4KIGA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with 4-hydroxyphenylpyruvic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
332
structure length
332
Chain Sequence
SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 122
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kigA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kigA02
1O9HA 2W25A 3FTFA 1ZREA 2VBWA 5L3CA 1UWVA 3ERED 5EKUA 1IW7F 2E7WA 3HTSB 2M8EA 3T0YA 1ZG1A 3SXJA 2ESHA 4PCAA 4C03A 4Y2HA 5BOXA 1VBFA 2BM9A 3QOXA 5DWQA 1JSZA 3EMDA 3GF2A 1BI1A 2A07F 3B7PA 2A68F 3I59A 1JR4A 3C1DA 1EJ6A 1VP9A 1BIBA 3CKKA 3FZGA 2V6CA 2DQLA 1J75A 3TO7A 3SX0A 2FBIA 3JSPA 4HDVA 2QRVB 3AJDA 3GUDA 4PWYA 4AZVA 4P9FA 2G9WA 2QBYB 2COMA 1BC7C 3ID6C 3JWJA 1FSHA 3LDFA 4UVAA 4GCVA 1S8NA 1PUEE 2HS5A 4PGGA 5K03A 1XCBA 2XAHA 2STWA 1YYVA 4YFNF 2CO5A 2NS0A 3HEMA 3IC7A 4I0AA 2F5EA 3M6UA 3WU1B 3IKVA 2BE5F 1P39A 2XBMA 3DMGA 2STTA 2YPRA 3KP3A 2L4MA 3E6MA 1OPCA 3KQWA 1G6Q1 4OBWA 4O29A 4P5OA 1ZHFA 2H6BA 2RN7A 2ADUA 2EFJA 2M45A 4L5JA 2L02A 3TM5A 4RS8A 4QVGA 2P7IA 2CMGA 1ZLJA 4YUXA 5D1NA 2FQ3A 2HEOA 5LQKA 4R8RA 3JTGA 1R5HA 4BLWA 3HCAA 3TRKA 3QP6A 2XROA 3ERCA 1XGSA 5ICEA 2ZIFA 2OBFA 1BBYA 2OA4A 4MTDA 3DEUA 1V39A 1EV7A 3DPLC 1STZA 5HEKA 4JBAA 1U2ZA 1XDSA 4HGYA 4EJWA 4M9ZA 4IRIA 2J5OA 4RGSA 3HA3A 5F1RA 1YUBA 2PT6A 3JWGA 3AXTA 3GW2A 3CDHA 3EYIA 2JZYA 3GFIA 1UIRA 3HTUA 1FPQA 4KUMA 3G73A 3TQNA 3ZN0A 3H3UA 1IZ1A 4HV6A 2ETHA 2GH1A 1HSTA 3M8FA 5E8IA 4K2EA 5FD6A 2HNKA 4MHTA 1NHAA 4HQEA 5FO5A 3OU6A 2L3DA 2FPOA 4P7FA 3KPYA 5HFJA 2XYVA 1SFUA 4FSXA 3BJOA 3JSOA 2GB4A 1JTEA 1VLMA 5E2BA 2FEZA 2MD5A 2ZCWA 1O3RA 3DXXA 4PNEA 2D45A 4TV7A 4R6XA 3M7GA 2YX7A 5FLXZ 1ULYA 4OQDA 3DFGA 3JTHA 4HQMA 3UJDA 1L3BA 4HX7A 3NDIA 2C7PA 3BGDA 3R3HA 4OA8A 2HR3A 2OPBA 4LGWA 4M37A 1WSUA 4EQQA 4E32A 1EJ0A 2O3FA 4WF2A 4CDGA 2VE9A 1VTNC 1Z9CA 1T43A 2PEXA 4PYOA 5BP7A 1K78B 3CJQA 4KFCA 1S7AA 1H9TA 3BJ6A 2G72A 3FZVA 3RI4A 1WQ2A 3HCBA 3TDUC 3WTZA 3HHHA 1XMKA 1IRGA 2HV9A 3KKZA 5K5QA 3MZYA 1L0OC 2XAJA 2JH8A 5K5OA 4GC5A 4KW7A 5H02A 3GIWA 5BPDA 1AV6A 5CVRA 2Z3YA 2CKDA 3O7WA 3BGIA 2HFHA 1G6NA 2ZNZA 5MHTA 2A5YB 4EJOA 3R60A 3RPUA 3ROUA 2A3SA 3U81A 3C3PA 4RVHA 3THSA 1W4MA 1MD0A 3M9AA 2DO7A 2RVCA 3MEXA 3FF5A 5FD5A 3WSTA 5CUQA 5EG5A 2D1HA 1KU9A 2RGVA 4EM1A 3F22A 3GZ6A 5K0BA 4MGRA 2P8JA 4KIGA 4JK1X 3ZN1A 3JAMZ 3ELKA 3GGDA 2DPDA 3FUWA 3JW4A 3EVDA 2A61A 3IKTA 2VODA 2PFBA 2JSCA 2EK5A 1F4KA 3F8MA 1N7IA 1FC3A 4ZYEA 4CTJA 1PP8F 2IRFG 3HVJA 5H20A 4BY9E 3P9CA 4MWZA 2OQGA 4EK9A 4ASNA 5K5RA 2XAGA 4RGXA 1XDZA 5DEQA 2EB7A 3B3JA 5HLGA 5D1HA 4V0RA 3I58A 3GO4A 1ZYRF 3ELDA 4M38A 1U5TC 5E8JA 4P9UA 2R7DA 2AOTA 3GDHA 2WC2A 1VIDA 4N0BA 1P91A 4CGZA 3HSEA 2FMLA 2EFQA 4ISCA 2K4BA 2FBKA 1KQ8A 1INLA 5EEGA 3UA3A 2GXGA 5E9WA 2W84A 2HTJA 1I1NA 1EIZA 1CGPA 1DUXC 2BGCA 2ZBKA 3ELUA 4KNYA 3BXOA 4DCGA 1B4AA 4XSXF 5FA8A 3JWIA 4U7PB 3GFMA 5CM2Z 1GVJA 2RQPA 4LG0A 1ZLKA 2WWYA 3TKYA 1WG8A 2YXDA 2HDCA 2ONYA 4IJAA 1S3JA 2AVNA 5FFZA 1IN4A 4HZFA 1XGOA 3D0SA 1FY7A 2VC1A 5E8RA 1FBUA 1HQCA 2BBYA 2PXCA 4C05A 3KETA 3F4KA 1WI9A 2GS9A 4GC9A 1WXXA 4NECA 5DXJA 2DI3A 3ABUA 3N97A 2EJUA 3EVFA 2PWYA 5DM0A 3PX3A 2PI0A 1FWZA 3P7NA 2ZZNA 2BEOA 4L5IA 2RNJA 3J80K 1O54A 3HCFA 1Y0UA 4AIJA 3NTVA 3BWCA 4MEYF 3CUQB 4L0YB 4QDKA 3ECHA 2FK7A 4EV0A 3PQJA 2BR5A 3QU3A 3E97A 4AIKA 1G4DA 2VDWA 5DSXA 1QAOA 3RODA 4ETSA 1MDMA 5EQJB 2JHCA 5HLHA 5DD4A 3EGVA 3B3GA 4XRFA 5K0NA 2FOKA 3V4GA 4ZYDA 3G2QA 4IV0A 4I7HA 2PX2A 5DRYA 5K0CA 5KVAA 3TMAA 2L01A 1O9GA 2ZZMA 4IF4A 4EGZA 1O3QA 3L9FA 2K27A 4XUDA 5K0JA 2OO3A 4EGYA 3FHZA 3PTAA 3AAFA 4RTLA 2GQQA 2ZJ2A 3KHKA 5EMLA 1ODDA 1QBJA 1BHJA 5CVDA 5EHGA 5F2OA 5HDKA 3CC8A 4HAMA 1EH7A 4UHTA 2QE6A 2A6HF 4BXUA 4PCLA 1XD7A 3I0TA 2KIMA 4YUVA 2DQRA 4HW0A 1G3SA 2HZTA 2ZTHA 3UJ9A 2IH5A 2EA2A 2EV0A 4L18B 5HIMA 4BNCA 4BLUA 2C7QA 4ENJA 4ENKA 3V97A 2JG3A 2BR4A 1SQFA 3E23A 4BLVA 1W5TA 1X1DA 1L3IA 1ZKDA 2VBZA 5D5VB 4HGZA 1RUOA 3HOTA 7MHTA 4E2WA 2P6TA 3R0QA 3G88A 5LSAA 4HF1A 5DCMB 4ZTBA 4AZTA 3W6KB 3UJ6A 1P2FA 4HTFA 4CKBA 2IA2A 2G7HA 3TDZC 1WZNA 2EJTA 3BT7A 3V8VA 1JG2A 5DPMA 3RIRA 2RKHA 5FWAA 1QANA 3ME5A 1OKRA 4AIHA 4WXHA 4PYMA 2WK1A 1NBIA 4RTSA 1G3YA 2A6EF 3AXSA 3F23A 4ZH4F 2EFWA 2PBIA 4HC4A 1Q1HA 3PFHA 1G3TA 4AZWA 4UOEA 2FSWA 3BZBA 5DRTA 5F64A 2OYRA 2YR0A 3VODA 3FRIA 4WCGA 1WXWA 1J0RA 5GIOE 1R5GA 2AOXA 4U0YA 2MH9A 4FHTA 1B9NA 1TQMA 5DM2A 4RV9A 3SZPA 3FUVA 1SVUA 1SD5A 1NV8A 3U9GA 2Z5UA 4M73A 2VS1A 2ZMEB 2R7FA 3SSOA 4OA5A 2ZCJA 1YS6A 5F6FA 4ZYHA 1TNSA 1MDMB 3SR4A 3DXYA 1GHCA 3NJRA 4Y17A 2M1BA 1SUIA 2P7VB 4I98B 1O3SA 2AN3A 5E1MA 2OB1A 3HCEA 4IWNA 1D3YA 1OYWA 5EZSA 3IHUA 4E2ZA 1FBNA 1U78A 1K78A 2HOEA 2XV4S 5KVRA 2G70A 4LB5A 1R1VA 3V7CA 4L9VA 2RV8A 1FP1D 3WTYC 3KP5A 2AN5A 2N47A 1HW1A 5FWDA 1HBXG 1IF1A 1ONVA 2OAZA 1IN5A 3S68A 4IKPA 3FTCA 2FXAA 4UNOA 1N2XA 2DW4A 5JHUA 4CHUA 1SFEA 5E1BA 3TFWA 1DDNA 1ORHA 5HZMA 3FXRA 5HDGA 3IRRA 3MQ2A 1U2WA 5EIWA 4L9JA 2X0LA 2HKXA 1K79A 1FX7A 1BOAA 4ZZLA 2XYQA 4HLXA 5DLYA 3X0DA 3FWEA 3CO7C 1JHFA 3FTEA 1R36A 2K4JA 1QGPA 4GGGA 1O3TA 2CWWA 2X4HA 3WODF 5BW4A 1BIAA 3TR6A 1R22A 4G6QA 5DTQA 4CTKA 3QAHA 4L9NA 1H9GA 1C0WA 4FT4A 2AS0A 1MHTA 4XLNF 3HRMA 2H27A 8MHTA 2P5KA 1YF3A 3G3ZA 4WWCA 3LQRA 2VE8A 4ENMA 4LWPA 5CYVA 5FHQA 3TKAA 3G7UA 3LX6A 1LJ9A 4A12A 4RB0A 4O3MA 1K7AA 1ZQ9A 3GWZA 3F21A 2Y1WA 2QLZA 3FPEA 3P71T 1TQIA 5LBQA 3KU1A 4YMHA 1YW9A 4GOLD 4Y13A 1YTYA 1FJXA 2O6GE 2HYFA 2M5WA 1R18A 3K1NA 2XVAA 3HIFA 1UFMA 1I5ZA 2FNPA 1YW7A 1YG2A 3UJ7A 5EEHA 4PYQA 4FSDA 3FYDA 3TM4A 3KR2A 2HQNA 2C7RA 3J81K 3M70A 3E5QA 4HF2A 1EG2A 3KFWX 1AWCA 5IH3A 5C0OE 1P92A 1TBXA 1NE2A 2XVCA 3T5XA 5CVUA 4GYIA 4A5MA 4KMUX 5JR3A 3G8AA 3EGIA 3BP8A 2PJPA 1TW2A 3PFGA 4WXCA 2IDKA 1I27A 3WTTC 3HVHA 1TLHB 3OPNA 1J5YA 2B9EA 2MLKA 1E2XA 3E5UA 4DKJA 1LB2A 2PN6A 2GWRA 1X1AA 1YFJA 2EFPA 3C0KA 1LNWA 1SMTA 4QTUB 5JUWA 3AWIA 3EVGA 2AOVA 4I01A 1FBQA 4G9YA 3GRZA 3MTEA 4P7JA 4C04A 5FFXA 2PSSA 2J5PA 2B0LA 5K01A 2JPBA 5LLQA 4RVFA 3DUWA 3F8BA 3F8FA 4I02A 2ZNYA 1OR8A 3GRVA 1J59A 2NYUA 2LKPA 3OE4A 5GIPE 3TQSA 2WA1A 4IPAA 2DK5A 1IY9A 1EH6A 1A04A 4P58A 3GFJA 3BOQA 4XUEA 2P6SA 4WXDA 1IN6A 3HM2A 1XSXA 4X61A 1RJDA 5DTRA 3M8EA 4OX9Y 4KIFA 1LEAA 1U5TB 1YFLA 3G2MA 2G1PA 2NNNA 3V8KA 2JHAA 2PLWA 1ZGJA 3Q87B 2BZGA 5B1SA 2KIFA 3KP4A 2GA1A 3M6WA 1Z6TA 4BHPA 3EEOA 4DMGA 3PFIA 5GWXA 3W6JB 4LLGF 3P9KA 4X60A 3RDIA 3E6DA 2E7XA 1F5TA 3DMFA 2OKCA 3KR1A 1TTYA 4QQKA 2ONZA 4ESFA 3N4MA 1BI2A 2P40A 2ZBQA 2A14A 4OU0A 3E3VA 5DT2A 3LCCA 2ZFUA 4UV9A 2PBFA 3CGGA 2VONA 5E1ZB 2YUIA 3FPHA 2EG5A 1RJGA 2MC3A 4P7GA 2H94A 2QVOA 3L2CA 3ZQ7A 4XSZF 1S29A 3K9TA 1RI7A 4RGRA 3LFKA 3NRVA 4BHCA 5TRDA 3BPVA 4DQ0A 1Z3CA 4G7OF 3LSTA 1NKVA 3BKXA 2MH2A 2M30A 4CWAA 2E5WA 3TOBA 4UUVA 3O3KA 3KQPA 5M5BA 5BS6A 3LAPA 2V1UA 1HMYA 2CWEA 3FX3A 4C4AA 4MQ9F 4U7DA 3R6SA 3VB2A 1O57A 4LG1A 1U5TA 2AR0A 1S6LA 4EVIA 1AQIA 2ELHA 2I6GA 2UXXA 1SQGA 1VE3A 2FU4A 3T8RA 4HV5A 5E9JA 5GM2A 3SMQA 1R8XA 3T7SA 2EA4A 2KKOA 4E2XA 2XKPA 2C7OA 4QQNA 1LDKB 2DULA 3K69A 1U8RA 1CF7B 3MAJA 3ZPLA 1ZARA 4DM3A 1JG4A 4XBFA 3GEZA 1SUSA 1G3WA 3FXQA 4M74A 2KRFA 3GX4X 4CXMA 5ILUA 2Y75A 4OBXA 3LL7A 3EVAA 2AOUA 5EC8A 2EV5A 3I53A 2CMHA 1U3EM 3MCTA 5E17F 3UJAA 4OIPF 3MCZA 3DLIA 3S2WA 3B73A 1YO5C 4GOND 3DLCA 1KU7A 2H11A 2P1DA 4R6WA 2TDXA 3COAC 1YZHA 3LA7A 4X63A 2AS5F 5DXAA 1FYMA 2F2EA 2QQAA 5D4RA 3PQKA 3ZMSA 2YSRA 3ULQB 2ERCA 1ON2A 2W85A 3ZMZA 4NB5A 3J80Z 1UHWA 2Q8KA 5EPEA 2L4AA 3BY6A 1DPUA 3MHTA 1FZPB 4V0QA 3SQNA 3B5IA 1XCJA 1W5SA 4KA4A 3NW9A 1T98A 3ZMVA 5ICFA 1NW5A 4R8HA 4PIMA 3VC1A 2YQZA 3FPFA 4KDRA 3WTSC 2V79A 3G5TA 3BZ6A 1BC8C 4D0PA 3A27A 2ZULA 4RTPA 2GA2A 2NNYA 3G2PA 3KLNA 3WTWC 1X19A 5LHHA 2BH2A 4LLLA 4KN4X 4BHBA 3GYHX 2I9KA 3IV6A 2QY6A 5LQNA 2IIPA 5HILA 2PT9A 4UVBA 3LCUA 3P8ZA 1D8KA 1T6SA 2IW5A 3L09A 5J8CA 2UWMA 1X1BA 2DPMA 2QQBA 3I5UA 3RKYA 3DPTA 3R0JA 4L7VA 4KICA 2V1XA 3DMHA 3IHTA 2IT0A 5EGSA 3FYCA 4IV8A 4KRGA 3G89A 2P41A 3C18A 2R3SA 5EKXA 1DCTA 1KQ9A 2UZKA 2XIGA 5F2NA 2MBFA 4AUKA 5A2QZ 3SSNA 3LGAA 3QPHA 2PV0A 1VPTA 2MLGA 3Q9VA 2JTVA 4FX4A 4HOBA 3EVCA 3NEUA 1H0MA 2C6YA 2HYGD 2XASA 3CJRA 3CBGA 1ZN2A 3ABTA 3IWFA 1T39A 4DNCA 3HA7A 3KPWA 5EMJA 1FT9A 1YFHA 4G7ZF 3QOPA 2DU9A 3CVOA 3E5XA 4RB2C 1IXKA 3GU3A 4RTJA 5FCDA 4BQAA 5DV5A 1XVAA 5CVVA 2AVDA 3BWYA 1F9NA 1ZRFA 2EV6A 3KQYA 3PT9A 4GYGA 4EMSA 4LB6B 1JQDA 4YV0A 3T0IA 2MA3A 4EQZA 1G55A 5A2QK 2VOOA 2B78A 2OBPA 2JHPA 3BWBA 5FGMA 1ZH5A 2IA1A 3BWMA 3B89A 2ZW9A 4R79A 4PYNA 4POOA 4AX8A 4PYIA 3QRFF 3L7WA 3EUHA 4KVZA 5CJ9A 2K86A 5FTWA 2OY0A 1R8YA 3CLOA 3OU7A 2HWKA 4HBLA 3NMUF 4I09A 1R7JA 2QZ8A 3B3FA 1B1BA 3H2BA 2HMYB 2FRXA 4ER7A 3WTXC 3KQSA 1QQIA 3HSRA 3TLJA 2FBHA 3G5LA 2ZO4A 4GF5A 1L3LA 1B42A 4PCQA 4PDKA 2ZIGA 3MQ0A 1JQEA 1HW5A 4YFKF 5GOZA 4P7KA 2YTZA 3DV8A 2XUBA 1LDDA 3KR9A 3TOSA 1KA8A 4FR0A 1FYKA 4NHJA 3IL2A 1Z05A 2O61A 4RTOA 4RSRA 1KQ0A 2DT5A 5DSTA 4MEXF 4QPPA 1FSEA 2WTEA 3GO5A 1NW6A 3HSFA 4Y15A 1F3LA 5BQTA 3SVZA 5K1YA 5E8GA 1QAQA 4FP9A 5GP1A 2R6ZA 1T2KA 3EPPA 4YIIA 2G8NA 2ZKZA 3P9NA 2W57A 3FPGA 2FK8A 3HNRA 5BMZA 1R1UA 3OV8A 5DCFA 1XB4A 3DKWA 4JXJA 4I0BA 2PX5A 4RTKA 2BR3A 4HTFB 3LQQA 2Q2EA 3MAGA 1SG9A 1UFKA 4XUCA 4DF3A 1I4WA 1NW3A 3LKDA 2GZWA 2OD5A 3EVEA 3NWEA 3BGVA 5LEJA 3OZRA 3DXZA 1PRYA 3LHDA 3FMSA 5AIPA 1ZRCA 3BPXA 4O6JA 2G71A 5LQJA 2P7CB 5DX0A 5K0EA 3FM5A 1RUNA 3Q7EA 5IT9K 2PMHA 2NXEA 4I2OA 4ATNA 4DCMA 3K6RA 5HOQA 1QNTA 4QWQA 3REOA 5FQNA 3PLAE 1S7OA 4UXNA 2PJDA 1HNNA 2G7UA 4LK0F 4HH4A 1IN8A 3KPJA 5E1OA 1E17A 2AOUB 4HX4A 4HRAA 4P55A 2FE3A 3MERA 4K6MA 3LA2A 4AD9A 2YVLA 1AOYA 1WY7A 3EMBA 5HOOA 1WS6A 5LGTA 4L9TA 4P96A 4YUYA 3ZP5A 4EM0B 3UFBA 3WTVC 4QPNA 2GLUA 4FZVA 3VOEA 3HCCA 3R24A 1WRJA 4HYEA 5HDNA 1XDUA 2ZIEA 3KQQA 5ILSA 3I9FA 2BYVE 1LDJA 4BYYA 1NV9A 5JFRA 3ER9A 5DTMA 2M87A 3SFZA 4M6YA 3J7AO 3GNLA 4FX0A 5C1IA 2UYOA 2ZBRA 2H00A 2KIUA 1I1GA 4EKGA 2ORED 2CQKA 1DPRA 5G02A 3GFLA 2P5VA 3C3YA 2BM8A 3O31A 4KDPA 3FRHA 3BKWA 4OMYA 3HP7A 1NW8A 2JPCA 1YZ3A 2IA0A 5BXYA 1Y8CA 4MTLA 3RTRA 5HVQC 2XAQA 5DDGA 4BAYA 3GJYA 4C08A 5FULA 5EOVA 2DTRA 1LVAA 3HRUA 3EVZA 1NT2A 2Q0OA 4KDCA 3OZSA 3DF8A 2I62A 2XRNA 4U7TB 2PKWA 4MNUA 4UV8A 3WGGA 1ZAOA 3F72A 3CTAA 1KPHA 3M4XA 5HIIA 1QYRA 3BUSA 3K0LA 2H09A 4L0ZB 2LD4A 2CG4A 4KYWA 4FT8A 3GLXA 4DA4A 2IFTA 2CSOA 2B25A 1MZBA 1BN5A 3TPZA 2QENA 4M9XA 3FM3A 2IP2A 4OMZA 1F38A 2B2CA 2ESRA 3RIEA 3RJPA 2WA2A 1D2CA 3RKWA 5BW5A 2CYYA 2VBXA 5AIQA 1YW8A 2NRAC 3LBFA 1H1DA 1IXSB 1EQAA 1SD7A 4HLYA 3E8SA 1KGSA 1IUYA 5ICGA 4MIKA 4EM2A 3F6OA 1BJAA 4PYKA 1U6GA 3KQOA 1MJFA 5ERGB 4ER3A 3OZTA 5D6EA 3V7RA 3GVAA 3FXUA 3M6XA 2LNBA 2YXLA 4M6XA 1UB9A 2YXEA 1OR7A 2ZVJA 3DR5A 1KIAA 2DBBA 1XGMA 3Q5FA 3ECOA 3A7EA 3FTDA 2OXTA 2QQ9A 3LECA 4YG2F 5HLIA 1P4WA 3KR0A 4PYLA 3V7SA 5LRRA 3KZZA 3NWBA 3JWHA 1IXRC 2FCAA 3LAJA 3KEQA 3I64A 5DUIA 4QLCU 5J8FA 1KP9A 4ER0A 2EX4A 4B17A 1CF7A 5LR6A 1OMIA 5P8WA 4GOOD 3EDPA 2D2WA 2QYOA 1FYLA 3UWPA 1RIOH 3ZMUA 3ANXA 1I1SA 2YX1A 4YV2A 3I54A 3CUOA 4YUZA 5DD8A 2GAFA 1QZYA 1FNNA 2RDPA 1LEBA 2LF8A 2FRHA 4IVNA 5HS8A 5T6BA 5K8VA 3NVKI 5ERIA 2IGTA 4CKCA 4GQBA 2NP6A 4CKEA 4HA8A 1IN7A 1G8SA 2H6CA 4IXAA 3CO6C 1V4RA 3CUQC 3VEPA 3JAMK 4H0EA 5HIKA 1DP7P 4RAZA 4HDUA 3LDUA 3GRYA 4R8SA 1QAMA 4CICA 1HXDA 5E1WA 3F3XA 5HS7A 5D5WB 4ENNA 5KQSA 3CJTA 4OIOF 5CVJA 1TPYA 2VN2A 2QM3A 5T64A 3UBTA 1MJ9A 4M72A 2IH2A 1SMYF 4HSGA 5L3GA 1M6EX 1LQ1A 5L3DA 1J9IA 1O7LA 3OU2A 1W7PB 1XJ5A 3E6CC 1BM9A 1JHHA 3GZ5A 2P4WA 4A2UA 1J7KA 3IYLW 3FMRA 1NW7A 3I71A 2P5LC 1W7PD 3E6BA 1J2XA 1ORIA 4ESJA 4ZZDA 2O0LA 3H92A 4HG2A 3M33A 3L00A 1GXQA 2GAUA 2ZWAA 2LDUA 3RW9A 1XTPA 3EVBA 3C3WA 5HIJA 3KLOA 4A6DA 4IRGA 4AWXB 3GRUA 4U7BA 5H6QA 2GPYA 1OYYA 3CJNA 2LF7A 4OQEA 4PGHA 4U0VA 5KS2A 4F7ZA 1XSDA 2QRVA 2QWWA 3HYIA 4ER6A 4WX9A 5FB2A 5F2KA 1YQAA 3MTIA 3CCFA 3K0BA 5LQUA 4G8XA 4QVKA 1L3CA 5L3EA 2F5FA 3UJBA 4RTRA 1KHHA 3HVKA 4H0NA 1R6AA 1RI5A 3LKZA 1HKSA 2Y0MA 2CW0F 1KU3A 1TNTA 5CIYA 4QTTB 2O03A 1SKMA 2VT3A 2O57A 2P35A 2Z6AA 3HOSA 2NNWB 4F86A 3WGHA 1G38A 4B09A 2HQRA 2PMUA 3F8NA 4RYLA 4BH9A 5LQCA 3KP6A 2F8LA 3MB5A 3KCCA 4S04A 3DOUA 4LMYA 2NXJA 3HA5A 1Z7UA 3J81Z 2ZZKA 4OINF 2YX4A 1MKMA 3F8CA 4PYJA 2GIVA 1USSA 3RYRA 3PB3A 4KWCA 2PVCA 2FYTA 5EMKA 2OQRA 3BWGA 4M71A 1RJEA 5FUBA 2F5CA 4QDJA 3MZHA 1SFXA 4CYDA 5LGNA 2VXZA 5JI6A 2W24A 3O4FA 3OFJA 3E7PA 2QUFA 5CVIA 4YV1A 3RPQA 2IJLA 3SSMA 2UXNA 5H6RA 4FS8A 3KP7A 2PY6A 4B8XA 5CCXA 2H1RA 1YIOA 2FF4A 5L3FA 4WVLA 5LHGA 1HKQA 2O07A 1HSJA 2FMYA 3EQLF 4EJTA 3SGLA 3KQMA 4OOIA 4LWOA 1RJFA 5CCBA 2PQ8A 1IAWA 3U1DA 2HGCA 2Q41A 1XN7A 3KPUA 3THRA 3EYYA 2ZBPA 2HR1A 2KJCA 4XCXA 4PONA 2IVMA 4FT2A 3LA3A 3V8LA 5KYGA 3TOAA 1O7FA 3LCVB 1F1ZA 2UZ4A 1KU2A 2P8TA 5IT3A 2OZ6A 1MGTA 2DAOA 4EJVA 3O2PE 1B9MA 5FLXK 3GRRA 2VBYA 4RAYA 2O8XA 3C7JA 2PGXA 4R05A 5JVTA 3KQVA 4Z2YA 1BI0A 1WWXA 1QO0D 3OE5A 2LSOA 3KPVA 5ILVA 3A25A 5EVJA 2AXLA 1JG1A 3AY0A 4BP1A 5K05A 4YFXF 1L9KA 5KQRA 2EFOA 1D2HA 2DLLA 5D5XB 3EETA 1WKMA 1R23A 1KYZA 1KPIA 2VDUE 3DULA 2EFNA 2AN4A 3E05A 3WTUC 3P97A 4RVDA 5FA5A 4BP3A 2AZTA 4F84A 3QPTA 4Q48A 4HF0A 1Z1DA 2CL5A 2YR2A 1RI2A 1DUSA 1YS7A 1ZGAA 1UCRA 4UVCA 4MHGA 5DX1A 3NQOA 1P6RA 2PX8A 4GOMD 1REPC 2UYQA 2VC0A 1SD4A 1UHMA 4U88A 1MJAA 3SXYA 4A5NA 3BDDA 1R1TA 4S05A 1RI1A 3FUUA 3EGEA 1BC5A 2ADMA 3UJCA 4U0WA 4PINA 2JJQA 2Z99A 1ZRDA 3A7DA 3H3ZA 2L54A 2ISZA 2Z33A 2F5DA 2OB2A 3A4TA 1Q0TA 5DX8A 5BPIA 2EJRA 2P3OA 4G7HF 3QU6A 3F6VA 2XAFA 1D8JA 3R4KA 1X3UA 2HWVA 4A0ZA 1I9GA 3ZMTA 10MHA 4PZJA 3HTXA 4N9HA 3RKXA 4M9SA 2OU2A 3IEIA 3A26A 5KK1A 3O6BB 4ON0A 5FQOA 5K09A 1M0EA 1TW3A 3KZYA 1FP2A 1IM8A 2VT2A 1YLFA 2V7EA 3LBYA 5K0FA 2ZMEA 3OOPA 1TQPA 1HW2A 2ZSUA 3I59B 3KQTA 3HHGA 3R9XB 5LHIA 5D4SA 1PJZA 4KN7X 4EJUA 4DZRA 5CVEA 2ZWVA 4LFUA 4RTQA 3T8TA 3TO6A 2PXXA 4G94A 4C06A 2YU3A 5E1XA 1JQ3A 3HVIA 2QBYA 3KEOA 4E31A 5EZQA 2P3QA 5E9QA 3M1EA 3EEYA 4YIFA 4GEKA 3WE2A 4Q4ZF 3OCJA 1EH8A 2K02A 1SD6A 4GBED 5EMMA 1RI4A 3K1PA 3GCZA 2P3LA 1AF7A 4ER5A 2DPUA 1X1CA 3QOWA 2NAZA 2V1DA 1OYIA 2D1VA 2IBTA 2I7CA 3OFKA 1IXCA 4ZYGA 1T0FA 5GINE 1ZG5A 5ED4A 1V3FA 6PAXA 1QZZA 2FA5A 5T67A 1GXPA 1R58A 4G56A 1NBHA 5DCMA 2GA9A 1P4AA 1N7JA 4KIBA 2KJBA 3MFKA 5ICCA 4CZZA 3R61A 2FNAA 3HRSA 3FUTA 4M7RA 4YUWA 1Q0SA 2AOWA 4OIRF 3T7RA 1P4XA 2NXCA 2OZUA 2FHPA 5IT9Z 1L1EA 4DQ2A 3TGNA 4X41A 3VC2A 4GUAA 1XMAA 2UYCA 3FMQA 1QPMA 4A0XA 1PDNC 4IHSA 2XVMA 2IH4A 5U4XA 4LK1F 3VFZA 4FGZA 1G60A 3CUQA 3UJ8A 2UYHA 1BKYA 3ER8A 4GXOA 3HUGA 4NQWA 3PS9A 3DXJF 3R0AA 5CLSA 5HS9A 2Y48A 2VDVE 4LLNA 3P9IA 3VYWA 1XCVA 3BJAA 4F85A 5J6XA 3MWMA 4OIQF 2PLYA 3MGGA 2VOPA 4RGUA 3DTNA 3NDJA 4ESBA 1XXLA 4HX8A 1Z6RA 3RYPA 1KR5A 3LPMA 4O5VA 1W7PA 4E70A 1P1BA 2VZ9A 5GM1A 4Y30A 5C9ZA 1XSVA 5L3BA 1RI3A 5LQAA 2JRTA 5E18F 4R1HA 1VL5A 1D5VA 2JH9A 3LWFA 3WG9A 4MQ4A 2EWNA 1Z91A 1T38A 5E1DA 2A69F 2Z6QA 4E2YA 1DL5A 1FLIA 4G6DA 3FUXA 4AVPA 4IHTA 2XGXA 1PP7U 1ON1A 4LJZF 2ISYA 1KYWA 5CD1A 3KE2A 5D6FA 2ESNA 3ELWA 3HCDA 4X1OA 2JT1A 3QP5A 1RNLA 1JSXA 3SM3A 4RB1A 2O06A 1BI3A 3HRTA 1VP3A 5TJJA 1EAMA 3PVCA 1SAXA 5DUKA 2NP7A 4GO1A 4Q47A 1XGNA 3UA4A 2E1CA 1BOOA 2IBSA 2ZLBA 4KMFA 3V8JA 3L8DA 4RTMA 3UZUA 2O05A 3ZMDA 2XYRA 5DM4A 1MJBA 2BV6A 1XCLA 4C07A 4RX1A 4WK8F 1K6OA 1B6AA 4N9IA 1JXSA 2PX4A 2E1NA 3GXOA 1YB2A 3IRQA 4Q5SF 3WU0A 2B3TA 3SZTA 2VP3A 3DP7A 4KT5C 4LECA 2DK8A 1JE8A 2DFIA 4AZSA 4CO8A 4IRHA 5IKMA 2K4MA 1D2GA 2Z6UA 2CFXA 3WE3A 2IPXA 5EHIA 3D5LA 2V74B 2Z9OA 5FHRA 2NYXA 4A6EA 3T7TA 3SHFA 2ZFWA 2AOTB 4MQVA 3P2IA 5FADA 2P7HA 2XHKA 1AQJA 3KP2A 2O0YA 3P2EA 2PG4A 3Q9SA 3I4PA 4E33A 2GXBA 3VSEA 1P1CA 1FBSA 1B59A 2HTEA 2OZVA 3R6TA 3TO9A 3DH0A 4YMGA 5LRSA 3IWZA 5D8LB 2IDJA 4LG0B 3DQVC 4E30A 1JG3A 1G8AA 2WV0A 5DM1A 1JGSA 1JTFA 4RWZA 5K0LA 4XLPF 4RB3C 3B02A 2CGPA 4CXFA 3D2LA 1KXZA 4RTNA 2XKOA 3G2OA 1ZG3A 5E2AA 4EKIA 3ORHA 2HTSA 3K1MA 3K2ZA 9MHTA 1I6XA 5D5UB 3ISPA 2IPQX 3QV2A 2ZXJA 3BROA 1VQ1A 5AONA 5D8KB 3PX2A 5K0GA 3C6MA 4A0YA 3M6VA 3T1BA 2V9VA 1FOKA 1KPGA 3P2KA 3LDGA 2ACJA 4LD5A 3WGIA 1R00A 2K7LA 1R74A 5EIFA 2RC4A 4MTEA 3U2RA 3C6KA 3NVMB 3FPJA 1IRFA 5LGUA 4RVGA 2PXAA 5LQRA 2NXNA 2Y1XA 4M36A 5E20A 5LEKA 1HKTA 4PIPA 2HKOA 3ELYA 3G8BA 2KW5A 1USTA 1RZ4A 3ML6A 1M6YA 2PWPA 5DYMA 4JQFA
chains in the Genus database with same CATH superfamily
4QHYA 2YN0A 3BRCA 4HDMA 4F3KA 2P81A 3VZRA 4LYAA 4TV9A 1Z0AA 2A0UA 1P7VA 2QMOA 3GD7A 3FTFA 1UWVA 4I2VA 1V4BA 2WNHA 5FOTA 1NU8A 1O94D 1J42A 3Q0VA 1JLHA 3JQQA 3S16J 1P4JA 1VJ0A 2M8EA 2LCQA 4XM2A 2O2GA 4C2UA 3D6UA 5U1PA 4IIGA 1MV5A 1IULA 1C9YA 2HPHA 3HCPA 5ALEA 2BBTA 3C1AA 1KBOA 3DFUA 3GJRA 2GO1A 5CJJA 1T5TA 3STWA 1SMKA 3S40A 1N2CB 4H7EA 1Z7GA 1BG6A 4LYFA 4Y98A 2H1IA 4YWJA 4DWWA 2A07F 1EM8B 3B7PA 3HP4A 4OATA 1PVDA 4REQA 2WADA 5AOCA 1JR4A 3CKKA 3FZGA 1BIBA 3LC1O 4QATA 1EMDA 4LJAA 5IJ9A 1LBEA 2OZPA 3OPQA 3RS5A 4FPXA 2FBIA 4HDVA 1XG5A 1ZH6A 2CXHA 2J4FA 3AJDA 3NBYC 3ZU3A 4Y3UA 4YPOA 1FK8A 4PWYA 4EI9A 4AZVA 1PFUA 1W0CA 2QMQA 3W2IA 2EQBA 2L42A 4FHDA 4E5MA 2IXTA 2V0NA 5FOQA 4I6GA 3EXFB 2WYOA 3BERA 3KXIA 1BC7C 4MR8A 2HD4A 1N0IA 1OROA 3JWJA 3S2DJ 5IMBA 5TF4A 4MW2A 2NADA 3X2FA 3LDFA 4XQCA 1AKTA 4DBRA 1W9MA 2JGMA 4E7LA 3IUEA 2M4GA 4UAVA 3R6WA 1PUEE 3ZW8A 4B44A 2XRMA 3ADOA 5ILQA 3ICOA 5J1RA 1T9AA 3V8PA 5AVTA 5KNBH 5D5HA 1EFUA 1N78A 1EUCA 2H7CA 2Z3ZA 4YO8A 2CO5A 2VUHB 4W5QA 3MD0A 2J31A 2ZSIB 2PLFA 4I0AA 1Z5PA 2C2ZA 2C4HA 1M0SA 2XB8A 1SD1A 4ARCA 1K98A 3PUJA 1N1GA 3OL4A 2II6A 3EZXA 2WPDD 1DJNA 3FBIB 4LJKA 2XB2A 4GT1A 4X7RA 4I1IA 2B8JA 3QG5A 1E3WA 1EXWA 3GRFA 4U1RA 5CURA 2XBMA 3DMGA 4LIUA 1E2MA 1UUFA 2CHEA 1ULHA 5EP3A 5JO9A 3R7BA 5JD4A 5D51S 5JXHA 1U2RA 5HRAA 4AS1A 3WLSA 2GT1A 2Y68A 4YJGB 1WXHA 3E6MA 2VK1A 2REQB 3F74A 2C95A 3AYZB 4XFJA 2GZ2A 4O29A 1M1YE 3TQFA 4P5OA 5HKKA 1ZHFA 1ACIA 1H23A 5KWJA 2RN7A 4TMTA 1SKBA 4DJAA 1U11A 3UK6A 2M45A 2IY8A 4TM8A 5INTA 1GVHA 1EGQA 1I39A 1H85A 4OB8A 1Z3YA 1OI3A 4WK2B 1G8JA 3HYSA 5EFZA 3ZU2A 1XWIA 4HUJA 3G5AA 4QVGA 3NQ41 5FNVF 2GNPA 1YS1X 1RKUA 4QYXA 3QBVA 3ZEIA 4QE3A 2AD1A 2JA6J 2HEOA 4KGVA 1FP4A 3IA2A 1R5ID 3PFCA 5GZ3A 3QNMA 4BLWA 1JQ5A 3QJYA 3CWQA 1D9XA 2DFLA 1VZ2A 2O5VA 5CMLA 2QY9A 1M9NA 4G5OA 2E4AA 4S1PA 3L2OB 5DZSA 5G3YA 4AJ2A 4C4SA 2CXXA 2A7XA 2ABWA 4EUSA 5C81A 1VBMA 3DEUA 1G6OA 1R0CA 3DPLC 3AVQA 3MCWA 3UHJA 1IZYA 2O2HA 2P9QA 3C39A 4G4SP 1U6KA 5HEKA 8GPBA 4JK3A 3I9V2 1DKPA 2ATCA 2GMWA 1P4RA 2PSEA 3ND8A 4GX1A 4DNFA 3UOGA 4DLXA 1YE8A 4F9EA 4W99A 3DF7A 5IBPA 1AGPA 3HA3A 4Q15A 2EKDA 3OM9A 4MQ5A 2B5WA 1KE1A 2MIIA 3W06A 3H5NA 5I4CA 5F1RA 1YUBA 2BFFB 1US8B 2IV7A 3EOAI 4J4TA 4K8OA 4Q82A 2ZS7A 3E3LA 3OF5A 4K6OA 1M34A 4RH1A 3S2UA 2QW0X 4NG4A 3GW2A 3H7AA 3CXUA 2YC2C 5I3CA 5CBPA 3TNLA 3UV6A 2AD5A 1NJ6A 3EYIA 1NNUA 2VUMJ 4XX0A 1O96A 2X2PA 4UFNA 4F91B 3GROA 1KHTA 4EMBA 2E34A 3TQNA 2W2TA 2XTJA 3LVBA 3PUZA 4U0JA 1GRRA 1PI3A 2DA5A 1G7CA 1Z2EA 1Q7BA 2BMWA 2ETHA 1N2BA 1H0SA 2GH1A 2HIGA 1QJ4A 4YT5A 4ZOLB 5MN4A 1C1DA 1SH7A 5DCYA 2P67A 4WH0A 4DR3B 1HSTA 5E8IA 2JHFA 4M0DA 2H1OA 3KYDB 4XOPA 3O3OB 5HZKA 1NH3A 4DA0A 3LMMA 5D84A 5EUCA 3M5WA 4BGDA 2YN4A 2RGGA 4XGIA 3OU6A 3WAKA 2YJTD 1Y34E 1YDFA 3PEWA 2FPOA 4YJ3B 4ZCPA 3OL3A 3W9UA 1OIWA 3L04A 2F59A 2TS1A 4UQPA 3TRIA 4PS0A 1W30A 4F60A 5EYRA 3JSOA 2FZ4A 4O2LA 3MPOA 1JTEA 1VLMA 5E2BA 4ZHQB 3DXXA 2EOAA 4IEIA 2JWTA 1HNZB 5IN4A 4M99A 2LKSA 4ZAVA 1NWCA 3WMEA 3TW6A 2AW5A 2GTIA 3DFGA 4HQMA 4OQDA 4BNLA 3L8EA 3H5AA 2HLNA 1F2UA 3QE4A 4TWBA 3EBOA 3NDIA 4Q9NA 4X7BA 4DCOA 5FBWB 1A27A 1FPMA 2EP5A 4FFLA 4YLGA 2OPBA 4YP6A 4CLHA 4TMYA 4PJNA 2HJHA 5JSZB 3ZD7A 3GGPA 2H8KA 5GPCA 3PQEA 4O4LA 2FAXA 3KOYA 1VIAA 2AZDA 1WSUA 2ZI6A 4M37A 4O4JA 3BMNA 1ZMBA 5T3UA 1U5AA 5TQ0A 4E32A 3KOZA 4BDZA 2O3FA 4I66A 4JZYA 3TLGA 5BWNA 2V7BA 3QVGA 4EHIA 2RREA 3VA7A 3KAQA 2DQSA 2I3BA 2PEXA 3GB9A 2EX0A 4FFMA 5E0OA 5JCZA 1K78B 2PBRA 4IDEA 2PVSA 2PFSA 1IWBB 1M76A 3G1WA 2QUZA 3CNOA 2PSJA 1GILA 1KA9H 4L8WB 5HQJA 5C4IA 3BR2A 3OPMA 5HKBA 4E5UA 5ITWA 1QCYA 5F5XA 2FRDA 3MZYA 1Q6YA 4X1IB 1QFSA 1KAQA 3CTMA 3AY6A 3PIIA 2HF9A 4NMMA 3FOBA 4MRPA 5CDFE 5BPDA 4GZ5A 1CRZA 3TQRA 3VZBA 3MW8A 4TMKA 1FRQA 2LUOA 1NVUQ 2KP6A 1BYIA 3B1YA 3PSAA 5BN5A 2FZVA 3T94A 3U0VA 1JAZA 5B7NA 1CLEA 4U6QA 2HFHA 5JZ9A 3QWHA 3ZDAA 4AUXA 3AFGA 4PFKA 4LMRA 3OO1A 5A7HA 1G18A 2ODTX 2G82A 1A9OA 5JCOA 3ZE7A 4WV3A 3ZTTA 2A3SA 4AG5A 4UU8A 1THGA 4A73A 4EGAA 3D5EA 3THSA 2PFGA 1MD0A 3FZQA 1FVXA 4EWLA 1OZHA 2Q5IA 1EU1A 3EF3A 4HATA 4TL6A 1P0MA 4DMRA 3FF5A 3ENZA 2Y05A 3CW8X 1QH0A 4KAFA 4GFDA 3O73A 1N32B 5EG5A 2KPMA 4G23A 3VGJA 4PSWA 2O8EA 1P72A 3KXKA 1M54A 1MB2A 2QYSA 1QHYA 2XKBA 1O94C 1GUBA 3FPLA 4OHMA 4E6PA 5LD2B 4KIGA 4D1QA 3DZDA 2DY0A 4C6HA 4BXOB 2VZLA 3O84A 1MQ8B 2IUSA 3LJKA 1G17A 4MWTA 3TRJA 1GSHA 2I3GA 4LMBA 1NZJA 1DKQA 1Y63A 3E53A 3G0OA 4CMCA 3ICWA 2KRHA 1M8GA 2A61A 2YW9A 4HZUB 4RA9B 4EJMA 3F6RA 3IKTA 1V7CA 5IG2A 4XLLA 4YRKA 2ZE5A 3X1MA 1N7IA 3IV5A 1H2WA 2E5LB 5LUBA 4UVIA 1OV6A 4NS4A 4MWZA 3VNAA 3E0XA 2LYCA 5K5RA 2R5YB 2LZ0A 4FUTA 2FXVA 4MS3B 1ELOA 2I4NA 3BQ9A 3ROKA 2JI7A 3IJ5A 3PHLA 5GAJA 4UW9A 3S29A 5L3SB 4GGPA 2ZPAA 5K3BA 1F2VA 2PZ8A 4ARZB 5LJIA 5MDHA 5HLGA 3A28A 3C5EA 4BXXJ 4TTTS 2Q2NA 4V0KA 1CQTA 3I58A 3MWJA 1JHOA 1U5TC 4G0ZA 3PJGA 3ABKH 1W52X 1K3TA 1NJ2A 3DZGA 1KR2A 2SKCA 1MW7A 1IIBA 2G9ZA 1KERA 4N0BA 1RTTA 3UMSA 1W5CC 2B3DA 1Y3IA 4IHYA 3B1XA 3BULA 5FOXA 2BH9A 5JZBA 1GTRA 2C96A 2K4BA 3K4BA 1SC9A 3LK7A 4D8WA 5CA1F 4LZLA 3E9CA 4RS4A 5JJCA 5IKEA 3DJYA 4HXFB 2G5TA 4IXDA 1QGOA 5FLKA 2P62A 4Y1GA 2OLEA 3RUHA 3U7RA 3SWWA 2FWPA 1I1NA 4JMLA 4QIWN 5CBKA 2OZEA 1M6HA 4KMRA 1M1XB 2R5ZA 4AURA 4KNYA 3BXOA 4BMPB 4ZVVA 1RZUA 4N9QA 4MROA 2MYSA 1B4AA 1JI3A 4XSXF 1GPMA 2WWXA 2GBCA 3DL0A 4KNVA 3JWIA 4WKNA 3GFMA 4AG3A 1GVJA 3BWDD 4O4JF 4LG0A 4XCVA 2WWYA 2MDTA 1WG8A 5K0SA 4DR6B 2O8CB 1UK9A 3G5UA 1FTQA 2ONYA 3GGOA 3KD3A 4B4UA 3S8YA 1PV4A 3W2FA 4OAYA 3MBIA 3KT3A 4GP7A 2MMGA 2ZE8A 1G42A 1UAGA 4QTZA 1XGOA 3D0SA 1FY7A 3QUQA 2VC1A 3ET5A 1SVSA 4YV7A 2YXPX 3GH3A 1E1QA 3KP1A 3EA5A 3IX7A 4U87A 4B3CA 3GCXA 2X4LA 4C05A 3CLKA 4E7KA 2R7MA 1WZEA 3BH7A 1WI9A 3IAAA 1XHFA 5H3LA 4BMDA 2GS9A 3S2IA 4CUKA 1RCUA 2C8JA 3UTCA 4FD2A 4NECA 4YQFA 2DI3A 5U4QA 4K9MA 2CLIB 4OB7A 5C4GB 4ZK2A 2FR8A 5LOVB 1R6XA 5AVKA 4C2BA 4DCGA 2FJ0A 3LCJA 1FWZA 1SHLA 3RADC 3K09C 4UZSA 1FMFA 3WL8A 2B30A 4H7IA 4DSNA 4L5IA 1RXUA 4O2RA 4PRKA 3FK6A 3JW8A 4NHOA 4TOIA 5DLPA 2BHNA 1LNSA 2WW8A 1PR9A 1E64A 1SKYE 4MUNA 4Y0VA 2C2MA 2A30A 1EB8A 2IHYA 3BWCA 4HEHA 2JZOA 4B8WA 3CUQB 3R5FA 3EDYA 2XVZA 4NX2A 4R9NA 4EYQA 3L84A 2ACEA 1RT9A 2AX3A 3ECHA 2OSVA 3ENKA 1FSGA 3WLRA 4CEHA 4F3TA 1WHSA 2XRFA 2BR5A 1MMSA 4H1TA 4FU0A 4P0TA 2AEJA 4R1SA 5ICSA 3OUUA 1DV2A 3EUAA 2D59A 5HLHA 2XXJA 5T41A 5C2JB 2Y0PA 3O2QB 2QD3A 2HRQA 4EMTA 1YDGA 1M7GA 1C4XA 3N7UA 3FVQA 1QIKA 3EC1A 3MCVA 2B4RO 2FLVA 1BCSA 2YYAA 5IT4A 4ASUA 2HF7A 4ZYDA 1PIWA 1OBVA 1RHKA 3K8OE 2JHGA 3Q41A 2G08A 3QMVA 5DRYA 3WB2A 4DCUA 2L7FP 4IUCS 3W1EA 3HUTA 1ULBA 3LSIA 4PLGA 3FH0A 3H8SA 1OT5A 5BV0A 1WZCA 1XYGA 2O50A 2C0QA 5E6SA 4EGZA 1GPAA 1OA1A 1XJQA 2LDBA 1PJTA 3L9FA 3UMFA 1TE2A 5LJLA 1HSOA 2F8TA 2IKSA 4RZ3A 1Y8ZA 2K27A 5LBUA 5K0JA 1DBPA 1Y6RA 3LSHA 2E4WA 1JW9B 1PX0A 3WDSA 1RYEA 3EF0A 4RESA 4XGNA 3ZDBA 5LVAA 3MD9A 2R00A 2IF0A 3KVYA 2ZJ2A 1QIIA 2GSWA 2R84A 4Q3KA 4I3FA 3KHKA 3SFTA 2CVQA 3T3EA 1RCFA 1HL7A 1E8NA 1UKZA 4PXAA 5FJJA 1BHJA 1AO0A 4NCJA 4L5CA 4YWHA 5F2OA 1CQPA 1Z5UA 2H06A 3IT0A 4DQVA 5G1NA 3FGPA 3N2YA 4UE2A 1POGA 1MO4A 4L9SA 4HAMA 3V4RA 4NBSA 1XQ1A 1IK4A 2A4KA 4S2UA 4UREA 4PCLA 3WB9A 4PANA 1XD7A 4YALA 5BSWA 2KIMA 2C2HA 3LA6A 2PT7A 4RPKA 1BFKA 4MRSA 1KDTA 4YUVA 3H5OA 2IUFA 221PA 3VZPA 1Z35A 1G3SA 1BFUA 3HNOA 4IOKA 2R96A 2C5FA 4ZQCB 1ZK8A 2TSYB 5AOAA 2DDBA 5BQPA 1T4CA 2IH5A 2REBA 3GBGA 2WIAA 4L18B 4R84A 2P0WA 2NYRA 4BNCA 2GN1A 3DDUA 4M1KA 5FWYA 1DQNA 1BE8A 3W7BA 3A1NA 2ADFA 4UNRA 2BFCA 1GT6A 2Q6IA 2QD1A 2NU7A 2QPLA 2X4DA 5HKAA 1SQFA 4QUKA 3SJBA 2E21A 4KOEC 2YWHA 3MSXA 3RYHB 4CQNA 3HUDA 4IYRA 4CL8A 3PPYA 5FBHA 1T91A 4L78A 1X1DA 2ZWIA 3K2QA 3A3PA 3HCOA 4ITUA 2VBZA 4NAHA 4RJTA 4DPKA 3LHKA 3EG5A 3JQDA 4P98A 1VYTA 1YRYE 2A59A 2HK9A 3PDWA 4I8XA 3GJQA 2EZ8A 3OY7A 4V03A 4WAUA 3WGOA 1YVUA 2R7WA 4B4KA 2GCOA 2EX1A 4ZTBA 1U1EA 2QNIA 3IDQA 5EJEA 3MFYA 2PUCA 4KIJA 1TEZA 1KAOA 2IHUA 4FUQA 4LX0A 3K4JA 1MIOB 5KKAA 1UDBA 5EJGA 3Q40A 3CWCA 2IA2A 4KTTE 1WZNA 1XTBA 1MA0A 4MK4A 1NYTA 1VHWA 3BT7A 1RRGA 3N53A 1EVYA 1WA5A 5F4ZA 4G5GA 4BVKA 4PSVA 1HKUA 3EHDA 4XKBA 3GLUA 4JNCA 3CVYA 3N70A 4TQ9A 1QANA 5B12A 5C51B 1VXRA 2XUJA 5K8LA 1P0PA 2ZJ0A 5JRJA 2GJ9A 1ZZGA 4MLZA 4CU2A 1UMQA 4EGSA 1JPVA 4QDTA 3T3NA 1YZUA 1NMXA 5BW6B 1X92A 2XNKA 2IZ6A 2YMMA 5JMTA 1TM4E 2B4YA 3LBHA 3KOUA 2CF6A 2EKZA 2KQUA 1NATA 2FFBA 3AXSA 3LT2A 4LJRA 2PBIA 3HB0A 1Q1HA 2D3WA 1TEVA 1QK4A 2BDTA 1BXRB 3G13A 3HI6A 1V4NA 1Y1RA 1KY2A 3L7NA 3LOPA 2R44A 2YR0A 3VODA 4P5DA 4YMWA 1WXWA 5CW1A 1OU4A 2WTUA 5KHDA 2Y4NA 1TM3E 3LIIA 4OI1A 3AF5A 4YH1A 2N42A 4HWOA 2GK6A 4GU5A 4RKEA 4QUBA 5LMUB 2F4OB 2WB2A 4ARSA 2QQGA 4KIUA 4NCBA 1D0ZA 2IRWA 3KALA 3L8FA 2JLZA 2XCIA 2OCYC 4WACA 2PWAA 4IIYA 1NUSA 1F6BA 1SD5A 1EVLA 1SZPA 1MR3F 2J3DA 3L05A 2Z5UA 3M0EA 5GJWC 5J1TB 3SF8A 1I36A 4CIDA 3O8GA 1MA3A 4LGCA 3SSOA 5JJLA 2G9UA 4WXEA 3HB9A 1DC8A 3GEHA 2ZCJA 1SVLA 4FQGA 4TN1A 3HDJA 4D3FA 5GADl 1MDMB 4GWLA 3V1YA 1H0KA 1QGUB 4WHMA 4JJ8A 4YAGA 1O95D 5K3OA 4KQFA 3V6LA 4BJ3A 4RHXA 1W4RA 3NJRA 5JANA 3JAKB 5ADVA 2SCUA 5L7WA 1Y81A 3VNSA 2DR2A 1S2GA 4D82A 1L0BA 1SWVA 1JFLA 1W85B 1YO6A 3CT6A 4Q03A 2Y31A 5K2OA 2HQAA 1I2CA 1O3SA 1HKHA 1DO2A 2AN3A 2OB1A 4M9UA 3EYAA 3HCEA 4WVFA 1OYWA 4PU0A 3S8MA 3A6LA 3HJUA 2Z5GA 4E2ZA 1FBNA 1Z9BA 3NLLA 4UB6C 4C20A 5AR1A 1K78A 1WU8A 1Z4MA 2VJNA 3ANNA 3ZV4A 2HBRA 4NXMB 2CUNA 3KS9A 2AC4A 4L9VA 5M3MJ 3THWA 2OCPA 1S96A 1Z4PX 2Q1UA 1DC3A 2HN9A 5KVCA 2AN5A 3LI2A 5COAA 3ZY6A 4B43A 2DX7A 4L8FA 1POXA 3PC7A 4UE6A 5D6OA 3KXLA 5AP9A 3HKDA 5FWDA 2HBQA 1MMDA 2ZJ3A 3CH4B 4PCVA 1ONVA 1RM0A 2ES4A 4X94A 3KM0A 5K0ZA 1QTNA 1CUIA 1IN5A 1SAYA 1LTKA 1RHQA 1R8JA 1VLVA 3DEEA 3L0SA 4H2DA 4XW2A 2O2DA 4IKPA 1YKFA 1ZSVA 3MAAC 4GEGA 4AMGA 3JPWA 3M4JA 5BN5B 5FR2A 5KO2A 5E3OA 4KX5A 2DW4A 4FB4A 1NVBA 4CF6A 1EXMA 2I7DA 3CKLA 4H7HA 4MEAA 2VQLA 3KZ1E 5AM5A 5HUQA 3WBJA 1MD9A 3QX3A 5IAKA 3WMFA 3V8EA 5HZMA 3DT6A 3W6VA 2DA3A 4M8NE 5HDGA 3IRRA 1RRJA 1JBQA 1TYBE 1U2WA 1W25A 2JH3A 3NTUA 1X7GA 3QW2A 4NBRA 5KTYA 4DQLA 1QLWA 3CCQI 4E5PA 4ZT3A 4TMVA 2TMDA 4DLRA 4YLYA 1XYYA 3F5QA 3GH1A 4FYKA 5DYYA 5JAZA 2P30A 4ASUD 3FWEA 2AF4C 3GLQA 4N7BA 1L7BA 1FZTA 4BVHA 4Z9YA 5C37A 3CRVA 4CM5A 4LV8B 2HYJA 1QGPA 4X91A 1RYMA 2WIKA 1V25A 4PSXA 3R23A 4OHFA 4EHHA 1SY7A 1BIAA 3OYFA 4G6QA 3N2GB 2EU8A 5FEMA 3SYNA 4X6AJ 2X2EA 2YQ5A 1FTGA 2RCYA 1YAHA 4D57A 2AS0A 3A3YA 3OKCA 1MHTA 4XLNF 2Z5FA 1MJGA 4F4CA 4BNKA 3AF0A 4TSRA 3RVBA 1RVV1 4KWEA 5I9LA 1AO3A 4TL9A 4C7KA 1XEWY 1WD5A 8MHTA 3VYVA 2P5KA 1CE8A 3G3ZA 2ZB3A 4XWKA 1YF3A 4B5LA 5KYXA 4DV2B 3LQRA 4LRQA 3BJIC 3U09A 1YRAA 1A8SA 1DQRA 3HBAA 5IT0A 4WX2B 4BCBA 3DF9A 2VNAA 3IR6A 1HZZC 1Z0JA 2Q9AA 1Z63A 4A12A 2PK3A 4NFLA 2VUUA 1SQ5A 1ZQ9A 3KZXA 5AKYA 5EF6A 4XRMA 3A3NA 3GWZA 3K4NA 2QAJA 3NG1A 4RHFA 3FPEA 3P71T 4FDMA 2VQDA 1NQTA 1T95A 1ONOA 1V6SA 2GNAA 2XNHA 4QD3A 1AN0A 1E9FA 1CQIB 4ZO9A 5T57A 5T4EA 2D2XA 3FDZA 2E48A 3GMIA 1JMYA 1Z8FA 3SXPA 4NKRA 1BWQA 3NM5A 4MPPA 5AQ1A 4M0KA 4H9GA 4ZZ0A 2DMTA 1FJXA 2P6OA 4HSTA 4OSOA 2NZJA 5KWEA 3K1NA 1GQOA 2F64A 3BZWA 3WWOA 1SO8A 3CEHA 4MI9A 5B58C 1Z4NA 3Q8LA 4G01B 1I5ZA 2FNPA 4ED9A 1YG2A 1JQKA 1LW7A 3V8NA 5AUOB 1R66A 3V8RA 2OGWA 1WH5A 2QMUA 2HIAA 1G3IA 3BDAA 4RFLA 4J3NA 3TM4A 3KR2A 2HQNA 2AI2A 4MS1A 2C4VA 4LOAA 1XZPA 1K5DA 4AQYB 2BFFA 1ZA2A 2EBHX 3JQPA 5EUBA 4NU0A 5KJ6A 3AFMA 1AWCA 3BD9A 3FTNA 5CXSA 4HDQB 5F78A 3AF6A 4UE3S 4CLOA 3IAHA 3RRMA 5AW7A 3SK0A 4KMUX 3HZRA 4W1UA 4EG4A 1SCKA 2QE7D 2Z0MA 5D7BA 3BP8A 5EQFA 4A9AA 1ODIA 5LL6P 4G85A 2O8BA 2B2NA 3DQQA 4B79A 1BWSA 4WXCA 4NOKA 3FBNB 1F6WA 2JCXA 1I27A 3L0PA 1RRKA 3IV7A 3GTMJ 1TLHB 2Y1CA 3DZFA 3H83A 3Q0IA 4MIYA 2MLKA 1JR3A 4QOSA 4DKJA 5EZGA 3L5OA 5L3SA 1I4OA 2JLUA 3HFSA 2WAQN 3A0BC 1PS9A 1Y5IA 2PN6A 4K6KA 1PVOA 5JY6A 4BFZA 1OXVA 1X1AA 5CK5A 1E3HA 1L7AA 2WZDA 3AR2A 1D9ZA 4MDYA 5ALYA 4NU5A 3C0KA 3DONA 3E5NA 3NHYA 3UXMA 3NYRA 4A0FA 4DIEA 1N8TA 2V58A 3BCBA 3IXLA 4Z99A 3QU9A 3SXUA 3TUZC 2QRZA 2ODPA 1KNXA 4AVYA 4F9GA 2WAFA 1FBQA 3EA4A 4G9YA 4DSUA 5I7EA 1BH2A 2JAPA 5C3MA 4P7JA 2Q2WA 1DXQA 4LHXA 8ADHA 2DLNA 1CF4A 2JA7J 1TKAA 3O1JC 4PHFA 2VDPB 5LLQA 4WI1A 3I2KA 2NX2A 3ZX5A 3PF8A 5KX5F 2JCSA 3U3ZA 3UCFA 3ADDA 4I02A 1XTSA 3OJ0A 4DIDA 1Z4QA 1CNFA 2EIHA 5F3DA 1GUZA 4C4XA 4F4JA 2NYUA 3NC4A 5C5EA 2GQ0A 1J5PA 2AT1A 3CQ9A 1XMIA 2BAGA 4XICA 3OOSA 4A1OA 1MHPA 2QORA 2A0FA 3NUQA 1EH6A 1TU3A 2FX5A 3SOPA 3T7EA 5CW2A 4HK4A 4HOYA 1IG0A 4KXXA 3STYA 4BFYA 4Z1OA 1UOQA 2B98A 1JI0A 2LRDA 2IVFA 1JHZA 1CQIA 1HH4A 1U0HC 4UMFA 4N76A 1EG7A 2AG1A 2FG7C 5F0FA 1W1WA 2AZMA 3QELA 5REQB 4GKKB 3AG4H 5EE1A 3KT0A 3L9XA 3UN1A 3ZX4A 4X61A 1FNMA 1RJDA 4LVCA 3K0SA 1CHDA 2JARA 3L1JA 1X58A 2XAAA 1R6UA 1HY3A 2ZCVA 5DTRA 2TECE 2GCGA 3M6IA 4KIFA 1LEAA 3KB6A 3RYIB 3FYUC 1YFLA 2G1PA 4K9QA 5A71A 1NGSA 4HV4A 1AA7A 3JR7A 3P9RA 6CHYA 1UAYA 5I7OA 2FUG6 2PLWA 3CW9A 1AU7A 1ZRMA 4Y7CA 1RKQA 4D8YA 2ON6A 3Q87B 2OAQ1 2BZGA 2OTCA 4ZT6A 5H16A 1UBTS 2DFVA 2KIFA 4M21A 4KPFC 2PKYX 1ETQA 4BHPA 1V4VA 3PKJA 3ZBUA 3UR3C 1CY7A 1XL1A 3JZMA 4ETWA 1I8TA 1KAMA 2IA5A 3I6ZA 1M2KA 4GVLA 4X1KB 1DV1A 5AVOA 3PFIA 1GHTA 3IALA 4YP9A 3ZBPA 4J7XA 2X0KA 3L46A 4B4WA 4DG9A 2QSFX 1ZWKA 3PNQA 5K51A 5F7XA 2HOAA 4X60A 2F17A 4KXMA 4NENB 3E6DA 4IMPA 2R66A 3VYTB 1VSTA 1F5TA 3DMFA 1G7RA 3GCGA 3H42B 4DDTA 3KR1A 1R4MB 3FHLA 5L4NA 1YXMA 1GIAA 3ZPXA 1QGYA 1BS2A 2OO7A 1OGJA 1BI2A 4KP7A 1O6FA 1PL8A 4DE5A 3R3XA 5CQEA 1UWCA 3MRTA 4WZAA 3T9DA 4LY3A 4UV9A 2YNMA 3BMOA 3GCWA 3O1IC 4C06A 2LK2A 2PGLA 3CGGA 4QUIA 1C30B 4ZPJA 3GVCA 4IF6A 1OLXA 4QIHA 1KI3A 2YUIA 3OBBA 3K71B 2GF0A 4I9NA 3GPLA 3G2KA 4BGEA 5E6SB 2NVTJ 1RJGA 1DDGA 1WR8A 3WLLA 4DNXA 4DC1A 4EHKA 1MW9X 2WKSA 3ZQ7A 3BXEA 3KZMA 3FKJA 1S4MA 4TT3A 5CNKA 3I2FA 4CLXA 3V2HA 2O3UA 1RMTA 2M0CA 2YYYA 4Z6KA 1IJWC 5CTJA 1FP6A 2O9JA 3GFVA 4UNSA 2NNLD 4BHCA 3NBUA 4ZC3A 4IQFA 2NOAA 3PQ5A 4NPHA 4JLUA 3JZDA 5HKLA 1M2FA 4DQ0A 1MX1A 3GBSA 3LDHA 3NYWA 3ZY3A 3BTLA 1FLAA 4Y2QA 2AQEA 5B30A 1VYVA 3FI9A 1W35A 4JOQA 4ENTA 5L4LA 4JBLA 2WUFA 3SYKA 1CR6A 4J9UE 4BZXA 3THYA 1RZRD 3KQPA 3SEQA 3JVDA 3H2HA 3LAPA 1XMJA 1XTRA 2JGNA 3FTPA 2PU5A 4YRMA 4WEQA 2EL9A 1AN9A 2CWEA 1CYDA 2QSYA 2WJHA 2WTMA 3QVKA 3EFEA 4I5FA 3PU6A 1KY5A 4J75A 1KRWA 1KO1A 3NNSA 5JHGB 2BTOA 1K9SA 3OLQA 3VB2A 2AG8A 3OF3A 1O57A 1X2MA 4KQEA 1SC1A 1RP1A 3ZQQA 3RIYA 4G0WA 1BR1A 2QTMA 3V7YA 4M0LA 5ALSA 2PE5A 3ZHCA 2ELHA 1SQGA 4BQPA 3TOZA 4HV5A 2GEUA 5GM2A 2K6GA 1R8XA 1RLOA 4GPAA 4MWSA 1LRLA 1GR0A 1VLLA 4RDIA 3BMNB 4RK0A 4U63A 3RYHA 2YN2A 3WJ1A 4B8ZA 4GLLA 3EZ9A 4GR5A 2C7OA 4RPIA 3T4UA 1XMOB 2C92A 3EDCA 1U8RA 1JJ6C 1U2GA 3MUOA 4RGVA 4LF9B 1EFRD 1ZCZA 3RDPA 4AMZA 2YJZA 1B0ZA 4DABA 2H48A 1BXKA 1OLUA 3OZBA 4EH1A 2HLPA 3BTUA 2VNIA 3IUYA 1VIYA 1WXEA 1Z2NX 3GEZA 1EJBA 3TTXA 3ZY4A 4M74A 4R0NA 3T7KA 1YACA 1LDNA 2GIZA 5ILUA 1HDIA 2V03A 2XT0A 4OBXA 1P5RA 3BM5A 3FMOB 3OICA 5A3JA 4N6NA 5KYVA 1C3XA 3CF4A 3L6CA 3WV5A 5JCPA 2EV5A 3D8SA 3TSAA 1G2IA 4MDHA 1QGAA 4PZUA 3JYLA 3FYTA 1Q1NA 2VWQA 1SRQA 3DLIA 3ONVA 1IC8A 4WLNA 2VCEA 3PDIB 4EB3A 4QPOA 4TM7A 3V7WA 3RUDA 4OEHA 3I39X 3CUVA 4TRJA 4ENSA 3H2SA 1IOZA 4HR7A 3A02A 1YL5A 3E27A 1HFWA 3QPBA 4TS3A 3OUTA 5IAAA 3BHIA 3PGKA 4KQGA 4D45A 3DVAA 2AS5F 1P2UA 4FDAA 4RXUA 4YCAA 1GUYA 3CG4A 5AM4A 3B6CA 3GFQA 3VUEA 1UT6A 1XP8A 3PQKA 4HH3C 2HQ5A 2K7ZA 4PLFA 2PZEA 3IIJA 1PJ2A 4K2HA 4Q5IA 4DZJA 4QECA 1N77A 3WK7A 1A4IA 3GDFA 2Y0SA 3ULQB 2A5DA 1CVIA 2W43A 1ON2A 3N2NA 5FRDA 2WHXA 4Z1MA 3J80Z 2R7OA 3B53X 1ND6A 1X8LA 3CU5A 3AF4A 3PHIA 1NM5C 1XTUA 5GGYA 2FETA 2EZIA 1KOLA 2AFRA 3O8LA 3RI3A 4BEWA 4CIYA 2V8OA 3SQNA 3MHTA 5FD8A 3AHIA 1EWRA 3GBPA 3B5IA 1CCWA 5KTPA 5MGNA 1YRNB 1XCJA 2GEFA 3EEBA 1W88A 5CX1B 2HT1A 2HEIA 4KA4A 1I6LA 3NWPA 2B8NA 4U0KA 1YOVA 1EM6A 1ZRHA 4HB3A 2RGXA 3PO2J 4G0PA 4PIMA 5LXTF 3BZKA 3VC1A 1WCIA 4GM4A 4U7HA 5IDQA 1V45E 4ZANA 1B15A 2VF4X 2PKCA 3O7MA 3CS3A 2ET6A 4KDRA 2E19A 1IZ7A 4HN4B 3WTSC 4IIFA 4OHCA 3OHSX 1UBKS 3B7WA 4C3ZA 1KMQA 2SCUB 3IEKA 1AKVA 3KLNA 2C97A 1N3LA 3QFCA 2JMWA 2A1UA 1D3AA 2G0NA 3RJZA 2DYSH 2OP0A 5E3HA 1T5HX 4A5OA 1GNTA 1L6RA 1YVEI 2O1EA 2PH3A 1NDUA 2WJIA 4EG5A 2W2LD 4V0LA 1SCUA 2H2AA 4DDUA 5HQ3B 3CVXA 1SXPA 4WKGA 2CU7A 3M4NA 4KN4X 2VHXA 2BKAA 2I1VB 1L4KA 4QRIA 2QY6A 3NR2A 5HW0A 2QRUA 1NLYA 5K7FA 2FZLA 3EFOA 3IIKA 1J0XO 2PJZA 2UDPA 3O2JA 4I55B 4N4OB 4UVBA 4GZMA 3LCUA 2Q2QA 3P8ZA 4Z0NA 3BOSA 1D8KA 2I8AA 3D8BA 2VK2A 5J8CA 3EK2A 3L8MA 4R1NA 2PXHA 5AI8A 4BNNA 4Z9FA 4EB8A 4PHHA 3NKVA 4Q1AA 1OCCH 3SYMA 1G59A 2B36A 2ZUWA 4G8DA 1NAIA 3GP8A 3I9OA 3DPTA 3KBBA 4UARA 3R0JA 4Q4CA 2P6RA 1QTIA 1SC4A 2YCLA 4J2HA 3DNFA 1ENHA 1NHWA 1RC1A 2W2KA 3FYCA 1RBQA 3HLTA 2O4CA 4IV8A 3RSSA 1T10A 4W5NA 5JJIA 4IIVA 1IMJA 4CM1A 3COPA 5LWQA 1U1CA 1FDTA 3Q88A 5KAPA 3SZ3A 4NCIA 1NVGA 4Q39A 3VOTA 1DCTA 3ZY5A 1NAHA 4UHJA 3PE4A 3HCRA 3SHVA 3TW4A 5BN4B 2VJ4A 3GFBA 1E3OC 1SHUX 5F2NA 2IVZA 1SZDA 4A82A 2R0QC 1NK3P 4NYJQ 2X8LA 4ENRA 1VFNA 2MLGA 4UULA 4KR0A 5AW6A 4B71A 4WZZA 2JTVA 4DNOA 4HOBA 1IUFA 3NEUA 4CCNA 1H0MA 2HYGD 1KMMA 5DW3A 3L2RA 1GV2A 3V6MA 4YFVA 4XTCS 3U3XA 1G98A 3CBGA 4OI4A 3ABTA 1PYVA 3IWFA 1XXHA 1E4OA 3RSFA 2NWQA 4F12A 3KPWA 4B83A 1FOEB 5C35A 4XMYA 3BTJA 1HYHA 5EMJA 5DLDA 4G4IA 2A88A 5CRIA 1OBFO 2G7MC 3C7KA 4F5ZA 2DH5A 5JO0A 3GU3A 2XGGA 2XOEA 4ND7A 4I4LA 5KQMA 4J6FA 2EF0A 3SLRA 3TPCA 2AHQA 4ZVKA 2JGLA 4FW9A 5IC4A 2ZAGA 2PSDA 3MWEA 1EX6A 4A3GJ 1CW2B 2ZSEA 2IK8A 1MBFA 3HJEA 3RT9A 1W94A 2D7DA 3U80A 2GHRA 4GYGA 3JVVA 1D5WA 1PR1A 4NAUA 4PG8A 2YFYA 1QOQB 2MA3A 2BONA 3T0IA 3F71A 4E46A 2XCQA 4ZRMA 2VOOA 2B78A 2XA1A 3R7FA 4PXYA 3T1HB 3E5HA 4MV4A 3GEMA 2Y0CA 3BWMA 3B89A 5AMXA 2ZW9A 4R79A 4MWOA 4POOA 2Z9DA 5JS6A 2F4VB 3LIPA 3MKLA 1JLLB 2ODNA 3HUFA 1EP1B 3Q11A 5DK6A 4AX8A 5IXJA 3CVVA 3DWEX 1FQKA 4QM7A 3QNWA 4KVZA 5FTWA 2K86A 2A67A 1ERDA 3D4IA 2REXB 1R8YA 4MUHA 4RC9A 4LRYA 4G86A 3WIOA 5AVZA 4QULA 2APJA 4GMDA 3CLOA 1U3GA 4UUSB 2BEKA 2GBLA 3CCYA 2UUOA 2HWKA 4JUFA 3F46A 3L0YA 3KLBA 4MW1A 4AZ0A 3IIMA 4MW6A 1MZVA 1GU7A 1MC5A 2ZUVA 4C7MA 4OQPA 1KEZA 1QIFA 1L4NA 2F4IA 1U0TA 1BR4A 3H2BA 2H07A 3A36A 4GSLA 3WTXC 4IH1A 1YE5A 5KKCA 3HSRA 3VNUA 2QL5A 1PV2A 4TGLA 4Z4QA 1TMGE 4PN7A 4XB2A 2CSUA 2WDZA 4E15A 2ID6A 1L3LA 2ZOSA 5JLXA 3MGAA 3LTEA 2ZIGA 3BRSA 1ENPA 4PY2A 2IEIA 3TRDA 2XXBA 3WGYA 4LC0A 2QE7A 3OHPA 5GOZA 5DV9A 1K6EA 2Q6OA 3DV8A 3AW8A 3P4YA 3OIGA 4IRXA 5B6IA 3FDYA 3OD5A 3ZOBA 1QR6A 4TN5A 1C9EA 1KA8A 1CF2O 2FOXA 3W5HA 1B0UA 3CCVI 4NHJA 2I80A 3DTTA 3IL2A 3NUZA 1ZI9A 3EE6A 1PFGA 1FNCA 4U6NA 2DWPA 2F1JA 4O8CA 4Q3LA 4NBVA 1AG9A 3L93A 1MKYA 2H0QA 2IEYA 3STHA 4BRUA 4BEHA 3VSAA 2DT5A 1JH9A 2NT3A 1CJSA 4WGFA 1BA3A 4E7IA 2EQ5A 2KPOA 3HSFA 4Y15A 1BOFA 1F1BA 2JASA 3EGDB 4O1MA 1UKBA 2AQ8A 3GI1A 2JL1A 2X3UA 1H88C 2R6ZA 1T2KA 4FGKA 3NPAA 4Z3DA 1SC6A 5HTOA 4J3JA 3NEAA 4JUAA 4MVWA 3T9AA 5BRNA 1L5GB 2ZQYA 5G1OA 4MV3A 4RD1A 1MSEC 2W57A 3K4HA 4FN4A 5KSZA 3RJTA 3HNRA 4A2CA 1PNQA 3SYTA 1HE4A 3BA6A 2JLAA 2NU6A 4JELA 4YQZA 1E79D 4PQEA 2CNWA 4DDHA 1AQYA 3DKWA 5B5EC 1LPOA 4JXJA 4JYMA 4B46A 3DLBA 4I0BA 2GO7A 1DSSG 1MRSA 2Q46A 2LFBA 3MWDA 4ND8B 4YJHB 1DG9A 3VI4B 3R7DA 3NWOA 5SY6A 1OH6A 3MAGA 4MS3A 4P34A 3FKIJ 1UFKA 2NSJA 4KQ9A 2M1ZA 4BY1J 2QG6A 3OFSA 2LVSA 4D26A 5TEVA 1JSRA 4P4NA 2GBFA 4ZIRA 3HFRA 2GZWA 1L4UA 3EVEA 1DKMA 3QV1A 2FCRA 2PRYA 2NN3C 3A1YA 3X1XA 1NVMB 3UHFA 3M1AA 4JR2A 1PRYA 4PC6A 3WOVA 3L77A 3BF7A 3KVRA 5BSVA 4FWBA 1R9TJ 3FMSA 2VRWA 3LHDA 2JA2A 2GLTA 3FD8A 2JLYA 2WU3A 3NCTA 2P7CB 4JC0A 5DX0A 1XRRA 4Y2JA 5K0EA 1MBJA 3Q7EA 4PE5B 2QCOA 4ZK6A 5JXIA 3VVLA 1VQ4I 2PMHA 1BDHA 1SBZA 4MAAA 1K83J 1J39A 1AHDP 3OYKA 4GRDA 4DY4A 1YRHA 1FOWA 2G7UA 4LK0F 1UBMS 2OC9A 1Y42X 4YXWD 9ATCA 5E1OA 2E2WA 1E17A 2G17A 2AOUB 2G67A 1D07A 3BSFA 5EGNA 3U60B 4FYPA 1T6NA 2Q8QA 2RJOA 3Q4GA 1MABA 1J90A 1ZINA 2QR5A 3BEOA 3VX4A 3RTDA 2RK3A 4AD9A 1W4ZA 2OORA 4WEOA 1WY7A 1ZEMA 3AL3A 3LPAA 1Y5LA 2VPRA 1KYQA 1L5HB 2I2AA 4FD3A 1AA9A 1AMOA 5IYDJ 1WCWA 3TQTA 3RIHA 1A9XA 1E4VA 3WDMA 1GKYA 1CQXA 1UZLA 2EXXA 3A6KA 4YAFA 1U2PA 2PKQO 3DVRX 4YUYA 3UAWA 3UFBA 1U28A 3R7LA 2LNDA 4UVEA 3U6BA 4FZVA 3X2QH 4XWTA 4XVCA 5GJBA 3P45A 3LRTA 3ONNA 3OX3A 2AE1A 1WRJA 5TQJA 5DSZA 3U4GA 1DU4A 3JYHA 4N9WA 4HWRA 3KT8A 4R1UA 5ILSA 1U0LA 1MBGA 2ZJQF 1F1JA 3Q0TA 4PFSA 4BJHB 5JJBA 4J7AA 4F4HA 1UZAA 3E8MA 2XXAA 3AVTA 1LDJA 1H1TA 3CRQA 1F4PA 2I4IA 1QRUA 2NO6A 3D5TA 1GCUA 4BNFA 1NV9A 3KKPA 5DTMA 3VAZA 3EN0A 2C2YA 1RC0A 4IZHA 1WB6A 1JLSA 5JS2A 1P3JA 4FX0A 4YK7A 4MRRA 3BGSA 2FWIA 1I01A 4XJSA 3A4LA 1BMTA 1QS0A 1WLSA 2Z2XA 2XUFA 3EZFA 1ZVMA 2XB6A 3GEPA 3GD5A 3QHPA 4R8VA 1ZR4A 4RBNA 4X95A 5G02A 3RSZA 4JBIA 3C3YA 1NN5A 4A3KJ 3GL9A 3QPVA 1SKAA 2BM8A 2VJCA 4JXKA 5I9SA 1KI6A 1IATA 5FLEX 4YRCA 5D3MA 3WY9A 3E82A 3BKWA 4MUAA 3VU0A 4YCSA 5L3QB 3S1RJ 5JSKA 3FROA 5A4MS 2X86A 4FBLA 1NW8A 1FZQA 1K6IA 5J4VA 2YWRA 1GNQA 4TXHA 5G41A 1OCOH 5FBRB 3EPLA 2I3DA 2IA0A 2VKHA 1KH2A 5EIOA 3VOAA 1JEJA 3PFFA 5C8YF 5CAEA 1Y8CA 2J0QA 3TGWA 3ST7A 1M1YB 2YVKA 1Z36A 4WCVA 2CJXA 3HKBB 5FULA 5EOVA 5EQDA 2ZXIA 5MGBA 1G8PA 1H69A 1FUEA 2ZUUA 3EVZA 5KC8A 4HEQA 1EFAA 4DUPA 4KDCA 3V55A 1HLDA 1A0OA 3OZSA 4JLBA 1IQRA 5FTNA 1OFIA 4J0CA 1G4HA 4F6RA 3FYHA 3AJ9A 3WGGA 1QWOA 3F72A 3NEJA 2CC2A 3OFNA 4KVGA 4ZP1A 5EXPA 4ARVA 5IT5A 2Z58A 2M6RA 3MB8A 1A6IA 3O90A 3ZEAA 5C1OA 1EXDA 3K0LA 2PZJA 2KDOA 2CNNA 4I1RA 4FT8A 4JBHA 1E2PA 1UPAA 4KK3A 3GLXA 2PD4A 4A4DA 4DA4A 1DZIA 2R7QA 3IEVA 3AOEA 1DG1G 3HBMA 3WYAA 1S2MA 5JAUA 4E5KA 1QK5A 1WDTA 2NGRA 2WD8A 4Q12A 5FBZA 1NVFA 3SN6A 5I51A 3A03A 4AX4A 1R3UA 2CFOA 1L7QA 3DKKA 1J25A 3MINA 4KR9A 4EA9A 3B82A 3ABMH 3I0NA 4M3GA 4OMZA 2IHTA 2J5XA 4MRMA 1P4SA 1TIKA 6GPBA 4QJ4A 3KUDA 2GEBA 3DKRA 4MVCA 1N0UA 5BUSA 4W9MC 2OBYA 5H83A 3FXLA 5BW5A 3C7DB 1Z39A 5AJUA 1X14A 1TC1A 4JBWA 1IXZA 3D4BA 4P3OA 4UNNA 3W4KA 1YW8A 4DBQA 4AJKA 1JHYA 1JIUA 3BIOA 3NHJA 1CDOA 3LBFA 1H1DA 1IXSB 1EQAA 4MTCA 1PG5A 1X3SA 4QARA 4F9FA 1VG1A 2F2TA 5JFTA 3FG9A 3SJMA 2CUFA 1Y7TA 2QJRA 4QJ5A 5DWVA 5J2UA 1WJEA 2H8WA 4QBTA 3TBFA 4AIRA 5KIAA 3KFLA 2PTGA 4GZ3A 4HMQA 4LSWA 2FPIA 4WFIA 3VHXB 4UDOA 4UUAA 2BMEA 2A58A 2UUPA 3ET4A 4Y6SA 3THXB 1E3EA 1NY5A 4PYKA 1FYWA 4ER3A 2FW7A 1G6HA 1V3UA 2HHLA 2XUOA 5CCEA 3V7RA 1MRNA 1E1RA 1NUPA 1VKJA 4MWGA 1DIAA 3GVAA 5AHOA 4GM0A 2W0SA 4NJEA 4OFXA 5ERYA 3OEHA 3DCYA 4ISBA 4RPJA 1B72A 2YXEA 3HP1A 1OR7A 4EX7A 4KAAA 4KLZA 1BDIA 4JUCA 2QHXA 1TZBA 2X77A 3A7EA 5FPYA 2ONJA 5DBHX 3L92A 1HFJA 1NBAA 3JRDA 2BHRA 3OYGA 2W4IA 4Z9AA 5HLIA 2WPDA 3S2FA 1P4WA 3M6LA 5DYWA 4C7VA 2BGLA 3V7SA 2MSEB 4G89A 3IP8A 4GQAA 1T2CA 3QI7A 5SZIA 4XWAA 2HXOA 2FCAA 2XWSA 1K7XB 5EZHA 4A3SA 3C5VA 2YJNA 4FIZA 2DG2A 1TWFJ 3EXIA 2I8CA 4CMEC 4E4RA 5FF9A 1CF7A 5TVKA 3KJIA 3SJUA 1KO8A 1DBSA 3A9CA 3CNEA 1IRIA 1ZY2A 4GBMA 4RCZA 4QHTA 1DX9A 1OTYA 1WJGA 1ZJZA 1YE9A 2CQ7A 1U8TA 2VHQA 3BMCB 3I2IA 4CHTA 1D0VA 1II8A 3T1VA 3FOFC 5CFNA 5CFPA 1W5FA 4UBMA 1YB6A 4R9SA 1Z17A 2GPBA 3CCCA 2BN4A 4NFSA 4ZT2A 5CA0B 2ZUCA 5ENZA 3K8YA 1YCHA 1ZJ6A 4PNPA 2GAFA 4FVTA 3VQTA 1LEHA 8LDHA 8AT1A 4NG5A 3WFZA 1AK9A 1BVYF 2Q27A 2J7PA 2O7QA 5TGZA 2DBQA 3IUPA 4JEIA 3SJ7A 4ZGGA 3RJMA 3UHOA 2FRHA 4TZ0A 4A36A 4IVNA 2PUWA 4P4TA 1JTVA 3ZGZA 1V1MA 3C16C 4N8DA 3GQBA 3OE7A 1Q16A 4KT6A 2QI9F 4EL5A 5KAMA 1ZCJA 1JIQA 2Q0XA 3VJMA 5AW1A 2NP6A 4HA8A 2VKDA 2H6CA 2D5IA 5EJ2A 4BNJA 4IXAA 4BS9A 3CO6C 2CK3A 1OAKA 2ZYSA 5KAFC 2FDXA 2I6QA 3DT8A 3HSSA 3JAMK 4W7HA 4W8GA 5A05A 4B4OA 4HDUA 5FLVA 3BJMA 5GQSA 5JARA 3BORA 4DLWA 2C1ZA 5JQWA 1TEXA 5DBFA 1GDTA 3P0JA 3GT4A 3SDBA 2I54A 3JALB 1HXDA 4DJJA 4UUTA 2F7SA 4IGIA 2X8BA 5HS7A 4FS3A 3DOFA 4ENNA 3T7DA 3V2IA 2L69A 2AJ8A 2VN2A 4IX1A 1MJ9A 3PHBE 2HRDA 3LGSA 2V4MA 4M72A 4BP8A 4DW8A 4F71A 2E1OA 3EPZA 2GZ3A 2ZSJA 3STVA 2IH2A 1Q92A 5L3GA 3SYLA 1M6EX 1LQ1A 4KVFA 1VFPA 1VMAA 3UCXA 1N0VC 2B8EA 5F73A 4ZI3A 4NCKA 5HSGA 1ZUNA 2WNSA 3GEBA 3KAPA 4KRYA 1G63A 1NTRA 4US0R 3VR2D 5HJEA 1SZJG 4PWZA 1A8PA 4TKMA 1Q1ZA 1VHJA 1MX5A 2ZJZA 2JATA 1GUUA 4G9EA 1S5PA 3FMRA 1I2ZA 3FCUB 2G07A 3RABA 4CQJA 4D97A 3E6BA 2P2GA 3QK7A 4CL3A 4F4UA 4Y1RB 1ORIA 821PA 1UEXC 2XQFA 3VNRA 3H92A 4ZJYA 3BG5A 3HPQA 1AUXA 3F97A 1M1EB 4R31A 4DUGA 1OWOA 2ST1A 2UVDA 5FL3A 4LNUB 2J9RA 2CFRA 3V4VB 2VDRB 2BM1A 4HXGA 2C94A 2YVQA 4A93J 3HYRA 3KKQA 1NU6A 3RW9A 1EP2B 1XTPA 2CNOA 1OCTC 4B32A 3KLOA 3F7MA 1G19A 5E2IA 4IRGA 2X13A 4PGAA 4EB6B 2C2OA 2GEKA 4AWXB 1TK3A 5C7OO 1B41A 1QS0B 1NMYA 2OBBA 4BCCA 1C3EA 1AH2A 3T3MB 3GRUA 1UBEA 4XD2A 4R2KA 1CIJA 2GPYA 1OYYA 3MJDA 3M6AA 4J19A 4GOXA 4N7RA 1WNFA 2LF7A 3RSCA 3EWSA 5KTMA 2B7LA 2V55B 3W9SA 2VJBA 1V96A 3IGFA 4ZN6A 5AI9A 1ETWA 1HYGA 3K4KA 1VHQA 1XX6A 3FBTA 3OVMA 4F7ZA 3R3ZA 4IDQA 1E9BA 4YPVA 4Q9IA 1HFEL 2RHBA 1XSDA 3M82A 3TTWA 5I4BA 2QWWA 3HYIA 1RYNA 4IDBA 4D3YA 4B47A 4ER6A 4N82A 1TO6A 3IVRA