4KIGA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with 4-hydroxyphenylpyruvic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
332
structure length
332
Chain Sequence
b'SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 122
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kigA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kigA02
2P35A 3WTWC 3LCUA 2AN5A 2MH2A 3WE3A 1IXSB 4Y17A 1JXSA 3C3YA 1ZARA 4L9TA 3GXOA 2RNJA 3FM3A 4KYWA 3V4GA 5E17F 4HG2A 4G7ZF 1ZGAA 2PSSA 1X1CA 5CM2Z 3ZMVA 5K5RA 3TPZA 5D1NA 4R8SA 1OYIA 4I02A 3E5XA 1KQ8A 2K7LA 2O6GE 4BYYA 3C6KA 1IZ1A 2OBPA 3KCCA 2PLWA 4MEXF 1G6Q1 1BC5A 2IA1A 3GW2A 3R60A 2PBFA 2CKDA 1SMYF 1VIDA 1NHAA 4A0ZA 1VPTA 1T98A 1I1GA 3ELUA 1P4AA 2MC3A 2ESNA 3NEUA 3O3KA 3HVIA 3X0DA 4G8XA 4RTRA 4HAMA 3I71A 2GA2A 3HVKA 1D5VA 2ZXJA 3DLIA 3G2PA 3NWBA 1XGMA 3KETA 1NW5A 3F8NA 4BQAA 2K4MA 1JG2A 3I0TA 4CXFA 5BMZA 4UOEA 1FWZA 2OA4A 5FQOA 5DCMB 3WE2A 4L0ZB 3HCFA 1XDZA 5L3FA 4LLGF 3M6UA 1LDJA 1JG4A 3DFGA 3PQJA 3FMRA 3BKXA 4LG0A 2ISYA 3BJAA 5LQRA 4LLLA 4RB3C 3RI4A 4OQEA 3PLAE 4EM1A 3T0IA 4UVAA 2WA2A 4ESJA 3V8VA 4M9XA 4MQ9F 2FMYA 3LBFA 3LKDA 1SFUA 1KXZA 3QU6A 1BJAA 3EVBA 3R6SA 4YFKF 3AXSA 3GLXA 3FMQA 5LR6A 4JXJA 3ZMUA 5E1XA 4KVZA 1O3TA 2UYQA 5LHGA 1BI0A 3ZMDA 5BW5A 2YR0A 4YV2A 4PINA 3LCCA 2V1DA 4OIOF 5HLGA 4B17A 3BY6A 4BLWA 5LHIA 1SKMA 3JSOA 5K09A 2MLGA 3UJ8A 4UNOA 2PXAA 2PY6A 4LFUA 3L2CA 3M8EA 1WY7A 2EFQA 3G7UA 3TLJA 1XCBA 5CVDA 3GO4A 5DM1A 3FMSA 1X3UA 1QPMA 1B4AA 3V7CA 3UFBA 1XSXA 3K0BA 2XV4S 2ONZA 4QQNA 2C7QA 4POOA 3WTUC 2KIUA 3F4KA 4A0YA 3BGIA 5DYMA 3HHGA 2UXNA 2O0YA 4IRGA 3V97A 2P6TA 5FADA 3GGDA 3EVEA 4QDKA 2CO5A 3DXXA 2VDUE 3EVAA 4FP9A 2BYVE 1O3QA 2QBYB 3HVHA 3ANXA 4IHSA 1KU2A 1REPC 4I01A 3LECA 3R3HA 5LBQA 1ZGJA 4RB2C 3Q7EA 4A2UA 2DO7A 3PVCA 4YFXF 3B89A 1MZBA 4RTLA 4RB1A 4RTQA 1MJFA 5JUWA 3RDIA 5IH3A 2K4BA 4KIBA 2F2EA 2H09A 3FTDA 4G6DA 2VONA 3ELYA 1Y0UA 4EJOA 5HS8A 2N47A 2PJDA 3MAJA 3TDUC 3CCFA 1F1ZA 3RTRA 2R7DA 3KU1A 2JG3A 4P7JA 4LK1F 1JHFA 4LMYA 2HTJA 1XVAA 2IDKA 3P2EA 3BKWA 3B7PA 2DK5A 5P8WA 2HTSA 3VB2A 4ER7A 2A69F 3HSEA 1RZ4A 3BOQA 1CF7B 3BPXA 1W5TA 4HLYA 4UHTA 3FPGA 3FXUA 4ISCA 5FCDA 4UXNA 5F6FA 3BXOA 4XLPF 1TLHB 5L3EA 2XRNA 2BR3A 4PYNA 2LDUA 3O7WA 3HCBA 4U7PB 5DLYA 4ZZDA 2B2CA 2AOTB 4ER5A 1V4RA 2RC4A 5D8KB 2G7HA 4RGRA 2DLLA 2EWNA 1UFKA 2P6SA 5K0GA 4GCVA 2VS1A 2NP6A 3NTVA 5CVRA 3I59B 4CICA 4XRFA 3U81A 2G9WA 3ERCA 2V74B 1P39A 2H6BA 1O9HA 1LQ1A 3G89A 1L3CA 5K0CA 4K2EA 2K86A 3JW4A 4KDRA 1LJ9A 3P2KA 4N0BA 9MHTA 5EHGA 3LDGA 3R24A 1BI1A 2VBXA 4Y15A 5D5XB 1SVUA 4YUXA 3DXYA 4LK0F 3REOA 1EH6A 2HYFA 3ERED 1FY7A 3E05A 2FNPA 1PP8F 2XAHA 4IHTA 5HIMA 2ZJ2A 1HKTA 5K03A 5DTMA 3TO7A 1CGPA 1WSUA 1VLMA 4QVGA 1XGSA 4GYIA 3KP5A 4MQ4A 4EJUA 2HMYB 2IBSA 5IT3A 3B5IA 2OPBA 4CKCA 4MQVA 2IVMA 2XASA 2XYVA 3R0QA 5E1BA 1INLA 2EJUA 4I0BA 1QYRA 3FUXA 10MHA 2FNAA 5HIKA 2VOOA 1R22A 1KR5A 4YMHA 3H2BA 1WXXA 5KVRA 3IHTA 4KT5C 2O03A 2W24A 1F5TA 1SUSA 2QRVB 5DM0A 4WVLA 5T67A 3C3WA 3LX6A 5BPIA 3ZN1A 4PZJA 4MNUA 4I98B 1HSJA 1ZN2A 3AJDA 1USTA 5MHTA 2GH1A 3R0JA 4L9VA 3LFKA 3ABTA 4HDUA 3I4PA 4Q5SF 1EAMA 1ZLJA 3GO5A 3SMQA 2Y1XA 2EA4A 2QENA 1XCLA 2BM9A 3JTHA 2FPOA 4P55A 1KQ9A 3ZMSA 4ENKA 4ASNA 3E6CC 1G8SA 3TO6A 1KA8A 1K78B 2P8TA 1RJGA 5LQUA 2X0LA 4C08A 1YUBA 1HKQA 2JPCA 1ULYA 1A04A 2VE8A 4HV6A 3G88A 5KVAA 3LA3A 3QP6A 1TQMA 2YXLA 3UA4A 2UXXA 2M8EA 4C03A 4EJWA 3K0LA 3ZMTA 1FBQA 2WTEA 4WF2A 2PVCA 2H1RA 1ZQ9A 4KRGA 2STWA 5D8LB 2OY0A 3O31A 2BEOA 1JE8A 1XCJA 3OZTA 2J5OA 4GXOA 5ICFA 2IP2A 3N97A 2GAUA 2A07F 3TOSA 1SD6A 2PJPA 4P9UA 3A7DA 4PCLA 1PP7U 4RSRA 2A6HF 2GQQA 1Z9CA 2D2WA 1AV6A 5HZMA 3CJRA 2IA0A 3B73A 1QZYA 2R7FA 5EOVA 5GWXA 2RVCA 1W5SA 2A61A 1QAQA 5DT2A 2OD5A 2YX4A 3FX3A 1RNLA 1WXWA 4RWZA 4X60A 5KQRA 1L9KA 4UV8A 5DCMA 1KU3A 1JSZA 3FPFA 5HS7A 2E5WA 1KU9A 1F4KA 3DQVC 5J8FA 2F8LA 3M6XA 5H6RA 2VP3A 2BV6A 3FZGA 4IWNA 4DCMA 1RI1A 2HKXA 2XYQA 5LQNA 4HYEA 3F8CA 5K0BA 3Q9SA 5GM2A 3G8AA 5LQAA 2UZKA 2EA2A 5DWQA 1W7PB 3UBTA 5LGNA 2LNBA 3U2RA 2PX2A 5E20A 3TO9A 4HBLA 2JT1A 5HLIA 5F2OA 2NNWB 4IV0A 3LBYA 5DRTA 2EJRA 3HSRA 4E70A 5HIIA 3R4KA 1EJ0A 3EPPA 1VTNC 1R5HA 4WWCA 2OBFA 4PYOA 2EFNA 3TM4A 3RKYA 2Z9OA 2JH8A 4DF3A 3A4TA 2IPXA 4MHGA 3TKYA 4FX0A 3MWMA 3CUQC 3SSOA 2ESHA 3K2ZA 3RPQA 2XKPA 4ENNA 3ELDA 3HNRA 3KPUA 4EM0B 4CKBA 4ON0A 3HCCA 3O6BB 1RJFA 3KPVA 2QY6A 3F3XA 4LWPA 1I6XA 1BC7C 1XJ5A 3CC8A 1GVJA 3P9CA 2FCAA 3D2LA 1DCTA 3THSA 4OINF 3FXRA 3LHDA 3OE5A 2TDXA 4BHPA 1LNWA 5LQJA 4M6YA 2ZKZA 4JK1X 2M30A 1TNSA 2CG4A 1VP3A 4F85A 2FRXA 4GOLD 5ERIA 4WCGA 2BH2A 2KKOA 1LVAA 5K8VA 2CW0F 1TQIA 3FZVA 3E6DA 1BKYA 5LEKA 4IPAA 4HX8A 2QBYA 3GU3A 4AD9A 3GEZA 3BJOA 1QNTA 4P7GA 2L01A 3NWEA 4M9ZA 3U9GA 4M72A 2NRAC 5EG5A 4YV1A 2JRTA 4R8RA 3F8BA 3R61A 2R3SA 5K5OA 1XSVA 5EVJA 5FHRA 3QOXA 4Y2HA 4EKGA 1R7JA 2L02A 1U5TB 1WZNA 4GOOD 3WU1B 5CVIA 2XIGA 2MH9A 1CF7A 5EEGA 2DU9A 1T2KA 2KJCA 2P7IA 2IGTA 5E1DA 3EDPA 3FXQA 3M4XA 2F5CA 2G7UA 1KPHA 2VOPA 3HEMA 1MHTA 4GOND 2NAZA 2QQ9A 4HOBA 4YV0A 5JI6A 5L3CA 2NYUA 5HS9A 4O5VA 3WSTA 2C6YA 3BZ6A 2EX4A 5DCFA 1LEAA 1JQEA 5KYGA 2JZYA 1YZHA 2HKOA 1D8KA 1YFHA 1I5ZA 4HX7A 3I59A 5IT9K 4QPNA 4HLXA 2EFJA 3KQTA 1LB2A 2DAOA 4OU0A 5EMMA 3KLNA 2VT3A 2ZULA 4XUDA 2FBIA 3KR0A 5D4RA 4P58A 1DDNA 5FA8A 2Y0MA 1Z3CA 5H6QA 5LLQA 1RUNA 4QTUB 2Z33A 3WODF 3HSFA 1HW1A 2WA1A 3COAC 2NXCA 3MQ2A 2QVOA 4M71A 2P7CB 3WTTC 5GIPE 3VODA 1WRJA 1YIOA 1ZLKA 3CKKA 3THRA 1JQDA 5DM2A 2HGCA 1ODDA 3P9KA 5D6EA 3CBGA 4O3MA 4PCQA 1HW5A 2OYRA 1FSHA 4BLUA 4YFNF 1G3YA 3FWEA 2YPRA 1K7AA 4IKPA 2BZGA 4FT2A 3W6JB 3MTEA 1FT9A 4BAYA 1IXCA 3D5LA 3I64A 2PWYA 2IRFG 1IN8A 1FJXA 4CHUA 1RI3A 2RV8A 5ILSA 3HCDA 4LECA 2OQGA 2QRVA 1FC3A 4PWYA 2Z99A 1RI7A 2HWVA 4KWCA 4PIPA 2AVNA 3VYWA 1HBXG 5K0NA 2AS0A 4JBAA 3KQMA 4AZSA 3HP7A 2Z6QA 2F5DA 4RTNA 2CL5A 3O2PE 1O9GA 2VDWA 1ONVA 3E5QA 3TOAA 2PMHA 1S7AA 3V7RA 4EMSA 1KQ0A 4Q48A 1Z05A 5LRRA 3I5UA 3A25A 3MAGA 1QQIA 5CCXA 1P91A 3KQOA 3KQPA 3LSTA 4GQBA 1K79A 3M33A 4HSGA 3SSMA 5CVVA 2QLZA 4AVPA 5DD8A 5JR3A 1K78A 3DR5A 3GZ5A 2AOUB 3OU2A 4IF4A 3IKVA 3QU3A 2FBHA 1IRGA 2YTZA 5EIWA 3LA2A 4RTSA 3QPTA 3QPHA 3M1EA 5EZSA 3WTXC 4HQEA 2FEZA 2D45A 1GXQA 2AOXA 2VBWA 4YIFA 5H20A 2OQRA 2PT6A 3FUVA 4PYLA 3MERA 1MD0A 3KEQA 4CGZA 4C05A 2PBIA 1LDDA 4OIPF 1RI4A 4R6XA 4RTKA 4BHCA 1E2XA 2PX8A 3ME5A 5FLXZ 3IWFA 5BW4A 5BXYA 1OR7A 2VC1A 4MGRA 2PWPA 1YO5C 1EH8A 1EH7A 1ZRFA 1ZG1A 1BHJA 4UVBA 2O05A 5DSXA 3GFLA 5D1HA 1H0MA 4L9NA 4CTJA 2P40A 2ZTHA 3L7WA 2ERCA 1EG2A 2IT0A 4G9YA 2FU4A 3ELKA 3FF5A 1U6GA 4WXCA 1BIAA 1UHMA 5DX8A 2QYOA 2NXEA 4M36A 3MHTA 2UYCA 4FX4A 3E23A 4OQDA 1RUOA 3EQLF 4HH4A 1MJBA 2PXXA 7MHTA 5DV5A 3PFHA 2Q8KA 2DI3A 1R23A 3OFJA 5CUQA 3SZTA 1J0RA 1NW8A 2QQAA 3KPYA 2ZNZA 4LB5A 1W7PA 5B1SA 3HRTA 4ENJA 2I7CA 2E7XA 2HQRA 3IYLW 5K5QA 1FYMA 4U0YA 2L4AA 5ICGA 3EVDA 1VBFA 3Q87B 4YUYA 2KIFA 3IRQA 3EGEA 2VC0A 5ILUA 3SM3A 4MTEA 3V8LA 4V0RA 4QLCU 3WGIA 3UJ9A 4S04A 1GHCA 1ZREA 3BP8A 1U8RA 3PQKA 3C6MA 2IDJA 3VSEA 5E8GA 1Z6RA 3LAPA 2K02A 3HCAA 4EGZA 2V1UA 3CO6C 4EKIA 2YUIA 2WC2A 4F86A 3FM5A 3OZRA 5D5WB 5FA5A 3LCVB 2JHPA 3LQRA 4KICA 5LHHA 3DV8A 2EFWA 1ZRDA 1DL5A 5FD5A 2P8JA 4LG1A 2V1XA 4WXHA 1U2WA 2J5PA 1FYKA 2G8NA 2EG5A 2YR2A 3GRYA 1MJ9A 1XTPA 1IW7F 4RGXA 5DTRA 3O4FA 1FBSA 3E97A 1Q1HA 3IKTA 4IV8A 2ZBKA 1BI2A 2ETHA 2OB1A 1HW2A 1S29A 2QE6A 4G94A 3FUWA 4F84A 4CTKA 3LL7A 1QGPA 1TNTA 5JHUA 5DX0A 4AUKA 2IPQX 1JQ3A 6PAXA 3TRKA 4PGHA 4EGYA 3ZPLA 2NP7A 4R1HA 1VQ1A 3DOUA 2GXBA 3UJBA 2IA2A 3JWGA 4A12A 4AZTA 3UZUA 2JHAA 2A68F 2BM8A 3A7EA 1U5TA 2DULA 2RDPA 4L18B 3MCZA 3NVMB 1ON1A 1ZKDA 1R36A 4E2ZA 1MKMA 4AIKA 5DUIA 2OAZA 1OKRA 5G02A 3IC7A 2LF8A 2EV5A 2PGXA 3VFZA 5F2KA 4PYQA 1F9NA 2Y48A 2QUFA 4FS8A 5EKUA 4DA4A 2PT9A 3CTAA 5IKMA 3CLOA 3EEYA 3F8MA 1YFLA 4KIFA 1QANA 2ZBPA 4M73A 1VE3A 5EMKA 2C7PA 2GS9A 1IUYA 2XVMA 3OV8A 4HA8A 2HFHA 5GINE 2GPYA 3BJ6A 3FUTA 3MZHA 3VOEA 1J9IA 2DK8A 2ELHA 2GIVA 3W6KB 2RGVA 5FHQA 3NDIA 2DTRA 4XBFA 4OX9Y 4AWXB 2JHCA 4B8XA 2XGXA 3H92A 2V7EA 1PRYA 3BUSA 5CVEA 4MTDA 1EJ6A 4DQ0A 4K6MA 3ECOA 1J59A 4HF1A 2ZO4A 2GA1A 3FTCA 3B3GA 5FQNA 4I2OA 5U4XA 3BWGA 2B9EA 3NVKI 4KW7A 3IHUA 1D3YA 4FT8A 2M87A 1DPUA 3DMHA 4YMGA 4ER3A 2G72A 4AX8A 2A3SA 1C0WA 3KP6A 1N7IA 3KP2A 1X1DA 2XVAA 2EJTA 2DPUA 3M6WA 3WTVC 5CD1A 5EC8A 3P7NA 1XXLA 1YW9A 3EMDA 4RVDA 2FF4A 2PXCA 2HDCA 3DXJF 1G38A 4PYIA 1Q0SA 1B1BA 4LB6B 1Z91A 3D0SA 5K05A 3DEUA 4H0EA 3IL2A 3SQNA 1YZ3A 1FX7A 2AXLA 2HOEA 2P3QA 3HCEA 5E1ZB 1SG9A 3FHZA 5DPMA 4KN4X 5F64A 2IW5A 3P9NA 2QQBA 3OU7A 2FOKA 5E9WA 2KW5A 4YUWA 4CKEA 2P5KA 4FR0A 3TMAA 3DULA 3KE2A 5EEHA 4HV5A 3LKZA 1I27A 2O0LA 2XUBA 2V6CA 2XVCA 2LSOA 4X61A 2L3DA 1L3BA 5EQJB 3PFGA 4Z2YA 3QOPA 1NW6A 5E2AA 1V39A 2XAJA 3WTSC 2NNNA 1YTYA 3FRHA 4MIKA 4MHTA 2CMHA 2QM3A 4R79A 2AOUA 3KR1A 3LQQA 3SFZA 3RKWA 1Q0TA 5HDNA 1FBUA 3WU0A 2UYOA 3I53A 3TKAA 4OBXA 1I1NA 3RKXA 2FK8A 3T5XA 3EVZA 1S7OA 4AZWA 3UA3A 3CJTA 3DH0A 4DMGA 1W4MA 3N4MA 5M5BA 4QVKA 3L8DA 4RX1A 3FPHA 4ENMA 1DP7P 2EV0A 3WGHA 1T38A 3EETA 4RS8A 1G8AA 4XUCA 3QAHA 3BWCA 2BE5F 2L4MA 5L3BA 1KU7A 1HNNA 1T43A 5HOQA 2DFIA 2Q2EA 1NV8A 4OBWA 1L3LA 5EIFA 4FZVA 4Y13A 2NYXA 2O06A 4BY9E 4XSXF 4E32A 4HW0A 3AWIA 2AN4A 3HTUA 1QO0D 1EQAA 1KHHA 2STTA 1WI9A 2DBBA 1JTEA 2XYRA 2P3LA 3BGVA 3CJQA 3T8TA 1AF7A 1ZG5A 5IT9Z 4HF2A 3KQWA 2I9KA 3MB5A 1P1BA 3TGNA 2H6CA 4BP1A 1G3SA 1G4DA 3G3ZA 3CUQB 1HSTA 1JR4A 2EFOA 5J6XA 2Z6UA 5CLSA 2P4WA 2PFBA 3T0YA 1IN5A 3KZZA 2GA9A 2PMUA 2CWWA 2UYHA 2ORED 2ADMA 4CWAA 1O54A 3KQYA 3EYIA 4PDKA 2VN2A 4HF0A 3K1PA 5DM4A 2P7HA 4DZRA 3JWHA 1XGNA 4EVIA 1Z7UA 4M7RA 3J80K 4U7BA 2E1NA 5C9ZA 5FWAA 2K27A 5K0FA 4P5OA 1B59A 5C1IA 2W84A 4OA8A 4U0WA 4LWOA 4KFCA 5L3DA 1MDMA 1J7KA 2X4HA 5CVUA 1QAOA 5HVQC 4XSZF 1E17A 1XB4A 5DSTA 5E8IA 5BS6A 1HQCA 2H94A 3CGGA 2QWWA 3KPJA 1R58A 4KIGA 3ZN0A 4DCGA 2HR3A 3B3JA 3GJYA 3OFKA 2ZBQA 1B9NA 1H9GA 4ETSA 5DTQA 3OOPA 5LGUA 1L0OC 5HEKA 4C4AA 3I58A 3JAMK 3KP7A 2HR1A 3PFIA 2OZUA 2LD4A 4N9HA 1V3FA 5CIYA 3VC2A 1R8YA 1KP9A 1P4XA 3ZP5A 1ZH5A 1I1SA 3QP5A 3E7PA 3DLCA 3RIEA 1G3WA 1QBJA 1YG2A 3C3PA 3WTZA 3J7AO 4G56A 3TR6A 2QZ8A 4JQFA 1L1EA 4U88A 1DPRA 3B02A 1NW7A 4IRHA 1BBYA 4A6DA 3GX4X 2ZFUA 2IH4A 1YFJA 1IY9A 1KPGA 1OMIA 3DMGA 3FYCA 3KKZA 3LAJA 1IN6A 4RVHA 4ZYEA 4S05A 2VODA 4BXUA 2H00A 3SZPA 3NMUF 4O29A 3JWJA 3U1DA 2K4JA 1T0FA 4KUMA 1BI3A 3F22A 3CUOA 3JWIA 3IRRA 5E8JA 4YIIA 3I54A 3RW9A 4L0YB 3DKWA 1YF3A 4RAYA 3GWZA 4ZZLA 1STZA 2ZZNA 4F7ZA 1UCRA 3FTFA 4RTPA 5DX1A 3DP7A 2G1PA 1S8NA 3H3UA 2HZTA 2ZLBA 3PX3A 2ESRA 2GB4A 1KPIA 1R8XA 3LA7A 4PIMA 3FTEA 2VBZA 4OMYA 2LKPA 2IIPA 3EVCA 4R6WA 3K1NA 1R74A 1R00A 3OE4A 1AWCA 1TQPA 4PYJA 2P5LC 1TTYA 3F23A 1UB9A 4EQQA 1BM9A 1VL5A 3ECHA 4G6QA 5JFRA 2AVDA 1KYWA 1ON2A 4CYDA 2AS5F 2CSOA 2JTVA 1JSXA 2CGPA 2Q0OA 2W57A 4PYKA 3MFKA 1G60A 4LJZF 4A5NA 2JSCA 3GFIA 4HQMA 3F6OA 2RKHA 1IF1A 1SQGA 2WWYA 3NJRA 2WV0A 1R6AA 5E1MA 1WWXA 1LEBA 1ZYRF 2M1BA 2YX1A 3RODA 1JHHA 4RGSA 4MTLA 1QAMA 2BR4A 4IRIA 4X63A 3L00A 1BC8C 4RYLA 1TW3A 2ISZA 2ZZKA 3I9FA 2V9VA 3AAFA 5GIOE 4RAZA 1TPYA 4GBED 3JTGA 1MGTA 3HA5A 2DQLA 3SX0A 3HRSA 2DPDA 5FWDA 5A2QK 3BPVA 4KMUX 3HA7A 1F3LA 1WG8A 3GUDA 1VP9A 1SFEA 4BHBA 3IWZA 3J81K 1TW2A 2DW4A 2RN7A 3KEOA 1JG1A 2AR0A 3Q9VA 3FUUA 2HTEA 5BPDA 3ZQ7A 3SSNA 2ADUA 2YXEA 5K0JA 2OZ6A 4TV7A 4YUZA 3VEPA 3GVAA 1J75A 2ZMEB 4B09A 3E6BA 3G2OA 1IM8A 4PYMA 3FYDA 5AONA 1PJZA 5BP7A 3H3ZA 4EJVA 3WG9A 1T6SA 2P7VB 3S68A 2PN6A 3LGAA 2BBYA 2MA3A 2NS0A 2VT2A 1O3RA 3SHFA 5FULA 3UJ7A 2D1HA 4WK8F 3FRIA 3UJ6A 3ROUA 4FGZA 5BQTA 2XAQA 3V8JA 5EHIA 4XUEA 2KRFA 2Z5UA 5TJJA 4X41A 5DXJA 2PG4A 2CWEA 2OB2A 2YU3A 2PEXA 4HZFA 2ZSUA 4KNYA 2FK7A 3K1MA 2B0LA 1F38A 4U7DA 2AOWA 1J2XA 5HOOA 1FNNA 4M9SA 4UUVA 2HWKA 1KYZA 1NKVA 2HNKA 4WXDA 5J8CA 2GAFA 4E31A 2AZTA 2EB7A 5F1RA 4RB0A 2R6ZA 3C1DA 5EZQA 4ESBA 3DMFA 3HYIA 3RYPA 2V79A 2ZIGA 3E3VA 2XAFA 5DEQA 2PLYA 4NECA 2RQPA 3LWFA 5EMJA 4E30A 4YUVA 2IBTA 4M37A 1ZG3A 5KQSA 1SUIA 1FOKA 2A14A 4CZZA 5LQKA 3L09A 4NQWA 5FD6A 1R5GA 3P97A 4C07A 2L54A 4L9JA 1I9GA 5E18F 4L5IA 2P1DA 2C7OA 4L5JA 3VC1A 4I0AA 4C06A 3CUQA 4QPPA 4A6EA 1ZAOA 3HA3A 3P2IA 1SFXA 4XCXA 2PX5A 2FYTA 5CCBA 3ZMZA 2IFTA 3RJPA 5LSAA 3GFJA 4P96A 3GF2A 3GFMA 1XN7A 4GO1A 1O3SA 1G55A 4MWZA 2GZWA 3M7GA 2D1VA 3B3FA 3KQSA 1TBXA 4GGGA 2ZZMA 4G7OF 4RTJA 3BWBA 4ZYHA 3TFWA 4IXAA 4OIQF 1NT2A 4HGZA 5EPEA 3C7JA 1MDMB 3EVGA 2P41A 1UWVA 2NXNA 1YW7A 3SXJA 2YQZA 3CDHA 5D5VB 5FGMA 5HFJA 3GRVA 1OPCA 4XLNF 5E9QA 2O8XA 1Z6TA 4RTMA 2PV0A 4I09A 2VZ9A 3BT7A 3F6VA 3ISPA 3KQQA 3L9FA 3EGVA 4Q4ZF 3G8BA 4M38A 2PX4A 2A6EF 8MHTA 2C7RA 3HM2A 2Y75A 4MEYF 3M9AA 2ZVJA 4FHTA 3G2MA 3TOBA 4RVGA 1NE2A 2MBFA 4ER6A 2F5EA 5D4SA 1LDKB 5HILA 2ZNYA 2NNYA 3UJDA 5DUKA 5LRSA 3F21A 3HOTA 5FUBA 1L3IA 3FPEA 1XMKA 3SXYA 4E33A 4GEKA 5E8RA 4I7HA 3T1BA 1X1BA 2HEOA 2FSWA 2LF7A 2BR5A 2I6GA 2XHKA 2OZVA 4FSDA 5AIPA 3R6TA 1KGSA 4AIJA 3OU6A 4UVCA 1IN4A 4LD5A 4M6XA 5FLXK 3AXTA 3BZBA 1SD5A 4E2YA 2ONYA 5E1OA 4H0NA 2IJLA 1FLIA 2ZWAA 4EV0A 1YS7A 4WX9A 1EIZA 3KQVA 3M8FA 1YS6A 2XBMA 3BGDA 1UHWA 1PUEE 3G5TA 2PQ8A 3ULQB 2F5FA 4P7KA 1D2CA 3HUGA 3KP4A 2COMA 2ZWVA 4QTTB 1P4WA 4PNEA 1YW8A 1N7JA 1ORHA 4GUAA 1UIRA 3DTNA 5FB2A 2O3FA 5EKXA 5FFXA 5E9JA 3ORHA 1B42A 2NXJA 3NQOA 3LDFA 5E2BA 5ED4A 1JTFA 3IEIA 3HHHA 1DUXC 2H11A 2FQ3A 4U0VA 5BOXA 4QDJA 3GRZA 2OXTA 4IJAA 4EK9A 3F8FA 1ZHFA 2DQRA 2YX7A 2W25A 1S3JA 1GXPA 2UWMA 1YLFA 2HYGD 5ILVA 4C04A 3PB3A 3UJCA 4E2XA 1IXKA 1O7LA 5T6BA 2EV6A 3JSPA 1YQAA 1P1CA 3SR4A 3NRVA 5ERGB 4EM2A 3R9XB 4P7FA 3DUWA 3MTIA 5D6FA 4KMFA 4DNCA 1N2XA 2CFXA 3TDZC 5K0LA 1O57A 1R1TA 1WKMA 4NHJA 2VBYA 2W85A 5AIQA 5HDKA 2HQNA 1K6OA 3F72A 4A5MA 1H1DA 3TM5A 3WGGA 4LLNA 2VXZA 3WTYC 2OKCA 2E1CA 4HTFB 1RJDA 3CJNA 3EGIA 1BIBA 1SQFA 1U78A 2KJBA 2JJQA 1NBHA 3HVJA 5LQCA 3QRFF 3HTXA 2E7WA 5K1YA 1RI5A 3ID6C 3QOWA 3FPJA 5E1WA 3A26A 3T7TA 1YYVA 3M70A 5HIJA 3UJAA 1FP1D 3MGGA 3J80Z 1HMYA 5H02A 3E5UA 4EQZA 4EJTA 4HX4A 1IN7A 4R8HA 1XCVA 1YB2A 1G6NA 1IAWA 3QV2A 5DD4A 1NV9A 3G73A 1X19A 4PONA 3K69A 1WS6A 2MD5A 4UV9A 1FSEA 5F2NA 4OA5A 5FO5A 2A5YB 3GCZA 1O7FA 2P5VA 2ACJA 3E8SA 2DPMA 2XROA 4QQKA 3LPMA 3GZ6A 3T8RA 4YG2F 1AQIA 1D2HA 3KFWX 3GYHX 3AY0A 4V0QA 1B9MA 3S2WA 4KN7X 1W7PD 1SD7A 3NDJA 1FYLA 2ZMEA 4AIHA 3K6RA 4HDVA 3MCTA 4Q47A 5GP1A 4PGGA 2H27A 3SVZA 4GOMD 1SD4A 3JAMZ 3LDUA 4BH9A 1RIOH 1USSA 2Z6AA 1S6LA 3MQ0A 1G3TA 3V7SA 3HTSB 5EMLA 2JH9A 4ER0A 1AOYA 3KR2A 4LG0B 3RIRA 2I62A 3C18A 3PT9A 3K9TA 5D5UB 5GM1A 3PTAA 2JPBA 2Z3YA 3T7RA 2IH5A 3G5LA 5FTWA 2DT5A 3PS9A 2CYYA 4HGYA 5JVTA 3SGLA 1D2GA 1KIAA 2YSRA 1BOAA 1B6AA 1XDSA 2XKOA 3TQNA 1JG3A 1P2FA 2O61A 2AN3A 2XAGA 1X1AA 4E2WA 2B78A 5LEJA 2O07A 5KS2A 1WQ2A 2HV9A 2FHPA 1HXDA 1Y8CA 1FBNA 4GC9A 3GIWA 3UWPA 1ZRCA 4BP3A 4NB5A 3KZYA 3OZSA 1I4WA 3CVOA 1EV7A 4ZYDA 2CMGA 2P3OA 2HS5A 4RGUA 3NW9A 2UZ4A 1FPQA 4GYGA 4KDPA 4FT4A 4DKJA 4KA4A 1BOOA 4RVFA 1Z1DA 4OOIA 1J5YA 3MZYA 1M0EA 2O57A 2EFPA 4O6JA 2FXAA 3P9IA 5DRYA 5ICEA 2FMLA 4ATNA 3P8ZA 5FFZA 4R05A 1QZZA 3ABUA 2B3TA 2G70A 2PKWA 1T39A 3EVFA 4RTOA 1OYWA 1ORIA 4ZYGA 3KPWA 3EEOA 2AOVA 3HRMA 2KIMA 1SMTA 2GXGA 3HOSA 1OYYA 2WK1A 3BDDA 4HC4A 2FBKA 2Y1WA 4ESFA 1PDNC 3PX2A 5T64A 2ZFWA 1R18A 5LGTA 3A27A 4G7HF 3DPTA 3IV6A 3KR9A 2B25A 2VDVE 5A2QZ 3EMBA 1BN5A 5EGSA 1R1VA 5K0EA 2M45A 4A0XA 3GRRA 4HRAA 3MEXA 1XGOA 2GWRA 3HRUA 2G71A 1P6RA 1XSDA 1OR8A 1AQJA 3EUHA 3J81Z 3BWMA 2GLUA 4OMZA 3M6VA 2ZBRA 5ICCA 4GF5A 1P92A 2FA5A 1U5TC 3GRUA 4CXMA 3OPNA 5DXAA 4IVNA 2Q41A 3DXZA 2YXDA 3DPLC 3RYRA 2PI0A 3KP3A 2ZIEA 4DM3A 2OU2A 1D8JA 2FE3A 4QWQA 1NW3A 4PCAA 5L3GA 1U3EM 3GNLA 2OO3A 2M5WA 3KHKA 4N9IA 3KLOA 3ER8A 4ZH4F 2VE9A 3ML6A 3G2QA 4FSXA 2AOTA 2EK5A 2BGCA 3ER9A 3RPUA 3EYYA 4AZVA 5K01A 1FP2A 1XD7A 1U2ZA 5GOZA 2YVLA 3BWYA 3C0KA 5DDGA 3Q5FA 2IH2A 1IXRC 5CVJA 3HIFA 4Y30A 1HKSA 3V8KA 4U7TB 4OIRF 1DUSA 1XMAA 4D0PA 3CO7C 1JGSA 4L7VA 1XDUA 4KDCA 1UFMA 3GDHA 1SAXA 1RJEA 4LGWA 4DQ2A 5HLHA 5C0OE 1RI2A 5CYVA 2ZW9A 3ELWA 2FRHA 2MLKA 1H9TA 4RV9A 4CDGA 1IRFA 5HDGA 5CJ9A 3P71T 4GC5A 4BLVA 3DF8A 2CQKA 1MJAA 3E6MA 2ZCJA 3TQSA 5TRDA 1NBIA 1R1UA 4HTFA 1M6YA 3R0AA 2ZCWA 3OCJA 4P9FA 5KK1A 4ZTBA 4CO8A 4X1OA 3BROA 4M74A 4BNCA 2ZIFA 1FZPB 1M6EX 3T7SA
chains in the Genus database with same CATH superfamily
2QZJA 2P35A 3SKVA 1USIA 1WLYA 1VLJA 2ATXA 4A5SA 3OUUA 4QQRA 3HDYA 2V4UA 4OQQA 3FROA 4IIXA 3P2OA 1Y34E 1G20A 2O2YA 4R8SA 2EJCA 2DT6A 4R41A 4EOGA 1ETUA 4DQDA 1ERDA 2BMDA 4MEXF 2VHZA 3MTBA 2H85A 4YQZA 2PBFA 3U17A 4KYIB 3HPGA 4MYSA 1TKCA 1X1EA 3IDOA 1N34B 1D5VA 5DLQC 4IEJA 2BXZA 4INZA 1N2BA 1KONA 3F90A 1GD1O 4ZYVA 1Z88A 4M1QA 5NLLA 1W36D 2DSNA 1E1RA 4X8LA 1XJQA 4KCGA 2WTAA 1XAIA 4OQEA 3T0IA 1HOTA 4IRMA 4YHBA 1TADA 4JYZA 1JIXA 4M9XA 4D5FA 2RI6A 2O0MA 3I72A 3L6EA 4CKXA 3G1OA 5HCUA 5CPBA 3CLKA 4JX4A 3WLAA 5LD2B 2E48A 3JVIA 3MXOA 4PINA 1T33A 3A4YA 3T4PA 3K70D 1WKVA 3LW8A 4CSWA 4YUAA 2OM6A 4WVFA 2VTDA 2E3JA 1OTXA 2J0UA 3QP9A 2GM5A 1Z34A 5BOSA 1E0AA 4QQNA 1NH3A 1JYEA 1MOQA 2VUTA 4A0YA 3U39A 2OZEA 3OZEA 1U94A 3V97A 5FADA 3FW1A 4BMDA 2CXUA 4A16A 3JY6A 2WB4A 3R5XA 1X8LA 3DE6X 4GPZA 1YRHA 1M2NA 5SY6A 4FOSA 4L8GA 3RNOA 4YFXF 4JV5B 1G4HA 1PZNA 2FDCA 3HLTA 2F2EA 2R62A 4OFBA 1V37A 3UR3C 4F4FA 1JHFA 2WD8A 2CSUA 3AIKA 1CF7B 1D1CA 3Q11A 4MIYA 2NO0A 3P27A 2R7OA 2NZ2A 1KSFX 2Q8NA 4BUJA 1F43A 4X91A 3UMMA 5KNDA 2AOTB 3HV0A 4UHCA 2P62A 4G25A 2EWNA 2CNKA 1XAHA 4YT5A 3RV3A 3GUUA 4A3SA 5CVRA 3QU7A 4OM7A 1TAGA 2OYSA 4EA7A 5CB6A 3WMFA 2UVPB 1T2FA 5G0TA 4FFBB 3ERED 1V0JA 4IHTA 3B1JA 5A5GA 1CGPA 2ABWA 4HPXB 5EJ9A 4Q4JB 5ITZA 3M2PA 1T2DA 4Y6OA 4K9QA 4EJUA 2YHIA 1JEYA 3RUAA 4XM1A 2OPBA 4IGAA 1QDLB 3UMRA 2YOFA 4DV6B 3BFVA 2GBIA 1DQYA 1VE9A 1SUSA 2QRVB 1T1IA 3MJEA 4EUKA 1RQ2A 5IXSA 3PENA 4L07A 2UZ1B 4XVHA 4UUOA 4RCYA 3R0JA 2DUUA 4PFJA 2Z3VA 2L9VA 3I4PA 3STVA 2W6PA 5I7UA 2CLOB 4C9YA 1WQ1R 3PSAA 4I5DA 2FPOA 1Q3TA 1G8SA 2VF2A 3R3VA 4PG8A 3EIHA 1K78B 4YHHB 3TXYA 1HKQA 2JPCA 4PLGA 1VF9A 4FTWA 4DV7B 2DLDA 1H05A 3AQ4A 4WT7A 1W5CC 2H1RA 1R0ZA 2STWA 1UBMS 2ZJ4A 3DEYX 4FIDA 3L0CA 5M3BA 3V7WA 4GXOA 2G9QA 2PJPA 3A7DA 1KI6B 5FXMA 1DLIA 1NY5A 1NVEA 1GYRA 2LK2A 5B7GA 2ODAA 3O2NA 1ISRA 3OEEA 4IQJA 1VMDA 1BDHA 4UV8A 2C84A 2RHTA 1LRKA 3BAZA 3AIIA 3NBZC 1ZVKA 3DQVC 1X2EA 7ADHA 3AINA 3ZKWA 1SVSA 2EZUA 4XYMA 4DBVO 1SIUA 2V7VA 1W7PB 1PCXA 3W9BA 4BQNA 4MW6A 3U2RA 4G23A 1EFTA 2X3FA 4RPCA 1D9ZA 1ZIYA 1Q77A 1IE3A 1VTNC 2QGUA 1MU0A 2ZT8A 2N46A 3UAOA 3IB6A 4Y6LA 3SSOA 2V3CC 3A4NA 1GAXA 4WX2B 5J2TF 2VFAA 2XPCA 2XMBA 4S0XA 2BAGA 2ZBDA 4IIJB 4M1SA 2A1TS 3FXRA 2X1HA 3VHLB 1QRTA 3FZQA 2R7QA 2WG1A 3T1NA 4GOLD 3HR4A 3M7IA 3MUNA 1WW8A 3WXBA 3GB9A 2QBYA 4BO2A 4QG3A 2IOFA 4O4HF 1I9CA 1YQQA 2P4EA 2RCNA 2AUTA 5A1JA 4QPDA 3FIUA 3G1LA 3ZQCA 4NCXA 1OU0A 4BB5A 2C8KA 3UWSA 1CUSA 3AKEA 1BHO1 4JB8A 1K6YA 3E35A 4O08A 3EAFA 4QECA 4UATA 3EZXA 1B0UA 1I3MA 1O0SA 5AKXA 3D6TB 3ZU5A 1XCGB 1DIHA 2PX9A 3FKJA 1IDN1 2C4NA 2K40A 4ZREA 5HFAA 4Y67A 1NC3A 2QQ9A 1I4EB 4XICA 2WUFA 4O5VA 3PUVA 4Z0NA 3VDRA 3TSYA 1YZHA 4KG7A 2EFJA 1ISIA 3BMCB 4U6QA 4M3FA 3INTA 1GV2A 2VT3A 1CUIA 3KCQA 1Z3CA 5A3JA 4HJRA 3T0GA 5CQEA 4W6ZA 2NXCA 2IYTA 2P91A 4ZQBA 4J07A 4YRKA 3X43A 4KO4S 1PW7A 1Z6PA 1EB9A 5LIPA 5BN4A 4L0DA 1JKJA 2L9RA 4YFNF 4FQ8A 3TKLA 4MVCA 2QTZA 1OCPA 4IH1A 2PWYA 3JRDA 7ABPA 1GPUA 5JZBA 2ZSDA 1A27A 1FTSA 2ISCA 5B1BH 4RQAA 2CK3A 1Z7GA 4ZVLA 4CKEB 5CU7A 3N2KB 1FU8A 3CPJB 5BUZA 4HEA2 3D8HA 1ZGWA 4ONEA 1JB9A 2WI8A 4MFDA 1S7AA 2HA3A 3UV3A 3ORRA 4MUEA 1AZSC 2REOA 3OZVA 4A69C 1RW4A 4PPGA 2YYAA 3QRWA 4HSGA 3IAHA 1ONOA 2FOLA 1G4AE 1R71A 2OORC 2BWJA 2Z16A 5EWMA 5HKAA 1X7DA 4RV4A 2V6FA 2VT7A 1G98A 2ZMEC 4EI8A 1DQZA 2OQRA 4PYLA 4B5KA 1L5MA 2PBIA 1L5OA 4KQCA 4RTKA 5IBRA 3OZBA 1OH5A 3MCUA 5BXYA 3Q6IA 4AT1A 4F7DA 4IQFA 3FBIB 3PDHA 4LSZA 4UAJA 2HXYA 3I92A 1JR6A 2KWIA 3CJQB 3OOSA 3KDSE 3B51X 1W4ZA 1FRZA 3H2YA 2C5LA 3DMTA 4DOZA 3KPYA 1A9RA 1YK1A 4OJNA 1T2VA 1UPCA 3TIIA 3IYLW 4FHDA 2OAGA 1VBFA 3L1IA 1Q7RA 3HV2A 4WZBE 4DZJA 4JR0A 3BP8A 1JXOA 2AJ8A 3C6MA 2K02A 1RAAA 3H9GA 2ZSIA 3P0HA 1GCAA 5FA5A 5INTA 1G5TA 4DEVA 2EFDB 3RT9A 2YVKA 4X95A 5FOUA 1N2HA 4HQNA 5CTJA 1U3VA 3ZXYA 2EYUA 4WNAA 4RHUA 1ULBA 3BXEA 2CYAA 2ZROA 1F5SA 4WIAA 3WFZA 1TNTA 1E6WA 1JQ3A 3EH1A 4HDNB 1WCV1 4UBOA 5JVDA 2IA2A 4XWAA 3IURA 3HI6A 1UELB 1XZEA 3TDKA 3GJ5A 2CXOA 3IVMA 1U2SA 5K2OA 4DT1B 4Q9JA 5FWYA 5C8YB 3EXG1 4N5IX 1IUFA 4S2EA 2VXCA 5TQ0B 1NI5A 2BFAA 4ZDOA 1OWPA 5ARDA 5A4AA 4Z6YA 3QE2A 2GN4A 1DXHA 3AF2A 4JUBA 1UQTA 1T36A 2H2WA 1QH8A 1DT5A 4I81A 2YOHA 8LDHA 4HA8A 5JFOA 2HFHA 3PGXA 4ZYLA 2ZSHA 1OC4A 2C2MA 4ZKDA 4TV9B 4YRZA 2DKFA 1LNSA 4TM8A 5HBRA 1EHIA 1IV6A 2M2EA 1WZUA 5HVNA 4RENA 3EK2A 1N7IA 3USES 1X1DA 3NANA 4XWGA 2ZE6A 4D4LA 3GL9A 1YFKA 3I0NA 4RVDA 3ZWNA 4EKEA 4PRLA 1J33A 3N2YA 4G9GA 3RC7A 1A1VA 3IL2A 3W9YA 2AEMA 3L3BA 1M83A 4GM4A 3FHZA 3OPMA 3V8MA 2H9YA 4YYZA 3GMIA 3IHKA 3P9NA 5BN3A 3LPCA 2P2DA 2R8EA 3BWXA 4BBZA 2WR8A 2X13A 4BBJA 4QT4A 1M8FA 5EN4A 3HJTA 3LY9A 3X1WA 3PFGA 1HYHA 4Z2YA 2IC5A 3NHMA 3T6KA 1YTYA 4MHTA 2OPHA 2QM3A 4I55A 2W6JD 2BFDB 4UMFA 2L0XA 1QGOA 1V7QA 3WGQA 1EJ9A 1E1NA 1YACA 4U7HA 3CJTA 5KDLA 3HZRA 1CD5A 4RX1A 2LD5A 1SHJA 3MBKA 3OZXA 4RS8A 2G1UA 4R9VA 3BWCA 4LI3X 1VIVA 1YU6A 4UFOA 2CW7A 4CCLA 2HJRA 3H4MA 2C00A 4JLJA 1TA0A 4DR6B 5DI9A 1JR3A 1CJKC 1CF9A 4BVKA 1XTQA 4XPIA 1P0IA 1L7RA 4HRXA 3KUDA 1L5LA 5JMOA 1LWOA 1TRKA 2A6PA 3KZZA 4CW7A 1NUQA 3KZKA 3CLVA 4D8TA 2E19A 1KTVA 1DQRA 2HMWA 1G2OA 2IQIA 5KSZA 4V1CI 3K1PA 3VH4A 4BTEA 3CCVI 1GZ4A 1P2GA 3G8DA 1PJAA 3WSWA 2M6KA 1TC3C 3UUEA 2AQIA 4BGEA 1QR2A 4YK7A 2QW0X 4XSZF 3EXIA 1XB4A 4YRDA 5U1PA 2ME6A 1OC2A 1GGKA 3ON5A 3OOJA 5M5YJ 4JJ4A 1G8PA 2X5KO 2VJYA 2WDPA 4XDYA 4LYHA 3U4GA 4WCFB 3MYYA 2PFKA 5J2UB 4K87A 1CULC 4DNXA 4I4TF 2NQ8A 4LJRA 3RIEA 1NNEA 3VX4A 2QZ8A 2LVBA 3LVBA 1PR3A 3FYCA 1BX1A 4ERNA 2CVHA 4M9CA 4OF4A 3WYFA 3JWJA 1RZ3A 4D4KA 2ZJ0A 3BIFA 3RW9A 3GWZA 3AEQA 3BXPA 1OIVA 3FB4A 1QP8A 3ZLTA 1MX5A 4HPJB 5L53A 3Q98A 2B5WA 3MKZA 4TMFA 1JLRA 3PNOA 3H16A 3TAUA 1KAHA 5LJLA 1P6QA 3OE4A 2HPZA 3C6QA 4LF5B 2H07A 4M88A 3ZS9A 5EJ7A 1NF2A 3AR6A 2ZTUA 1ADCA 1FRFS 1G60A 5A9SA 1X9HA 3KUCA 4J0EA 4I1VA 5TMDA 5F7OA 3GEHA 4Y2YA 2LRHA 1ENYA 2VK1A 2C2ZA 4KIUA 4XARA 3RVRA 3CCQI 1P4RA 1TW3A 3H1AA 2Y30A 5DV9A 1TPYA 5J58A 4HV4A 1YCHA 1YKSA 2C3PA 5D87A 1WG8A 4WSOA 4LDJA 4QASA 1ZD5A 1RVV1 3CDIA 4MO9A 1ZVQA 3E8XA 3K32A 4XAQA 1P2VA 1F2TA 1DU6A 3MNFA 3IMCA 3DMPA 1T6SA 4CNBA 3HA2A 3O8LA 2BBYA 5FULA 2L42A 2JQ7A 3AERB 3PCRB 1Z68A 4CF5A 3FRIA 4CEIB 1B0AA 2PYZA 1FFBA 4I0WB 1Z7YA 3BK2A 2X9GA 2O5RA 2HTFA 4PFSA 4U7DA 4LYAA 1Z5GA 2ORYA 4G1UC 1LU9A 2EQBA 3TRIA 5A0TA 3DMFA 5ARCA 4XX1A 1XP5A 3HRKA 4UAUA 1XQWA 5LOVF 4TTVA 1Z28A 1N8KA 4X7RA 4XD7D 2X5OA 3I83A 2HBQA 1KJWA 1Z4QA 4WI1A 2QRUA 3UMJA 1SUCA 1Y6GA 4IZZA 2Y93A 4BRWA 3RJPA 1RABA 3BQMB 2QVXX 2WVHA 3I1YA 1DJLA 5LU8A 1GPAA 4EGJA 1OD6A 4UU0A 4KO2S 3AB7A 3J81k 1FRNA 3L4SO 1UWVA 2OC9A 2XWSA 1VLZA 2CGEA 1VG9B 5HFJA 4I9NA 4XLNF 3X1MA 1Z6TA 4E7JA 2PV0A 1NPDA 4B45A 4JY7A 3KL2A 3T3GA 8MHTA 3OO0A 2Y75A 4GRIA 3N2NA 5LA6A 1R27A 3T4XA 3MWEB 4R68A 3B78A 3JATB 1LDKB 1ACIA 1J1ZA 4DG8A 4BU2A 3FNBA 1XC7A 4I7HA 1ZJ5A 1UC8A 3VR2A 3DUFB 2YS6A 3HRIA 5DH9A 1EWYA 2Q1WA 1X13A 3N2GA 3WGUA 5JRDS 2ONYA 3RLIA 3VKHA 1MDBA 3L8MA 5KZMB 4DBZA 3IMFA 4FJ1A 4CODB 4UDYX 4V3CA 4DSOA 4RJ2A 2O3FA 3LCRA 3HRHA 3E84A 3NQOA 3PIOF 5DBFA 4JX8A 1MH4A 3OM8A 4PSKA 5J4YA 3P0EA 2EW8A 2WVJA 2CBXA 4TMKA 1MFZA 3NWSA 1XEAA 5IUNC 5T6BA 1XHEA 4XYLA 3NDBB 4UU7A 3PTLA 4F5YA 3DDHA 4B43A 2FP4B 3W6UA 1BMFA 4DTIA 3ZUGA 1KWKA 1R1TA 1SGWA 4LMBA 3I05A 2AKAB 3F72A 1U98A 4RD6A 2E1CA 2F1RA 2TSYB 4EG1A 4Z7JA 3D7NA 3CRNA 2LR0A 4YRCA 1RI5A 3QNWA 2A4MA 3QOWA 2XF5A 1R12A 1TEHA 1Y1RA 3LC2O 2FR8A 1XLUA 5AMXA 3UJAA 2C7GA 1HOXA 3C8DA 4TX1A 4HX4A 1LKXA 4RU1A 4ZVOA 2A84A 2AX3A 1USGA 2P5VA 2PFSA 1OFGA 2ZI3A 1HC7A 3ZY6A 2LY2A 4A3EJ 4EW2A 2JVKA 4JYBA 1AA6A 4ZD6A 4BQPA 3GH3A 5ALZA 3NGMA 2YNMA 1G3TA 2ZIXB 2W6IA 4PQGA 1N5LA 3HLYA 5C7YA 3LLVA 3DWGA 3MGKA 3QU4A 3VO8A 1HFEL 4JENA 1TP4A 3TZHA 4O3FA 3K1YA 5AVYA 3WMXA 5LMNB 2Z1DA 1LI4A 3GQBA 4GOJA 2B78A 2Q3BA 5DM60 2FHPA 2HO4A 3UWPA 3GIWA 4UY8I 3KZYA 1RESA 4KXUA 2CMGA 3NC4A 4HUJA 3OL4A 4AP9A 5IP6A 3JAKA 1NBMA 1T2UA 1MKYA 5K7FA 1A3CA 4QM6A 4Q15A 3DD1A 3T12A 3SZUA 2XNDD 5J5VA 5TY0A 4MDHA 1I3AA 1YA6A 4DZPA 1B1CA 3HFRA 4RHCA 2EKDA 3GFBA 3LA6A 4J2TA 1ANKA 4IILA 1T39A 3P5BA 4UB6C 5JQWA 3VM6A 3J7ZI 3N7TA 3OJLA 2J3HA 2WWRA 3VI3B 2OA0A 4H3HB 1T0IA 1QFMA 2BSAA 1VZ0A 4NX2A 5KDDA 1BYUA 4QYXA 3KR9A 5A2QZ 1H1TA 1SXGA 1R1VA 1A4UA 4OHVA 4W5HA 1KWGA 3JRXA 1XSDA 5JY6A 4N01A 3RRXA 1KQPA 2PIAA 1P92A 1I7QB 5CRIA 2DPHA 3QZUA 1CZOA 3MVEA 2Q99A 2ET6A 3QVGB 1S4QA 3LYLA 4OXRA 3JARB 1ZC4A 2PGIA 4M0FA 1M1YE 3E5HA 3ZW7A 1GKKA 3WB9A 3S3NA 2OV4A 2DM6A 4ZCTA 4UXHA 3UXMA 3EUEA 3AHFA 1I3CA 1YDHA 4FB4A 4ZTZB 1Q20A 4AULA 4MAAA 3WRYA 2HCBA 4A3BJ 2WYVA 2A67A 5E79C 1E3DA 5EIEA 4RSHA 4DQ2A 1EP2B 3G1TA 1AM4D 2IHVA 1TZ2A 4G63A 2KLBA 5KHLB 5B3SH 1ONBA 4QYSA 4XRRA 3E6MA 2C2KA 3R1IA 1T35A 4D6XA 3RUEA 4HTFA 2GLXA 2ZCWA 4FYWA 3NUGA 4K9SA 4M3GA 1OZHA 1Q12A 5C7OO 1Z45A 3O8NA 4A8JC 3CCMI 1IXSB 1N75A 4MEJA 3L82B 3CCLI 3TIVA 5JSZB 3THXB 2ZM6B 1ZARA 3OCVA 1T08B 3UG6A 4DC1A 4EL0A 3BSYA 5A62A 1KQ8A 4OQYA 1QPZA 3AY3A 1Y37A 3RKSA 3Q3GE 4AUXA 5FBQB 1NHAA 4RD2A 1TMKA 1Z47A 1M0WA 1P4AA 3AP2A 1MO6A 2CFTA 3WBKA 4HZIA 4G67A 3BBLA 1DBSA 1PSWA 3EXG2 5FQOA 5DCMB 1AMOA 3HCFA 4GZMA 3WGJA 4DDWA 1QFYA 4QUKA 1QPGA 2VDQB 1SUBA 2O3TA 4HVCA 4HNSA 3LBFA 2HSGA 1BJAA 2HLNA 4IEIA 4CL0A 3ZDYB 5IK2A 3LW7A 3DV0B 1EDBA 5CDFE 4GQIA 2Y92A 1LJUA 1SUAA 3MJDA 5HQTA 1U63A 1R6DA 3FNRA 3NC0C 3H18A 3MINB 3VPCA 3UJ8A 1LZLA 1C30A 4LMRA 4RV5A 3IP4B 3JVVA 4QAJA 4Y2GA 2WAQA 5F04A 4OSOA 1FDSA 4LC1A 4MITA 2ZB9A 3ZY3A 1K4KA 4POOA 1MBFA 1MBZA 2BKVA 2OCYC 2CVOA 2HRCA 1WUTA 3ZCPA 1PWZA 5FLVA 2GO1A 3BQNB 1EJBA 2FRDC 3CUVA 2O3RA 3OOYA 4I01A 5LBQA 2I6UA 1E77A 2R7AA 4CMIB 1KK3A 5DWDA 5A4JA 2ODBA 3DBHA 2H09A 3NVAA 3CCFA 2XUGA 4KBYA 5JCXA 1F1ZA 3IUYA 2O2EA 1XVAA 1MV5A 4C5BA 4C22A 4U7GA 3CT6A 3BOQA 1GSOA 4OJQA 4JJIA 4WOPA 4FXPA 4TZTA 1JECA 5KYKA 4R9SA 2LDUA 1NUUA 3O7WA 3S2UA 1M1EB 4NCKA 2EARA 3RU3A 1V9LA 1IBMB 2DKNA 3RJ5A 4ETIA 4F4HA 4V2GA 5K0GA 4B33A 2D1TA 1YR3A 1C2YA 2G9WA 4W1PA 4INJA 2WABA 4EABA 4ANFA 1QYCA 3QA3E 2XX3A 5BMOA 1BI1A 1SN7A 4B8YA 5KNCA 3TD9A 5AXDA 3HOWJ 1NX6A 2PAFA 2BGWA 3SQMA 1JDJA 2JSPA 1E2DA 5K03A 3G9ZA 1GL7A 4IHVA 3ZVLA 3NV7A 3BD8A 5JNWA 4HMOA 5KKCA 3ZJTA 2YJGA 3ZE8A 3OE7D 1QVTA 4OU5A 5EP2A 3ONQA 1ZD2P 1D6MA 2NU9B 1W59A 3HG9A 3VR6H 4MQ6A 4YMHA 4FINA 3CX6A 1JEQA 4JI0B 3EFEA 1FX0B 1TKBA 3ESDA 4FILA 4L9VA 3LFKA 4EH1A 1HE5A 5AM3A 1CUEA 1TE2A 3K10A 4QDTA 4BX0A 1LPPA 1WJDA 4JNCA 3KM0A 2BM0A 1L8QA 3G88A 1M2VB 5DNYB 2Q45A 4EJWA 4O8CA 1E3LA 4Q7JB 1A82A 2G88A 1RHKA 1Q6ZA 3CZ4A 5H3LA 4EZBA 3CG4A 3K30A 3BK1A 3MFQA 3HKZA 2VXYA 3ZCUA 4IF6A 1BVHA 3RSFA 2CBGA 2GQQA 3FI0A 4NZPA 2HUNA 4XYBA 4X6YA 2X51A 4HSEA 2IYYA 4DA0A 4JOQA 1M34B 3PSFA 3S2ZA 4ACAA 3KYDA 4KQKA 1ENOA 3A4CA 4BWVA 2E5WA 1RXWA 5C52B 2RHWA 3ACDA 5H6RA 2QU8A 4BV8A 2FPXA 5ADWA 1JKXA 5I9SA 3QUBA 2H17A 1O1YA 1AF4A 2RKWA 1QYDA 3K6GA 3B1VA 3IAM6 2PX2A 4NDZA 2IPOA 3FSRA 3OLWA 1BFDA 3EOAI 4CIDA 1UFQA 2KRHA 3B1YA 3TM4A 4PYOA 2GX6A 3EA4A 4QDOA 4UUNA 2LUOA 3H13A 1E2MA 2DEUA 4FX0A 2YCLA 2Q3MA 5JD5A 1SIBE 5HNKA 3OZAA 5H81A 3ZIAD 3TO5A 3P9CA 3CMYA 4JI1B 2JFQA 4ZT7A 1J9EA 4OINF 3LK6A 5AHKA 1E6EA 4FU0A 4XFJA 3VH2A 2VQDA 1W94A 3NG1A 3VPHA 2QL7A 2BH2A 3EDRA 1SBCA 5BWLA 3PPVA 4QPCA 5KWEA 3OJWA 1G41A 3D9QX 1SM4A 2VQFB 4XK4A 1SULA 2TMDA 5AVTA 1D0YA 4DLAA 2IE8A 4B1RA 1AHNA 1PVDA 4XUGB 3AUYA 2XCOA 1CZKA 1Y3AA 3W7VA 2P9EA 1G5IA 4XVCA 5DK6A 1WUYA 1S3SA 3NKVA 4MVJD 1W9MA 3CLSD 1KEKA 2XUQA 1HSZA 2A5DA 4MVJE 1CF7A 5EEGA 5CA0F 4GI5A 1ZN9A 3T7EA 2P7IA 3IR5A 2HDHA 1UFOA 2D06A 2IYSA 4HOBA 4C88A 2NZYA 5HP4A 4XZ3A 3WSTA 2C6YA 3BTUA 3SIPA 4CMHA 1Z12A 3U3RA 4ECAA 1JQEA 3Q0EA 2IIBA 1D8KA 2NO9A 4BMNA 4X0EA 4ZVUA 3V3KA 2GFQA 4GH5A 4Q4HB 3AJEA 3A32A 1SXJB 3KLNA 4S1PA 5DHSA 2SKDA 3GLRA 4HSTA 3IE2A 4Q4DA 4FLFA 2UVPA 3KOUA 4FFBA 1QVZA 1RZVA 4N49A 4IJMA 4KK4A 5I7VA 5JXWA 5IWCA 5F27A 1RQ7A 1KVUA 4Q4JA 1SXPA 3IV9A 1MW8X 3SBXA 1LB1B 4BAYA 2Q0QA 5B5SA 4A3DJ 1YR6A 1FJXA 1LPMA 2QRVA 5FBHA 4DQLA 4NPAA 2XCIA 3IAEA 1VCOA 1LSUA 3WDSA 1K2WA 2UZ1A 3T54A 4AN1A 2PANA 1R4NB 1S2DA 3IQDB 3KOXA 4L4RA 4W97A 1WVMA 1Z4IA 1UG0A 5DE3A 4MWGA 1K78A 4AVPA 3DR5A 4HH0A 4BV3A 5CB8A 2DYRH 3ZE2B 4MPDA 2MD0A 3HU5A 2YWRA 1NP3A 1F0YA 3EARA 5IXJA 1W19A 3M4OJ 1TLFA 2BF7A 2JAWA 2QI9F 4OHBA 2VJLA 2UYGA 5BW4A 1JUMA 4K9RA 2QTAA 1K3TA 3UT6A 5LYJB 1ZGZA 1YMVA 4N3BA 3ROEA 1O87A 1JDBC 4G9EA 1EG2A 4DPLA 2FU4A 4TXJA 5DX8A 3WLTA 3QY9A 3PGJA 7MHTA 2H5LA 1WXGA 3PFHA 4D3SA 1PKXA 3JYLA 1W7PA 2XF7A 3HRTA 1YUMA 4ENJA 3I37X 1DP3A 5K5QA 4N7RA 3KB6A 2ECOA 4MSUA 2HBYA 1NONA 3COPA 1KVRA 3HJEA 3VJKA 3WGIA 1Q21A 1GHCA 3V80A 1G6KA 2QL9A 2JLCA 3AF5A 2IDJA 2K3FA 2A5FA 3NT5A 3HCAA 1IJFA 2DC1A 4I1RA 4MVJM 3U3ZA 3Q9LA 2WC2A 3RUIA 1YSCA 4IIJA 3LQRA 4US2R 2HBRA 4PAMA 5EWLB 1D0IA 4LDNA 2QAJA 4YY3B 1V6CA 2F55A 1TQ2A 2V65A 4H4KC 3F67A 1IW7F 4C5CA 1FBSA 3O4HA 1BI2A 1RP1A 1V5EA 3R3YA 2ZK7A 1OIXA 2BVNA 3ZPLA 4L50A 2NS7A 5BSRA 1P75A 1UKYA 4F4IA 2LYCA 5JNTA 4BQEA 1GEEA 3QXCA 5KI6A 1V1RB 1EUCB 4I8IA 4R2JA 4J75A 2I10A 3IC7A 5F0CA 4GBJA 3WYNA 2WPDA 3ANNA 5IYDJ 4F3RA 4A7PA 4F6LA 1ICIA 1QLWA 4GSYA 3W6KB 1IOVA 2E6KA 3E4DA 2DTRA 1THGA 4F3TA 4YCBA 5K20A 1W25A 5CVEA 3NAUA 3BMCA 2AFIE 1R66A 2GERA 4HF1A 2GA1A 2W11A 2AWOA 3MOIA 2M87A 5D6NA 3DMHA 3WLQA 4YMGA 3G5AA 3AVXA 3S16J 2FE1A 2AXPA 3LO8A 4X93A 2P79A 3X44A 3URKA 3QEMB 3D8UA 4S3MA 2G1AA 1S5LC 2NACA 3ZYCA 2FF4A 4GGMX 3DQZA 3WZ2A 3K9HA 1DDIA 3SQNA 1FX7A 5AIBA 1AU7A 3SEFA 5HDBB 1XZ8A 3VDQA 4FW8A 4K2HA 4CKEA 3N2KA 3KE2A 2FE4A 1GGFA 3LKZA 1EXMA 1U0NA 2V6CA 1F2DA 3G0BA 4OKIA 3RF7A 1VI2A 5E2AA 2IU6A 4EGQA 4ZCPA 1KBOA 1JEOA 4B75A 5GJVC 5HDNA 2Q50A 1D6JA 3K9LA 4TQAA 4C0SA 3G9TA 3MXTA 2P77A 3IH4A 1Z38A 1T2AA 2GM3A 4H08A 2LBFB 2O2IA 1FA9A 1LLFA 3EETA 2FX0A 2ZP1A 1XTRA 4FZVA 1KY4A 1XKXA 5JCJA 2HI0A 1DZIA 1PR2A 4CG3A 1EQAA 3JPWA 4CCOA 4R5MA 3UF0A 1N5DA 2G5CA 3CJQA 4LZNA 3TGLA 1K4TA 4UHEA 3KQWA 1P1BA 1BWRA 1T0BA 4BVLA 3ZQIA 2RJ3A 1I2AA 2ALJA 4G5GA 5TGTA 2EBFX 3AG5A 2RHBA 4NKRA 3HHPA 5T41A 4HOYA 1PT9A 2ADMA 4EHNA 3JREA 4YDRA 4TSKA 1AA7A 4EVIA 4OK5A 9GPBA 4P22A 2NT4A 2O59A 4G1BA 3MWGA 3GFSA 3ET4A 2VJJA 3EXEA 1RC0A 3CNBA 5HVQC 2IT1A 2EJWA 3N8KA 3FGNA 2Y05A 2WADA 1O58A 1SKYE 4WV3A 1QHGA 2PSDA 3FJOA 5F9HA 2HJSA 4AP6A 2JARA 4XQCA 1BGXT 2CLHB 2PA3A 5LXTA 3TLBA 4BLSA 1R8YA 1QH0A 1KZHA 4HDNA 3VNSA 4G0MA 1JKPC 1TYBE 3B02A 4BAZA 4BNIA 1JKIA 2DHCA 4DT1A 4YRNA 4BXUA 5C8YA 5TQ0A 5B6PA 4YTEA 2FW8A 5TGZA 3I54A 3O47A 1U6KA 1V54H 5FH9A 4NE2A 4CYCB 3DMDA 3B9BA 1G5FA 3KOZA 2DF8A 2GB4A 3GAMA 5EY5B 1SHTX 4E2FA 5IZCC 3GMDA 2D2EA 3FZNA 2DWUA 1QP0A 4A82A 1KIMA 5DOZA 2Y2ZA 3DKYA 3EUKL 1X38A 3WGLA 3D64A 3N05A 3CZRA 5C1OA 3O4JA 4GE0A 2IL1A 5A5FA 1JSXA 3RTEA 3GTMJ 3SHTA 3E0QA 5CBPA 4JYAB 3OI7A 4ZCQA 2WHYA 4P4LA 3QPSA 1L8XA 4RGSA 2BR4A 4IRIA 5B1YA 4BXOB 4XN3A 3FUCA 3NM4A 1BVUA 1X1SA 1C1DB 4NTZA 2WAEA 1VFPA 3GCWA 1PV2A 3CV3A 2GZSA 4LFAB 1VTKA 5A2QK 5FTNA 3BPVA 2F6RA 2COEA 5AKHA 4AQ7A 4PZZA 2OO7A 5KO2A 5IU6A 4M0CA 1AKNA 1J2JA 5JZ9A 1UBNA 3AFOA 5CCDA 3IBCA 1AGRA 1IM8A 1M2EA 1TM2A 4TPKA 1ZVVA 1FVHA 4NAUA 2JIZA 5F3DA 3O9MA 2BFDA 2ZR9A 4PO3X 3RG8A 5TS2A 4JBGA 4W82A 2G76A 2XD4A 3WIOA 3S55A 3B48A 3H4TA 3Q12A 4J1NA 1S9HA 1B14A 3I32A 3WYAA 4WHMA 2GT1A 2W82A 4BP9A 3RYPA 1QMPA 2XAFA 5KYXB 4XSHA 2PLYA 2RQPA 3LWFA 1Q2UA 1SUIA 3O73A 2O5CA 1FOKA 4B7ZA 2V7FA 5LQKA 3I56I 3CZQA 2ZPTX 2I2BA 4LXQA 1DWOA 1I9GA 1YCGA 3ZN2A 2CE2X 3KXDA 3TLKA 3U19A 1EGMB 4AKIA 3B1ZA 3GF2A 1RR7A 3KQSA 1Q15A 1YA4A 3BWBA 1B43A 2PMCA 1CLUA 1F8XA 4M8NE 3RUDA 2YDYA 4DM7A 5JAZA 3Q9UA 2PTGA 3IBTA 1HE2A 2J9XB 1MNAA 4RTMA 3QU9A 4DCJA 4QXAA 1I4TD 2W43A 1ZOIA 3EGXB 4XSVA 5LBUA 3KTDA 1JEDA 5JYDA 3CCEI 4HATA 2FI1A 5JSFA 1U8TA 4FHTA 3E9MA 3JD2A 3SQDA 3L7AA 2JIBA 4X97A 4A0SA 3KAKA 2BY2A 4DDVA 4WCFA 4RSMA 3ZWMA 5J2UA 1C8KA 4J94A 1HORA 2YW2A 3IRVA 4FSDA 3QLVC 4Z9FA 4W1RA 1ZD1A 3BZBA 3SS9X 3PPWA 4DIFA 2AJCA 4ESOA 4WX9A 1HYGA 2RAPA 2O7OA 1BAPA 3G5TA 2O2JA 4QJ4A 3V7UA 4FFOA 2GYYA 5LMZA 1FXSA 2QSZA 4EFDA 1CIJA 5EKXA 3OQ6A 2VEOA 4E11A 4C4XA 1B6RA 4BMYA 4UVDA 4Z2AA 1VQ4I 3IIJA 3BL6A 4U87A 5L4LA 1YLFA 1Z4OA 5FOVA 1KRWA 4E2XA 1GPJA 4IAOA 3TTUA 2ETXA 2JANA 4QUBA 1R6VA 1H2ZA 1MBKA 5EPOA 2GXSA 4Y9TA 4Y6GB 4PJ0C 5AVKA 3A1NA 1GNQA 4JUCA 6REQB 2B20A 4XIFA 2R68A 4KQXA 1WPKA 1NVXQ 5DKFA 2JJQA 1A9SA 3CTMA 4DR2B 5TXGA 2Q62A 4IR7A 4LE2A 4KPEC 4RPGA 3ID6C 4R0VA 1ZAKA 3QK7A 1NMSA 1TA4A 4BFTA 1HMYA 3E5UA 4IQGA 1IN7A 1YB2A 1XCVA 1G6NA 1LV7A 3ZGXA 4XIGS 4RZXA 3EIOA 3IIMA 3I34X 1MOZA 3W2VA 4DPKA 1II9A 2KE5A 2YQ5A 4Q34A 4GP9A 2CYBA 3GZ6A 1GOTA 2LNDA 4TL9A 4YJGB 4IYRA 3A0UA 2QQ8A 3EC7A 4I1IA 5JS2A 5MGNA 2V6BA 4D9JA 5IC4A 4BNVA 3MN1A 3NETA 2ZOSA 4AMVA 3AERA 3WA7A 3RDPA 4CEIA 3TL2A 4JEIA 3EZ6A 5B30A 4EBFA 2HNHA 1GTJ1 1MC4A 5IVKA 3B36A 4JDUA 2Z3YA 1O95C 2GTPA 3OQHA 4GSKA 5BN5B 4KXNA 4RIIA 4YAFA 2AN3A 2EAUA 2DMRA 1WHTB 1X1AA 2CH0A 1PEDA 3HVUA 4BWGA 3PXDA 2JL1A 3L6OO 1B41A 4CA0A 2WHEA 4ML3A 2XW6A 5AJHA 3WE7A 4AJJA 2UZ4A 2DH5A 1EP9A 4IDBA 3C8MA 5C8DA 3V9PA 4ZTFA 4BNNA 2HX1A 1RXSA 4B4KA 3LAWA 3FD8A 1ITYA 3CLRC 3OKCA 1GDHA 3GT4A 1IOLA 5D7NA 4WBNB 3EEOA 1HMPA 1G63A 2C9ZA 4HBZA 5AM0A 4YCCA 1MV8A 1ZH6A 2PIDA 1NJ5A 3AJ9A 1R18A 3B8EA 4AC0A 4ZOCA 4DSNA 5CDUA 4MQEB 2QSJA 3MWEA 4IX7A 1RJ9B 3JATA 4CCKA 2XT6A 1OR8A 3VR5D 4YRGA 4IVNA 1FP6A 2ANBA 1QHSA 3DPLC 5BMVB 1ONSA 1TEVA 3VU1A 4D8VA 2B2NA 5JSYA 3FCUB 2TMYA 4K9KA 4I9HA 4UUSB 5CW1A 4DBQA 4LWQA 1KR2A 4GMDA 1U3GA 2NO5A 2Z1NA 3DPIA 3RPUA 2WKQA 2RBGA 1YV9A 2YVLA 4RGBA 4CIBA 3CNNA 1R0BA 4LV5B 2HH9A 4U2KA 4Y18A 3BSFA 4D6PA 1KEPA 4JVMA 4L7VA 1XDUA 4F2GA 4DFDA 3BHNA 2ZKIA 2EP5A 4IZ6A 5IMBA 5C0OE 4OH7A 1XMJA 2FP4A 3MJ4A 5EUMA 1WRBA 1XZKA 2NPIA 3DF8A 4CMJA 3AVVA 5DS9A 4WPGA 1VLHA 1Z6QA 3WQHA 4L08A 1V5FA 4UMDA 4BNHA 3ESRA 1CK4A 1DVRA 5L7YA 1ILEA 2MH2A 2QYSA 1DGQA 2W71A 3IVAA 4L9TA 4CQMD 2RNJA 4D8WA 2PDAA 2ODEA 4GMGA 2ZRDA 4WY5A 3FDFA 4CIWA 3M82A 1BCRB 1FJLA 4PSCA 1UBKS 4MGZR 2Q7OE 2IA1A 1SCAA 3WGVA 4DDUA 2FN3A 3ZJYA 3ZIUA 1JP7A 3PXAA 5JLAA 3K72B 3KETA 3INNA 4BJ5A 4QODA 5TEWA 3PL8A 1GYPA 3I0TA 3RRJA 3QOEA 2ZIXA 1GRVA 1KSHA 4MRSA 4FBMA 1V35A 4LLLA 4GDFA 3RJTA 3FETA 4ESJA 2PPVA 1PDWA 3S2EA 1XNRB 2QGZA 3PVSA 4GR4A 5E1XA 4FXOA 3ZMDA 4IDAA 1YC5A 2X8WA 1RACA 4U8GA 3JSOA 1H42A 4OSPA 1XPJA 4TN5A 2FTKE 4TTAA 4UNOA 4CKBB 1YDFA 2YY7A 4JL5A 3TH5A 4I5FA 2QI9C 1HA8A 2YY5A 4EJ6A 1FYFA 2UXBB 2RK3A 2XSZD 3LXMA 1YJCA 1T8IA 3F4KA 3A0HC 5EHZA 1O4XA 1Y6FA 1A2OA 3HKBB 4R81A 1KOGA 1O3QA 1QO0A 4EUSA 4IHSA 1CYEA 1R9GA 1ZA1A 2Y9MB 2PD4A 3TW0A 4YASA 4KGDA 4ZDPA 3AFIA 4NMXB 3RDIA 5JUWA 2GJSA 3PL5A 1CY2A 1GZVA 2PJDA 3TDUC 1VQ7I 4OAZA 4GPTA 2HTSA 1QVUA 4X1EA 1RZ4A 4UHTA 1KEZA 4Q3EA 5JXHA 1DHTA 1VA5A 1P74A 3N8DA 4RACA 3BXOA 1STOA 2E4UA 4KJXA 3W1VA 4TVKA 2ZU6A 3DWIA 4CLXA 2G7HA 4L28A 2O0JA 3K0EA 1XRSB 3QVGA 2EJBA 3I59B 2E5FA 3ERCA 1IK4A 1ES9A 2ACKA 3JARA 3IEXA 1N3LA 1S2MA 3IDSA 3OFND 4MUFA 2QRJA 1S01A 1UQRA 5ULLA 1KNQA 4E5YA 1IRZA 1TQ8A 4NWIA 1FLDA 3ONFA 5DYTA 2XVYA 3LNQA 2FNPA 3ZEIA 2ZE8A 2CKMA 1H6AA 2HMSA 3F5SA 3IS3A 5CFNA 5AJYA 1P2SA 4EY4A 5KB3A 1I94B 3RASA 1XGSA 4PZPA 1XZIA 5IKOA 3G1WA 1DDOA 3D7KA 3DDUA 2J0EA 3FWKA 1AKMA 2CJFA 5F0HA 4I0BA 2WNIA 1CUHA 1AQNA 1SIOA 3ZN1A 4MNTA 3WWPA 5EXEA 1M2KA 4IXTA 4BB0A 4UREA 1ZN2A 4L3WA 3L40A 1IC6A 5JZMA 4ZAYA 3QVXA 3A04A 1CT9A 2D2XA 2VTVA 1TWFJ 3ZMSA 1A5SB 3U7IA 4CDRA 3THXA 5JSZA 4C08A 2IUEA 3ND7A 3TUIC 3IKMB 3ZMTA 3UO8B 3QLEA 13PKA 1JW9B 4E5VA 1ZGBA 2I7VA 5L3RA 2GAUA 1A2KC 4M7PA 1WULS 4NABA 1PJ4A 3EYWA 1G8FA 2OFXA 2YZMA 4KO3S 1JG7A 2XPVA 2P5TB 5ESRA 5DCMA 3H8JA 1T1SA 2Z8YA 4DCMA 2I80A 1QE0A 3FYSA 1HNWB 1WV1A 1KJ8A 1VYUA 5GM2A 3A31A 5LQAA 4FEGA 4B8WA 2VBFA 1WSAA 1GN9A 5C3EJ 2IYOA 5EG0B 2C94A 1KK1A 3PUBA 4RCZA 1R5HA 1ZNZA 2A0UA 2OBFA 1XGKA 2IPAB 3DV0A 5IAAA 2D7JA 4CF7A 2FPPB 4K6OA 4DNOA 3OIVA 2DWQA 4EM0B 2QY6A 4YONB 3RGGA 3WWOA 3DE2X 3OUTA 3H3XA 2WB1A 2HLDD 3NBYC 3LG2A 3S8PA 5IYBJ 2JUGA 2FSVA 4DADA 3LHDA 3WKAA 1FXWF 3TLAA 2OLKA 4XJXA 2VYCA 5DASA 4Z9BA 1RHQA 5ERIA 4D6YA 3K2BA 2KKOA 2VDOB 1V95A 3QIVA 3C41J 5ITVA 1E9SA 3V6MA 4YREA 2J5KA 3PEWA 3HJCA 1F14A 3W34A 4M9ZA 4M72A 2JRTA 3KRTA 4CMIA 2F1OA 1RRKA 2C4MA 2XXJA 4R2KA 1XKTA 4DIKA 4ZJZA 2R00A 2IJGX 1NSYA 3WU1B 3S0JA 2WAAA 3C3DA 5ALOA 1VQOI 3KZOA 4RY9A 1BWPA 2VKDA 3M4XA 2F5CA 4EA9A 2WM2A 5HS9A 1G2HA 2K9NA 4K0RA 1T5IA 3IT0A 4UPEA 4AQYB 4MDYA 1HK7A 3OYGA 1JPJA 3LSMA 1IQRA 4BKMA 3VSCA 1A8HA 1JRLA 4ENUA 5CVTA 1G0NA 3WZLA 4OFXA 2O2XA 4D5EA 3RFUA 1GUAA 1MBGA 1NYRA 5DBGA 1W0KA 3E3NA 4HL6A 3GY0A 4QM7A 2J59A 3LC1O 3N8HA 1CJMA 5H6QA 3KBBA 2AA3A 3HSFA 1HNZB 4TKMA 2BBOA 3WQRA 2Z8XA 2ADFA 4PIVA 4GPEA 2MABA 2GF0A 1U81A 1ODDA 4HDKB 3ER6A 3D6AA 4DB4A 4JA0A 5AUQA 4HPWA 1IHDA 4S0ZA 2VA8A 3EUAA 3NATA 4ODIA 3KQUA 3RFFA 3V1NA 3TOVA 4G8CA 3RVBA 4AD8A 1E6CA 2NU9A 4ZVRA 1M5TA 2PT7A 4RMJA 4OOEA 4YCNA 2Z99A 3LXUX 4EY7A 3O94A 5B3AA 4BJ6C 1FX0A 1YIDA 4E5KA 1X14A 2HVRA 1Y1PA 2IYEA 2V7QD 3ZI7A 4RZIA 3LUFA 3TOAA 2JFNA 1UOPA 1W2HA 3KQOA 3HFJA 1AKWA 2V7GA 5AKIA 1M2VA 3QPTA 3WTXC 3NHUA 2AOXA 3ZDZB 5H20A 3C7AA 3HFSA 1E96A 4QXMA 4OIPF 2H3EA 5GV8A 3FNIA 3R3WA 4ND5A 1W1WA 4URYR 3WOVA 2JHGA 1EH7A 4L4XA 3FVTA 4UVBA 2XGSA 2ECCA 4BO3A 4HFMA 1M34A 4J2HA 2YWBA 3K16A 4YJDA 1OZ0A 2IT0A 1LLQA 5CXXA 3K0KA 1F0NA 2GXQA 3OT1A 1VFCA 2JA7J 1N4AA 3NHSA 3CUKA 1WQ3A 3CRW1 3PITA 1RR8C 4LB5A 2JB9A 4ARAA 1AXGA 5FFFA 3F3SA 3CB4A 2VKQA 3EVDA 4HRVA 3IRQA 3PE4A 3S2DJ 4HNRA 2C29D 1BA3A 1TNDA 1W36C 1L5FA 1FE8A 1N2GA 1U1CA 3CG0A 3VPBA 3D4IA 3LC7O 1YRQA 4EKIA 4HZUB 4LZAA 1MRSA 2Z95A 4YJ2B 4Q9AA 2GSWA 4QVGA 4H6WA 4QJ3A 4LZWA 3T06B 1LW7A 4O0MA 1EFPB 3ZHTA 4IUCS 3G9UA 4UNNA 4TUYB 1XFAA 2QSUA 4K9OA 3LVRE 4RGXA 1KVTA 2HAEA 3QPUA 3E97A 1T8UA 3KELA 4TKVB 3BF8A 2X2OA 3OS1A 5DX0A 3OLCX 4FETA 1W88B 4LJ6A 1CUDA 3UZUA 4BATA 3H97A 2BM8A 3HL2A 3FNGA 3O83A 4JC5A 2RDPA 5KAIC 1SZDA 4MUMA 2A5JA 5KBYA 3QKWA 2LF8A 3D02A 5F2KA 2VDNB 1WY5A 5EKUA 5KDOA 4LXUA 4AJKA 4A8PA 4WD3A 3C8HA 4KXWA 5DXFA 2D2FA 1VJCA 2DK8A 3ADOA 1BXRB 5HF9A 1GAWA 4AWXB 5KOHB 3UMVA 2C9YA 1DARA 4QE3A 2IXGA 1SXJA 1DC4A 5EE9A 5C4IA 3UY4A 4RGQA 5IP9J 5IAKA 1FFCA 4R0NA 2CNOA 2XVAA 3M6WA 3LP8A 2H2GA 1SXQA 1E2PA 3A1WA 3V6LA 5TX7A 1JWLA 4YCAA 1ZU4A 3STTA 5KQPA 4TS4A 3EPKA 2GVZC 3G9QA 1T4DA 4KQ6A 3VTKA 2FVYA 2VJOA 2CBZA 1T0UA 4ENWA 3T3OA 1E60A 4P31A 2FOKA 2FEKA 3RRFA 4G5YA 5ED0A 4UBLA 5IDWA 1R4NA 4RVCA 5FUVA 2O0LA 2R6JA 5TV2A 4U2CA 1C5KA 2WG2A 1ZLYA 1XD2A 4WE3A 2ZQZA 3V8PA 3AFGA 3OPYB 4AJHA 4DSAA 3GQVA 4YROA 1QZXA 4AZWA 5TGDA 3EFOB 4ENVA 3NOXA 4KXFB 4TLDA 3SWWA 3FFXA 4XUCA 1XF9A 1QFZA 3R8FA 4EEXA 5LYJA 1C7FA 4BY9E 5BT8A 4M3BA 4GYKA 4P0TA 5EIHA 2STTA 2P2ZA 4X84A 4EWLA 2XYRA 1L8OA 3BA1A 5E6RB 4UQPA 2O6LA 3PFWO 2SNIE 1SOUA 2X1LA 2Z6UA 1E5LA 3AGQA 1IN5A 1G4UR 3STUA 1WB9A 3DMYA 3DOHA 5EGNA 5I9NA 3PIDA 3ZDRA 3KALA 3NZEA 3OECA 3AWDA 3D4NA 3CESA 2JVHA 2Z1MA 4M46A 3QTLA 4TLLB 4HAVA 4OA8A 4CR6A 5EWLA 5L3DA 1MDMA 3HZHA 1ZJZA 4HAWA 4R8KA 4PFPA 1VL1A 4N03A 2V7WA 1Z82A 5JTUA 3AHEA 2FEPA 1XDGA 1Z5WA 3R3XA 1MMGA 4H3KB 4DWJA 3PNTA 4M2LA 4EJFA 2EKBA 1D1SA 3OY9A 3E22B 4Y2QA 3HNOA 5DHPA 3EIXA 1YRYE 5I48A 3BWVA 2RGWA 4JQFA 3ABSB 3REFA 4CQLB 4L4UA 1KPGA 4ZVQA 1EUCA 3EEQA 3U1DA 1CS0B 2EX0A 2HOQA 2QLMA 3PC3A 3H1TA 4JT4A 2BW0A 1KIFA 2D1YA 3LUJA 4HEQA 4Y2SA 3BDIA 1KPIA 4G89A 2NU7B 1USWA 4UD6A 1NLFA 1WIWA 1XZQA 2LKPA 3D3WB 3K1NA 5DN6D 3NTLA 2VHQA 2R7TA 3WIVA 1NRIA 1IATA 1L5NA 4QUGA 3OJXA 5SZJA 3OAAA 2J3IA 4XQGA 2FEAA 1RAHA 4UEWA 2DY0A 1THMA 3ED1A 4TT8A 5HGXA 5KQMA 2QE7D 3QEMA 4HQLA 1NNUA 3TSWA 1QKKA 3KSDO 3I9FA 3QE3A 3IAS1 1CF4A 4XX0B 1A71A 1K08A 2IYQA 3FVVA 4NZYA 3GP3A 1HT1E 1E98A 1JVSA 4KT6A 3FMIA 2VP0A 3ZQKA 2YXEA 1XRRA 1MF7A 3IESA 3ABQB 1RLIA 4LS3A 2P68A 1QHYA 1WBBA 3TRJA 4YDSA 4MB0A 2ID6A 4XRGA 2NZUG 2C2YA 1KL7A 1WD5A 3I1JA 4KL8S 2BEJA 2OB2A 3T3IA 1UDXA 4AYTA 2YJ5A 1W0JD 3I2JA 5AW5A 2AOWA 4LOIA 1OW3B 4J03A 2LBFA 1FNNA 5FO0A 3AUJB 1Z15A 5J8CA 2Q3HA 2EB7A 1XTSA 4OL0A 5J1UA 2QAIA 3RS0A 2QTVB 2OP0A 1XTAA 4G5SA 3TNDA 3KQNA 2YMMA 3NHJA 5KQSA 3PDWA 2Q5EA 5FP0A 5ES3A 2HL6A 2EKQA 4I0AA 3PA8A 3HA3A 2W2QA 4XCXA 4TZKA 1PBTA 1T0HB 5ALMA 1KY3A 3S3OA 4F3NA 1I6LA 1YQGA 2H4ZA 4ZWNA 1YJAA 2VHCA 2IIVA 5MFPA 1LDGA 3A3OA 3MUEA 5BR7A 2KHMA 2YV5A 1FFHA 2WMYA 3CP8A 4JCOA 5J1TB 3HK2A 3L9FA 2HHCA 4EGAA 1BWSA 4WNYA 2BIFA 4G4GA 3TOBA 1EBBA 4PLHA 4Z1MD 2DBVO 1WB4A 5JOQA 2ZJQF 1V96A 3UPDA 1TQ4A 5KIAA 3R7BA 1EWVA 3ZR8X 1T5TA 2CXRA 2EFGA 3VBCA 3FSJX 4J4TA 5JS8A 2PMZN 2IBMA 4D41A 2Z2JA 2VQLA 4GR9A 4JXKA 4KE6A 5MF6A 2V8OA 1FLIA 1XD9A 3WGKA 4YQFA 3BE5A 3ULQB 1VE6A 3TGPA 1EFCA 3ZHUA 1YW8A 3K3PA 1XTKA 4H4DA 2OHJA 2XTMA 5HJ5A 4E94A 3CZPA 2BHSA 1TPZA 3FSGA 3AYZB 1R8SA 4UD2A 4CYCA 5GGYA 1ORKA 2ZAIA 2OXTA 3IIKA 4NOLA 5JH7B 4KNVA 1HDCA 2G67A