4KIGA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with 4-hydroxyphenylpyruvic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
332
structure length
332
Chain Sequence
SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 122
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kigA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kigA02
4U7BA 3RPUA 3QOWA 2AVDA 2XV4S 5H20A 3HSEA 2LF8A 1TBXA 1S8NA 4ESJA 2ZFUA 2EJTA 3F8NA 5DCFA 1YFJA 2STWA 4CTKA 2JRTA 1TNSA 1HSTA 5EHIA 4X63A 2ELHA 3JAMK 2F5EA 3RODA 1SKMA 1FOKA 1U8RA 3LDUA 5E2AA 2YUIA 3M6VA 2B9EA 4YUWA 1FSEA 3K9TA 2BV6A 2HQRA 1HNNA 1P1CA 2ZZNA 1XCVA 1R23A 2B3TA 3GXOA 2QLZA 1NBHA 1KU9A 4RTKA 1IXKA 1RNLA 4EQZA 5C0OE 1I1SA 1ON2A 3F6OA 2YVLA 3SGLA 3SXJA 2FHPA 4BLWA 1ORIA 3JWGA 2Z33A 5MHTA 3TDUC 5FADA 2IA2A 5F1RA 4GC5A 4QDKA 2JTVA 5A2QZ 3CO7C 2G1PA 2HWKA 4X61A 5KYGA 1Z9CA 2A6EF 5AONA 4UNOA 5FGMA 3E5UA 3PQKA 4KIGA 4X60A 1RI5A 1BI3A 4HDVA 3MB5A 1VQ1A 1T98A 3PLAE 3EDPA 1UFKA 2EA4A 4MGRA 1BIBA 3OZTA 1N7IA 4HC4A 4C07A 1RIOH 2F5FA 5F6FA 3BPVA 4FT4A 1KQ0A 3EYIA 4GO1A 4IKPA 4CYDA 2ZZMA 4U0YA 2UXNA 3A4TA 3SZTA 3P2KA 4EQQA 3RKYA 2A68F 2ZBRA 2LSOA 5LEKA 2ZWVA 2PLWA 3LAJA 2Z3YA 3ECOA 3W6KB 2XUBA 1YYVA 4HAMA 5ICCA 4Z2YA 1R7JA 2ZJ2A 3CDHA 2AOUA 3PFHA 1UB9A 2O61A 1MGTA 2JH8A 2PKWA 4ATNA 1MJBA 1JSZA 2QQAA 3U81A 2VDWA 5EEGA 1Z91A 5K0FA 1BI1A 1DP7P 3IYLW 1FBSA 3ULQB 2AN4A 5CVRA 2GXBA 1HKSA 2O0LA 5CCBA 3DEUA 1FBUA 4Q4ZF 3FYDA 4HW0A 3TO9A 1FX7A 1AOYA 1X3UA 4WK8F 1LDKB 4UHTA 1KHHA 3WGGA 2GLUA 1W4MA 1B9NA 1EH7A 5J6XA 4HF2A 3LECA 5D8LB 1ZGAA 3T0IA 2M87A 4ZYEA 1MJFA 1G38A 3P9KA 3KQTA 3SMQA 2P40A 1ZG3A 4L9VA 4PYOA 5K0JA 1MZBA 3SXYA 4DM3A 5K05A 2EV6A 4IWNA 3O6BB 4MQ4A 2H11A 4E70A 2O0YA 4JXJA 2Z6UA 4L9JA 3ANXA 5K01A 5DEQA 2C7OA 5LRSA 4LJZF 3V8KA 4LWPA 4HYEA 2AOUB 4OBXA 1G3YA 5LBQA 1L0OC 3KE2A 4HQEA 4ENKA 3COAC 3M6WA 3UJ6A 3E05A 2ZZKA 3HSRA 5KVRA 1ULYA 5FCDA 3IHUA 3GGDA 1RZ4A 3MERA 5CD1A 1XD7A 2ESNA 2O05A 3Q5FA 2DW4A 2H1RA 3HRSA 2W84A 2I9KA 2C7RA 2B2CA 3KPVA 3PFGA 4KUMA 3R4KA 4KDPA 3OOPA 2VBWA 2XKPA 5LQRA 2AN5A 2P1DA 2OXTA 5JFRA 4IV0A 2Q41A 4M73A 2ZBKA 2IGTA 5LQKA 5HOOA 3Q87B 3OV8A 2M5WA 3S2WA 2I7CA 1WWXA 2BM8A 2XKOA 3M6UA 1FY7A 1X1BA 1H9TA 5GM1A 2OZVA 1AQJA 2D2WA 3HCCA 3BGVA 5LGTA 3RDIA 1Z05A 2IFTA 4O29A 3R0QA 1G6NA 3PFIA 3R24A 3WG9A 4A2UA 4U7TB 1KU2A 1KYWA 2L54A 1KU3A 3DOUA 3OZRA 1FSHA 2EFWA 4PGHA 4LLGF 5TRDA 3FPHA 2NNWB 2OA4A 3FM5A 2PT9A 4DCGA 3GW2A 3R60A 2P41A 4YV2A 2P35A 4KT5C 2G71A 2RC4A 3ZPLA 1UIRA 1T39A 3B3JA 2O6GE 1QAOA 4PYIA 5JUWA 3TO6A 4AIHA 4YIIA 4MEXF 1NW5A 3FPFA 3ER8A 3KQYA 4RGSA 2RV8A 2OZUA 4HLXA 3Q7EA 5ILVA 1ZN2A 3L2CA 4K6MA 5HLGA 4XCXA 4HX4A 5EZSA 5HDGA 3OFJA 4EV0A 3HM2A 4ZTBA 4M6YA 1U3EM 4G9YA 3R3HA 1UCRA 3LKZA 3B7PA 3FUXA 2D45A 4G7HF 2ONZA 4I7HA 4YFXF 3HVJA 1R1VA 2F5CA 2NXJA 2XAHA 4KN7X 3ABTA 2IIPA 5D6EA 1WQ2A 2F5DA 2QWWA 3C7JA 2O03A 5EVJA 3F4KA 5FA8A 3ZMZA 1GVJA 1JHFA 4MQVA 3V8LA 4PYNA 5L3EA 1ZG5A 2JSCA 1ZH5A 1XGMA 4LB5A 2KIMA 3LSTA 2VN2A 2BH2A 3A7DA 1XXLA 4M37A 2VONA 4NQWA 5LHHA 4OMYA 2ERCA 3HCAA 4BXUA 1X1CA 1TQIA 2HWVA 1FNNA 1BOOA 2YXEA 5H6QA 4DMGA 3CTAA 5KQRA 3B5IA 3B89A 2EFJA 2BM9A 2HS5A 4IVNA 5FULA 4KICA 4HV6A 1ZLJA 3LBYA 3LDFA 4OQEA 3FMRA 5E1BA 3EYYA 2YR0A 3RW9A 5D1NA 3LBFA 3FMSA 1SD4A 2K4JA 2PWPA 5FUBA 3WTTC 2L01A 3IWZA 1IN8A 3WTUC 5E8IA 3DQVC 3GDHA 5DX8A 2FSWA 4BP3A 1DUSA 3DULA 3QU6A 1C0WA 3DTNA 3GRZA 4AIJA 2VXZA 2R3SA 5HIKA 1BN5A 3DR5A 4X1OA 2O07A 5E2BA 2DAOA 3K1MA 1CGPA 1OYWA 4HF1A 4UXNA 2IVMA 2CKDA 1YUBA 3ELWA 4YMHA 1QBJA 3GNLA 1VPTA 5L3GA 2MH9A 3CUQA 2VS1A 3JWHA 3E6DA 1A04A 5CVUA 2HYGD 2PI0A 1RI4A 2H6CA 2IA0A 1XGSA 3EMBA 1BC8C 4MHGA 3BKWA 4KDRA 1J0RA 1MJAA 1FP2A 2XIGA 1KQ8A 5K0LA 5LHGA 1M0EA 3IEIA 3MZYA 1NT2A 3G5TA 1IAWA 4PWYA 4PYQA 5K0CA 1KR5A 3AXSA 3DLCA 2G8NA 2J5PA 2Z6QA 3B73A 2VZ9A 5E1DA 1FLIA 5HOQA 2IP2A 3DPTA 3LAPA 4H0NA 2D1VA 2VDUE 2WA2A 2UXXA 5CVIA 1ZYRF 2XBMA 4WX9A 3A25A 4Y13A 3EVDA 1ZKDA 1M6YA 5KS2A 5C9ZA 1XN7A 4HF0A 4N9IA 5BP7A 2P7VB 2E7XA 1X19A 4L5JA 1BBYA 2OO3A 2VOPA 2UYHA 2R7FA 5LGUA 5F2OA 1F1ZA 1P2FA 2WC2A 2BR3A 3DXZA 4ER7A 3VFZA 2PX5A 4V0QA 3UWPA 4AZTA 3D0SA 2AOWA 4QVKA 3CUQB 1L3IA 4HOBA 5LSAA 4AUKA 3DV8A 1XCJA 1J5YA 2I62A 4OQDA 3L00A 3ID6C 3HA7A 3BWGA 2A07F 4RTLA 3PX3A 3EQLF 4FX0A 1KA8A 4WF2A 1WZNA 2UYCA 4QPNA 3CCFA 4GC9A 1DDNA 1VIDA 2NNYA 1FC3A 2JH9A 3M4XA 3PT9A 3GF2A 3PB3A 4CXFA 5LEJA 4HA8A 4PONA 4RB1A 3PX2A 5E18F 3OE4A 3T8RA 3BROA 2LKPA 3V7RA 2EK5A 2EJRA 1TQPA 5IKMA 4UVCA 1DL5A 3BWMA 2P7HA 1EV7A 4EGYA 3WTWC 2P7CB 5FQNA 2HGCA 1AQIA 5E8JA 5EQJB 5CLSA 1QANA 3TKAA 4L7VA 1SAXA 1T43A 5G02A 2B78A 5D5VB 3P9NA 4EGZA 3KCCA 4KIBA 4C06A 5LQCA 4RVDA 5T6BA 3F3XA 3I54A 2OQGA 2W25A 3LCUA 5F2KA 4WXHA 2E7WA 1F9NA 2AVNA 2PJDA 3HEMA 1D5VA 3BJAA 4IV8A 2ORED 1S3JA 3FWEA 1YTYA 1QAMA 2DFIA 3VC1A 3DMGA 2DO7A 5D5XB 4LG0A 1NV9A 2JPBA 2PT6A 4FSDA 4KWCA 1SMTA 3RKWA 2PXAA 2HKXA 3BJOA 3MFKA 1V4RA 5DRYA 1KPHA 4F85A 2XAQA 1Y8CA 2N47A 4HGYA 1VP3A 2ZO4A 2RQPA 1U78A 5J8FA 3HNRA 3KETA 3HCEA 1G3WA 3TO7A 3G2QA 2KRFA 1LEBA 4FX4A 2DULA 5KQSA 1QAQA 2ZIGA 1S6LA 2FK7A 4GCVA 3GIWA 4CTJA 4HTFA 3FMQA 4G56A 5E1OA 2RN7A 3AJDA 4L0ZB 3SSOA 5K5OA 1JG3A 2UWMA 2PJPA 2Y75A 3NRVA 4EM1A 4RB3C 1T6SA 4YIFA 1ZRFA 3SQNA 3FUTA 3F8FA 4FHTA 2ISYA 3TQSA 4NECA 2PY6A 4ER0A 2WWYA 2YX1A 2QVOA 2VBXA 2P6SA 4HLYA 4YV0A 3N97A 4EJOA 3V7CA 3MQ0A 4LG0B 1I6XA 2GH1A 2HFHA 3TQNA 4I01A 1RI3A 5CJ9A 3FUUA 5CVEA 2OZ6A 4UVAA 3I71A 4FP9A 4A5MA 2MH2A 2OYRA 3KP2A 5A2QK 2LD4A 2ZSUA 5K8VA 4IRIA 3I53A 3KR1A 4GBED 3DMFA 5LQJA 3E5QA 2G9WA 3E7PA 2XAFA 2F8LA 3EGEA 2JG3A 4EK9A 2L02A 4ZYDA 4HTFB 2FNPA 2YSRA 2TDXA 3KPUA 1UHMA 3K1PA 4AZVA 3C18A 2FOKA 5E17F 1USTA 3EMDA 5JI6A 2BBYA 2GA1A 2EX4A 3ZMDA 5IT9Z 4BNCA 5DD8A 2Z6AA 5EIWA 3MQ2A 4OMZA 1QNTA 4L9NA 3GLXA 4RVFA 3FRHA 3RYRA 3H3UA 3NTVA 3SFZA 4ESFA 4B09A 3KQQA 1JGSA 2V1XA 1O7FA 2UYOA 3V8JA 1I5ZA 1WRJA 3WGIA 2Z5UA 3HTXA 5E9QA 3P8ZA 2B0LA 1Y0UA 3C6MA 1R1UA 2XVAA 1BM9A 2OU2A 1Q0SA 1WG8A 3CC8A 4U7DA 3C3YA 5DM1A 4ISCA 3KQWA 3GRVA 4EJVA 3F21A 3BPXA 1R8YA 4C04A 4PYJA 2XROA 3G3ZA 3LQRA 2XYRA 1XGNA 3THRA 5K5RA 5IH3A 3HTUA 4EKGA 1UHWA 3LA2A 3IWFA 3ZMUA 1Z6RA 3SHFA 1GXPA 5DTQA 4Q5SF 4CKEA 3DKWA 2VODA 4AWXB 4Q47A 1XSDA 4XBFA 2PXXA 4M38A 4FT8A 1W7PD 1PP7U 3GO5A 3BJ6A 4RGXA 4O6JA 1X1AA 2GAUA 1XTPA 5K0NA 2HR1A 4I02A 3U9GA 2FBIA 1VE3A 5L3BA 3SZPA 5FFXA 4F84A 4LK0F 3GX4X 5DSTA 3M8FA 3TOSA 2V6CA 2VP3A 5ICGA 5DSXA 2Y1WA 1PDNC 4ZYGA 3SR4A 3VB2A 4ZH4F 5CYVA 5D8KB 1IF1A 2UZ4A 5T64A 3ORHA 1XCLA 3V4GA 2RGVA 5FHQA 3G89A 4P96A 1TPYA 5K5QA 1HSJA 3KEQA 3OU7A 3OZSA 2GIVA 1D2GA 1YQAA 3QP6A 4KMFA 4IHSA 1TTYA 4PCAA 5DM4A 1WS6A 4Y17A 4KIFA 1FJXA 4RV9A 3KQVA 1L3BA 1LDJA 3QU3A 4GYGA 3SM3A 3CGGA 1JE8A 2OPBA 5CIYA 4CGZA 5TJJA 1U5TC 5BS6A 3ZMTA 3CJQA 3K0BA 2IW5A 1OR7A 4ENNA 5ICEA 3QAHA 2EFQA 5JVTA 2HEOA 2PG4A 2IH5A 4PNEA 2IDKA 1SUSA 2FE3A 4KMUX 3NJRA 4HRAA 1IY9A 5DTMA 2Z9OA 3EVAA 2FBKA 2EJUA 3T7RA 3ABUA 2YQZA 2ZWAA 3FYCA 5DV5A 3IRRA 2WK1A 4G94A 3NWEA 1EH8A 1I9GA 2EG5A 3PVCA 5HLIA 2XASA 1BC5A 3U1DA 4HG2A 4BHCA 5EKUA 4M9XA 2DU9A 2ZW9A 2QQBA 1EJ0A 3QP5A 2P4WA 3R0JA 1TW3A 2R6ZA 3ZN1A 1DPUA 2RDPA 2H6BA 5LR6A 1I4WA 3FTDA 2XYQA 1JR4A 3N4MA 2PXCA 1FT9A 4HZFA 5B1SA 3L7WA 4PINA 1YF3A 3FPJA 3QOPA 2OB1A 4MWZA 2ZBQA 2A3SA 2A61A 3R6SA 1YIOA 3REOA 3EVGA 2XRNA 1FP1D 1XMKA 4R8SA 1JG4A 1XDZA 5E9JA 4EMSA 1O3SA 1DPRA 1BOAA 4IRGA 4V0RA 4E2YA 5K0EA 1J2XA 2ZCJA 3HVHA 4MTLA 2V1UA 2EV0A 3KP5A 1JQ3A 1JHHA 4Y15A 4G7ZF 2ESHA 1JG2A 2P8JA 1WI9A 4QWQA 3LL7A 3OU6A 5DD4A 5EMLA 5EGSA 4R1HA 4KNYA 4OIPF 2DK8A 2YTZA 1Z6TA 4GOMD 2O06A 1O57A 3G7UA 3VSEA 3KP6A 1LDDA 2IA1A 3TMAA 1UFMA 4E33A 4P9FA 3KP3A 1EAMA 1IRFA 3OPNA 3LCCA 3M9AA 4QQNA 3WSTA 2NYUA 4XRFA 1U5TA 5GM2A 3SSMA 4UV9A 3GRUA 1AWCA 3T0YA 1R18A 4LWOA 2EB7A 1K7AA 2YU3A 4B17A 3NMUF 1WY7A 3RJPA 6PAXA 2ZNZA 3ELDA 1LVAA 4XUEA 1MDMA 3GO4A 4RGRA 3CO6C 1NKVA 3DLIA 4XLPF 1KP9A 4YMGA 3DPLC 3EETA 2NS0A 4A5NA 3HCBA 4OA5A 1M6EX 2AS5F 5D4SA 5ICFA 2P3OA 2BR5A 3MGGA 1D2HA 3M7GA 1IW7F 3LDGA 4ENMA 3ME5A 1QPMA 1D8JA 5EMKA 4CKCA 3G2MA 5FLXZ 1G3SA 4QTTB 4BAYA 2ISZA 2IPXA 1SG9A 1YZ3A 4L5IA 1W7PA 5H6RA 2M8EA 4M72A 4WXDA 4MTEA 2IBSA 3ZMVA 4CWAA 4XSXF 5C1IA 4I0AA 4R6WA 3EPPA 1U5TB 4HX8A 1TQMA 3D5LA 4HH4A 4GOLD 2PLYA 1P91A 2XAJA 1I1NA 2FCAA 3H2BA 2ZBPA 4HX7A 4CZZA 5BXYA 3KQOA 2GXGA 4DQ2A 2BR4A 1SQFA 3KQSA 4CDGA 1D3YA 5K03A 1IM8A 4KN4X 1MDMB 3G88A 3C0KA 5BPIA 1LJ9A 4HGZA 3SVZA 3VODA 4IRHA 3WE2A 4BH9A 2P5LC 4UVBA 2OY0A 4TV7A 3DXXA 1MJ9A 3LA7A 2AS0A 4D0PA 2ZVJA 3V97A 2K86A 1WSUA 4RTQA 3EVBA 2BEOA 4BHPA 5L3CA 5CVVA 1TLHB 4ZZDA 3TOAA 3IC7A 1E17A 1B42A 8MHTA 1ZG1A 3MCTA 5GWXA 2JPCA 4KVZA 4FT2A 1RUOA 5AIPA 1ZGJA 4YUXA 1SMYF 2ZXJA 1P39A 4LGWA 3I5UA 5AIQA 2ADUA 3NEUA 3O2PE 1YS6A 1FZPB 4YUYA 3TM5A 3JWJA 5ILSA 5CCXA 1KYZA 3ML6A 3J7AO 3BUSA 3K1NA 3BWYA 4BQAA 4I98B 1W7PB 2R7DA 3RTRA 4QPPA 5HS7A 3AAFA 4ER5A 3KEOA 1XDSA 2NXCA 2B25A 3TLJA 4RB0A 2C6YA 3B3FA 1AF7A 1J9IA 2WTEA 2LNBA 4GXOA 2H00A 4PZJA 2EV5A 3E6CC 1HW5A 1KIAA 1MHTA 4A0ZA 4ON0A 2P5KA 4GYIA 1RI7A 3E8SA 5GP1A 4K2EA 1FWZA 2AOXA 2AR0A 3FRIA 3WTVC 1I27A 2EFOA 5P8WA 4RVHA 5FWAA 1U2ZA 3P7NA 1OYYA 2VBYA 2BGCA 5DUIA 4PCLA 4OINF 3DUWA 1OMIA 1JG1A 3G8AA 4CO8A 3HRMA 3IL2A 4UV8A 3ZP5A 3QV2A 3Q9SA 2P5VA 3HIFA 2HDCA 4CKBA 2X4HA 2MC3A 3L09A 3RI4A 2GZWA 2VBZA 4P55A 5EOVA 4P9UA 1R6AA 1XSXA 1EH6A 1GXQA 4M9SA 3H3ZA 5E1MA 2DTRA 4S04A 1IN7A 2HYFA 3MCZA 1NW6A 1G6Q1 1R8XA 4AD9A 2CMGA 1F3LA 1JQEA 3GU3A 5GIOE 1L3LA 5E9WA 4ER6A 3VYWA 4L18B 3GZ5A 5BW5A 1B59A 2IH4A 2NRAC 2FF4A 2QM3A 4PIPA 5E1XA 3ZN0A 4BP1A 10MHA 2E5WA 5LGNA 1P6RA 4MHTA 4IPAA 4YG2F 4MIKA 2FNAA 1J75A 1SD7A 5BQTA 2KJCA 1O3TA 2IT0A 1IN5A 2L3DA 2VC0A 1P1BA 1HW2A 1ZAOA 4S05A 3B3GA 3OU2A 4PYKA 4RTOA 2HV9A 3HOTA 2DPMA 3HCFA 2G72A 5IT3A 5LRRA 3FX3A 4DKJA 3MHTA 1D2CA 3NVKI 2GPYA 1STZA 2CG4A 2MA3A 5FD5A 3HA3A 5DWQA 5HIMA 3DMHA 5BW4A 3O31A 4IXAA 4P7KA 2HTSA 4IF4A 1D8KA 3KR2A 1ORHA 4ETSA 3I0TA 3TGNA 1ZLKA 3FZGA 3SSNA 2D1HA 3TR6A 1S7OA 3QPHA 4C03A 2H09A 5EG5A 3J81Z 3TOBA 5GOZA 1I1GA 2CFXA 1ZQ9A 5DM2A 3GFLA 3ECHA 2YXDA 2CSOA 2K27A 2QQ9A 4RSRA 3CJRA 5DPMA 4NHJA 4AZSA 5E1ZB 2QE6A 3FXUA 3WU0A 5D6FA 1XMAA 1L9KA 5K0BA 3BY6A 2A14A 4OX9Y 5FD6A 2JHAA 3LGAA 3G8BA 1HW1A 4QLCU 1K6OA 4XSZF 3FHZA 5HZMA 1OKRA 5EKXA 1ZREA 3ERCA 2ZTHA 3OE5A 1IN4A 3R6TA 4IHTA 3I9FA 1G60A 2Q8KA 1PP8F 2ZIFA 2XAGA 4QVGA 2K4BA 1IXCA 1V3FA 5HILA 4M9ZA 5LQUA 2FMYA 2YX7A 5K09A 3BWCA 3BGIA 4G8XA 4R8RA 3ROUA 5JHUA 5HLHA 4AZWA 3FF5A 2FRHA 1VLMA 3PTAA 1UWVA 1YZHA 1T0FA 5DT2A 4GGGA 4EM0B 3UFBA 5F2NA 3BT7A 3ISPA 3GCZA 3MWMA 3C3PA 3AWIA 3X0DA 2JZYA 5F64A 5IT9K 3AXTA 3MAGA 1SFUA 2MLGA 2QYOA 2PMUA 5E1WA 1SVUA 3KLOA 1P4AA 4R8HA 2AN3A 4MTDA 3CLOA 4UUVA 2JHCA 5HS8A 2HKOA 3M6XA 3EEOA 1FBQA 4A0YA 2ZFWA 3J80Z 4MNUA 3BZBA 4PIMA 3T7TA 3LCVB 3T5XA 1DUXC 5HDKA 3TFWA 3GEZA 4UOEA 1P92A 1LNWA 4YV1A 3HSFA 3UJ7A 4PGGA 1BC7C 2WA1A 1REPC 1O3RA 3RKXA 1FBNA 4BLUA 3IKVA 3WE3A 2NP6A 3FTFA 1E2XA 4LLNA 3TPZA 4PCQA 4LECA 3FTEA 4YUZA 3KQPA 1O9GA 3M33A 3DP7A 5EC8A 1O3QA 4FGZA 1USSA 3JW4A 1F4KA 2E1CA 2FPOA 5K1YA 4ZZLA 3O3KA 4PYMA 3ER9A 4MEYF 1P4WA 4YFKF 4L0YB 4RX1A 3VEPA 3H92A 3LKDA 2A6HF 3R0AA 1HKQA 2VDVE 2VT2A 4GOND 2OBFA 1KU7A 4G7OF 5FHRA 2CMHA 2FXAA 4AIKA 5DYMA 4RTRA 2X0LA 3CBGA 4CHUA 1NW3A 2ZKZA 5CUQA 5CM2Z 1W5TA 5FB2A 3KR0A 2PEXA 3WTZA 4OIOF 4E31A 1XJ5A 2IBTA 1YO5C 3M8EA 1G3TA 2G70A 5E20A 5DXJA 4OU0A 4G6DA 4WVLA 1QZYA 4AX8A 4E32A 2C7PA 3DF8A 1MKMA 1LEAA 1R5GA 4E30A 3HOSA 5DXAA 4EM2A 2VE8A 3JAMZ 3KP7A 2ZLBA 4RTMA 1KXZA 1B6AA 3O7WA 3KQMA 5LQAA 3BP8A 2XYVA 2L4AA 3LWFA 5EIFA 2O8XA 2YX4A 1KPIA 1Z3CA 2Q2EA 1SUIA 2IRFG 4I0BA 1YLFA 2Q0OA 3GYHX 3EGVA 1RI1A 1RJGA 4LG1A 1HQCA 1JSXA 4DA4A 2PVCA 4KW7A 3FPGA 4A12A 2KW5A 4M36A 3V8VA 3G73A 3MZHA 3O4FA 2ESRA 5DUKA 3UBTA 1T2KA 1BI0A 3FXRA 4U0WA 4RTNA 2FU4A 2L4MA 3EVFA 4C05A 2OB2A 5L3DA 2PBFA 4BY9E 2BZGA 2O57A 3MTEA 3GFIA 5LQNA 3JSPA 2CO5A 2ETHA 2EFNA 2J5OA 3UZUA 3HUGA 2DPUA 2HQNA 4LB6B 3EUHA 2ACJA 3LQQA 3IHTA 4JBAA 3PS9A 2PFBA 4JQFA 3DFGA 2JT1A 4M74A 2IPQX 1DCTA 1BI2A 3MAJA 2XVMA 2JJQA 3A27A 1XCBA 4LMYA 4EVIA 3HCDA 5ED4A 4GEKA 3HVKA 1KPGA 3ELYA 4DQ0A 5DX1A 1IXSB 4HDUA 4KRGA 2O3FA 3BOQA 4XUCA 2YPRA 5HDNA 2H27A 1INLA 2VE9A 1R74A 2MBFA 3GRYA 5EPEA 3K2ZA 4BLVA 1NW7A 2ZIEA 4ENJA 5L3FA 4I09A 1IUYA 3UJAA 9MHTA 2KIFA 1U2WA 2Y48A 3A26A 2K02A 3MTIA 2NAZA 5DCMA 3R61A 2HR3A 4EJWA 1SFXA 1O54A 2STTA 2QRVA 4HSGA 1GHCA 3EVZA 2PSSA 3QRFF 1PUEE 4OA8A 1ONVA 3GRRA 2ADMA 1VBFA 5ERIA 1PRYA 2FBHA 3FTCA 4RB2C 3R9XB 2VT3A 5EZQA 2PX2A 3FZVA 1ZRCA 2GQQA 1WXWA 4R79A 3LHDA 2M30A 1H9GA 5E8GA 3L8DA 2OKCA 4C08A 3KHKA 1TNTA 4DZRA 4H0EA 1WXXA 2WV0A 5D5UB 1N2XA 2PBIA 1NW8A 3NWBA 4I2OA 3A7EA 3CVOA 1T38A 1BJAA 1G4DA 3UJ8A 1B4AA 5H02A 1YW9A 2CYYA 2EFPA 3P97A 4HBLA 2NNNA 3G2OA 5K0GA 4C4AA 1NV8A 4OBWA 3E6BA 3RIEA 2M45A 5FTWA 4L9TA 3GVAA 4M71A 3K69A 5D4RA 5DCMB 2AZTA 1KGSA 2QRVB 5EMMA 2IDJA 1SQGA 3THSA 4OIRF 2PMHA 2DLLA 2PX4A 2FK8A 3HTSB 4FR0A 4P7GA 3FUWA 1OPCA 3AY0A 2JHPA 2HMYB 4F7ZA 2OAZA 4U88A 1IN6A 1FYLA 2V9VA 4RTSA 3F8CA 4ASNA 2QY6A 4P58A 1LQ1A 3HRUA 5GINE 1P4XA 2V1DA 3P9CA 3T8TA 3DXYA 1B9MA 5DRTA 3C6KA 4RWZA 3K0LA 3MEXA 1RUNA 2QZ8A 3E23A 2P7IA 2Y0MA 1QYRA 4E2WA 2F2EA 3V7SA 2ZULA 3C3WA 1EG2A 3KPJA 3JSOA 2GS9A 5FLXK 1G8SA 3FPEA 3VC2A 2ZNYA 1YB2A 3QPTA 1FPQA 3E6MA 4EKIA 4ER3A 3ZQ7A 2XHKA 1IZ1A 1X1DA 4KDCA 1R58A 3KPYA 3CUQC 1TW2A 3CJNA 4BHBA 5DX0A 2FA5A 4M7RA 3WODF 2P3QA 1G8AA 5BOXA 2ZCWA 1SD5A 4O3MA 2BYVE 4XUDA 4PDKA 3EVEA 2V7EA 4RAZA 4DF3A 1VTNC 3F22A 2PWYA 2KIUA 3JWIA 5HS9A 5CVDA 4F86A 1R5HA 3WTSC 2UZKA 2MLKA 3K6RA 2G7HA 3U2RA 4EJUA 2G7UA 1JXSA 2MD5A 3GFMA 2P3LA 2K4MA 1K78A 2OQRA 3GZ6A 2BE5F 3HVIA 3HA5A 4GUAA 4YFNF 5U4XA 3B02A 3TRKA 4ZYHA 3CKKA 2Y1XA 5EMJA 4GF5A 3NQOA 2RKHA 4JK1X 1B1BA 1N7JA 2COMA 4E2ZA 4GOOD 3HYIA 3ELKA 2HZTA 4BYYA 1VP9A 1U6GA 3OFKA 3TDZC 3P71T 4U0VA 2FYTA 1Q1HA 2H94A 3GJYA 1O7LA 3VOEA 2FEZA 3JTGA 4P5OA 2I6GA 5KK1A 2V74B 4U7PB 3NW9A 3UJBA 3LX6A 4A6EA 3G5LA 5FQOA 5ERGB 3HHHA 3WU1B 2RNJA 4OOIA 3KPWA 2DQLA 3UJDA 1R22A 2AOVA 3M1EA 3EVCA 3NDJA 2QUFA 1PJZA 4Q48A 2A5YB 4E2XA 3F72A 1QQIA 3HHGA 2PV0A 2W57A 4YUVA 2DI3A 7MHTA 3CUOA 4G6QA 5BPDA 4FSXA 4P7JA 5D1HA 2XVCA 2GA2A 5FWDA 3I64A 3BZ6A 2A69F 3C1DA 3BKXA 5FA5A 5DTRA 5DM0A 2C7QA 3HRTA 1K78B 1O9HA 1YG2A 1R36A 2EA2A 1HKTA 3WGHA 3ERED 5J8CA 2VOOA 4WXCA 2CL5A 1XGOA 4LFUA 2NXNA 2IH2A 3UA4A 2QENA 5DLYA 3S68A 4P7FA 3FUVA 3KP4A 4DCMA 1XB4A 4MQ9F 4NB5A 3BWBA 2HNKA 2W85A 3E97A 1ON1A 3BXOA 1J7KA 3PQJA 2GB4A 4KYWA 1J59A 1BIAA 3E5XA 1OYIA 5LHIA 4QTUB 3KFWX 5FO5A 2CW0F 4KFCA 4RAYA 5D5WB 4QQKA 3ELUA 5LLQA 3TKYA 3RPQA 3ZMSA 5HFJA 1RJDA 2OD5A 1L1EA 1VL5A 3LA3A 1RJEA 2P8TA 3I4PA 3KZZA 2GWRA 4RTJA 3KR9A 1Z1DA 4N9HA 4CXMA 4KA4A 4HV5A 3DXJF 1EIZA 1W5SA 3GUDA 1QO0D 2ONYA 2ZMEA 4O5VA 4QDJA 3JTHA 1YFHA 1EQAA 2V79A 2PGXA 3NVMB 4RVGA 4R05A 1SD6A 1IRGA 2CWEA 5BMZA 5E8RA 4X41A 2CGPA 1EJ6A 1BKYA 3P2EA 3F6VA 1R1TA 1R00A 1QZZA 3J81K 2FRXA 1FYKA 4RYLA 3LPMA 2NYXA 2HTJA 4B8XA 2AXLA 3KU1A 1NBIA 2DQRA 4PYLA 2E1NA 3WTYC 1ZHFA 2PN6A 2RVCA 1WKMA 3RIRA 3F23A 3KZYA 2KKOA 1HMYA 2CQKA 5EHGA 2YXLA 2PQ8A 3IV6A 5HIJA 5JR3A 2W24A 3M70A 4GQBA 1JTFA 3WTXC 2PX8A 4Y30A 1CF7A 3GWZA 1RI2A 2DK5A 1ZARA 3TM4A 1S29A 5HEKA 3UJ9A 3UJCA 5HIIA 3FM3A 3FXQA 1F5TA 5ILUA 1L3CA 3T7SA 2GA9A 2YR2A 3W6JB 3KKZA 3L9FA 5FFZA 4WCGA 2CWWA 2ZMEB 2K7LA 1F38A 4DNCA 1NE2A 2GAFA 2FQ3A 4HQMA 2M1BA 1HBXG 4N0BA 1IXRC 3BDDA 2HOEA 3IKTA 3E3VA 3IRQA 4EJTA 1SFEA 2VC1A 4FS8A 3F8MA 1JTEA 3I58A 1NHAA 1QGPA 1OR8A 1BHJA 3T1BA 2P6TA 3SX0A 3I59A 4A0XA 2AOTA 2KJBA 3P2IA 1LB2A 5KVAA 1H1DA 3QOXA 3NDIA 4RTPA 2UYQA 1XDUA 1K79A 3EGIA 1RJFA 4XLNF 2QBYA 1XSVA 3F8BA 4LK1F 3G2PA 4LLLA 3UA3A 4R6XA 2Z99A 3EEYA 4IJAA 4WWCA 1KQ9A 5HVQC 2HTEA 1Q0TA 3J80K 1YFLA 1CF7B 1V39A 1HXDA 3LFKA 2LF7A 3CJTA 3OCJA 3BGDA 2XGXA 2DT5A 1YW7A 1S7AA 5DDGA 2FMLA 3D2LA 4Y2HA 3RYPA 4OIQF 1JQDA 2LDUA 5M5BA 1G55A 3P9IA 1Z7UA 3Q9VA 1YW8A 4RGUA 1YS7A 2DPDA 4LD5A 1ZRDA 5GIPE 4A6DA 5CVJA 2NP7A 1XVAA 3KLNA 5T67A 3DH0A 2OBPA 4AVPA 1ODDA 4CICA 1FYMA 1H0MA 3HP7A 1AV6A 2DBBA 4RS8A 4ESBA 5EEHA 3I59B 2AOTB 2NXEA 4FZVA 2EWNA 4M6XA 4POOA 3GFJA 2IJLA 2QBYB 1MD0A
chains in the Genus database with same CATH superfamily
4U7BA 4FN5A 3ES9A 1Y1PA 4ESJA 2GPWA 5BPFA 1YQEA 3I62A 2LWIA 1REQB 2KRCA 4OQPA 4HH1A 3AR9A 1P5HA 2CD9A 5IXJA 2H2GA 1XCVA 2PRJA 4TRRA 5CNJA 4C2AA 5C0OE 2DAPA 2FHPA 4MUAA 5DNEA 5BV7A 5F1RA 3RFCA 1NQVA 4IHAA 3HB0A 5LMNB 2KX7A 5AONA 2X4DA 3A8TA 4KIGA 4EY3A 4LQCA 5AI0A 4AJJA 3A9SA 2R44A 2X8AA 1N7IA 3ZBPA 2OCXA 4AWBA 4DJ5X 3Q8MA 5IJXA 4ZYVA 2O20A 5LU8A 4I9UA 2MD0A 1PFQA 2ZWVA 3FNEA 2PLWA 2WOOA 4M76B 3PYMA 1XTZA 1UJCA 5THKA 4KH1A 4WBNF 4PG8A 3I39X 2AR7A 2RHDA 3D6FA 1OCCH 3W6NA 2H3EA 3IYLW 4G0QA 4L16A 3T5AA 1SXPA 4YJGA 2QHXA 2H1LA 1DX4A 4R01A 2OV1A 5LD2B 2YNMA 1BQ4A 1H8AC 5KQGA 5KAFC 3WGGA 2GLUA 2BZ0A 3TGPA 4OCZA 2ZJZA 4FE4A 3L4BC 4GH5A 4DBQA 4OD0A 2P40A 1VHJA 1VQKI 3SXYA 4B82A 4IWNA 3ONWA 3HCNA 2J5XA 1V9CA 4S1TA 2QRHA 3PKIA 1BMDA 1YZTA 4YRCA 3BGWA 4MR8A 3M6MD 5LBQA 1A8SA 2BGTA 3IOYA 4FFDA 3UJ6A 1U2QA 2HL6A 3KV3O 4CMEC 1F36A 1RQNA 3HSRA 4P3OA 5FCDA 3BZKA 2X4GA 4Q37A 4NJMA 3ZCQA 1MB9A 1I5EA 3WU2C 2I8DA 1X7DA 2CL7X 3KVYA 3A01A 3ASNH 2DOFA 3C5EA 1ACIA 4FNMA 4KDPA 1NNUA 1Y1LA 4IQ4A 1H22A 2QN8A 3BRWD 1RFGE 1GGVA 4YR9A 2R6CA 3L5OA 3OO0A 2DMPA 2H8KA 5CXSA 1SKYE 4BNTA 4U9UA 3MD0A 5GOTA 4PGHA 2KBEA 2VT7A 4NZYA 1Y8RB 5CJ2A 1X86B 2QTCA 2NNWB 3H05A 3S1MJ 3NUQA 1MVLA 4NS1A 4TV9B 5B1EA 2Z09A 3RIHA 2WJZB 4BLRA 3NNDA 4MV3A 1B0UA 4L76A 5JUWA 3PHGA 1GHTA 4S3MA 3FPFA 4E21A 2YWHA 2ZTMA 2RV8A 4YECA 2OR3A 2O5RA 1P0IA 2MSNA 3NYIA 3O3OB 5HDGA 4F5EA 5HUJA 1S3IA 2PGIA 1IK4A 3I73A 4UOQA 1M2JA 3SPXA 4YN3A 2B4KA 3M83A 1P2SA 1UDCA 2JA8J 2ERCA 2V6JA 4HEA6 4DMGA 5F9MA 1HM5A 5TR9A 3C3MA 1YCHA 2R7RA 5SICE 3CPEA 1J8FA 1L7OA 3VR4D 2W48A 1V11A 1P0CA 3GDHA 3TG2A 1L4KA 3DTNA 5FUWA 4UHHA 4B2PA 5LYYA 4ALLA 2ICAA 4TV9F 2IVMA 5L4NA 3TO5A 1RWQA 4HFRA 1VPTA 1GZUA 3BXFA 4QA9A 3GTGJ 1ZW1A 3S99A 1WCIB 2JJ7A 2PI0A 4BLQA 5LA6A 2C2YA 3AW8A 3G0CA 4U7GA 1TL8A 5BYBA 1O96B 1Z9BA 3IQDB 1ZDMA 4PX2A 4UPDA 2OXCA 1OX4B 4MLPA 4OSEA 1U3GA 3ESQA 4J75A 5EPOA 3LZDA 5DEOA 3EAGA 1VQ5I 2DOEA 1XEWX 4M1TA 1W49A 4N40A 2PO7A 4WX9A 5B37A 4I1PA 1M6YA 4N3GA 3K05A 3FW1A 5C9ZA 3M1IA 3NXSA 4L8WB 5EXSA 3IQIX 4PRYA 1YO6A 1PJ2A 3JRWA 3EIOA 1I1HA 2WIAA 5JZ9A 4IFBA 4WESB 3LQ2A 4MO2A 4JNKA 3EODA 4IIFA 1O0CA 2RC5A 3UAOA 1WZNA 4XKWA 1CNMA 1PV2A 1WCWA 3PXGA 4EBFA 4G5XA 5FPTA 4YHHB 2LKPA 3SDZA 3DZHA 2K6GA 3BWMA 3G2KA 3CP8A 3EH2A 2EIJH 3NTQA 4DPKA 1BJZA 5JTTA 3TTWA 4AP9A 1KOJA 4IDEA 2H9AA 4F46A 2B4AA 3TQHA 1BO6A 2QD2A 5PGMA 1SCKA 4NCIA 2H06A 4DEVA 2CEKA 2XNDA 3C15C 1YE5A 3FWEA 1YH3A 2DO7A 2VAXA 4F4JA 1S3FA 2PSHA 4YPOA 2I1LA 4WJZA 1DIOB 4I66A 1XVTA 1UQTA 2XAQA 2WJHA 2CVHA 4AMZA 5IP7J 3AHGA 2RN7A 1IG3A 2FW9A 3ZHXA 5BQFA 2ACKA 2Q5IA 4J3FA 3KEFA 4P5PA 1VRCA 4BGIA 4JB0A 1LFUP 2WWYA 2W22A 4RAFA 3QELB 1KIFA 3JQ7B 1YVRA 4AULA 3AP3A 3RUHA 2QL7A 2R85A 5JPDA 4Y7CA 2L9VA 3AF2A 4OQZA 2BEUB 1IVYA 2PA0A 5LIPA 5A2QK 2NM0A 4LW8A 2AQ8A 2IEGA 3L7NA 1HFWA 1F0KA 4GFDA 4DIEA 2R4TA 5HKAA 2FNPA 2G06A 3R0XA 3WIOA 1UHMA 4WCFB 2FOKA 4NG4A 1WX1A 5IT9Z 4RLHA 4EGQA 3E4CA 4EI9A 1KFBB 4EL0A 2XSDC 3Q41A 3H3UA 5ER9A 4Q1AA 3CZ6A 3VR4H 2HEIA 2W43A 3CSUA 5EA2A 1NUPA 2B0LA 2FVXA 3MJHA 1FLNA 4JBYA 4Q3CA 1UANA 2CFOA 5I7UA 4GKKB 2HCTA 2R1TA 3GCMA 2EW2A 2P9GA 2BM0A 2MG4A 2VYFA 2MOKA 4JEIA 2BOLA 1QB8A 3NATA 4MQUA 1V8OA 1GO2A 2X3YA 4Y3OA 2FUG6 3LA2A 1KJZA 1F2TB 2IJGX 5IUKC 4TQAA 4XGRA 1JXMA 1KA9H 2XCQA 2EPFA 5H68A 3CMMA 3GT3A 1KTIA 1UDWA 3OZAA 3TQCA 4M1EA 4PJJA 5L3BA 3SZPA 4HR7A 5FFXA 4H7PA 1MB3A 3RSFA 1JUSA 1C2YA 1MW8X 4OY3A 4OJQA 2XEDA 1EX1A 1PDOA 4ZA2A 3N2NA 3TQRA 3GN1A 3SR4A 5JLXA 1QHFA 3F7MA 3JASA 1Z0JA 1OXVA 3JYLA 1AXEA 1HYQA 3DE0X 2X76A 4MKGA 4RZQA 2NZWA 2C97A 4GVXA 5IEBA 3DD5A 1QIEA 1LBQA 5CIYA 2C4NA 5BS6A 4UE2A 5E6UB 5B12A 3ZMTA 2X4LA 2O0JA 3MXOA 4WASA 1E2KA 3QA9A 3QI2A 4LISA 4BFCA 2Z2JA 1GJRA 1XQXA 3JAKB 3KKEA 4LZWA 4D3XA 2WYOA 2YQZA 1ACLA 5IKEA 2XEXA 3K3PA 5F76A 2P62A 4HFJA 1GNTA 4C0XA 3FLAA 1M10A 1O1YA 5EKUA 2FW8A 1KEUA 3PCXA 1EKXA 1A4UA 2R6ZA 1PZMA 1CYEA 3GA7A 3AW9A 2VYQA 1HYBA 2XYQA 4HY3A 5HMMA 3L7WA 1T1EA 5JHHB 3R77A 3SKYA 3OZBA 3H16A 4BO1A 3A1NA 1MAAA 1PUJA 5EE1A 4GGOA 4KN8A 4UM7A 1ISIA 5EP1A 4TT3A 4ARVA 5C8VA 4R2HA 1SXJA 1YMQA 4Y2SA 4PX5A 4PUSA 2CV1A 3Q3GE 3T5GA 1Y1RA 4JKOA 4X6AJ 1WIWA 1N5MA 4BECA 2KYRA 4AAYA 3GRUA 2CLMB 3VBCA 1OH5A 1XLUA 3LOPA 4DQUA 3WRYA 5C32A 4QIWN 5HDQA 1NKVA 1EEHA 5FOXA 2RKWA 4KAAA 3MGGA 2G5TA 5A5VA 1ZOOA 4X1KB 1BEEA 5IG2A 1QPMA 3BVPA 3JARA 4IDOA 2ALJA 2Y9PB 3P20A 4EBBA 4NK4A 1XU4A 4I2VA 4LOHA 2PZMA 4HH0A 2I3AA 1UJBA 3MJDA 3HCPA 3L6EA 3OQJA 2HOAA 1HH4A 3VSKA 4GOLD 3EWSA 3CZ4A 1R16A 1I1NA 1PL0A 4DQ2A 2QGZA 4PR3A 3GFPA 4H17A 4Q7MB 1IUKA 4TUYF 2YS6A 2ZSBA 1DKPA 1LTHR 3UNXA 3HGGA 1SKYB 2ONCA 3NPMA 2E6KA 1TVKA 4Q7QA 3HPHA 3C8DA 3G0IA 1ZHHA 2BEOA 1JT2A 3ESCA 4OLHA 3FVVA 3IC7A 5GWXA 4PG5A 2ZSAA 4FDAA 2Z98A 1D0VA 4BO6A 5LDHA 1I2BA 1GGEA 2XT0A 1KL7A 4QAJA 1ZPDA 1DJPA 1JDVA 3PGJA 3ZQCA 1T5SA 2X5OA 2F4VB 4D3SA 1J70A 1OXTA 3WTVC 1EVYA 5HW0A 3LPCA 2PUBA 1DEOA 2H6EA 3CB4A 3VNRA 3ZZ1A 1H2EA 1Q1EA 3WQSB 4RY2A 2CLEB 3G8AA 4PM4A 3IL2A 2PTGA 4DV2B 3T5PA 4RVCA 2BI8A 2K2WA 2DBZA 3HY4A 3A0RB 1X9HA 3U80A 3G7SA 3UB2A 1EBFA 1F3LA 1JQEA 3GU3A 4C1BA 2X0IA 3BA6A 3OZVA 3CUYA 1RJWA 2OO5C 4GWLA 3LO5A 1TVEA 4MHTA 2E0IA 4ZZIA 3JR9A 4J1NA 1I4EB 4BE2A 4DEYA 3GJXC 3SS7X 4HNAB 1D2CA 3A02A 1BE1A 4R0VA 1NC1A 3JREA 2VC2B 1NF2A 2J3MA 4BNKA 3ZY5A 1SWWA 1S7OA 2AZDA 5B64A 4JX9A 1YK0A 3K4BA 5JPIA 5LYJF 1I1GA 4D7AA 5ENVA 4C0WA 4C78A 4NHJA 3G1OA 4G89A 1TD9A 3IULA 4XQCA 3P4UA 5FD6A 3K1TA 4F3RA 1Z2CA 2RI1A 2D6FA 3GLGE 1XSEA 3ERCA 4UUQA 2DCEA 3OOJA 4B4WA 2BXYA 2BIFA 2WF8A 3PL8A 3O0DA 2XE8A 3I4LA 1Y6IA 2Y05A 3QF7A 1TUIA 3L40A 4YCSA 3VR0A 3MFQA 1UBOS 1ETXA 4B0OA 4TTPA 4M8LA 4DV3B 4BVAA 2V0GA 4GGGA 4EM0B 1Q21A 1OLXB 1E2JA 4X93A 2FD5A 3GCZA 3GHHA 3SXUA 1BXZA 3E9QA 3ZEAA 1AKHA 1JEOA 1L4HA 2WPDD 4L9AA 2AN3A 5BUCA 4B3FX 2FTKE 4D4JA 2P5UA 2DHDA 3VKUA 3ZV3A 4C0LA 5KWJA 3AETB 3DTEA 1GA1A 1GEGA 4BE9A 3ROKA 1N6KA 4AY4A 3JW4A 1B43A 3HKZA 4ZZLA 1NXXA 5GAEJ 1P4WA 4BC1A 2BXZA 4G8CA 3R0AA 1K4KA 2ZP1A 2J4CA 1TAUA 4R1NA 5AP9A 3IUOA 1W0UA 1HY3A 5DYMA 3E8XA 2A5JA 1TWFJ 4EY8A 2K5UA 3WZ2A 5FB2A 4JJIA 3WTZA 4YXWA 1UAAA 1UODA 3HYRA 3C6YA 3T1OA 1CG6A 1GCUA 3DF8A 2CL6X 1LEAA 1U9NA 4ZT4A 5EWLB 2HX1A 3NHKA 2QTLA 1B6AA 3O7WA 3K4MA 4Q4AA 3WIDA 4H31A 1Z3CA 3QYAA 4FLEA 3AHFA 4I14A 4OP3A 4I0BA 1TZJA 5D3KA 1ISFA 3I56I 1XZLA 3IP9A 2J45A 3L6UA 1IRIA 2WSIA 1ZVQA 4IIYA 4D8WA 3G73A 1YBAA 4NARA 4C05A 3RZOJ 1R71A 3A1UA 1A1VA 1R5NA 1N9ZA 2JAUA 1U8XX 3LRXA 3OSUA 3L6RA 2BBOA 4G8DA 4QEKA 4FMBB 1DDGA 4K2AA 1VJCA 3AUKA 4MXDA 2JKZA 4QOFA 2QTZA 4A3SA 3NBAA 3LVQE 2QZSA 2P2ZA 1WQ3A 2X77A 1R4AA 3FIJA 4FD2A 3TAHA 1MTZA 1F0YA 5KTMA 1HDZA 1XDGA 5HZHA 3VPHA 4LVOA 1ZMTA 3WSWA 3ZCRA 2OCLA 3BSFA 2FN3A 3K15A 3COYA 5DI3A 2JA7J 3UW1A 4H0EA 3Q7PA 3VX4A 4OJNA 2KLHA 2WLSA 2PBIA 1RXEA 1NVVQ 3W5AA 1AGNA 4ZVQA 4NXMB 3EHEA 3FOFC 4GMHA 4NMHA 5E7IA 2ME6A 4NV3A 4ZEMA 3O83A 2Q1TA 1TCUA 1Z12A 4AJ9A 3OWOA 4ZGWA 1XTKA 2ZAIA 3E6BA 9ANTA 2WABA 3BTJA 3M6FA 4X0EA 4V3CA 3W04A 3TKLA 1DV1A 1YFZA 4P7GA 3GGOA 5FOVA 1ZD9A 4F7ZA 2JFFA 2BI7A 4LK2A 4PYRA 5T4BA 5DHTA 5GINE 5EHZA 5LN1A 3A1YA 1RUNA 1OFUX 4IL6C 1RADA 3C3WA 5FJ8J 1ODSA 3VGPA 4S1VA 1O2DA 4ER3A 4TVKA 4Y98A 3S2EA 5J4HA 2GZHA 1CY0A 4QU5A 2HQOA 3GEPA 1R4MB 2X2FA 3TDNA 2PWYA 3FUCA 1WNTA 3DEAA 4FFBA 4JI3B 1L7NA 2NS7A 2LW7A 3LOCA 3IEUA 1U8YA 4GUAA 2EW1A 2ZSIA 2P5SA 3UAVA 1TECE 1YU6A 2F6CA 1SVMA 1VCMA 2XF5A 1OWNA 1TGYA 1HA3A 2HA6A 3HE3A 3VOEA 4F12A 3KYDB 5IVPA 4DCCA 3G5LA 3U26A 4C7JA 2DQLA 3FKIJ 5GJWC 1ZGCA 2FX3A 5A5FA 3LNCA 4O2BF 1JL3A 5KDDA 4Y7NJ 2KZVA 2JJ8A 4M8KA 5KTRA 3DTVA 5FWDA 4K6CA 1Q11A 5FA5A 5JSZB 4MUFA 4X1YB 6LDHA 2PS3A 4DV4B 3MT9A 4EJ2A 3GNSA 2B35A 3UAZA 5KNDA 3DFIA 1U3TA 5ALHA 4XVCA 1Z0XA 3I9NA 3L9WA 4YRFA 3DEHA 3OQ6A 2GOYA 4R2XA 4C6TA 5DNWA 2JCXA 2RHJA 1NJGA 4N0QA 3UK2A 3H2YA 3YASA 1J59A 2F00A 3GLUA 1OYIA 4QTUB 2HHLA 2C8VA 4HLNA 5B58T 4TOIA 4G8JA 4QDUA 2GTIA 4DT1B 1IDYA 4NYJR 3KZZA 2WJ6A 5LUBA 3X2FA 3N2IA 1EIZA 4O6VA 1BH2A 4NXNB 1C3OB 1YFHA 4MUNA 3NVMB 5CB6A 2FF7A 2CGPA 4OHXA 4UNRA 1SBNE 1RMTA 3OPYB 2Q4TA 2DQRA 1RM3A 2A5WA 2GTPA 1L5NA 3ICEA 2RVCA 2ILVA 4YRTA 3U37A 4RDXA 2XB5A 2DX7A 3ZXIA 2W6PA 3DPUA 3EF1A 3F96A 5JR3A 3DEYX 1JTFA 4G0UA 2GF0A 3RRXA 2WZQA 2PZJA 4MAMA 2DUNA 2NIPA 1DLJA 4I5GA 3T7SA 3BWEA 3KKZA 5B5SA 3IHWA 3WB0A 1RAHA 1G3MA 2YQ5A 4FGWA 2FQ3A 2YFKA 2DA3A 5ENDA 1HBXG 1IXRC 1ZZGA 1JTEA 2JGMA 2KJBA 1FU8A 3UG6A 4WAUA 4GVPA 1FMJA 2I2DA 3OWTA 3CN9A 1IAQA 3LGSA 3W05A 4DR5B 2C5EA 1R6RA 5HRAA 4FLFA 1TJPB 3WFZA 5GADl 2VDNB 4OHWA 1CF7B 1E77A 3KYCB 1VI6A 1OXUA 5JH7B 1S7AA 5LD2C 1CB7A 4NICA 4E5UA 2I2XB 3P9IA 2RJNA 2ME0A 4NQZA 3D4BA 3EZXA 3MTBA 3WGMA 2PD6A 2IY8A 3COJA 2BY4A 4MRMA 3R8XA 4AZ3A 2JZNA 2RD2A 4ESBA 1DGRM 1VJ0A 3IKMB 4QOJA 4POOA 1P19A 4D7MA 1XG5A 2QN6A 3ABOB 5KAIC 2BFEB 1EFPA 5H20A 1XF9A 1UM9B 3OAAA 4QUAA 2Y2UA 3FVTA 2GZ3A 3WHKA 2Z30A 4KQ6A 3KAJA 3QPCA 3SBEA 2OM6A 5GTDA 1OZHA 2HQRA 1JF8A 2DP4E 2PZAA 2CDNA 1ZVJA 4GLLA 1JPVA 3EEFA 1C3XA 4I8DA 4TXNA 1JR2A 1V6CA 2VHJA 2DR2A 3BDAA 3QLEA 3N70A 4Q66C 1ZU4A 1WSBA 3DL7A 3FXKA 2JA6J 2I6QA 1Z9CA 1CUAA 3E5UA 4LBWA 1Q74A 3O3CA 5T41A 5A6SA 5JH7F 1WSWA 2Q62A 1W0JD 2FDCA 2F5FA 4FT4A 1ZH8A 3RC1A 2R7WA 5FOTA 4XLAA 3DE2X 4RD4A 3O03A 1GZVA 2ZBRA 4MPPA 2OCYC 5DLDA 2GCNA 1NN3A 4JI1B 2XUBA 1V4NA 1YDGA 1BWSA 1GCIA 1WB5A 3GG9A 2MR5A 2WMOB 1UB9A 1IJFA 1MGTA 3C8ZA 4KYIB 2O3TA 1U1IA 4HQLA 1ZS9A 4BVHA 4LIPD 1HCRA 2I7DA 1OYVA 4XIJA 1GTG1 3BMQB 1MJGA 5A9SB 1LDKB 4MPRA 1QIFA 1KHHA 1I5OA 4CKXA 4F1KA 1B9NA 5J6XA 3GT4A 4F4DA 5A5EA 3I61A 1DG3A 3LRPA 4J76A 1ZG3A 1Q15A 1RIIA 2QN9A 3ECCA 4LVNA 2Z6UA 5LQDA 4LWPA 1GWNA 1E96A 2A88A 2QLMA 2L9RA 2XMQA 4E7HA 3VOAA 1JQJC 3M6WA 1FRNA 2CLOB 2WKPA 1FTNA 4PJ0C 1XD2B 3QSYA 3R5TA 1ZOPA 3D7NA 3P9RA 5F7ZA 3VR6D 2PA3A 4JB3A 4YCAA 3GJ4A 2P1DA 2Q41A 4ZIRA 2HQBA 4RBOA 4ZYWA 4Q9KA 1WHTB 2J9XB 3AR5A 1IDZA 1ZP6A 1Z5OA 3R0QA 2B94A 1WTCA 1PQ4A 5JJLA 1DC7A 3SIRA 2QIOA 3S1QJ 3TW4A 1KU3A 3G9UA 5F33A 5EP4A 3FDYA 3VSLA 3FBNB 2P41A 4D0SA 5J43A 2P35A 4F97A 3K9LA 3I8OA 3B70A 2AC4A 3K1YA 3OR1C 5JRJA 4R0NA 4S12A 3X1MA 2X13A 1GILA 5HRCA 1ACMA 3NQ41 2FUNB 1YCFA 2GASA 5ILVA 3L2CA 3OIWA 4N0MA 4K6MA 4MEAA 3DBHA 5IDQA 2E82A 2CFTA 4N6NA 1ZD8A 2N0SA 1TK2A 2IIPA 4WKCA 5D6EA 2F5DA 3HM5A 4BNDB 4NI5A 1F8GA 3MWJA 2B8EA 3LUKA 3ZVRA 5C34B 3SJAA 1UP4A 4GHWA 3IS3A 1PK9A 4U5XA 4HH3C 4IAOA 4Z0HO 1WCYA 3ICWA 3HBJA 4QGBA 2J6CA 3N9IA 1KSFX 4OFZA 3G9XA 2O6HA 2K4JA 5J3LA 1UL1X 4JBXA 3IWZA 4CH7A 3C97A 2FSWA 3QP9A 4AUMA 1C0WA 4AIJA 3PJRA 2KPMA 5FXMA 3V1LA 2O07A 2ZYUX 4HF1A 1S3GA 3B9QA 1UMCA 2WM8A 2M8GX 5I9IA 4NQWB 1RPAA 1A04A 3D6JA 3FHNA 4DLAA 3ED5A 1J22A 1SAUA 5GV7A 3HJNA 4TGLA 3O84A 3MZYA 2GAJA 4C87A 1KVUA 2YBEA 3AGPA 3NIWA 1YZVA 1MO6A 5ECWA 2Z6QA 1YQ9A 2C0QA 4MWBA 1YWGO 3OUZA 3CCUI 4EG6A 1DQNA 2HLPA 1FLAA 3TF5A 3O95A 1U9CA 2XMRA 5BP7A 4MR7A 1X19A 5LP6F 2I6XA 3IUJA 4JLMA 3RC9A 4FNAA 2ZXEA 3PR2B 4FYYA 2PX5A 3BAFA 5J2UA 5I48A 4WCFC 1K7CA 2P2LA 4ARCA 3RSGA 1KIMA 1FA9A 1P44A 3WMFA 2UYCA 3OYCA 1FOEB 1DDNA 5HKKD 3M4XA 2LR0A 4L4XA 3D1LA 1D6JA 3ONQA 1KKMA 1VB5A 3WJ1A 1NKSA 1W5EA 2LBFA 4AKSA 4FDLA 3COZA 1YU9A 5FQNA 6PFKA 1GL9B 4PPGA 1H9CA 1AO0A 1JQAA 4P4NA 2FSGA 2K9QA 1GDTA 3TX6A 1R6VA 4JT9A 2GXQA 3DVSX 2W25A 3VR6H 1D5VA 4IV8A 3K5WA 4HGOA 2LD5A 3CTMA 5GGYA 2PGLA 2EGHA 3NP9A 4G8BA 2HMVA 4CM8B 5F0HA 3KUCA 9ABPA 3MFKA 1RAAA 2E49A 4FB4A 4AKEA 5EI5A 1YRWA 3W5UA 4A5OA 3BL6A 1QE0A 4D9HA 1Y33E 2BMDA 4HRVA 2R87A 3OL4A 4BEVA 1SUAA 5E1OA 2VATA 5AI9A 3H0GJ 5GGXA 4HX2A 4MV9A 5L95A 4RK5A 1MENA 3FR8A 2Q0SA 3HHEA 1MO3A 5GJBA 2XCOA 2J4FA 1QZXA 1P6UA 3RYFA 3GVIA 2VL8A 3WGZA 2Q5CA 4DYQA 4KK4A 3C5HA 4RCVA 5A5DA 3GUVA 2BUBA 3HGTA 3I3LA 5DNYB 1G9TA 1YQGA 3I5XA 2EF1A 2Y9MB 5C4JJ 2ZSUA 1E3JA 3GQBA 4IRIA 3I53A 3NC0C 1URPA 4W5RA 1NVKA 2VDQB 5EGOA 1U31A 2TDXA 2OHVA 1F9AA 4K8OA 4RJ2A 2I3GA 4EB8A 1R9JA 5ALKA 2P2CA 2FX2A 4FX5A 1G5QA 3C3BA 3KLMX 2DSTA 3WOVA 1JU9A 2GZDA 3U44A 4O25A 4EY6A 2JJ2D 5FPKA 4B3GA 1GNRA 2OU2A 1GD1O 1Z4PX 5L9AA 3JTMA 4AC0A 1DBWA 1R9TJ 3PFCA 1UZUA 2V55B 1U3VA 2O2DA 2NW6A 1T10A 1II0A 5TT1A 3ZMUA 4CKEA 1JJ6C 4QU9A 2YYYA 3AOEA 4RGXA 4O6JA 1JBQA 5KJ6A 4UMEA 2VZLA 3ADCA 2XZTA 1K83J 4XD2A 4RPLA 4JI2B 3PFYA 5ICGA 4RGYA 4YTEA 5AOAA 4ZYGA 1QE3A 3P0EA 1XCLA 2OLJA 1Q1BA 2IXAA 4P96A 3JRBA 5J2TF 1ULAA 4KXYA 4U6NA 4BQRA 1G4AE 3VI4B 5FBHA 4DREA 1CP2A 5B1AH 4JEMA 4MGHA 1KI4A 1L7VC 2CFRA 4C3IJ 2DMNA 5TJJA 4CLDA 1XJQA 3BQYA 3CJQA 4BJ5C 2QUKA 5C4GB 2H3HA 1L8OA 3QAHA 1J8QA 3FWKA 1EZZA 2GN8A 3EJWA 4BU2A 2VAPA 1E98A 4KMUX 3IMKA 3PYLA 4IOMA 4GM4A 2WHPB 4WA8A 1CKEA 3AEQA 2DUMA 3FOCA 4OP1A 5BSGA 3S2DJ 2FQWA 3T34A 1BC5A 4KISA 4M9XA 4TTRA 1P73A 1WW8A 4P84A 3KRTA 2C1ZA 2RI6A 5JSYA 1FT9A 4D5CA 2JUCA 3SFIA 3QOPA 4HRXA 1BA2A 3ND5A 1XF1A 1LEHA 2UYYA 3AKZA 3ASZA 5E9JA 1NBAA 2WTBA 3RVSA 3HVHA 1RJ9B 3ESBA 1PUXA 4WZAA 3U3KA 1V55H 3RC8A 3M8KA 5ICMA 4IIUA 5EYRA 2XRZA 4E33A 5F9FA 1E5VA 1NNLA 1SG0A 2D5VA 4C6RA 4MV4A 3SQLA 2V7VA 3E9ZA 4OFWA 3NH9A 5CBPB 4P4TA 4CR7A 3WLFA 2RE8A 2QTBA 4M0PA 1GLVA 2WWIA 5JWHA 6PAXA 4DUZB 1P4SA 4X7PA 3BTLA 1IHPA 2VPYA 2BR5A 4H2DA 3M7GA 3B48A 1NU6A 3KV1A 1IW7F 3W1WA 2IZZA 3BJEA 2X8BA 1QWOA 4X1IA 2XTAA 1G3SA 1TCAA 4QTTB 1GLNA 1DRVA 2M8EA 1L5OA 2XUKA 3DE5X 3MRTA 1QFXA 3VOBA 4V0OA 2I71A 3IQXA 4NOLA 3H2SA 2FCAA 2ZWPA 3H2BA 4CLEA 2FE4A 4ACAA 4O0MA 4KN4X 3MWKA 4KLRA 3T7AA 4HQ0A 2P5LC 2PYDA 3QY9A 4G0OA 4AK9A 2BEWB 2ZVJA 1XCMA 1CY7A 4XARA 4AJLA 4ZZDA 1C3VA 1RZUA 1ZNZA 3ZGXA 1PR6A 2JPCA 3BXEA 4YUXA 4PC7A 4WE3A 3NEAA 1FQWA 1YB6A 3TM5A 4JI8B 2QX8A 2Z8XA 3UHOA 3RWOA 1CJUC 1Z37A 1R2QA 2W8BA 4QPPA 3LDAA 3PF9A 2GN1A 2C6YA 2VUHB 4PZYA 2LH9A 4ZOLF 5DCLA 4D3ZA 4MS1A 1KNQA 1I1OA 1ZVKA 2AOXA 2PO5A 4A2CA 1G291 1U2ZA 3TBFA 4ZAZA 5FV7A 2VBYA 5FIUA 3K09A 1I2DA 2CJWA 2OZPA 3CH5A 1B23P 2IYLD 2P5VA 4F9EA 4CKBA 1L0BA 4FZ3A 2VRBA 4TWZA 1GGFA 2YQ4A 4I99A 1TC1A 4Y0NA 2VBZA 3TFQA 3EULA 1HX7A 1R6AA 1EH6A 2D59A 3CONA 1NW6A 4DR7B 3SQMA 1L3LA 3WV4A 4N8SA 1OFUA 1H6DA 5LGNA 4YRDA 3B3AA 1UXOA 1SD7A 3WYCA 1M7GA 3ILXA 4KT6A 4RNDB 3LM8A 3WGTA 2XWJI 2SBTA 2ZB7A 4A3JJ 1STZA 3DBVO 5IYZF 4AF7A 1OWPA 3WHPA 2FMKA 3ZI0A 1ZI8A 3I0TA 2WTMA 1UFVA 2IIVA 2D1HA 5IF9A 1E9CA 1GY8A 1BW6A 4ZHSA 3W5VA 1OCRH 4HSEA 2X86A 5BWBA 2YXDA 1U11A 5BMOA 2QQ9A 4RJJA 2L0KA 4FGSA 2B82A 3LG2A 2B36A 3FYUB 1WHUA 1H23A 2GCOB 4ES6A 4OX9Y 3P2YA 2MJLA 5KU1A 3L43A 3UMFA 2NPIA 2DA1A 4C7OA 1G60A 4XONA 4EHLA 3MVPA 4F4UA 1X7XB 2D1SA 4J90A 4L02A 2Z0MA 1LDYA 3T9BA 3ZDRA 4DR1B 2Q8QA 3LMKA 1K6IA 5IOYA 1DRUA 2REQB 3COPA 3VKFA 3HCOA 2GXUA 5K4GA 1XTRA 4WOCA 3MGAA 4PC6A 1ODKA 4UE6A 3OC6A 1V4VA 3GLKA 4DGQA 3LCVB 3TFWA 3VH3A 3HSFA 4OJYA 2B69A 1BC7C 1U02A 4E1BA 2Y8EA 2CJFA 1E2XA 1C41A 2CHGA 3EQ8A 3QEAZ 2A2ZA 3OKCA 4IOCF 4RZ2A 2CVOA 1NFFA 4CG2A 4LYAA 2XCIA 3WK6A 5BV2P 1C3EA 3DCNA 3O3KA 1QGDA 5IBRA 4MWSA 1CJBA 3GWGA 2YMMA 3TZBA 1DU0A 2VDVE 5GPBA 1Q57A 3ROFA 2OBFA 3BEOA 2OGWA 3RKSA 3D8RA 3I4NJ 1GL3A 5CBKA 4NG5A 5IS2A 3T95A 2H2AA 4MJ3A 2G70A 2OFOA 2ATEA 3THYB 1P17A 1ECLA 4EM2A 1XJWA 1J2YA 1ENZA 3RU7A 2QTVA 4RETA 4B4UA 1JALA 1H0RA 4YP9A 1JKQC 3EFOA 2Q2EA 3CNHA 1V5GA 1YLFA 5FFNA 2FDRA 4J9UE 4F06A 3GEGA 1HQCA 2EKBA 4RKQA 4BNLA 2JGDB 2XITA 5IC6A 5DUKA 1IL0A 4GKJB 4CMHA 3V7YA 4Q7KA 3H8SA 1PZXA 4CN8A 7REQB 3EOZA 3MOIA 3SLRA 2DKOA 3JSPA 2ETHA 5C1DA 4OHPA 3R9XA 4E7ZA 3GEBA 4LB6B 1YJ9I 1QOZA 2BMAA 1BRTA 4AYTA 2H0AA 2RG7A 4N9WA 3WK7A 2GKGA 1BI2A 3CWQA 4OHBA 4KXXA 3CNNA 3FDXA 1LU9A 5I7EA 3ELYA 2Q3DA 1QHHA 4KRGA 2P27A 4HF7A 3EIEA 1YKSA 2FY8A 2OVFA 3D3WA 4GX5A 3MTIA 1QRTA 2GJ4A 2GKSA 3OCUA 1GAWA 2X0DA 1FTGA 1ETVA 5J4LA 1K9VF 2IYSA 2Y6UA 1SBHA 3NP7A 4YJKA 2DWOA 2GPNA 3MMYB 1UMDA 4Z4CA 2I0FA 1EUQA 3VU8A 5B6PA 2GQQA 3HKEB 3IT3A 3L8DA 4NP6A 5JFTA 1PTJA 4PPNA 4B8YA 5LP1A 2WV0A 5L3QB 2PUEA 3UAXA 4II2A 2IHTA 3RRMA 1BJAA 3TZEA 1FVFA 3WS7A 4EL5A 3ORSA 4UEKA 4B3IA 1PVEA 1XD8A 2IHYA 1DWOA 1CRWG 2BUAA 3AEYA 1SQGA 3G0HA 3LLMA 4RZUA 1AVTA 1L5ZA 1FYXA 2YHIA 1P18A 1D1BA 2OAZA 2VP4A 2V9VA 1PJ8A 2GCPA 1P4XA 2GNAA 2V1DA 1G5RA 5DRTA 2CMFA 2P7IA 3HJGA 1XQ9A 3TSOA 3KE8A 2BYTA 4N0DA 4UBNA 4JXKA 3C7CB 3UK6A 5E3HA 2BE9A 3KPYA 5EG0B 3WY9A 3CJNA 2MSEB 4YRPA 3TAUA 3OLXA 4M7RA 4EG1A 2Z57A 2GCEA 4J0EA 1CC1S 2WD8A 4IJWA 4O3MA 3QJ5A 2ZIXA 5DP1A 4IIEA 4V19K 4O0LA 1KMNA 4MICA 4AW9A 3L79A 2J3HA 3QVLA 3CESA 2K4MA 3JQPA 1L5GB 4C9YA 1NJSA 3NONA 4FFOA 1RE1A 2XOKD 2OLEA 3GY0A 3WRWA 4N41A 3GLRA 1DRJA 2BFBB 1IXYA 2ZG6A 3TBHA 2HZTA 4KGXA 1VP9A 1U6GA 1N5OX 2ZXWH 5FV4A 4EOGA 3A37A 5TJ9A 4AF8A 3OM0A 4A92A 1CUZA 3A6PC 2X1DA 1DIBA 3NDJA 3NJ4A 4U63A 621PA 4Q48A 1M34A 1R6DA 4BJ6A 1G2QA 2D62A 5FO0A 1IY8A 1C1XB 3CLRC 3BG9A 3KO8A 1H3FA 3TPCA 4ETIA 4HUJA 4HAZA 4D44A 3OVMA 1QHSA 3UA4A 5HX7A 3LNQA 4GLFA 4NB5A 3EWNA 2BM1A 3PFKA 4DAOA 1DBSA 3RR2A 4TSFA 1EMDA 4UVHA 2HT1A 3EZ2A 2LY9A 2JGNA 5FO5A 2CW0F 1E7QA 4MVJI 4QQKA 2QRGA 2HXYA 1W4CA 2OD5A 4XFDA 4XOIA 3QVOA 4NL4H 2BFPA 1YACA 5E7QA 2KIQA 4KFTA 1W47A 1COWD 1D07A 4F71A 1QO0D 3K5PA 5DV9A 3GAFA 3MJCA 3IXMA 4B74A 4X41A 3RFUA 4UTZA 5COBA 3MPOA 1X80B 3A0BC 2FRXA 3IJ5A 2C4VA 1XZQA 4LOIA 1XKQA 3OS1A 1IPEA 2A9QA 2G76A 1VQMI 1O03A 1ZESA 1T8TA 5F3WB 4CHTA 3RIRA 1HMYA 2GGSA 4KLCA 4QG7A 3ACCA 3SM9A 4EPYA 5B6JA 4J16A 4PRLA 3FYSA 2ZRDA 1V5EA 3ILVA 4D02A 1VQLI 3O2QB 2C5HA 2Z58A 2IRWA 2H07A 4IM7A 3BR5A 1JEAA 2K7LA 1L4MA 5TQ0A 2QRNA 1M6NA 2GAFA 4TQUS 1CETA 1OSNA 2RGNA 4ZK2A 2BFAA 4YT4A 1LB2A 4J0KA 1RJFA 2O5CA 1KQNA 5EAIA 1TCVA 4X66B 1EM8B 1VZ3A 2IPMA 1P0QA 3JQDA 2IOFA 1VG0B 3LFKA 2FN7A 4RA6A 2NSLA 3ABSB 3D2LA 4HATA 4Y2HA 3I1IA 2G9QA 1VKZA 4RF4A 3S1NJ 1VG8A 3QXXA 4JX8A 3I6ZA 2F1OA 5KPJA 5GIPE 2C2GA 4A6DA 4HEQA 2F6RA 1SOMA 2GIZA 3HP7A 3QYFA 1QPZA 2BY1A 2IKQA 3AIKA 1I33A 3LA6A 2ZJBA 3BD7A 3F0CA 1V5WA 1S8NA 1C9DB 2C2KA 2DCUA 3KELA 3Q4GA 3F3KA 4A23A 2STWA 2A7QA 3JAMK 1XRJA 2QM8A 1Y98A 2GD1O 1FSEA 2K40A 4V03A 2ZZNA 1R23A 3K16A 5KTKA 5ALOA 3TN7A 4F2WA 4EEFG 1YZQA 1RXSA 1DGWY 1KO4A 4PJLA 2R7SA 4OEHA 2GRAA 3AG5A 5HCNA 4CCJA 3FMGA 4BQSA 1G8GA 3T3NA 1C7IA 4C21A 1XVVA 2G0TA 3RK4A 4P81A 4CQLB 3DAGA 4HC4A 1IZZA 3TE6A 1PJ3A 3OZGA 3TRFA 2B9VA 5ADHA 2ZZMA 4YBZA 4MI6A 1NC3A 4Y6OA 4FOTA 4XQFA 2REXB 3CO0S 2XGEA 3A6JA 4UBIA 4TKZA 1JGGA 1YYVA 3PRKE 2VXYA 2ZJ2A 2GX6A 3CDHA 4ZU6X 4XSVA 5EE3A 1RKTA 1MJBA 2GK4A 3T5MA 2H1IA 3ONNA 3AJ9A 4LF5B 2DTDA 2I7TA 1V6AA 4I9HA 5KTNA 3DVRX 5LP6C 3X1DA 1KI7A 3OICA 2PRSA 3OUUA 2OG2A 4K9LA 3U4DA 4PANA 2P79A 2GEKA 2JEZA 3QU5A 4AJHA 1QVRA 5TNXA 1UPCA 2Z4TA 5K05A 2H11A 3G0GA 4E70A 4DLZA 3WDLA 5K3FA 1NMZA 4OBXA 4HYEA 3UUFA 4X85A 2TRTA 3GLVA 4DNFA 1CCWA 1KJWA 2OWEA 5KVRA 1P8JA 1EE2A 3RK1A 2D5CA 4R1SA 1UADA 3X1JA 1YAJA 5DGIA 1PNOA 3HYLA 2O8FB 2GYYA 2WYIA 3QU7A 4ZMSA 4BGUA 4OKSA 1SFOJ 1SK9A 5LKRA 1WMAA 4M3GA 3GJZA 5HOOA 3DVLA 4X54A 1UBKS 3HCCA 3IJEB 4AZ0B 3O1LA 5KHLB 2OBLA 3G5AA 2C0CA 3V8MA 3MNFA 4CF6A 2MGQA 1PJTA 4I6EA 3VO1A 2D1TA 3T9FA 3KALA 1NIJA 4K9PA 1PQYA 5CB0A 2HB6A 2P0EA 4OTZA 4HLXA 2C59A 1C14A 2QLNA 1VC2A 3IEMA 1FNMA 4XCVA 3OFJA 5KUTA 4EV0A 2IZ6A 2JBAA 2ONZA 1R1VA 3L7LA 4ZJZA 4ENWA 3NT4A 3FCYA 2CSXA 1VL0A 2XODA 2VNJA 3U13A 1MBZA 3CN7A 1CQJB 4N3NA 1TCBA 4UJ3A 3U3JA 4RSHA 2IT1A 5IN5A 4TROA 4AFNA 2R751 3SMVA 3H2ZA 3H6GA 3B5IA 1T1GA 3EDRA 1TC3C 4NYIR 4J49A 2DFDA 1DBIA 3UT0A 3KVOA 3KQLA 1NVUQ 2Z3VA 1SD4A 4CCWA 1G5HA 1IN8A 3WTUC 2DKFA 4JSTA 4NAUA 4RL6A 3DVAB 4ZARA 2JVHA 5JSUA 3ODPA 3FSEA 5IHXA 1UPTA 3QIVA 5AK5A 3PUXA 4E4YA 4RKEA 1PZEA 4E4TA 3TQTA 2HZDA 1QGUB 1RIFA 2IV2X 1RHQA 4ARAA 2ZVDA 1ETWA 1G2IA 3QFCA 4KDRA 4RGBA 4MHSA 3OKAA 4NF2A 5AW6A 1XT6A 3TXAA 1EDOA 1YJAA 1CZHA 2WMYA 3PWTA 4CTOA 1R6XA 3EGXA 2JIBA 2X22A 3QMPA 2E4VA 2ZS9A 1AKYA 1HOXA 3A25A 5KS2A 1J07A 1MW9X 2E7XA 3BDIA 1M76A 2H57A 5LB4A 5JZVA 5D87A 4HOBA 2QAGA 2YOFA 1J9GA 4AUKA 1V1MA 3KTDA 3L00A 4J4HA 4REOA 3VAZA 1HBJA 3N2EA 1P7VA 1B6GA 2CUFA 4W63A 3AZPA 4YUAA 4BB5A 2BCJQ 4ABZA 4K0KB 4Z4HA 1CS0B 4CIVA 5JY1A 1ODLA 5EUQB 1YHQI 3W06A 1DL5A 2P7HA 3LDHA 1R5ID 3UUWA 3KKQA 4OLJA 4IRMA 4C88A 2CJXA 5CB8A 4K9QA 2XQIA 1W85B 5CDSA 4OQNA 1CUBA 2CZQA 5TT0A 2WUFA 1P9NA 2YWGA 3L0CA 4JLAA 2CBXA 4LCBA 4ZQEA 1YTYA 1QAMA 4KK3A 2QX6A 2Y1KA 1L6IA 3TB4A 4EGCB 2WINI 3KZMA 1JNYA 1RWMA 1OZ0A 5JHFA 3CCVI 3BJOA 1JA9A 1K1EA 1KPHA 2INGX 5FJJA 1Q0RA 5DH9A 2PMEA 3SJ7A 3E9CA 3EOBI 4A3MJ 1T3ZA 5KYWB 2QJWA 4GCVA 3RYTC 2JATA 3S2FA 1KZ9A 1B93A 3SSOA 4LEIA 5BURA 1PFUA 3PZRA 5BWLA 2YWEA 4BIMA 1MBJA 4GUDA 2X5KO 2PY6A 2QD3A 4CF4A 3AL0C 5HGJA 1B0AA 4BRUA 3GOQA 1XN1A 1YZYA 4YV0A 2QG4A 3N97A 2ZS7A 1G6KA 4P0QB 2A7XA 5AIAA 2E4UA 2J30A 2NU7A 3JQ8A 3JZMA 3SP1A 3IT1A 3CLQA 3SVLA 3E3LA 2ZPTX 1QGZA 2FUKA 2X3FA 4D0LB 1G7CA 4MTCA 4MRAA 2HOTA 3WADA 4AWXA 3VOTA 4TZ6A 4XLEA 4OMZA 1QNTA 3RSOA 5JNUA 3EPZA 4CM3A 1Z56C 3NASA 1PLLA 5EJ6A 5I4IA 3LYLA 2JFHA 3BE5A 2HUPA 5CFMA 1HQDA 1Z75A 5E9QA 2FRDA 5DM1A 4ISCA 3L4SO 4UUTA 4OI2A 3WL3A 2IQIA 4HVLA 4CNBA 4BUZA 1SD1A 4LSMA 3MJFA 4EKGA 1MG0A 4QXQA 2A9JA 2NSYA 1JUMA 3Q3SA 4ZYAA 1QK5A 1EDEA 3H5AA 1TXGA 2P9TA 1HA8A 4IH4A 1VE7A 2R65A 3NV7A 1BJTA 2R7VA 3RSLA 1V37A 4KMOA 4ZN6A 3LK6A 5DSXA 3FBIB 2GBFA 4INOA 3N6XA 2O8DB 1PDNC 3GJ6A 3KYBA 5J1SB 2B20A 2BTEA 2ISQA 4M83A 1V16A 2WVHA 3V4GA 1GUBA 3WR5A 1LRLA 2PL5A 5CEJA 1D2GA 4DEXA 4B34A 1F48A 5IXYA 1L3BA 1LDJA 2VO1A 3SM3A 5LKAA 3QPDA 4HGNA 1I3LA 2IU4A 3F3SA 3D5EA 3VKHA 1Y3IA 1HZZC 1M2GA 3GT7A 4O3FA 1GDDA 5KNCD 2FE3A 2WSSD 3Q40A 6Q21A 4J0QA 5CYFA 1BMFA 3OX2A 1ZAYA 3U4IA 3HKZN 2YH2A 3FYCA 3PC7A 3HB9A 4IP0A 3PNYA 4WY5A 1I5RA 3RFFA 2AV6A 1DWPA 3U1DA 4EJ6A 5I6DA 2JLCA 1EUYA 3IAS1 5AI8A 1R0SA 5IX8A 1PK7A 5KI6A 3WMRA 2XGOA 3D54D 3NEJA 2CUTA 2RHHA 3SKVA 3VOSA 2W93A 4MWZA 1OXBB 3E2IA 3WLTA 3ZY2A 1XDZA 4JYZA 1RPNA 4P0TA 4D92A 3AESA 2VEOA 2C2XA 6ADHA 2ESHA 2D74A 3E84A 4JBHA 4XX0B 1ZH6A 3W2TA 4N7BA 1TAGA 1CDZA 1ZONA 4AO8A 3ITKA 2ABWA 4QQNA 2P2GA 5F52A 5GM2A 4R3NA 3NNSA 2HMTA 1WXQA 4ARZA 1IZ7A 1THMA 5HNKA 4GWKA 2QTFA 3ELDA 3LLUA 4XLPF 5G3YA 4YMGA 6REQA 3ABZA 1J09A 1EHIA 5AOVA 5CIQA 5IZCC 4ENMA 1GFZA 3KJEA 5CNMA 1N2BA 3OKFA 4L5IA 2QTMA 5A1TA 1XEFA 4M4SA 1J39A 3HOZJ 2O7OA 3ZNNA 3FYUC 2J0SA 4ZOQI 1ZICA 1ZQ1A 1IDN1 1F8XA 1IC6A 5K03A 1J06A 4J2TA 5KJFA 1RYHA 1DT5A 5EJGA 1EA3A 2D5LA 4E7LA 2OY0A 1XTBA 1MJ9A 2QTGA 1MA3A 2ZS8A 4Z1MD 1ESNA 4RTQA 2X85A 4RFSB 3MLBA 1SCNE 3NBMA 1HG0A 5L3CA 2QWXA 4K26A 5FFMA 5D2CA 4FT2A 2XUHA 4BDYA 3QEOA 5AIQA 2NTNA 5IDYA 1XRQA 1SU4A 4XDGA 3OF3A 3IBSA 3J7AO 1ST2A 2R7DA 3PHHA 3KEOA 3O2NA 1ETUA 4BZPA 4EA8A 1FDRA 4GDMA 5KYNA 2EZTA 2OTJI 4TS4A 1RI7A 1EWQA 4NR0A 5IVHA 5CLFA 4UM9D 3G68A 4E3WA 3TIXB 3JQFC 1AUXA 3N5KA 1NZFA 4HXFB 2NU8A 1FSFA 1Z28A 5LIRA 3DMTA 4YP0A 5E3JA 3PNKA 3D0RA 4B35A 4YCDA 2QM3A 3LOUA 4JK3A 4QHYA 3OZFA 3DZBA 1ZR4A 5KNCH 1CYDA 1Y4SA 5BQTA 4EYOA 1O3TA 1ZAOA 3B3GA 3RT7A 4NENB 1E8DA 4JVSB 1OLOA 1CZKA 4N3CA 2PBZA 3NHSA 1G20E 1QHXA 5CX1B 3JVDA 3D5RC 1U7ZA 5B3LA 2OBMA 4QJBA 3P45A 4ZVTA 4BX8A 4V3BA 1GZSA 5L53A 1AA7A 2H2FA 1Q95A 3K9BA 3HRKA 4BZWA 2A14A 4BAZA 1HQYE 1YAHA 3C6XA 2EZIA 2QSHX 2FR8C 1PS8A 1RRJA 5I8WA 4RMHA 3N5CA 2R7NA 2AJBA 3PDCA 3ROUA 5AK0A 1TTTA 1T0FA 1EGHA 4D79A 3EQ6A 2J3QA 4FXPA 2WVAA 4RYDA 2HF2A 4DA0A 1BJRE 2EEPA 4MITA 3CJRB 2PWBA 3KLOA 1PG0A 4O4JA 3OEED 4K46A 2HKOA 1ZUNB 2IYWA 5HDKA 2NSDA 4XPIA 2I55A 3AHHA 4UCXA 1REPC 3GC6A 1DQYA 5AM4A 1DAIA 3TPZA 4LECA 2EFCB 1LD3A 3M33A 4MQEA 2F8MA 2G9RA 2E1CA 2P2DA 5DGCA 2EWVA 4BO7A 2PFKA 5G2OA 2VXBA 1EYZA 3F1KA 3KZXA 3BSYA 1BEUB 3ZHUA 3IB3A 3P96A 2K85A 1WJFA 3X1ZA 1CZUA 1JYSA 4QE3A 1MSFC 2F9LA 4CW7A 1JLSA 1LVHA 3ITDA 5I3CA 5E20A 1RZRA 4G6DA 2XB4A 3G17A 5EZYA 3GLGB 3QVKA 4RHXA 2ZLBA 4YQYA 2HF7A 3BE4A 2GN2A 2CYCA 5G4KA 4LOCA 1XQ1A 1YDMA 3A9VA 1USIA 2L4AA 1A9YA 1QQAA 3CRZA 3ENVA 3VDNB 5CYPA 1CUVA 3VVCA 1NZDA 3TNJA 1RI1A 1RJGA 4JFAA 4XLLA 5FKLA 1X42A 1Z3IX 3V8VA 3V32A 3O4FA 4XOTA 3H11B 1U0GA 5AXCA 3R7LA 2L4MA 2MW8A 4W8HA 3QFSA 2H4YA 3VJLA 1NFQA 4UVGA 4YRJA 4Q9HA 2FGKA 4BHTA 3OETA 4LBYA 1OU0A 1TP4A 1IN1A 3TP3A 2MSYA 4EY7A 1E4YA 4LMYA 3EFHA 4WKBA 4UUMA 3L5KA 3GBGA 1MV8A 4MV6A 2XQVA 2DHQA 1VL1A 2W6ID 1HDXA 4MRPA 1NR1A 2CMKA 4QYIA 1OI3A 5CG1A 5AKEA 4A0RA 5AHWA 2LGJA 4M3DA 3VHXB 3NTXA 1GHCA 2VWQA 1R4NA 2MSKA 3PO3J 3JD4A 1C1DA 1HZJA 1UXJA 3DFZA 2YZGA 1H0KA 2OHFA 3Q7RA 5AVZA 4PJMA 4RPKA 3E5HA 2Z9BA 1RTKA 2R2AA 4FR2A 5E8GA 1TA0A 1TNTA 3MKLA 2HRZA 5CAEA 1NW8A 1OH7A 2AQHA 2ATXA 2AG1A 5KTPA 1YVPA 1Y81A 1GYQA 4WOKA 2V7XA 2JBHA 1BXGA 3K73O 2HAEA 3RC2A 1GAQA 3K69A 5D4RA 2OP0A 3NZEA 4P08A 1XZGA 2L17A 5ALJA 4LGMA 2KI5A 1R0XA 2HMYB 4YT5A 1NBMD 1JILA 4CJXA 1JE0A 4B0PA 4GGMX 5C1BA 1FFCA 3MQ4A 3HRUA 1EB8A 4ZJUA 1GRCA 1QTIA 4OYLA 2HU2A 3MEXA 1GT0C 3H1EA 3KXIA 3JSOA 1GRRA 1G8SA 3IPLA 3TBIA 2H1OA 2SKCA 2DHEA 4IIJA 3BWVA 3COSA 2O3UA 3LVFO 4E5DA 1KSHA 3LLVA 2VLIA