 1HR0T 3FZHB 3HKBE 4CN1A 3JC6C 3RGLA 1I94T 3AEFA 2QGSA 4KHZF 4HTEA 3RQUA 3KBTA 4AQFC 2V26A 1HX1B 3VHLA 1ZV4X 4DUYT 1ZHCA 2B1EA 3H37A 2JRKA 3VRBA 2E9XD 3M3ZB 4O8SA 2L9QA 3UU6A 4F6RC 2OLTA 2I0MA 2WDVA 4LF6T 3E08A 3FZFB 4UVCB 2JJ9A 3N9MA 2MPKA 1Y01A 1UUSA 2QRXA 3ZJ1A 4AISA 2H3RA 3OPCA 3UQ7A 4GK5E 3NRXA 4DR3T 2IW5B 4ZHQE 3RLFG 4NUUA 3KBUA 3J9X1 2WDQA 3EHZA 2ACZA 4DV4T 3I9WA 3O1HA 4X66T 2X0YA 1UURA 4LF9T 3ONJA 2FJAA 2UXNB 2JMHA 3AE7A 5HEOA 2IMLA 4IDNA 3FBZA 4HKAA 4KI0F 3QK6A 4AQFA 2DCFA 1WR6A 4X20E 1LKXA 3NBXX 4PK5A 3UT5E 4H9NC 5HWXA 5JDLA 5HXEA 3W15B 2YDRA 4JI3T 2WWUA 4HFVA 3TUJA 2CE7A 3FXEB 4H9SE 3HKEE 4EXTA 4ZI7E 3CX6B 2NW7A 2BKOA 1ZEEA 2K3WA 3ZJ2A 3PUSA 2LOPA 2CM0A 4EIWA 1T98A 1OWAA 3AEGA 3VU7H 2IIUA 3UUMA 4K0UA 4EYYR 5E0OA 3C4XA 5JRCA 2XM2A 2R6GG 3HI2A 4XIGN 4TNWA 2WS3A 4DVDA 5BMVE 5FP3A 2N2NA 3ONLC 2V6YB 2WQYA 3C51A 5LXTE 4L5GA 5M4YA 2Q9QB 3AEBA 3C4WA 2BKPA 3ZC0A 2X51A 2D9DA 4JI1T 2XQ3A 1G8XA 1G73A 5CGMA 3LG7A 4CN6A 2XPKA 5HWYA 1JNZA 3RC3A 2C5KT 4X64T 4MALA 5AQGB
chains in the Genus database with same CATH topology
3PUVF 3PUZF 4YMUC 3RLFF 3PV0F 3PUXG 2R6GF 4JBWF 4KI0G 4TQUM 3TUZA 3PUWF 4XTCM 3TUJA 4YMVC 4XIGM 4KHZG 3PUYG 4YMTB 3D31C 3PUXF 4YMWC 4KI0F 4YMSC 4TQUN 3PUVG 3PUZG 3RLFG 3PV0G 4XTCN 3DHWA 4KHZF 2R6GG 4JBWG 4XIGN 3PUYF 3TUIA 3PUWG 2ONKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV F;  3PUZ F;  4YMU C;  3RLF F;  3PV0 F;  3PUX G;  2R6G F;  4JBW F;  4KI0 G;  4TQU M;  3TUZ A;  3PUW F;  4XTC M;  3TUJ A;  4YMV C;  4XIG M;  4KHZ G;  3PUY G;  4YMT B;  3D31 C;  3PUX F;  4YMW C;  4KI0 F;  4YMS C;  4TQU N;  3PUV G;  3PUZ G;  3RLF G;  3PV0 G;  4XTC N;  3DHW A;  4KHZ F;  2R6G G;  4JBW G;  4XIG N;  3PUY F;  3TUI A;  3PUW G;  2ONK C; 
#chains in the Genus database with same CATH topology
 3N9O A;  4HEA A;  4J2C A;  4ZZC A;  2HPL A;  4N78 D;  4JI7 T;  1KF6 A;  3ZSS A;  3CX7 B;  4XIG M;  5LHH B;  2BS4 A;  4TQU N;  4TNV A;  4CI3 B;  4JBW G;  4NXM T;  3PJA J;  3H3M A;  2OA5 A;  2X9Y A;  2DNX A;  3GN5 A;  2A3D A;  3F2E A;  2HH7 A;  3HA4 A;  1VRB A;  2ACX A;  3VR9 A;  4Z90 A;  1T7S A;  2E9X C;  2W0G A;  4GKK T;  2A9U A;  3NRY A;  3T1Y T;  4DO0 A;  3D31 C;  3SFD A;  3AAA B;  5IHY A;  4QX7 B;  1N33 T;  3FZK B;  2BVM A;  3KFW X;  4TQU M;  3KV6 A;  2XAG B;  2LEH A;  3P4P A;  5DQW A;  3PUY G;  2UU9 T;  1IAP A;  3Q5E A;  3IHR A;  1W09 A;  3WI3 A;  4PFO A;  3P7I A;  3JAF A;  3UU4 A;  4H9O C;  4O4L E;  2X9H A;  4HN9 A;  3ZN0 B;  3Q9D A;  3DP7 A;  3LBX B;  3QUJ A;  4U33 A;  4IGU A;  3FZM B;  4TX5 A;  3CWZ B;  4NPP A;  4HFH A;  1LVK A;  2LHR A;  2ZLY A;  1FJG T;  5KMG P;  3UUB A;  2M6B A;  3JAD A;  4YLH A;  3ZC1 A;  4U31 A;  1NAF A;  1S94 A;  4DV5 T;  5AQR B;  5C8Y E;  3RRC A;  1CHU A;  4IST A;  2VWA A;  4X65 T;  1MND A;  1D0X A;  2M67 A;  2I6H A;  4H63 H;  3N9P A;  2PTF A;  5JDH A;  5CA1 E;  2WMN A;  3UFG A;  2XAJ B;  4O4I E;  4IE0 A;  4LFA T;  3EAM A;  4YSZ A;  3ZYL A;  1FMW A;  4JI0 T;  3Q5X A;  4AIU A;  3I0O A;  3EVY A;  4JI4 T;  4PJL A;  4WBO A;  4F8H A;  3WAJ A;  3FZL B;  1I6Z A;  1J5E T;  4PJM A;  5HEH A;  4O2B E;  5ETW A;  3RC8 A;  4FJO A;  4QH4 A;  3B13 A;  2F4V T;  4LF4 T;  1M7K A;  5L2L A;  5LGN B;  4QH5 A;  4IDP A;  3ZKR A;  2W61 A;  3CX8 B;  3Q2M A;  5HEU A;  2VL0 A;  4WW0 A;  3QNU A;  2L3L A;  2LSK A;  2W4X A;  2DL1 A;  4DMV A;  2XQ6 A;  3JC6 D;  4OHF A;  2DHR A;  2NTX A;  2BDE A;  1KK7 A;  5FY1 A;  3PUX F;  4BJN A;  4UR9 A;  4DBR A;  3I1A A;  1LRZ A;  4AKR B;  3LK3 B;  1W0A A;  2WSS V;  3CQC B;  2D2S A;  4JEH B;  4JI6 T;  1FIO A;  4DV2 T;  4EYU A;  4X5T A;  5J1G A;  5AQS B;  3PUQ A;  2RP4 A;  1KNZ A;  3A5X A;  3QB5 K;  2UUB T;  3ONX A;  3WAK A;  4HWF A;  2MAW A;  5IUX A;  3JCF A;  4CQI A;  3B5M A;  2DI4 A;  4TWD A;  5LHI B;  3PUW G;  3KV9 A;  4LF7 T;  2LRK A;  5EK4 A;  5JDN A;  3IEE A;  4OYJ A;  2CLY B;  2CXD A;  1V9D A;  2ODU A;  4KMC A;  4E7S A;  2YIN A;  3AE1 A;  3NVO A;  1GQE A;  3P50 A;  3PV0 G;  1MNE A;  2XAS B;  4AQY T;  3N9Q A;  5AQP B;  2CXF A;  2ZM6 T;  2KWH A;  4AKI A;  1IBM T;  5CJ5 A;  3EUH A;  5FKY A;  2CEA A;  3ZST A;  4ANJ A;  5L3B B;  3ZLI A;  3ZMT B;  3QC9 A;  3R6N A;  4JYA T;  2V5C A;  3ZMS B;  5FXW A;  3RYI E;  4IL9 A;  2NW8 A;  1SUM B;  2BKN A;  2XY8 B;  2L8K A;  3LFM A;  1JNR A;  4UVB B;  3SOL A;  4DR4 T;  4JI8 T;  3VKH A;  3UUL A;  2KWI B;  2LSG A;  3KVA A;  4B3S T;  2Y6X A;  1HNW T;  2YEV C;  3K8P C;  2XQ4 A;  2QYW A;  2E5V A;  1SA0 E;  2UXC T;  4WZX A;  3N2G E;  5LA6 E;  3T1H T;  2V7I A;  5LNK A;  5FXZ A;  5L4H A;  3CPZ A;  4Z91 A;  4EED A;  2W66 A;  1BR4 A;  3P8C D;  2UXX B;  4COF A;  3P4Q A;  5FYM A;  2V1D B;  4LMJ A;  2RA1 A;  2JIW A;  3RHW A;  3OBV E;  3FHN A;  3NZP A;  3VKG A;  4HWI B;  3BQL A;  2BS3 A;  1MMG A;  2WZI A;  2XQ8 A;  4UVA B;  3P4S A;  3O4X E;  4DMW A;  4YSX A;  3VRA A;  3D0T A;  5JH7 E;  3TLT A;  2UXB T;  3UU8 A;  2UUC T;  2VQE T;  2CWY A;  4ZI2 C;  4G2A A;  4YMW C;  5C3J A;  2KT9 A;  5LCY A;  5FXX A;  3VR8 A;  4ZOL E;  4KBM B;  3SFE A;  3N2K E;  4PFP A;  1D1B A;  3TLU A;  4YMV C;  3AAE B;  4IDO A;  4GK0 E;  4DV6 T;  2J1D G;  5AQT B;  2JQ9 A;  3MJX A;  3PUZ G;  5JDQ A;  2WAU A;  3I0Q A;  5HEJ A;  3O1J A;  4DR2 T;  5L3G B;  5EZY E;  3P4R A;  4A56 A;  3C4Z A;  2XHE B;  4BJM A;  2LKH A;  2AE9 A;  4ISS A;  5BR8 T;  3AE8 A;  4UV9 B;  4QX8 B;  3KVB A;  2YK0 A;  3TLS A;  1QSD A;  4CI2 B;  3KIN B;  2WM9 A;  1XNR T;  1FEW A;  3EDV A;  3GWH A;  2XJ7 A;  5F3J A;  5AQF B;  2K48 A;  5LOV E;  2NP9 A;  2XM1 A;  3OJA A;  2VVS A;  5LJN A;  4G63 A;  5AFU L;  1MIW A;  5CA0 E;  3G06 A;  3PUX G;  4U7I A;  2XSB A;  3ETV A;  4QH1 A;  5AQO B;  4IE5 A;  3A8Y C;  2LKG A;  4I43 B;  1MMA A;  1T8B A;  1IBL T;  2WU5 A;  1NEN A;  1EZ3 A;  5J2U E;  5HCJ A;  2K9A A;  4YHH T;  2LJL A;  1MMD A;  2WU2 A;  2Y8D A;  5L3C B;  3PUV F;  5ABF B;  2P9B A;  5DAB A;  3Q5W A;  2BBJ A;  3ZYK A;  1Z8U A;  3F31 A;  4U74 A;  3ZEF B;  1D1A A;  4B3T T;  5LGT B;  4XZC A;  2H88 A;  3E0Z A;  4LFC T;  3BK9 A;  2JQK A;  3AVR A;  3RIA A;  3S4U A;  1HG5 A;  5AQK B;  2CBJ A;  2ZM2 A;  4EOZ B;  3EDU A;  2QVA A;  4XTC N;  4V1A v;  4MHC A;  4IE6 A;  2Q9Q D;  4U2Z A;  4GIW A;  4DV7 T;  3CML A;  4UF0 B;  3RPU A;  4YTP A;  2XQ7 A;  2C5I T;  4JI5 T;  5L47 A;  4HFC A;  5L3F B;  3O9X A;  2IDO B;  5LG4 A;  1XDP A;  3UUX B;  1R8I A;  4X1Y E;  4IRE A;  4YT0 A;  4QKN A;  2V7L A;  1J5W A;  1ZP0 A;  3OVU A;  4XTC M;  3N9N A;  2V7M A;  3U78 A;  4EZ4 A;  5DJQ C;  2KND A;  3ZPO A;  4GYS A;  4JUY A;  4CN4 A;  4UEL A;  2WBL A;  4P09 A;  3R84 B;  2WDR A;  1W9R A;  4EB6 E;  2OV9 A;  3RLF F;  3O1I A;  3L09 A;  1XMO T;  1UX4 A;  2E8I A;  4AKG A;  3C50 A;  2LSI A;  4HWD A;  2J47 A;  5HXC A;  2WCA A;  1D1C A;  2X0L B;  2LSJ A;  3AEE A;  2MTQ A;  1HX8 A;  4EGW A;  2CHO A;  2AXD S;  1L0V A;  2DWG A;  2PBI A;  4KHZ G;  2H7O A;  1Z0P A;  3UQ4 A;  2VKO A;  4WNK A;  3P4W A;  5AQU B;  3AE2 A;  2BBH A;  3L39 A;  4P0A A;  5CFB A;  2BG9 B;  1YXR A;  3OKQ A;  1IZN B;  5LGU B;  1ZKE A;  4IL4 A;  3ZMZ B;  3AEA A;  5FXV A;  4AI6 A;  3HKC E;  3C64 A;  4U7Y A;  3N2O A;  4TN7 B;  1W0B A;  4YTN A;  2H7V C;  4I4T E;  5ABH A;  2R6G F;  3CVR A;  5JR9 B;  4EEB A;  3NKZ A;  5HEG A;  5AQM B;  4OK0 A;  4TWH A;  4PJN A;  5AQN B;  1Y64 B;  2CCQ A;  3V5U A;  2C0S A;  4LMK A;  4LF8 T;  3IF8 B;  2YOE A;  1X79 A;  3AE3 A;  5AQJ B;  2H89 A;  4KI0 G;  5A1L A;  1IJ6 A;  5HXS A;  4HGA A;  2CRB A;  4MBQ A;  1QUU A;  4H9P C;  4YTM A;  5KXJ A;  1D0Z A;  5LBM A;  1XNQ T;  3GN5 B;  3DHW A;  4A5X A;  2Q9Q C;  5JDF A;  3N9L A;  4QXC B;  3PU3 A;  3T8O A;  4JBW F;  4M1P A;  2XUE A;  2WWV A;  3TLV A;  4YJ2 E;  4ERR A;  3RRW A;  3AE9 A;  4ZI2 D;  4U72 A;  3DJB A;  1KFY A;  2NR4 A;  1WR0 A;  2CA5 A;  1WFD A;  1YQ3 A;  3RYF E;  1WLX A;  1KNP A;  2LM9 A;  4IIJ E;  5JVD E;  4AKH A;  2VB6 A;  2CXL A;  3PUY F;  4PK6 A;  4O2A E;  1UGO A;  3U3I A;  1XZY A;  5AQI B;  4HFE A;  4AKL A;  5KDM C;  4CXW A;  2FUP A;  5JTG A;  4XAX B;  2V6Y A;  2HN1 A;  2Q9Q A;  1AJ3 A;  4L9I A;  2E9X B;  2LOS A;  4TV8 E;  4QHO A;  5FMN A;  3HL6 A;  2MYS A;  2LE8 A;  4JLE A;  3PUR A;  3ZN1 B;  3RIU C;  4PJJ A;  3MK7 C;  4DV0 T;  4YJ3 E;  1QLB A;  3LK2 B;  5HCM A;  5FL0 A;  2JPF A;  4I50 E;  2B76 A;  3NZQ A;  2D0T A;  1WRD A;  3ZT6 A;  3ANW B;  2V7K A;  5AQH B;  4DR6 T;  2LHN A;  3FB2 A;  3AE6 A;  2W62 A;  3RIF A;  3TKL B;  3ZCI A;  4I55 E;  2XTL A;  2BVL A;  3K3N A;  5ABF A;  3SS1 A;  4IDQ A;  3L3P A;  5JQG E;  4E7Z A;  4EV6 A;  3PUA A;  4KUM B;  3CIR A;  1UK5 A;  4ZS3 A;  1HNZ T;  2KMF A;  2JQQ A;  1MIV A;  2K24 A;  5LMN T;  1HS7 A;  1US7 B;  2BS2 A;  2WMO A;  3Q5D A;  4DND A;  3PUG A;  2D5U A;  4UXN B;  3AXJ B;  1BR1 A;  5FL1 A;  2VL8 A;  3K3O A;  4P1N A;  2LLY A;  3QOF A;  3MXZ A;  4U2Y A;  5FNV E;  2EHO B;  3RIU A;  4P0B A;  4NUV A;  5AQL B;  2YU1 A;  1YD8 G;  2KXP B;  3RF1 A;  4BA9 A;  2NW9 A;  2XQ9 A;  4X1I E;  4ASK A;  4KHP T;  2DWK A;  4UF0 A;  4UEM A;  3ESL A;  4A98 A;  4CXX A;  5HXH A;  3LBX A;  3AE4 A;  5LP6 E;  5EK2 A;  1E7P A;  2SPC A;  4B6X A;  1OXZ A;  3L8R A;  4AQG A;  4H63 V;  3OYZ A;  2BG9 C;  5J2T E;  3IA3 A;  4CXY A;  4TV9 E;  2NOX A;  3ABV A;  2KIN B;  4HFD A;  3TUI A;  4CZZ B;  2ZM8 A;  2NWB A;  4H9Q C;  1NWM X;  4WYV A;  5ABE A;  3MKD A;  2X66 A;  4I0U A;  2YN6 A;  4KP3 C;  1HNX T;  4O4J E;  4EZH A;  5LHG B;  5LBQ B;  3BQI A;  2LRL A;  3AVS A;  3EAB A;  1XMQ T;  2BG9 E;  3CKD A;  5JR9 C;  2CBI A;  3ZMU B;  4KX6 A;  3LDQ B;  4K0K T;  4TZ4 C;  5DQV A;  2XQA A;  4PW8 A;  1OED B;  2G0U A;  1BR2 A;  4H9R C;  5L3D B;  3LK4 2;  4ADZ A;  2EHO D;  4X62 T;  2JQH A;  4AXP A;  5AQV B;  2BG9 A;  2X68 A;  4QXH B;  3PUW F;  4DR1 T;  2HHH T;  1MMN A;  2A2F X;  3AEC A;  4C90 A;  5LB7 B;  3RI5 A;  2WB5 A;  5LJM A;  2IC9 A;  2Y48 B;  4ZEY A;  3C98 B;  3N5L A;  3PV0 F;  5HXR A;  3AA7 B;  4UIG A;  4ZI3 D;  5JR9 A;  2FJB A;  2YDQ A;  3LJC A;  3A7M A;  2J4G A;  4OFZ A;  2CLY C;  5ABG A;  1HF8 A;  4GYR A;  4DBQ A;  3BQK A;  2E5L T;  1H7C A;  2W63 A;  5KX5 E;  2W00 A;  2VAS A;  3RKO A;  3HKD E;  2Z6E A;  2V6X A;  4TUY E;  5FVK A;  2CWO A;  3DTO A;  2BZB A;  2XAF B;  2D0U A;  1X9B A;  2XQY A;  2X67 A;  4HFB A;  4ILA A;  5ADX L;  3K1S A;  3E22 E;  4JEU B;  4YSY A;  3ZT5 A;  1U4Q A;  4BAY B;  5HAX A;  1LVF A;  1HFA A;  3SWH A;  4NIQ A;  4OYK A;  1VCS A;  5JDM A;  5TAO A;  3PDY A;  5JDG A;  5LMU T;  3TLW A;  2YDS A;  3UTK A;  3PTR B;  5JRE A;  5L3E B;  4YMT B;  1IJ5 A;  5LG3 A;  2ZMA A;  3MAC A;  5FY7 A;  4HE8 A;  3CQX C;  4IHJ E;  2IUB A;  2IAK A;  2FJD A;  2W67 A;  3RKG A;  2XQ5 A;  2PJQ A;  3FBL A;  2LSY A;  4PNI A;  4YXD A;  2N9D A;  4LFB T;  3CK6 A;  3LSV A;  4YY3 T;  4DV3 T;  1YKE B;  5F8P A;  4DUZ T;  1YW0 A;  2E9X A;  2I59 A;  1WYC A;  4ZS2 A;  2K5B B;  2VUR A;  2CMR A;  3PE0 A;  3OTO T;  3TUZ A;  3JAE A;  1VCT A;  2IC6 A;  1HCI A;  2EHO C;  1BR0 A;  3AB3 B;  4MFR A;  3RH3 A;  1UX5 A;  3ZYM A;  2ZM0 A;  1U5P A;  2C5J A;  5F5W A;  4XBF B;  3UFE A;  3F57 A;  4O4H E;  1NEK A;  4U3C A;  3ANW A;  2X9W A;  2CPT A;  1T72 A;  1N36 T;  2WP9 A;  1O3X A;  2YKS A;  5H6R B;  4HFI A;  2MBG A;  3AA1 B;  2V5D A;  5AQQ B;  2GK9 A;  3UU5 A;  2VKH A;  1YQ4 A;  4B3M T;  3B57 A;  4YFS A;  3ZCJ A;  2V7J A;  2ONK C;  1XWM A;  4YHJ A;  1IBK T;  3ETU A;  3PUZ F;  4ILB A;  5C2T A;  2X0H A;  4ZI3 C;  2UUA T;  3EI0 A;  3NWI A;  2JMK A;  4LF5 T;  5JRC B;  3GMI A;  4PAG A;  2HPJ A;  3RQW A;  3SRZ A;  2CHN A;  3X1D A;  4C91 A;  3AXJ A;  3AA0 B;  1N34 T;  3CQG B;  2V8S V;  2EHO A;  2WY2 A;  3HR0 A;  3AAI A;  1WYB A;  3MA9 A;  2YU2 A;  2NTY A;  4QWN B;  4PK4 A;  3UUN A;  2RPA A;  4ILU A;  1DU2 A;  1OED C;  2PFV A;  5CB4 E;  2VVN A;  1B7T A;  3RYC E;  1SE7 A;  4MLK A;  2FBW A;  4IDZ A;  4JI2 T;  4CI1 B;  4A97 A;  1S35 A;  1MIY A;  2WZH A;  4DR5 T;  2VKD A;  4GOU A;  2QA7 A;  2XSA A;  3UU3 A;  3K3Q C;  5EK3 A;  1SHZ C;  2LT3 A;  1OED E;  2HN2 A;  5FY0 A;  1M62 A;  5J0Z A;  1N32 T;  3J7Y q;  3MZK B;  4NXN T;  4HWC A;  2W2U A;  2VQF T;  1CUN A;  5IWA T;  3AED A;  4YMU C;  1WCR A;  4IT4 A;  3GA8 A;  4JV5 T;  2ODV A;  4TWF A;  3OYX A;  4QXB B;  1OED A;  5LYJ E;  5FVL A;  1XDO A;  2J62 A;  1FMV A;  2KZ7 B;  2MOZ A;  1E2A A;  2LM2 A;  1VOM A;  3RX6 A;  4OX9 T;  4Z8X A;  2A72 A;  4ZXL A;  5HYA A;  4ZZB A;  2XAQ B;  1KEY A;  3RYH E;  4EAH A;  2N1G A;  3I9Y A;  2PG8 A;  3AE5 A;  3PJA A;  2XZE A;  2ES0 A;  1UCU A;  4B3R T;  1HG2 A;  5GON E;  1D0Y A;  2VK9 A;  2XAH B;  2M6I A;  3KV4 A;  4HWH A;  3QB5 A;  3ZMV B;  1ZOY A;  1HTJ F;  4YMS C;  1KNR A;  2KLQ A;  3PUV G;  5H6Q B;  4IE7 A;  2KSR A;  3ZT7 A;  2IHR 1;  3M65 A;  4FI5 A;  2UXD T;  4WBN E;  3H3A A;  4GKJ T;  5IYZ E;  3V5S A;  3KDS E;  3FXD B;  3KV5 A;  2E2A A;  5L4E A;  3IBP A;  3AA6 B;  1E1H B;  4L0R A;  2FJE A;  4DR7 T;  2VKJ A;  4Q25 A;  4DID B;  4UV8 B;  1J1J A;  3PU8 A;  2DLR A;  4X1K E;  4DV1 T;  4ILC A;  4IE4 A;  4LML A;  2X9X A;  1YKH B;  1HR0 T;  3FZH B;  3HKB E;  4CN1 A;  3JC6 C;  3RGL A;  1I94 T;  3AEF A;  2QGS A;  4KHZ F;  4HTE A;  3RQU A;  3KBT A;  4AQF C;  2V26 A;  1HX1 B;  3VHL A;  1ZV4 X;  4DUY T;  1ZHC A;  2B1E A;  3H37 A;  2JRK A;  3VRB A;  2E9X D;  3M3Z B;  4O8S A;  2L9Q A;  3UU6 A;  4F6R C;  2OLT A;  2I0M A;  2WDV A;  4LF6 T;  3E08 A;  3FZF B;  4UVC B;  2JJ9 A;  3N9M A;  2MPK A;  1Y01 A;  1UUS A;  2QRX A;  3ZJ1 A;  4AIS A;  2H3R A;  3OPC A;  3UQ7 A;  4GK5 E;  3NRX A;  4DR3 T;  2IW5 B;  4ZHQ E;  3RLF G;  4NUU A;  3KBU A;  3J9X 1;  2WDQ A;  3EHZ A;  2ACZ A;  4DV4 T;  3I9W A;  3O1H A;  4X66 T;  2X0Y A;  1UUR A;  4LF9 T;  3ONJ A;  2FJA A;  2UXN B;  2JMH A;  3AE7 A;  5HEO A;  2IML A;  4IDN A;  3FBZ A;  4HKA A;  4KI0 F;  3QK6 A;  4AQF A;  2DCF A;  1WR6 A;  4X20 E;  1LKX A;  3NBX X;  4PK5 A;  3UT5 E;  4H9N C;  5HWX A;  5JDL A;  5HXE A;  3W15 B;  2YDR A;  4JI3 T;  2WWU A;  4HFV A;  3TUJ A;  2CE7 A;  3FXE B;  4H9S E;  3HKE E;  4EXT A;  4ZI7 E;  3CX6 B;  2NW7 A;  2BKO A;  1ZEE A;  2K3W A;  3ZJ2 A;  3PUS A;  2LOP A;  2CM0 A;  4EIW A;  1T98 A;  1OWA A;  3AEG A;  3VU7 H;  2IIU A;  3UUM A;  4K0U A;  4EYY R;  5E0O A;  3C4X A;  5JRC A;  2XM2 A;  2R6G G;  3HI2 A;  4XIG N;  4TNW A;  2WS3 A;  4DVD A;  5BMV E;  5FP3 A;  2N2N A;  3ONL C;  2V6Y B;  2WQY A;  3C51 A;  5LXT E;  4L5G A;  5M4Y A;  2Q9Q B;  3AEB A;  3C4W A;  2BKP A;  3ZC0 A;  2X51 A;  2D9D A;  4JI1 T;  2XQ3 A;  1G8X A;  1G73 A;  5CGM A;  3LG7 A;  4CN6 A;  2XPK A;  5HWY A;  1JNZ A;  3RC3 A;  2C5K T;  4X64 T;  4MAL A;  5AQG B; 
#chains in the Genus database with same CATH homology
 3PUV F;  3PUZ F;  4YMU C;  3RLF F;  3PV0 F;  3PUX G;  2R6G F;  4JBW F;  4KI0 G;  4TQU M;  3TUZ A;  3PUW F;  4XTC M;  3TUJ A;  4YMV C;  4XIG M;  4KHZ G;  3PUY G;  4YMT B;  3D31 C;  3PUX F;  4YMW C;  4KI0 F;  4YMS C;  4TQU N;  3PUV G;  3PUZ G;  3RLF G;  3PV0 G;  4XTC N;  3DHW A;  4KHZ F;  2R6G G;  4JBW G;  4XIG N;  3PUY F;  3TUI A;  3PUW G;  2ONK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...