4KIGA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with 4-hydroxyphenylpyruvic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
332
structure length
332
Chain Sequence
SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 122
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kigA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kigA02
3NDIA 4MTEA 3M6UA 2IVMA 1ZH5A 5LQAA 3I0TA 1XD7A 1KGSA 2MLGA 5GM1A 2QRVA 1WXWA 3F8BA 3UWPA 3DPLC 5HLHA 2OB2A 3OU2A 3A26A 1HKSA 3FXUA 1P39A 1GXQA 1SD4A 1TTYA 1M6EX 5K05A 2FMLA 3KCCA 3P8ZA 1FYKA 2NXEA 3MCZA 4C4AA 1PP7U 1XDSA 2HKXA 1RUNA 3EEOA 1EG2A 1FP2A 3GXOA 1SUSA 2F5DA 1I1NA 2L54A 4UVCA 1FP1D 2QVOA 5FLXK 2C7RA 3EGIA 3R60A 2YU3A 2ONZA 3C0KA 2QE6A 3C6KA 3EQLF 5IT9K 3GVAA 1R00A 1VIDA 1U5TC 5FHRA 2HQNA 3P9IA 2IH2A 3HCAA 5FFZA 4OA8A 1XSXA 4PIMA 2VDUE 4ATNA 1AQJA 3KEOA 2V6CA 2W24A 2G72A 2I7CA 4HH4A 3BPVA 5DUKA 2DK5A 5ICFA 4M6YA 2P7CB 4G9YA 2BH2A 2JJQA 2ZIFA 3KPWA 3UZUA 2A5YB 3E3VA 3UFBA 3BWBA 3CTAA 2XVCA 3RDIA 4IRIA 3DP7A 3UJ7A 2UYCA 1TBXA 1BI2A 4RGXA 2OQGA 3JWIA 3DXJF 5K5QA 4PGGA 1T6SA 3G2MA 2QBYA 2V1UA 1XVAA 2AOWA 2DBBA 1YW7A 1ZGAA 4OX9Y 3TLJA 4P7JA 2EA4A 3FWEA 2K4BA 1SD6A 5GM2A 5K09A 3HRMA 1JXSA 4Q5SF 4O6JA 3P2KA 3DF8A 2ZIGA 2EFJA 3O4FA 4RTKA 1V4RA 2ZMEA 3PFGA 5L3GA 4UNOA 5LHHA 3DXXA 4DM3A 1V39A 3TDZC 4B8XA 1K79A 2B9EA 2PY6A 2EG5A 3ORHA 1NV8A 3FMSA 2A69F 1J7KA 5EQJB 4GQBA 4ENJA 3IC7A 2M1BA 2VT2A 5HS7A 4P5OA 1FYLA 4RTJA 2LF7A 3FPEA 2IP2A 2YSRA 2Y48A 2VOPA 3SQNA 1YZ3A 3I5UA 4XUCA 3HRTA 1BBYA 3HHHA 2O03A 2VT3A 1ONVA 3MCTA 3I64A 2ZLBA 4KDCA 4XLNF 3HTUA 3B02A 2P8TA 3K9TA 4Z2YA 5JVTA 3A25A 2V74B 2FCAA 2H94A 3FUXA 3G2QA 1XSDA 4KUMA 4MQVA 4BHPA 1B1BA 4OQDA 1G6NA 4LG0A 1ZKDA 5FADA 1QGPA 2P5KA 2VXZA 1R22A 1XGMA 3F23A 2QLZA 5DSXA 3LHDA 3EYYA 4AX8A 4C06A 3F22A 3K0LA 3F6OA 4XLPF 3DUWA 3C3YA 1WXXA 2FBKA 4LD5A 5L3DA 2PWYA 1IY9A 4C04A 3W6KB 4IV8A 7MHTA 1BI0A 1RI4A 1TPYA 4F84A 2KW5A 3JTHA 2V79A 5EZSA 4DNCA 4PIPA 4DCMA 3ZMSA 3EMBA 1B4AA 1I27A 4AVPA 3KQYA 1V3FA 4PYNA 3GU3A 3KR9A 2OBPA 2YX7A 5ICCA 2HTEA 1IN5A 1G3TA 5LEJA 5FLXZ 4HYEA 3Q5FA 1R23A 4DA4A 4EJWA 4E2XA 5F1RA 2Z3YA 2PXAA 2Y75A 4ER0A 2P8JA 1FNNA 4R6XA 4EM1A 3SZPA 1NW8A 5TRDA 1N7IA 3VOEA 4BH9A 1JGSA 4OIRF 5K0BA 3M6WA 1LEBA 3G2OA 1ZHFA 1J2XA 3P9NA 2XAHA 1R1VA 4P58A 3EYIA 5E18F 4PINA 4U7TB 2E1NA 4MQ4A 1PJZA 3BDDA 1B6AA 4RTRA 4ZTBA 2W25A 3NQOA 5BS6A 3HRUA 2IBSA 3DMGA 1HKQA 3FX3A 4XUEA 4BNCA 3H2BA 2BBYA 2ZTHA 3P97A 1JSXA 2O0LA 3ABTA 3LAJA 4NQWA 2V9VA 5DLYA 4YMHA 5DM4A 5FHQA 4A5MA 2FK8A 2I9KA 4I01A 4ZH4F 3NRVA 1NHAA 3P7NA 1AF7A 5BMZA 4G6QA 4YUWA 3CVOA 3G3ZA 3E5XA 1QPMA 2DLLA 3QOPA 2AOVA 2MA3A 5DXAA 1FZPB 1T0FA 4CDGA 2OU2A 3KQWA 1XGSA 1HSJA 2IH5A 3FTDA 1YQAA 1K6OA 4BLUA 4LECA 1IF1A 3ELWA 3MERA 4FR0A 2YQZA 3NVKI 4TV7A 3PT9A 3TO6A 3IHTA 4HC4A 2ZW9A 5LQRA 3M33A 1LDKB 4PYLA 4BHBA 4FHTA 1LNWA 2XRNA 3EGEA 5FFXA 1BIBA 2XHKA 2IT0A 2CWEA 4ZZDA 1ZG1A 1SFEA 2NNNA 4HLYA 3I59A 4D0PA 3D0SA 1OYWA 1P4XA 2HFHA 2AR0A 2PVCA 3QU6A 2DFIA 1PP8F 2CG4A 5E8JA 5JR3A 2OD5A 3LKDA 1O57A 1RI1A 4L5IA 3PFIA 2JSCA 5GIPE 1XB4A 1ZLJA 1D8KA 1NW5A 1UHWA 2MC3A 2PFBA 2BR5A 2E5WA 1KIAA 3TPZA 3OOPA 3G8BA 3DH0A 3HOTA 2WC2A 3E6DA 2OAZA 4HGYA 5D5WB 3SFZA 2GXBA 2AVDA 4GEKA 3B3JA 4RGRA 2RGVA 2DPUA 5E1DA 4U7DA 1ZG5A 1ZRCA 3G8AA 3D5LA 3GZ6A 3Q9SA 3LA2A 2XROA 1DUSA 3L09A 5EEHA 4EM0B 4S05A 1QANA 1GXPA 4R8SA 3RKYA 2GIVA 3K2ZA 2P6SA 4A2UA 2FU4A 4E2ZA 4KA4A 5CVIA 1EH8A 4M7RA 3V8VA 2XGXA 3FHZA 3R0JA 4O3MA 1EH6A 3DQVC 1X1CA 1O3SA 1YUBA 5IT9Z 5K0CA 5E9QA 2A68F 5HOOA 2YXDA 5K8VA 2YR0A 1YO5C 5EMKA 3HCDA 1WQ2A 3RIEA 3L8DA 4OQEA 4DCGA 3MEXA 1NBHA 1Y8CA 3RPQA 2DULA 4PGHA 3IEIA 3ELUA 5MHTA 3UJ9A 5BP7A 3GYHX 2IPQX 2AZTA 3GEZA 1O9HA 3L9FA 3UJCA 3EVGA 4KVZA 1MDMB 5C9ZA 1P1CA 5KK1A 2VOOA 4P7GA 1UB9A 5HDKA 1LQ1A 2JPCA 1KQ8A 4JK1X 1R6AA 2AN3A 5EMMA 4ENKA 4EGZA 2EFQA 1OKRA 5BOXA 2NYUA 3ER9A 3A27A 4G7ZF 4OMZA 2O07A 2CYYA 1IXCA 4KN7X 3FTEA 3LL7A 2L3DA 3GFMA 3HNRA 5K0NA 3HRSA 1HQCA 3FUWA 1FBNA 5D5UB 2HQRA 2FYTA 3GDHA 3UJBA 5CLSA 3KQPA 1WSUA 1WI9A 4M9XA 1KU7A 2O61A 4M9ZA 5E1WA 3FUVA 2F2EA 3IL2A 4RVHA 2H09A 4FGZA 4UV9A 2Z6UA 5AIPA 5CVRA 5F2NA 2ZZNA 3GGDA 2GA1A 1M6YA 2RVCA 4CHUA 2WA1A 3KPUA 4ESJA 1VTNC 4BP1A 2ESNA 1ON1A 2CGPA 3ZMUA 4LMYA 4BP3A 1VP9A 2EJTA 4EJUA 3QOWA 2HZTA 3H3ZA 3HIFA 5LQJA 4UVAA 2IA1A 3T7RA 2CL5A 4EJTA 2R6ZA 1G8AA 2Z6AA 3HUGA 3NDJA 1BN5A 1G4DA 5CUQA 2TDXA 2PBFA 2YXLA 3LQQA 3R3HA 3GO4A 5CM2Z 2VC1A 3I9FA 3G5TA 5EGSA 5HFJA 2E7XA 3KZYA 4FT2A 2P40A 1WRJA 3F6VA 1DPRA 3PS9A 4L7VA 5AONA 1O9GA 2EFNA 5ILSA 1IM8A 4U7PB 4WXDA 4IHSA 3EMDA 2FSWA 3RYRA 4P7KA 3CUQC 1P4WA 2VONA 3T8RA 3WTZA 1REPC 3RTRA 4FSXA 1KYZA 5LGNA 3THRA 2K4MA 4FT8A 3KQQA 2OKCA 4CTKA 1YF3A 1G38A 1T98A 1YW9A 2HYFA 2D1HA 3O31A 2JH8A 1F9NA 5E8IA 5FCDA 1CF7B 5DWQA 1ZREA 4KT5C 3W6JB 5DTQA 1F3LA 2IW5A 4RB1A 1ZLKA 2H6CA 5D1NA 3BT7A 4ENNA 3DR5A 4NB5A 2GAUA 5L3CA 4UHTA 2O6GE 2PJDA 3LKZA 2EA2A 5BXYA 3R6TA 3E23A 3FYDA 1UHMA 2NXCA 2JPBA 1WG8A 4YV1A 3T5XA 2ZMEB 4HA8A 4EJVA 1YFLA 2OZVA 2UYQA 3QAHA 4PZJA 3G89A 1U78A 3V8KA 4OINF 2ZCJA 5CYVA 2O06A 3DPTA 3T1BA 1KR5A 4ZYDA 1J5YA 3IRQA 4RGUA 5D8LB 5EPEA 2VDVE 2GWRA 5J6XA 1R1UA 3HP7A 3VSEA 3P71T 3LFKA 2CMGA 1VPTA 3OU7A 5GWXA 1B59A 3V7RA 3A7DA 4G56A 1I1SA 4KIBA 2L4AA 1NW7A 2GQQA 4N0BA 3FPGA 1KU2A 1O7FA 1YFHA 2LF8A 4PCQA 5D6FA 3TQNA 4KYWA 2JHCA 3SM3A 2QENA 5CJ9A 1Z6RA 2VDWA 1BC5A 3IKVA 2QY6A 1R74A 2P5VA 1EV7A 1QO0D 3IWZA 3M9AA 4UOEA 3F8FA 2DW4A 5ERGB 4NHJA 1HW2A 1LJ9A 3C18A 4IV0A 4I0AA 2DQRA 3THSA 1FBSA 3F8MA 3U1DA 3WODF 3GJYA 2AN5A 1R18A 4DKJA 4LGWA 4EJOA 3JTGA 5DTMA 3S2WA 1SFUA 1L0OC 5DPMA 4ZZLA 1WY7A 3WU1B 1X19A 1XDZA 3DLIA 3JAMK 4ESFA 2IDKA 3LBYA 5FQNA 4HGZA 2HKOA 4WK8F 2FF4A 2CW0F 4CICA 2F5EA 1JQ3A 1L3CA 1YFJA 2LSOA 3KFWX 1XCLA 3TOSA 4HV5A 1YB2A 3VFZA 3M6VA 4WF2A 1S8NA 2G9WA 1FBUA 2G7HA 3E7PA 3EVCA 1INLA 5EZQA 2K27A 2NRAC 5H20A 4GOLD 2AS0A 4YUYA 4Q48A 3LCUA 1Z91A 3DFGA 2A07F 3OV8A 1YZHA 4ER5A 5CVEA 3SXJA 3LPMA 5HIIA 3G2PA 5K0EA 4I98B 3WGIA 5HIKA 1AWCA 3DULA 3GWZA 1Z9CA 1USSA 1TQPA 2NNYA 1YW8A 1XDUA 1ORIA 2ONYA 2GB4A 4E70A 1EIZA 5EVJA 2RV8A 3MQ2A 3F3XA 3MTIA 4ETSA 2GS9A 3HCBA 2HGCA 2PN6A 3EVAA 3UJ8A 4M73A 1MJFA 2C7PA 5HDGA 4EKIA 5ERIA 3GNLA 1KHHA 2PLWA 1UCRA 4X61A 3ISPA 2D1VA 5J8FA 3HVIA 3QPTA 4AZSA 5K01A 4IPAA 3GFIA 3C1DA 3HCFA 4M72A 2PT6A 3JAMZ 1KYWA 1HSTA 2XUBA 4HX4A 1SD7A 4HLXA 5DCFA 4AIHA 1R36A 3HOSA 5K1YA 4M38A 1Q0SA 1ZQ9A 4YFXF 2J5OA 3SHFA 4V0RA 1AV6A 1IN6A 2P6TA 1XGOA 5LGUA 1I1GA 3KHKA 1F4KA 3U81A 4XRFA 1BI3A 1BC7C 1MKMA 4CKBA 2W84A 4A0YA 1SFXA 3P9KA 4OIOF 4HRAA 1J75A 3MZHA 2M8EA 4KNYA 1R5HA 4HTFA 2WK1A 1RJEA 3TGNA 3GF2A 5EHGA 2B0LA 4OBWA 2ELHA 2HMYB 3RPUA 2R7DA 4AZVA 2QZ8A 3KETA 1O3RA 1QQIA 3RYPA 3ZMTA 4LK0F 1QZYA 3TR6A 3QP5A 1S29A 1QAMA 1OYYA 3TM5A 5IH3A 1W4MA 3J80Z 3OZRA 4I09A 4AZTA 2STTA 1IAWA 5KQRA 2WV0A 5KQSA 1A04A 2QRVB 2AOUA 3M6XA 2KJBA 4OOIA 3C3PA 2FRHA 1FJXA 4C05A 3H92A 5A2QK 2IPXA 4I0BA 3E8SA 1QBJA 1MJBA 1ULYA 6PAXA 3CO6C 4WX9A 1JTEA 1X1DA 3Q87B 1STZA 3OPNA 3CBGA 2KJCA 4RVGA 2DAOA 1KQ0A 4RX1A 3KR0A 2IIPA 4H0NA 5CCBA 3HTXA 3GIWA 5DX1A 4P55A 2QYOA 5EIFA 2NP7A 3OE5A 3MFKA 1HXDA 3EVDA 5ILUA 2DO7A 5LHGA 1BKYA 2MH9A 2UXNA 3T7SA 1R8XA 2H27A 2BZGA 3BY6A 1JHHA 3BKWA 2PXXA 5DDGA 4YUVA 2NNWB 3B3GA 5D4RA 4RYLA 5LHIA 3HCCA 3OFKA 2PI0A 2IBTA 2JT1A 3KPVA 3AAFA 1W5TA 4L9JA 2F5FA 2Z99A 1I9GA 1XCBA 5E9WA 2VE8A 4KW7A 3D2LA 3K1PA 2PWPA 1IRFA 1H1DA 2CO5A 2DQLA 3ECHA 3QU3A 1BM9A 1Z6TA 2FBIA 1OPCA 3LDUA 3LECA 4L9VA 2RNJA 1O3QA 3PFHA 5EEGA 5M5BA 2EB7A 3NW9A 3PQJA 3ZMVA 3C6MA 3ROUA 1SVUA 1BOAA 4X1OA 4HAMA 1JE8A 2MLKA 3PVCA 3VEPA 3SGLA 1I5ZA 2VBXA 3E6CC 1RJDA 3WU0A 3T0YA 5FQOA 1FBQA 4KICA 3IYLW 3ELYA 1X3UA 3GZ5A 3OU6A 1SG9A 4BHCA 2C7OA 2B25A 3M8FA 2VC0A 4GF5A 4CGZA 2IA0A 4GBED 4RTSA 2K4JA 2ESHA 3NWEA 3CKKA 2ZWVA 1E2XA 4IHTA 4MHGA 4AWXB 3WSTA 4S04A 5GIOE 4EVIA 2MD5A 3JSOA 3BGIA 2A61A 2UYOA 3ELKA 3V8JA 2O3FA 5DYMA 4R1HA 3ERCA 1OR7A 2STWA 5DEQA 2Y1WA 4ISCA 2FXAA 4EM2A 4X63A 2JH9A 5H6RA 3MQ0A 4DQ2A 3SR4A 3CO7C 2L4MA 3KP6A 3DXYA 4IRGA 3R4KA 1T38A 4C03A 3I4PA 1FWZA 4P9UA 3J7AO 3KP3A 2G7UA 3OZTA 4Y30A 1RJFA 5E1OA 3BWYA 1QZZA 1SD5A 1FX7A 4AIKA 5KVRA 5DCMA 2VP3A 2ZXJA 3KPYA 1NW3A 1N2XA 1H9GA 4QLCU 3HA7A 4PYQA 4Y2HA 5T6BA 1DPUA 1PDNC 2B78A 3JWGA 3ZP5A 4UUVA 2ORED 3WE3A 4I2OA 5K0LA 1KP9A 4Y13A 1XMKA 2X4HA 2ZBQA 5DTRA 5E9JA 4FT4A 1HMYA 5DD4A 3K0BA 1DL5A 4CWAA 2O57A 5LQUA 3EVBA 2YTZA 2P3OA 5P8WA 3L7WA 3DMFA 2DK8A 1KA8A 3B73A 3V97A 4WVLA 4BLWA 2M5WA 3TOAA 1K7AA 4QTTB 1I4WA 3SZTA 1JG3A 3I53A 2HWVA 1AOYA 3LA7A 4G7HF 3E05A 2VS1A 3LDGA 5FA8A 4U0YA 3AXTA 4GC9A 4BY9E 3FM3A 3LSTA 1L3BA 3CJTA 3J81K 5E20A 3GCZA 2OYRA 3PTAA 3BGVA 2EJRA 2PT9A 3G7UA 3G88A 3LGAA 4RTOA 2ZNZA 2LD4A 4XSZF 2DPDA 3M7GA 2EFOA 2BM9A 1TLHB 3QV2A 1WS6A 4MEXF 5DCMB 1L3IA 2BR3A 1HNNA 4CKCA 2AVNA 5HZMA 2F5CA 3VYWA 3WE2A 4Q4ZF 3R6SA 1OR8A 3BJAA 1VLMA 3DXZA 1IRGA 4U7BA 1XSVA 2P3QA 2PX4A 5HILA 1YS6A 4FSDA 4MWZA 2UYHA 4ESBA 5FWAA 5E17F 1TW3A 5B1SA 4Y17A 2P7IA 4O5VA 2C6YA 4LK1F 5HVQC 1B42A 1DP7P 3KP2A 4PWYA 2RN7A 3GRRA 3CUQA 2HEOA 1O3TA 1RUOA 5HIJA 3KP7A 3TDUC 1NBIA 3FZVA 2B3TA 3NEUA 1W7PA 5HLIA 4RWZA 2NP6A 3E6BA 3HVJA 1JG4A 3O6BB 4L0ZB 1QAQA 5DT2A 1VQ1A 5EIWA 1FOKA 4OIQF 3Q9VA 2OZUA 5DD8A 2AOTB 3KR2A 5K5OA 4QQKA 2ZVJA 3RODA 5A2QZ 4R6WA 2FPOA 4LB5A 4PYJA 2KKOA 3BP8A 2FQ3A 5U4XA 3TRKA 4Q47A 4ER7A 3FTCA 3MAGA 5L3EA 3UBTA 1ZN2A 2BEOA 2AOUB 3AY0A 2ZIEA 5ICEA 1EJ6A 1PRYA 1KPHA 1SMTA 1KU9A 3MHTA 4ASNA 4RB2C 4KDPA 2GZWA 4L18B 2PQ8A 1Z1DA 2KIUA 2XAFA 2FA5A 3HVKA 3EGVA 5TJJA 3ID6C 1S3JA 3GLXA 2G70A 1Q0TA 3WTVC 2HWKA 5FD5A 3LCVB 4FZVA 3CC8A 1JSZA 4IWNA 3RI4A 3ANXA 4BYYA 2PXCA 1G8SA 3QRFF 2XV4S 3ERED 2NXNA 1RI7A 4GUAA 4KRGA 3MWMA 4HTFB 4A5NA 4YUZA 1RNLA 4RV9A 2ZWAA 5J8CA 1P2FA 2X0LA 1MHTA 1RI5A 2YX1A 4IKPA 1IW7F 1SQFA 5CVUA 3VC2A 4XSXF 4O29A 3G73A 4V0QA 4F85A 4IXAA 2FRXA 3R0AA 5BW4A 2VN2A 1S6LA 3I59B 1RI3A 2PX5A 5EOVA 2J5PA 3KP5A 5CVDA 5FUBA 2P7HA 2G71A 3QOXA 3T0IA 1NT2A 4LG1A 3M8EA 2A6EF 4GYIA 5C0OE 2HR1A 2PMHA 5D6EA 1U6GA 2AOXA 4CXFA 1CF7A 2BGCA 5LQKA 3F72A 2Z5UA 2ADMA 2JG3A 2V1DA 4QDKA 4DF3A 4U0WA 4RS8A 2H00A 4XCXA 1P92A 5D4SA 2A3SA 4P96A 3FPFA 3UJAA 5EMJA 5ICGA 2HTSA 3R0QA 4HZFA 2EV5A 2GPYA 2M30A 4N9HA 1VL5A 1FYMA 3ZMZA 2HOEA 2ACJA 4Y15A 3ZQ7A 2OO3A 3GW2A 1NE2A 5F64A 4HF0A 3U9GA 3BXOA 1CGPA 3HCEA 3PLAE 2Q0OA 1SKMA 3I54A 1D2CA 3G5LA 2O05A 3MTEA 4RSRA 4YV2A 3KP4A 5K5RA 4R79A 4RTNA 1W5SA 3HM2A 1HKTA 5E8GA 3WTXC 4QVGA 1RZ4A 1MD0A 2DTRA 2OQRA 3LBFA 2W85A 1KU3A 1SQGA 2L01A 1XJ5A 4RGSA 1PUEE 4GXOA 3V4GA 4CZZA 5F2OA 3CUOA 4EQQA 1U5TB 3LWFA 2W57A 3ECOA 4HBLA 2YX4A 3ELDA 5HEKA 3E97A 3F4KA 3DTNA 4BXUA 2WTEA 1BIAA 2LDUA 1S7AA 1JQEA 4JBAA 1GVJA 3GX4X 4B09A 3KKZA 1YTYA 2OBFA 1J59A 3HSEA 1IZ1A 4RAYA 3KLOA 2MH2A 2RQPA 2OXTA 4M71A 1R58A 4BQAA 3KR1A 5FO5A 4HSGA 4PCAA 4GC5A 1IN7A 2ADUA 5HLGA 4LWPA 5FWDA 4HQEA 3MGGA 1XTPA 4FS8A 3HYIA 3P2IA 5LRRA 2GAFA 2ZZMA 5JHUA 3FPJA 1P6RA 2NS0A 1KPIA 4KN4X 1Y0UA 2XAGA 1HBXG 2K86A 4L9NA 2ZULA 4I02A 1EQAA 3WGHA 3O2PE 3ZN0A 1G6Q1 1XGNA 1YYVA 5LR6A 1MDMA 1JR4A 3V7SA 2XYQA 2L02A 1HW5A 2R3SA 3KEQA 4IJAA 2CMHA 3TKYA 1WZNA 1KXZA 4DQ0A 3V8LA 5KS2A 4HX7A 3EVFA 2HV9A 3FF5A 3E5UA 2IFTA 2FMYA 4AIJA 2EX4A 4CYDA 5IKMA 2G1PA 1KQ9A 2ZZKA 1WWXA 5CD1A 1U2ZA 4HOBA 1L1EA 1L3LA 2PLYA 1D2GA 2ZBKA 3NMUF 4U0VA 1GHCA 1UWVA 2QWWA 5LLQA 1QYRA 2PX2A 3BUSA 5KYGA 2LNBA 2CKDA 2P41A 3WTWC 2VE9A 1USTA 2YPRA 2P7VB 4E2WA 2H11A 5AIQA 2AOTA 5LEKA 3E6MA 5E2BA 3PX2A 3FTFA 3O7WA 4YIFA 1DCTA 3TQSA 2NYXA 3HEMA 2UXXA 4ZYEA 1XCJA 3R9XB 1P1BA 3PX3A 3AXSA 3TKAA 2CQKA 3WTYC 4R05A 1XXLA 2ZSUA 4EKGA 2Z9OA 5LGTA 1R8YA 4PYOA 1BC8C 5L3FA 1LVAA 4KWCA 2PV0A 3B5IA 4C07A 4OBXA 3HHGA 1KPGA 3A7EA 3LX6A 2K02A 1ZG3A 4POOA 4M6XA 2ESRA 3VC1A 1R5GA 5ILVA 3N4MA 1LEAA 3SSNA 1BOOA 1MJ9A 2ERCA 1SUIA 1Z05A 5HDNA 2XYVA 3KQMA 5EMLA 4QPNA 2ZBPA 3OE4A 3CJNA 2JRTA 2PEXA 3M4XA 5H02A 5D1HA 4IVNA 1YG2A 3VODA 2AS5F 5EHIA 2GA9A 4KMUX 3SX0A 5LSAA 4ER3A 4ZYHA 1BI1A 5GINE 1B9MA 1X1AA 4HF2A 3S68A 2XYRA 4GOND 4M74A 3NTVA 3KU1A 5DX8A 3V7CA 1LB2A 4QTUB 2FK7A 4RAZA 1O54A 2RC4A 3N97A 2VBZA 1T39A 4MTLA 3BJOA 4MIKA 2YR2A 5FULA 1IXRC 2NAZA 4CKEA 4F7ZA 4CO8A 2A14A 3HVHA 4P7FA 3BWCA 5LQNA 4RB3C 3HSFA 5GOZA 4RVDA 2QQBA 3FUUA 5K0GA 4RTPA 2C7QA 5F2KA 5F6FA 3L2CA 1FT9A 3DMHA 1OYIA 4KIFA 5DRTA 5FB2A 3KLNA 2JHAA 5JFRA 4UVBA 1QAOA 5L3BA 1Z3CA 4X41A 5CIYA 2WWYA 4HF1A 2Z33A 5FA5A 5DV5A 3GRYA 2V7EA 4K6MA 4G6DA 2UWMA 4ER6A 3KQTA 2QM3A 3O3KA 3B89A 4QPPA 4DMGA 2COMA 3EETA 5DXJA 10MHA 4QWQA 4PDKA 2HDCA 1P4AA 5BPDA 3EVEA 3EDPA 1XN7A 4OIPF 5D5XB 4EK9A 3QP6A 2CWWA 4YG2F 2VODA 1U2WA 1JQDA 2ZKZA 4PYKA 2D2WA 3GFLA 5FGMA 5T64A 1DUXC 1OMIA 2NXJA 2Y1XA 4L5JA 3GRVA 4L9TA 2EFPA 1O7LA 3BWMA 3LA3A 1TNSA 2ZBRA 5FD6A 3FXQA 2BE5F 3J81Z 3WTUC 3IKTA 3CLOA 3OCJA 4I7HA 2PGXA 3EPPA 5EC8A 3I71A 3K1MA 2CFXA 2YVLA 5E2AA 4HDVA 1N7JA 4YFKF 2P5LC 4JXJA 3SVZA 4WWCA 1IN8A 4UV8A 2BM8A 2BR4A 2RKHA 3GO5A 4A0XA 1D2HA 4AZWA 4YV0A 4HDUA 5LRSA 1W7PD 4PCLA 3PQKA 2ZCWA 4WXHA 1ZRDA 3GRZA 4HQMA 4G7OF 3IWFA 1U5TA 5KVAA 2XAQA 2E7WA 4OA5A 4E31A 5D5VB 3JWHA 1ZGJA 2ZJ2A 1SMYF 2DT5A 4AD9A 2OB1A 2VBWA 3F8CA 5BQTA 2OZ6A 4PYIA 3LAPA 2UZ4A 4LFUA 3ULQB 3A4TA 1FPQA 3JSPA 4F86A 4XUDA 2O0YA 3DV8A 5HS8A 3BWGA 3F8NA 2ISZA 3IRRA 1TQMA 4A6DA 3WTTC 1G55A 5HIMA 1MJAA 4BAYA 3NWBA 3NJRA 1VE3A 1NW6A 2Q2EA 5DRYA 1HW1A 3OFJA 1NV9A 3UJ6A 2EV0A 1I6XA 2QBYB 2O8XA 2XIGA 1Z7UA 5CVJA 4EGYA 2Q41A 4OMYA 2EWNA 1RJGA 4GGGA 5K03A 2YUIA 1UIRA 1F5TA 2AN4A 3ER8A 2JTVA 4HG2A 3KE2A 5IT3A 2HTJA 2QQAA 2ZNYA 1YIOA 4LLLA 3MZYA 1ZAOA 3LDFA 4KIGA 2FHPA 1U8RA 4ENMA 3R61A 4HX8A 2IDJA 2FOKA 3RJPA 2ZFUA 3TO7A 2PBIA 2XKPA 3FM5A 4WXCA 1ON2A 2E1CA 3FPHA 1W7PB 3T7TA 1VP3A 1IUYA 1TQIA 4ZYGA 1E17A 1G3YA 1BHJA 5H6QA 4GOMD 3UA3A 3I58A 3SXYA 3DLCA 1Q1HA 3CUQB 4FP9A 3BOQA 1FLIA 2GH1A 2OPBA 3K69A 1VBFA 4GYGA 1XCVA 2HNKA 3DEUA 2I6GA 4PNEA 5E1MA 4CXMA 4OU0A 4LB6B 4UXNA 1JG2A 2P35A 3KZZA 4IRHA 2XBMA 4H0EA 3B3FA 2ZFWA 3F21A 3FRIA 3Q7EA 3ME5A 3TMAA 1JG1A 4ON0A 3FMRA 1RI2A 1WKMA 4E2YA 5DX0A 1SAXA 2H6BA 1T2KA 1EJ0A 1D8JA 3E5QA 3EVZA 3FRHA 3HSRA 2P3LA 4WCGA 1JTFA 3BROA 1FSHA 4R8RA 4M37A 2ISYA 4MGRA 3NVMB 3M70A 4A6EA 1EAMA 4LLGF 2IA2A 3VB2A 4AUKA 3DOUA 4FX0A 2PMUA 4M36A 3KQVA 4MTDA 5T67A 4A12A 1FSEA 3IHUA 3B7PA 3MB5A 1U3EM 4RTQA 4RB0A 3CDHA 4IF4A 5E1ZB 2KIFA 3TM4A 1ORHA 2HR3A 4HW0A 2LKPA 3L00A 5FTWA 3SMQA 4KMFA 1P91A 3SSMA 2GLUA 2B2CA 3UJDA 2VBYA 2QQ9A 3X0DA 1YS7A 2BV6A 3ZN1A 4M9SA 4K2EA 4EMSA 5K0JA 4MQ9F 3HA5A 1MGTA 3WG9A 1UFKA 5G02A 1M0EA 2Y0MA 4R8HA 1L9KA 2XVMA 1LDDA 2G8NA 5GP1A 4CTJA 3WGGA 2N47A 4YFNF 2V1XA 5K0FA 3FYCA 1XMAA 3KQSA 2VZ9A 3BPXA 3RIRA 3BZBA 3GFJA 1RIOH 2AXLA 4LG0B 1J9IA 4FX4A 2Q8KA 2HYGD 5CCXA 5DUIA 1ZYRF 3BGDA 2XKOA 1ZARA 3C7JA 5E1XA 2CSOA 3IV6A 1MZBA 2GXGA 4RVFA 1IXKA 3T8TA 2FNAA 3JWJA 1D3YA 1R1TA 2OA4A 2HS5A 3FMQA 2IJLA 3DKWA 3GUDA 4RTMA 2RDPA 3AJDA 1IN4A 5BW5A 2FNPA 5JUWA 1LDJA 3CGGA 1FC3A 5DM1A 5EKXA 2EFWA 2F8LA 2H1RA 2XAJA 3REOA 2EJUA 5C1IA 3HA3A 1F1ZA 3RW9A 1R7JA 1ZRFA 5DM0A 2M87A 2PJPA 2QUFA 2D45A 2P1DA 4L0YB 1BJAA 3LQRA 1F38A 3FXRA 2FBHA 4BLVA 1TNTA 1FY7A 3TFWA 3SSOA 1K78B 2PSSA 5E1BA 9MHTA 3COAC 3EEYA 3RKWA 4YIIA 3TOBA 2DI3A 3JW4A 2JHPA 3KPJA 2IRFG 3ZPLA 1NKVA 1J0RA 1T43A 4B17A 2GA2A 2XVAA 2I62A 4GOOD 1H9TA 4KFCA 1G60A 1UFMA 2XASA 4N9IA 1DDNA 2IH4A 4QDJA 2FEZA 3P2EA 3M1EA 5E8RA 4GO1A 2OY0A 3BKXA 1EH7A 3KQOA 4MHTA 3QPHA 4G94A 4QQNA 3MAJA 3RKXA 2KRFA 4RTLA 2PG4A 3AWIA 3C3WA 4U88A 2Z6QA 1YLFA 5HOQA 4XBFA 8MHTA 3FZGA 2PKWA 1AQIA 2YXEA 4G8XA 3ABUA 3J80K 5LQCA 1IXSB 1ODDA 3U2RA 4LLNA 2M45A 3BZ6A 5D8KB 4A0ZA 2BYVE 3K6RA 4P9FA 5EG5A 5CVVA 4YUXA 4E32A 2P4WA 3BJ6A 4C08A 3GRUA 5EKUA 2JZYA 2DPMA 2R7FA 3R24A 4PONA 1QNTA 4E33A 3P9CA 3H3UA 1G3WA 4LWOA 2ETHA 2ZO4A 5DSTA 2EK5A 3K1NA 5LBQA 2WA2A 5HS9A 4DZRA 4KDRA 5JI6A 3OZSA 1H0MA 1K78A 3LCCA 4E30A 4PYMA 1S7OA 1G3SA 3ZMDA 2EV6A 4MEYF 1JHFA 3CJQA 1C0WA 5DM2A 1B9NA 3CCFA 2K7LA 4EV0A 2KIMA 3CJRA 3TO9A 3WTSC 3UA4A 2A6HF 2PX8A 4HV6A 4YMGA 1D5VA 2MBFA 3HTSB 2IGTA 5ED4A 5BPIA 1TW2A 4JQFA 3FUTA 1X1BA 4GCVA 3PB3A 3EUHA 3ML6A 2UZKA 4X60A 2FE3A 2DU9A 4EQZA 4MNUA 4QVKA 4NECA 4LJZF
chains in the Genus database with same CATH superfamily
4BMPB 3FXOA 1B2RA 2NZ8A 3IH4A 3OP1A 4KR6A 4PZDA 2IVMA 5KJ6A 2NAPA 4LGYA 1J2UA 2R6HA 4RW0A 2AE2A 2MLGA 5GM1A 3ZQKA 2ORIA 3UAGA 2QRVA 1LPOA 1D5YA 1EP2B 2FPSA 3N6XA 3QOFA 1JSCA 2ACEA 2PUAA 3F8BA 2Q5JA 3IDQA 2W9XA 4I4LA 1UFQA 3IO3A 3DPUA 4DCCA 1XC7A 1UDWA 1GU0A 1PWHA 1QP7A 3Q3IA 4A3JJ 2JFPA 2AMVA 3CRRA 3HWWA 2BP7B 1YB5A 4E7PA 1EAYA 4XFKA 3KCCA 3CC7I 2J6BA 3N2KA 3S40A 3C45A 3G2JA 2X9NA 3IV9A 3MTJA 4QDXA 4CQMA 9LDTA 1C3OA 1L7XA 4E46A 1ADCA 1NULA 4C4AA 1EHYA 1YR8A 1P31A 3NRBA 3EGDA 1SBHA 1EG2A 4L8VA 5KOIA 1SUSA 4G89A 5J2TF 4EG7A 5JNUA 4WUTA 1BQ4A 1R6DA 1ZDMA 3H17A 4UVCA 1UEXC 5JXWA 1FFGA 2V0GA 5SY9A 4EA9A 1PLLA 4WOKA 1J20A 1N2ZA 3SSMA 4DYRA 3R60A 1QUFA 2C00A 4O4LB 2YN4A 2XZLA 3D3NA 4P1ZA 2EINH 2QE6A 2QX8A 3WTCA 3KB6A 1B8NA 5IT9K 3CH7A 3Q8WA 1BRTA 4KNVA 4NZOA 5BVHA 2F8TA 1TA4A 3OA0A 3GVAA 2PV7A 3R3ZA 4I1IA 4P3PA 1R00A 1VIDA 4Y2QA 4E21A 3KU4A 2WD7A 4GPAA 2CVQA 4KO4S 3WL5A 2IH2A 5BSGA 2HSEA 3K15A 3L02A 4MR9B 5BWNA 2G0NA 1WZEA 2ODQA 4PIMA 1EG7A 4DY4A 2R86A 1ESNA 4C0WA 3CLVA 3L8ZA 4DAOA 2W24A 3RYIB 1AUVA 1D6SA 2FRVA 4CETA 5KHLB 1F06A 1AH2A 5BORA 2C92A 1CUHA 1M34E 4LCEA 4O59O 4RHCA 4YREA 3MS4A 3V9AA 5TLSA 1IL0A 4JUDX 4FMCB 4QOSA 1QB7A 5EE9A 4JZYA 4L4XA 4ZQIA 3F5SA 4JFRA 2KBFA 3OYMA 2P7CB 4LQCA 4MH0R 4UBLA 4O2LA 1QG4A 4ZT5A 5K51A 4CCNA 1GPJA 5LP6F 2CJWB 5G1PA 2IHJA 1WW2A 3UZUA 2A5YB 5K9ZA 2BFCB 3E3VA 2BVMA 5GY7A 3BWVA 3HJTA 5J2UA 1EGHA 4UBOA 3UFBA 4FN5A 2AFIB 1P2GA 2XNJA 3B2NA 1ZTRA 2PT5A 2QAGA 4ZC8A 1REQA 1Z38A 3PKJA 3RDIA 1IY0A 3RT9A 1HDEA 2MMCA 3UJ7A 3VZDA 4DJDC 1UM9A 4Q05A 5AO9A 3BTJA 1W46A 1XQ6A 2ZRGA 5TS2A 3JWIA 4BNVA 2OCYC 5F76A 2O4CA 1U3WA 3I8XA 3ZDRA 5E7QA 3I0NA 3DXJF 1T5OA 1F48A 1U8TA 1YVUA 2DQ4A 5DV9A 5K5QA 3ROXA 2AYYA 4KYVA 1IH8A 4QOEA 5JPCA 1JPVA 3MC1A 3N6VA 4OHMA 2QGUA 3KJGA 4W8GA 3D8HA 1UBUS 1G42A 1P0PA 1A8IA 4J16A 2O2DA 1Z37A 1C14A 2I10A 3O82A 4KXLA 4F97A 3OTHA 3MWJA 4Z7QB 5K8UA 1KWGA 2VJ5A 4YJFA 4P7JA 3UUFA 4B8ZA 2JIQA 1CUEA 4QQNA 4PSVA 1JHUA 3A05A 1XLUA 3RVPA 1E66A 5A4JA 4YRIA 1SD6A 2QMEA 2AFRA 3WYCA 4F96A 1T1GA 3IBYA 3U49A 4HNGA 2X48A 4XWYA 4IGFA 3CIFA 13PKA 1JXSA 3FOWA 3T1NA 4Q5SF 5I7RA 1AKVA 3W0LB 3JQGB 4DDKA 1EJBA 3DF8A 4PX2A 1KKLA 5EMHA 5A4IS 3AT1A 3CDIA 2ZIGA 3MWKA 3V8NA 4AECA 5J43A 2W1OA 1DGQA 3K72B 1CUXA 2BI4A 1Z33A 2UUPA 2ZMEA 3PFGA 4LF4B 1T34A 1G41A 3OPYB 4AM3A 1C7IA 1CE8A 3Q7PA 5LHHA 5IVKA 1YJ9I 1I0IA 4EAQA 3PQCA 2CQQA 4DIQA 2PUHA 2H06A 3NP9A 1UPTA 2Q1UA 4IZHA 2B9EA 4J7AA 4BUPA 1TIBA 3I6BA 1E7YA 4NF2A 4EF5A 2A69F 4F2PA 2XHZA 4YDQA 2LVBA 4LJ6A 2QN1A 2DY0A 5KYYB 3VFDA 2FDCA 4BP8A 4ENJA 3BGWA 3IC7A 4XLCA 2R60A 3ER6A 3KP1A 3OL4A 1WXGA 3ZIAD 3T3EA 5DBIA 3BFXA 1C29B 5KVCA 1FYLA 1Y33E 4MP6A 2LF7A 1D0IA 2EZ9A 3CNOA 2QOEA 3VPHA 2GYWA 2B82A 1PQ4A 2AKAB 4HXYA 4QU5A 4R1MA 2KPMA 1VSUA 4BJ5A 1XVVA 4BKXA 3DEHA 1P6XA 2PZGA 3U4IA 4N3AA 3GBVA 3ZYCA 2C3MA 2A30A 2RGGA 1F36A 3HRTA 1BBYA 1RR6A 3A1NA 3RKUA 1ONVA 4EWLA 3OVMA 1LPMA 4TLDA 5IZCC 4KDCA 4XLNF 3HFRA 1DX6A 2X3FA 3WX0A 3B02A 5IM4F 4B44A 3DEAA 1T36A 4RS4A 2XCOA 4Z2YA 4XN3A 2V74B 4DG8A 4NPAA 3ZHSA 1Y7LA 5AI6A 4XKCA 2GZHA 1XSDA 4UOZA 2CBGA 1PHPA 3ZH2A 2EZLA 5JHGB 5BXQC 1B1BA 2BRUA 4V38A 3CCJI 3ZE8A 5IVIA 1MQAA 1Y9EA 2WB1A 2X1DA 1VL8A 3SC2B 1G2HA 1OLTA 4D44A 3ANTA 1V3QE 2VXZA 2Q5IA 3U9TA 5JS7A 2EGHA 1YB1A 1PJ2A 3HUUA 3K05A 4NRDA 4W8HA 3OZGA 5DSXA 1NUQA 3JSXA 4X95A 3UKOA 6REQB 1A8PA 1OYOA 4U9UA 3DUWA 4C2MJ 4R1NA 1WBJB 5HF5A 1I2MA 2C57A 4LHZA 1HF0A 1DMSA 1L5FA 3HEAA 4ZT3A 2EBUA 4OOFA 4MVJG 4X7MA 1QP4A 1BS1A 4IV8A 2JFFA 4LEIA 1BI0A 4LJ9A 5ALNA 3OYHA 1HX7A 1GGKA 4FI3F 2W71A 3MOGA 4NMHA 3LRPA 3UOGA 5JRZA 2PUDA 4XVHA 2FWBA 2DFKB 2LWIA 1MF7A 3G0OA 3RRXA 2KW5A 2EARA 3CVJA 5K8TA 2ABWA 5C8YF 1W36C 3JTHA 3DT6A 4BMNA 1UIMA 4K1LA 1C3LA 3ZLJA 2O7OA 4WT7A 1II0A 3OJOA 1IBSA 1NK2P 4R1LA 4Y2GA 5HKKA 1I27A 3QLVC 1A82A 3I4LA 4JV5B 1EX9A 3FCEA 2GN6A 3VU3A 2P67A 1EKEA 4PSAA 1SULA 3T3DA 1DWQA 1WX1A 4XARA 4BVKA 3UXHA 3L6BA 1W9HA 3SS9X 2XE6A 5IZCA 5GGYA 1GNVA 3HGYA 2XGJA 2HTEA 2J9GA 1X6VA 1IN5A 1FDTA 4TSFD 3F4LA 2DCEA 3LYUA 4Q16A 2BMJA 4L07A 3Q5FA 2R8BA 1M5UA 5IMBA 1QJCA 5LC1A 3N53A 5ALEA 1STOA 2UYGA 5JZOA 3S8YA 4DA4A 4TRNA 1TM7E 2WAOA 2WG1A 1QPGA 1E5XA 2VQLA 2JFWA 3FWPA 4ER0A 5AW0A 3SZRA 2P8JA 4Y9TA 4CLRB 2OAQ1 3K7EA 3WIDA 4PLHA 2FUG2 1F0YA 1PNTA 5TF0A 5IHPA 1N7IA 1A9QA 4IIJB 1JGSA 5E7MA 3LSGA 4D7MA 2B30A 3C3XA 3D02A 2BUBA 3IPYA 1LEBA 1X13A 4MQFB 4XPZA 3JVVA 3RJMA 4CA0A 4B6PA 2XAHA 1OQAA 1SEVA 3JQAB 3VHXA 2OD2A 3U31A 3QKRA 2XB2A 4KQ2A 3AYXB 3A1UA 4PINA 5K8IA 2WJ4A 4U7TB 1U9JA 2E1NA 1HDXA 3INYA 3JRAA 4QUEA 5F2NA 1PJZA 3BDDA 1QNFA 4NAVA 4P53A 1NVXQ 1JEQA 5CXXA 3RYHB 5B3JC 5JECA 5FKNA 4P9NA 2BSQA 3H36A 1OH5A 3WRVA 2NGRA 2VXOA 4COOA 3HCNA 4M8NE 4XUEA 3VPBA 1Z7YA 3H2BA 4AKGA 5KVQA 4MDHA 4Y8VA 1BMTA 4K3VA 1G0NA 3P97A 3LAJA 4XVCA 2O2EA 4GICA 5D5PA 2GIZA 2Z2ZA 4GT1A 3FXJA 4PRYA 5DM4A 3SQOA 1X7XB 5FHQA 4Y18A 1Y5NA 2R25B 4LVNA 1UF9A 1CR2A 1GU7A 2PGDA 1JXOA 3TSOA 1QC5B 4ZH4F 3Q8KA 4O1HA 3VNRA 2H5LA 1E1RA 1KAMA 2X5OA 5BMZA 3L79A 4G6QA 5KNLA 4YJKA 1NPDA 1SD2A 2DAPA 3BIOA 4HB2A 1KMIY 4PZAA 5J4HA 2GZ1A 2HMSA 1TDJA 1QPMA 3QOPA 2AOVA 3ZKAA 5C7LO 5K0JA 5JQWA 2GN2A 1E69A 4BCBA 4P86A 3DYIA 1P2BA 4KO8A 3U4DA 3AG2H 1RXWA 3ROZA 4BO5A 2FE4A 5GGXA 1NONA 4E1VA 4JI7B 5IUNC 5LUAA 3C3BA 1JBEA 3LLCA 2PKEA 4P1WA 1L4KA 1WCWA 3IIIA 5J5AA 3J7YJ 2FR8C 4HYYA 1VQMI 3HGTA 4HC4A 2VP0A 2ZW9A 4D9IA 2O3TA 3URMA 2M1XA 2X9QA 2EFHB 1M6HA 4MX8A 4OLAA 3IVRA 3EPRA 3OEWA 2VPYA 5FFXA 3BSSA 4EW3A 2Y76A 5B64A 4IH9A 5FO1A 5SV2A 2IF2A 3A28A 1WCV1 3WOVA 5HM8A 4ZCIA 4HLYA 1HE8B 2Q1TA 2ZRNA 4LF7B 3VVBA 3AVTA 3K16A 1CQZA 1CZOA 2OGSA 2HHCA 2XNHA 4O2AA 3ZUPA 2IZZA 2QMYA 3CRQA 1H05A 5TISC 2FKNA 3AIMA 4HLUA 2Y0SA 1I2DA 3VBCA 4FFNA 2PVCA 3BS4A 5BURA 5FPKA 2QSJA 2J7PA 1M6WA 3FOZA 1MPTA 3QKSB 4MXDA 1YZTA 3IVMA 1W4AA 3WU2C 1UMCA 1W85A 3LGXA 3WB1A 4I66A 5EAIA 1L5QA 1RI1A 2LGJA 2WJJA 4MTCA 4J03A 1GTVA 1HG0A 1P77A 3AEZA 3PFIA 3JD0A 3X1XA 4EHLA 1N0WA 4IXNA 4QGBA 2BGUA 3NVAA 1XB4A 4MRNA 2P0YA 1E5QA 1NW5A 2K7ZA 2MSWA 4RZQA 1UHWA 2MC3A 3UK0A 2BR5A 2E5WA 1KIAA 1XZPA 4R2KA 4DT1A 2I1WA 1QQ6A 4YASA 3E6DA 4H6XA 4EEKA 2OBMA 4HGYA 3Q3SA 1PF7E 3UAZA 1O97D 4J9UE 5CDTA 2H1OA 1BJTA 3HXPA 2AVDA 2GSDA 2V65A 4GEKA 4NBVA 4KZPA 3QZUA 2ODEA 1MQ8B 2RGVA 3NEPX 1ENHA 2Q6VA 4NESA 5E3JA 3KOOA 2ZSHA 2EP7A 3GAMA 4ILKA 4MQFA 4UAGA 4EHNA 5KOJB 2WADA 5BT9A 3GI1A 4DPKA 1T2NA 3HKDB 4M9CA 1D0YA 1BL0A 2WTMA 2OC6A 2N1BA 4ZC3A 3GEPA 2ZIUB 3B6ZA 1RWXA 3C85A 1DSSG 1QANA 2YL2A 3RD5A 4EPVA 2C3YA 2QPLA 3R6GA 4CM8A 4CLEA 2ZM5A 4F9TA 3LDHA 4G0YA 4WCFB 2VBFA 1SG0A 1SUFA 4KFUA 4XLTA 4U0KA 3LM8A 4B4KA 4KA4A 1T8RA 1PEAA 1UBGA 1DEOA 3NOVA 3PQ5A 4LZAA 4RPKA 2QRHA 1NBME 2XGXA 4GLJA 3H35A 5M3BA 4KRXA 2IIVA 1US8B 3T9EA 5IEBA 4B6EA 1EH6A 1L4FA 1O95D 2OGWA 4ADSG 1O3SA 5K6AA 2VH2A 1YUBA 4W5NA 2GZAA 4RA2A 2A68F 1P1RA 2YXDA 4OHVA 1JA9A 1KU0A 1YO5C 2GDJA 3HCDA 4Y2UA 4JYMA 3X2FA 2NO0A 2EW8A 1F8YA 3TXAA 4GLBA 2JVGA 4EGQA 1SBYA 1P1FA 5JZSA 2O8CA 3H0DA 2PJZA 3IEIA 1GXSB 2HJWA 3JQGA 4XD7D 2A58A 3TEMA 3AFOA 5AW3A 2LYCA 4CKWA 2CUJA 5MHTA 4JCCA 3UJ9A 2IDZA 3I4CA 3U0VA 2RJOA 4JFAA 5BP7A 3U7RA 1R4MA 3ZDEA 1LF0A 2XZPA 3TQSA 4BKQA 1QZEA 4GQAA 1DX4A 3TI9A 1Y6GA 2ZQZA 1DZ3A 1ZN7A 2D54A 1QHYA 2FWRA 3EVGA 5DEIA 2FU5C 3IQZA 3F71A 5L45A 3CLKA 2UU9B 2VOOA 2GF2A 6REQA 1PZHA 4J4TA 1FTSA 1SBNE 1MXFA 4X90A 4DA0A 1U2PA 3H0GJ 2EFQA 2X22A 3CDLA 4IICA 3IP9A 2NYUA 2QLLA 4ACBA 3JQ9A 4M0MA 2E35A 3NV7A 3CY6A 1T8PA 2OV7A 2O07A 4LIPD 4L8WB 1SANA 1IXCA 3FTEA 3HZOA 4S12A 5D7BA 5JLJA 2I6UA 1P5RA 3KAQA 4TYNA 3V4OA 5JNRA 3R6WA 1S7EA 2YZKA 1Y39A 3WLIA 2C4UA 2Q4TA 1ZH0A 3GHHA 1HQCA 1RHMA 3Q6IA 2GYVA 1UC5B 4CN8A 2XCRB 4UVGA 2VJIA 4CLDA 4ESHA 5EHNA 3VU1A 5D5UB 4UPDA 1CUSA 3H84A 3EW9A 3GDHA 3UJBA 5K0SA 4N0EA 2Z1DA 3L1HA 3K9QO 5CLSA 4FHEA 1RCUA 1WSUA 3BAZA 4YXFA 3EE6A 3EFBA 4C4YA 1NL3A 1ETKA 3KSAC 3T5AA 3HOYJ 2O61A 3OYKA 1BCRA 1BMFA 1VCHA 2GBCA 3H1FA 3PDWA 3WP0A 3CCYA 2PFGA 3TSCA 4KITB 3FUVA 1U1CA 1XQ1A 4NH4A 5CK4A 3NHWA 3RPUD 2EQRA 1JIIA 4LXQA 1TEHA 4ENSA 1QHHD 4RVHA 4WZAE 4ZOBA 5LIRA 2Z6UA 4L0QA 2O3UA 1B16A 2PMWB 4L9AA 2V3CC 2C5GA 1QHIA 3IH2A 1DRKA 2GA1A 4FQ7A 3T3PB 3NKVA 4ZJUA 2E1MC 4CHUA 2NACA 2QVBA 3HZZA 3E6AA 2OCDA 3OWXA 5IP7J 4NOLA 4QE3A 2HW8A 1B23P 1BE1A 1ISSA 2NQTA 4D97A 1AKRA 1ZI8A 4LMYA 1WTAA 3AKDA 3CZMA 3EFEA 4XMYA 1VDZA 3O3NB 3QJ5A 1B8IB 4PLTA 8ABPA 5JJLA 3WLKX 3PCRB 5BVHB 3KPHA 1Z2EA 3FHOA 2FRDA 4IFTA 3S2FA 5ECGC 2HRQA 3ZV7A 1NDUA 3R9WA 4P4UA 4N9WA 3DDZX 2CL5A 1WETA 2A84A 1ETQA 2F5VA 1G8AA 3C8MA 4BVBA 4C0KA 3HYNA 3NDJA 3SQLA 4E51A 1BN5A 3M6FA 3RQSA 5KTSA 1KFKB 3KYCA 1BXZA 1AQUA 3LC7O 4JBLA 1U3CA 4HR7A 5H0IA 4RGBA 2A94A 3TTSA 2O9LA 3R3HA 4BRUA 5CYFA 2FWJA 2G06A 2QTVA 2XCIA 2R7RA 2DHCA 4HS4A 2GRUA 3I9FA 3F5MA 3B1YA 2V9KA 3OLQA 4W4TA 3LMKA 5SZHB 3VR3D 4BZPA 4R8MA 2E7XA 5E3MA 2VH1A 1NI4B 4Y4RA 1O0SA 2P40A 2YY7A 2ZIWB 3KSZO 4AZ0A 3V9PA 1VE6A 2H3HA 4Z51A 3TBKA 5FUMA 2FPPB 5IARA 1T0BA 2XXAA 2D3WA 3BJMA 5CH5A 4EHHA 1NIJA 4QYIA 1ATIA 5GAHJ 2FWAA 3EUHC 2GJSA 3ASVA 4TMWA 4UNPA 4WAUA 3TIVA 3WTBA 3VJRA 3AZPA 4UVDA 3I61A 2O2SA 1WZCA 3ROMA 5AJYA 1L1RA 2OO5A 3CUQC 4RMJA 4A23A 1LKZA 1JTYA 1KEUA 3QNWA 3IAXA 2OG1A 3A6HA 3D7MA 3KFLA 1OAOC 3SC6A 4N18A 5JSZB 3WTZA 1SH7A 1REPC 1T0FC 1YZQA 1U0OC 2I2AA 4FSXA 5LGNA 4IVRA 4ZREA 4YWJA 2OWEA 3KQQA 4WBSA 1ODFA 1WU7A 4V2UA 2I54A 4MQEB 5EZHA 3FBNB 3FZYA 4N5IX 4NICA 3VV3A 1FL9A 2YVAA 4BV2A 4OGFA 3QVXA 2ZCVA 2CRGA 2D1HA 3BULA 4ZZIA 2VWPA 4F2HA 4DV6B 1XTVA 1MC1A 1A8SA 2I5PO 2AIRA 3HXQA 4QODA 5T3YA 3HN6A 3D8NA 4P3OA 4QC2A 2QZ4A 5B4TA 1YRYE 3AONB 5MN6A 1Z5PA 4P5EA 4HAZA 5DWQA 4KQFA 1ZREA 1DU4A 2YHSA 3CUUA 3SX2A 1YAJA 1Y7PA 1Z0FA 3TXYA 4CKXA 4E7OA 5DTQA 1QDEA 2ZSIA 4BNMA 4UB6C 1T3SA 3BXEA 3E9DA 4M3FA 3K0CA 4J0GA 2IW5A 4TN5A 5ANRB 1JKXA 421PA 1GQSA 4ETWA 2ZB2A 1YASA 4X8HA 3K70D 5DGTA 1U0FA 4A8HA 3L8HA 4MRVA 4HXFB 1FFBA 3GHYA 3QLVA 2NVUB 2IYFA 2O6HA 4N9QA 5L3CA 5LQDA 3ZWBA 4Y0AA 4EW2A 5IP9J 2P6RA 4MR9A 1BYIA 3WWCA 1UJMA 3NIWA 2R85A 5BXYA 5IAGA 1W94A 3PZBA 5FJIA 4ZQCB 4AL4A 1OXUA 1UHMA 4DBLE 4AUNA 2X0NA 4JLKA 4M8LA 1BCRB 1U94A 4CTMA 2CNOA 4IJMA 4YV1A 2NQ2C 4E15A 2WHXA 1Y4ZA 4ZHQB 4B3HA 2O5VA 4M7PA 4BX9A 3OQNA 2ZCJA 1UBLS 1W0KA 1KR5A 1KK1A 1WHTA 1J5YA 3EUKL 3IRQA 2C4NA 2GN4A 3D4BA 3HSYA 1Y3FE 3K09A 1TAUA 1CNFA 3DWLE 2FUG6 4B6SA 2JA6J 3KUKA 1GZ7A 1OFHA 4BQNA 1R1UA 4RZIA 5ERYA 3WK9A 5B55A 1KO4A 3HKEB 4YGYA 1IO2A 1S1CA 3FCXA 2QSYA 1B59A 3V7RA 2GNPA 2Q27A 4KIBA 2L4AA 2EFEB 2XLBA 3PFFA 4N0BA 1BWQA 3A3OA 3ZS9A 3EXIB 3A01B 2JDIA 1U7WA 5C32A 2O14A 4MUFA 4BEWA 3N2KB 2YIDA 5D6FA 3EARA 3LOUA 3SM3A 5JC8A 2JHCA 2PRYA 3MGKA 2J9FA 2ZRIA 3EUEA 2DN0A 2VDPB 2VYCA 4B75A 3MPUA 1Q91A 3KXIA 3SXUB 1IULA 2QDKA 3LZCA 2QY6A 3USCS 3GP8A 4G25A 4LJRA 4PAWA 1TYBE 3QPSA 2P5VA 2EKQA 3FVVA 4Y7NJ 5F7JA 4EVQA 2NZXA 4X85A 3QPLA 2GLTA 3JRNA 4FGUA 4MWGA 4ZYVA 4B3BA 4XJSA 3QRWA 2GSWA 2R1ZA 3ZCQA 1P2UA 1WXQA 5KWVA 1F7UA 4NHJA 1HW2A 2C31A 3C18A 2JI9A 3PUXA 5E6UB 1PBNA 3PPIA 1FX1A 1T29A 2AN5A 3R6LA 4GKBA 3Q0VA 4DKJA 3LT1A 4LGWA 4EJOA 2WMOB 3GJRA 4EVSA 1SFUA 3INGA 2FSGA 3L7JA 3QKUA 2PT7A 5DPMA 1OBHA 3L82B 3T5TA 3OZCA 2A6PA 4QSMA 1XZIA 3IAS6 1WY7A 5A1TA 2JLVA 4JITA 4KFTA 5ALYA 1U31A 2G9VA 3TSAA 1PQYA 5FJ8J 1Z4PX 2JHFA 3DFMA 3FA2A 2JJYA 4FBMA 1XDZA 2C8VA 4Y9RA 4KVAA 4ESFA 1JLKA 2Y3IA 1GNLA 1RWMA 3KVYA 3CF2A 3C16C 5L7YA 5FDFA 4TWJA 4ISBA 3LXXA 3OLWA 4HGZA 2YHAA 2ZT6A 4WK8F 3O1JC 2PIDA 4LRWA 5IOYA 1DINA 4B6JA 4F11A 1JQ3A 4BE4A 4ZFNA 5TMBA 3CU5A 2M32A 1TJPB 4LDNA 4R2MA 1S96A 2RHJA 3OQPA 4KAAA 4MV7A 3UG7A 5BN5A 1K4KA 4QG3A 1KQGA 1ZH4A 1S8NA 2G7HA 3CESA 3E7PA 1RHKA 2G28A 3NO4A 3EMVA 3NWPA 4OXKA 4IHQA 4RGYA 3CISA 5KNCD 3U21A 1Z29A 3KOMA 1QV6A 5CFNA 1JECA 4II7A 3GV0A 4I1OA 5I7HA 2OXIA 4KHPB 2OL4A 4B31A 1RC9A 2XB6A 4RZXA 1SCUA 1Z0UA 2BHRA 4OLJA 2PSFA 2E5ZA 3T6KA 2K3PA 3QODA 1YOVA 1UBJS 1ORDA 3AG4H 2G4VA 3PHJA 4J6FA 2CLFB 3OV8A 3IFSA 1YZHA 1ULHA 4G12A 2QY9A 4IGIA 3IC5A 4J1SA 4LYGA 3EXHA 2YZMA 3LA6A 1EDZA 3V32A 3OTOB 1G8YA 5CH8A 5HIIA 3EASA 3IEMA 3G2PA 2OO7A 5EJCA 2LBPA 4YACA 4I98B 5K0EA 2RH4A 2X6OA 4CNQA 1C1DB 4XR4A 1NNUA 5FUXA 3ESQA 3VR2A 1Q1AA 4GE0A 1SXJA 1Z9CA 3DKVA 1KK3A 5EHQA 4AJNA 4R4JA 2DHEA 1BMDA 2PZJA 1YW8A 1IDZA 2CXTA 2VQSA 1XDUA 4M54A 4LITA 3LYAA 1WCIA 1M2FA 2DWQA 2W2NA 2GB4A 3RM3A 4EELA 2HNHA 3VZPA 5EVJA 1EIZA 4JLUA 5GPBA 3MRTA 2G7MC 2J3EA 4S35A 2PUJA 3SBOA 4BBPA 1GR0A 2REXB 3MTIA 2NVBA 2BEUB 1QQBA 4MVJF 3DVRX 3HCBA 2HGCA 5CEEA 5AVSA 3N39C 1WUKS 3BG5A 1Z0XA 3DTVB 3EVAA 4EHFA 2XE7A 2QVGA 1QQAA 4M73A 3D4PA 4RAGA 3G6WA 2MABA 1RWQA 3FISA 4EJ2A 3FKSD 2OBBA 3UC5A 3REFA 5G4LA 2XPVA 1PFKA 1KHHA 5JY6A 1K98A 3OQIB 4X61A 1MG5A 1XZKA 2IE8A 3RYTC 3ISPA 2D1VA 5J8FA 1O6FA 3L4SO 3TCXB 3WGYA 1I3CA 4YMUA 3K9FC 3O9ZA 4L4SA 5CTAA 2QNBA 5JOQA 2Y0BA 2I4RA 3UBMA 2AMLA 1RQRA 3KVVA 3EQ6A 4M72A 4GLFA 2Q9BA 3VKVA 5JANA 2IXDA 4UM8B 2O7NA 3UMBA 3WO0A 2XUBA 4HX4A 5GAEJ 1SD7A 1XTUA 2EKLA 3VHQA 4HLXA 2K85A 3HU1A 1C9EA 2ZVQX 3MD0A 1H85A 1JHDA 4LY3A 1IDOA 3NONA 1Q0SA 4M38A 3V8MA 4D82A 4YFXF 2GJAA 2CXRA 5BO5A 1KMQA 2O4UX 1U2DC 3AYZB 1AV6A 1DRWA 3F2IA 1WVMA 4U9IS 2XUHA 2UUCB 1TUBA 2CU7A 3RHZA 4BTLA 1EIWA 3F9KA 3E35A 1XGOA 5HKBA 4TMVA 5K03A 5ALIA 1KQNA 4CMCA 3L2WA 3CJRB 2R5NA 3ZWNA 2AJCA 1JWBB 1MNDA 1JIKA 3DE4X 1BI3A 1XWIA 4X54A 1LNQA 1MKMA 1RAGA 2X13A 2R7SA 4CW7A 5ILOA 1JEYA 1WF3A 4A0YA 4G8BA 3PRYA 4MGHA 3CF5F 5ALXA 4HXGA 3IAS2 3VSBA 3GNQA 3P9KA 3SDBA 1ZRNA 3DMYA 4MAFA 3PXUA 5D3ZA 4EP1A 2PQ0A 3QVTA 1J75A 5AIBA 4JC0A 2GUWA 3H97A 3JWEA 2VKQA 4HQNA 3S4YA 1GILA 3AZOA 1OIWA 3HC7A 1L5ZA 4U0JA 4G01B 4ZA2A 4WNIA 2L18A 5HRCA 2HMYB 5F7OA 7REQA 2EJCA 3ZWXA 2WTBA 2QZ8A 5DKFA 5FTMA 3SJUA 3HXTA 2FQ4A 1JU9A 1X7WA 1I7PA 2AUMA 2DQYA 3HSKA 1FYEA 3OT5A 4FDAA 4JLPA 3JQ7B 4G9BA 1Z39A 2Y0EA 2Q2WA 1EWTA 4NHOA 1DU6A 4ZTUB 1TTPB 2C29D 4RDHA 3TR6A 3QP5A 1LDEA 1BGVA 3PGVA 4EA8A 4X8LA 1S29A 1P7IA 2DOAA 1TL7C 1UXOA 1ODKA 2WU8A 4MVWA 1D1AA 1Z3YA 2WM8A 5BQ5A 3G85A 3QG1A 3WFJA 1WXIA 1PW7A 4H6PA 4I09A 4AZTA 1EUCB 3UUEA 4QSHA 5JWOA 1E2BA 3SICE 4BFXA 2JFBA 5KQSA 4FYPA 3RVOA 2E48A 3F9IA 4IZ6A 2AOUA 1UJ6A 3GTOJ 4OOIA 2L9RA 1CDZA 1FA9A 3NUGA 5FNVB 2CUFA 4PUSA 1P6QA 4UTZA 4ALIA 4OV6B 5ALSA 2ZR9A 5A2QK 3NAMA 4CM7A 1O5TA 1QBJA 1DDGA 1R37A 3I6QA 2IGMA 3WK4A 4M1YA 4BNDB 2OQ2A 5CBKA 4G0XA 4ABZA 3HOZJ 1X1DA 2C5LA 2JCYA 2PH1A 1BOBA 1AVTA 2IEGA 4GFBA 2QVLA 1STZA 4GBGA 4RYDA 1N6OA 2BH9A 2QUBA 2ZSAA 1NXTA 1PJSA 3QEJA 3W5BA 2QMZA 2AKYA 3CBGA 4WNAA 5HDQA 5A5GA 2O19A 1DBQA 1ZICA 2QN8A 3GJ5A 2DAOA 1ML4A 1KQ0A 1ZK2A 2HX1A 3AC0A 3DZJA 3GT4A 4FEGA 3QVOA 2YJ5A 1R3DA 3KVOA 4O5AA 4B3CA 4F9GA 2LRHA 2ZITA 5FLYA 3RVKA 4G8DA 4H0NA 2IIPA 3PIRA 4GLOA 1EFPA 3GIWA 4OMFG 4Y1EA 5K6AC 2F3RA 4CFZA 5M5XJ 4M0DA 3RBXA 2R7WA 2YNMA 3WB2A 1VFPA 5BOSB 2X76A 3OE5A 2IYZA 5B1HA 5ILUA 2E71A 5LHGA 2H9IA 3M0EA 4RAFA 4Q3AA 1BZYA 4A26A 3NANA 1ENOA 3IOEA 1YC2A 3ZTTA 4H4KC 2LW7A 2KYRA 1MB9A 1D6MA 1XI2A 3HI6A 4NCXA 2DXIA 4DE5A 4G8JA 4ZWNA 3PF8A 2C83A 1F0PA 5C18A 3B7GA 1RU3A 1WJBA 4P0TA 3BKWA 1M7HA 2QLTA 4TS4A 5DDGA 1LTHR 2ZI5A 4NU0A 3AWDA 2NNWB 1KFCB 1X2NA 3OC0A 5ENDA 2GEJA 3WI7A 2FQ1A 4IEEA 4RYLA 3HCCA 2RC6A 3GLTA 3FR8A 5KPJA 1NUHA 3KB8A 1R0KA 2QHXA 5HRAA 1PYOA 3DCNA 3ZDAA 2JT1A 1NDHA 1NLMA 3M9LA 3O1LA 1G21A 3KPVA 3ROQA 3AAFA 3V8RA 1ZD2P 4TYYA 1W5TA 2O8FB 2VJJA 3BR2A 1Q3TA 4MQ5A 4RKEA 3WGKA 4CYCA 3BMXA 4LXXA 5EVCA 4Q01A 4ASUA 2X58A 4KE8A 4F6LA 5JD5A 1LSSA 1UC9A 1XCBA 5CP8A 1CY0A 3E8XA 1A9TA 4RK7A 4WFJA 2ZUBA 1H93A 3BA1A 1DC3A 2R6DA 3CEJA 4GPBA 3WP1B 2H7XA 5GTHC 5F3RA 5EJFA 2DQLA 4ZCRA 3QU3A 1LK0A 2JJ2A 3GEMA 2JHGA 2DFDA 2VBGA 1HDYA 1NMZA 4LMAA 3CSSA 2KPOA 2OD7A 1ORVA 2YXNA 4UHJA 4M3GA 1EVZA 4OLBA 2F4MB 3CNHA 4J1QA 3EIEA 2K9QA 2A9PA 1XMQB 3NW9A 1XXHA 4LHEA 4C7JA 3JQQA 1BOAA 2B7BA 4HAMA 2FZLA 1SK8A 3B1VA 3OJFA 1M2JA 4GSYA 3B2QA 2V9CA 3QITA 3MT8A 3VEPA 4G0ZA 4IGEA 2D0DA 4EO7A 3SYTA 1EHIA 3CNNA 4PSUA 4TTRA 3U17A 5A9TA 3F3MA 3WU0A 4DOZA 4OJKA 4XKBA 4MVCA 3RTAA 2QRUA 4TS1A 4ZGGA 2Z2JA 3KFXA 3NHSA 4JL8A 3QVGB 1G21B 4AO8A 2GAOA 3ENWA 4MDYA 4XSVA 3WL6A 1A9PA 2BHZA 4I1PA 2JLXA 4E4TA 4E6PA 4M0CA 1X3UA 3GJ3A 3OTGA 4DR7B 2JAPA 1YDMA 1E94E 3KSMA 3QPBA 4XLHA 3GZ5A 3SJMA 3SEAA 1FEZA 5AKEA 2FOLA 2V7XA 2GFQA 5AM1A 5HE8A 4XWOA 4ZEVA 2DBVO 1G21E 1DNPA 5E0KB 1NKTA 2HA0A 4JC4A 2IA0A 3RCOA 1OREA 4AVZA 1V4NA 2ESHA 1H0HA 2GUGA 2RHGB 4H9GA 4PSCA 4RABA 4WN9B 1GT91 3QPCA 1S7CA 1VHDA 5C31A 1P19A 4AWXB 4HAUA 1G8MA 4S04A 3HA2A 3S16J 3BB3A 2VI5A 3EQ7A 4GXQA 3FZEA 1RYZA 4RH1A 3ZH9B 2VEOA 2GERA 2B5VA 4Z3DA 1M10A 1NM5A 1ZSNA 2YUTA 4QUIA 3RO7A 5IWCA 3CZRA 4R2IA 2JIMA 2VI6A 3ERCA 2QN3A 1OR7A 1S5PA 1TLTA 4DXHA 1TJ4A 2H07A 1XALA 2QYSA 4EM2A 2IHUA 3G0GA 4IQGA 2J5KA 5K3SA 2H4HA 3RREA 2PMBA 4JJFA 5H6RA 5EUBA 5HX7A 1B4DA 5CA1F 3JQ8B 4ZVUA 3SR4A 5C8XA 1BO6A 1HDGO 3NBXX 3KP6A 1H2EA 1A4IA 1N5OX 3H05A 4HN2A 4KQ1A 4XDHA 5LZ9A 3U4MA 1EM8B 4C03A 3I4PA 1FWZA 3O8DA 4P9UA 5CNMA 1CRPA 1GARA 4PYRA 4HXEB 4K0RA 4V1CI 2G7UA 2ZE7A 4HDMA 2EBFX 1RJFA 4Y30A 1RPNA 5E1OA 1MIOB 5E3LA 3QHAA 5AKHA 1QZZA 2A1UA 2HJGA 2DU8A 4AIKA 4UDNA 1BW5A 1PK8A 4J43A 4KR3A 3U13A 1Q74A 3DQQA 4TM7A 3ZQFA 1TMGE 4QNNA 1NW3A 1B26A 1PO7A 1VYVA 2EEZA 2GPJA 3AL3A 4NJMA 4TL9A 1H9GA 2OCCH 5D84A 4YP6A 3Q6NA 4S1OA 2JGKA 3KXPA 4Y2HA 2C9BA 4EW1A 4OATA 2RQQA 3MYYA 4KODA 2IZ7A 5L6LB 2I2CA 1PDNC 1CP2A 4OPMA 4ANJA 2ZJAA 4BFWA 4FDUA 3S1RJ 1BW9B 4A27A 2IK8A 2HQBA 2B78A 1A71A 2RE8A 2OCIA 1H65A 4K9KA 2ZUTA 2ZAYA 5DVZA 3ZP5A 2NS7A 1AUQA 1QM5A 4GNRA 2X85A 4I2OA 2PGAA 5FKKA 2WF9A 4PC6A 4G5RA 4PZPA 4EYQA 1Z83A 1DIAA 2PVSA 3E0QA 3K53A 4JJ4A 4DAEA 5IJ9A 3IT0A 2Q5QA 1Y7HA 4O4IF 2D59A 1JG6A 1W5FA 1M54A 2VUSA 4Z7OB 2EL7A 1MEOA 1P8JA 2H5EA 1O95A 3RJ9A 1P75A 1IEVA 3JAWB 3FK7A 2VQFB 1PGPA 3CGWA 1BE6A 2G9NA 1E2KA 1JG3A 3R7FA 4JI0B 1DE0A 4XQFA 1XNRB 2OK8A 3R7AA 2F8SA 3D64A 2FMKA 1WKCA 2DH5A 1LK5A 1WXEA 2X14A 5IC5A 1Q0QA 3RJTA 3UXMA 3NYIA 2JVJA 3D4LA 3I09A 2HJRA 5M04A 4G7HF 3E05A 4HRXA 4NYIR 3A1CA 4P3KA 3SC3A 3H3JA 2Z8ZA 5HZKA 1WIWA 3B3QA 4GKVA 5FA8A 5I7SA 1K7XB 2YMPA 4MGYR 5CB4B 4RH0A 3HB1A 4GC9A 2JGAA 2YC2C 4MLPA 4LHXA 2PL9A 3LSTA 1L3BA 2NUPA 4C7KA 4MHSA 4KPGA 5K8CA 2QTFA 3EGDB 3H2HA 1BRMA 1QRYA 4HNRA 4WZBE 2JNWA 3BK2A 5JT1A 4LXYA 2VK8A 5EHXA 5IW8A 5C4MA 2QUKA 2CN1A 3J7TA 3MWDA 1R15A 1MW7A 2PT9A 3GMSA 3CWCA 4H18A 4J7CA 4LVCA 2CLSA 5FOQA 3I2FA 2G04A 4XFDA 3G7UA 1E4EB 2Q5LA 2QW8A 1E7SA 3SQDA 3X1YA 5BY2A 4RTOA 4Z1MD 1T4MA 1XKTA 5EJ2A 5GONB 4JJ6A 3VSCA 2DETA 1JDSA 4KSYA 3FOFC 5FBVB 1CZKA 2C5BA 3SCZA 1TLHB 3QV2A 5B57C 3NBAA 1IG3A 3M5DA 2BR3A 2D4AA 2OHOA 4JYPA 4EB8A 1HNNA 1HYQA 2AVNA 2FJUA 1NLUA 2F5CA 3GRFA 3VYWA 4AS1A 4W7SA 1Z26A 3D54D 4I50A 3DAGA 3L7MA 4ITUA 1ISPA 1OR8A 4M9UA 4AY6A 4WA7A 1XDDA 3OF2A 1XSVA 2INGX 4A8JC 4HFRA 1FMLA 2GF0A 1QG0A 5HILA 5J23A 3Q0WA 1X9GA 3AIIA 3C24A 4GRDA 4O08A 4A3KJ 4FQGA 3M1YA 4CMJA 4MWZA 3DVAB 5D5QA 3L6UA 3SNHA 4XD7A 2JRCA 4JOSA 4ESBA 2HVRA 2JPDA 1TX4B 1Q11A 5B1SA 3W8DA 4JHLA 4PR3A 4UDXX 4Y17A 1DVRA 4IV5A 1AXRA 4O5VA 2JASA 4LY0A 2H1IA 3HBLA 2E9SA 1JI0A 3OIVA 3KP2A 1H2HA 2G1JA 4PWYA 2RN7A 5JTTA 2X4DA 4HAVA 3G1UA 2AZDA 3TRKA 5BSWA 4X0GA 2HEOA 3OWHA 1IVSA 1W9MA 4AF7A 2ANBA 3AERB 3KP7A 4MUXA 3ZI7A 2ZJPF 1TCBA 2HT1A 3CZ4A 3NEUA 3I55I 1IY8A 4JQSA 2GNOA 1EU1A 3WDKA 3O6BB 1QAQA 1KZ9A 4L1KA 3HXOA 1VQ1A 4PLCA 2A7XA 3DJFA 4HDSA 2W83A 2HDNB 3ZQIA 1E2NA 5DD8A 3IUMA 3VPFA 3U7HB 3MZ8A 3D0QA 1F6BA 1QH8B 3Q0IA 2OOKA 1EK1A 4QQKA 1FLVA 1HE3A 1R5ID 2RGXA 3CR7A 4R6WA 5H16A 4LB5A 2YW9A 1U0TA 1PT6A 3SIRA 1ETYA 3MFYA 5DGCA 1GV5A 2DLCX 2W2MA 3KKOA 3KKQA 1K8XB 3KVNA 2VHVA 2D2IA 3VO1A 2BWJA 3H0CA 4AW9A 4Q47A 3BQYA 4ER7A 1AK2A 2XGDA 3DSRA 3KE9A 3MAGA 4CMIA 1TMOA 4I46A 4YCAA 5ALOA 1A5AB 3AI2A 1IM5A 1ZZGA 2UXBB 3N8NA 4HL6A 3BZUA 3CO5A 1EXDA 3K94A 4D6XA 4NFSA 2BE7A 2ZSFA 4BVFA 1EJ6A 1YB7A 2D13A 4RHXA 3L0DA 1K66A 4ARAA 3ZGVA 5C37A 1TL8A 4ZI7A 3K5HA 4IDEA 3V6MA 4ASNA 2SECE 4RB2C 4KDPA 1ZPDA 2FZ4A 3E4DA 1A95A 3NBQA 2PS9A 4LJSA 2PQ8A 4W1RA 4D43A 2P77A 3DBHB 5BSUA 4RY9A 4LF9B 4IMRA 1YCFA 3QVUA 4BE2A 4KKVA 4OSPA 5C51B 3LXMA 3LWBA 1SHLA 1WM1A 2Q2QA 4JI6B 4TV9F 2VASA 1M3SA 2G70A 1Q0TA 1RDFA 2HWKA 4A6XA 3I8OA 1NRWA 3CC8A 3E2MA 4XDYA 4QAJA 4BYYA 2NVXJ 5BWCA 2RGBA 4BE0A 3AM1A 3QF4B 4TL8A 4QM7A 3LF2A 2NXNA 2AF3C 4WLVA 1AGPA 1DAIA 3RTGA 3RH0A 5I4CA 1Y6JA 4GUAA 3SOZA 4S2UA 5CYGA 3MWMA 3FMPB 4HZUA 2ECBA 2GFHA 5C44J 3SKXA 1KONA 3PC4A 1KRHA 4PLFA 4A5NA 4W9NC 5DB4A 2ZAGA 4C9BA 2VHJA 5F1JA 3SEQA 2WRZA 3QPUA 4RV9A 1QKIA 2DYSH 1PUJA 2B3DA 2XEDA 3S3NA 4PTYA 5G0WA 1RIFA 2WYOA 1XZMA 4R51A 2AFHA 3RVNA 3W4IA 1APLC 1RI5A 3PXEA 2MSNA 1S3SA 1I1QB 4V2GA 1RKXA 3HB0A 2W2TA 4TMFA 1NMXA 5AOCA 3TWOA 1DRUA 3C4JA 1I4LD 1IW7F 1SQFA 1Y3CE 1D0ZA 4I3HA 4O29A 5JEDA 4S1WA 4V0QA 2ECQA 4IXTA 4N7JA 4YAWA 3TLYA 4OM8A 3ZGXA 4B3XA 4EATA 4DIEA 2VN2A 2TMDA 4G41A 4DR2B 1MHPA 4BDZA 1ILWA 1CG6A 1Z12A 5EOVA 3OE7D 1I2BA 2WYIA 2HDWA 4LN1A 3NWJA 2V9PA 3KP5A 3BDVA 5LN1A 1TUEA 5F35A 4K6KA 4P54A 4C7MA 4MUJA 4XOIA 2Y69H 1YZUA 3M8EA 2DYRH 1R9NA 3QE2A 4J49A 3N1UA 3DWEX 3K9HA 3O1IC 3QA9A 3KEYA 4I1UA 2F7SA 5ALPA 5LIPA 3OS1A 5I8PA 3GT0A 3CZCA 2EJWA 5IT5A 1M2GA 1CF7A 1JI3A 1VQ6I 5CB8A 4TTIA 1G17A 4A36A 1PR2A 4BKMA 5DLEA 5FKLA 2PMZA 1IBCA 4FDVA 3F72A 3RBZA 3RR2A 2V1DA 3GAFA 3OE7A 3NYWA 3SZOA 2GVDC 4RS8A 1R0SA 1ZK8A 1UH5A 1LSJA 3UHJA 2BKLA 3P94A 1P73A 5D4SA 3V7UA 4A2PA 2ZU6A 2REBA 4TTAA 3ETDA 4YRPA 3UGJA 4ENVA 1C1XB 3IP4B 1KAHA 4YFVA 2LKCA 2VKVA 2E82A 1JYSA 2QGFA 3QGMA 3K1AA 1N5KA 4CCOA 1KNXA 4OJMX 5L3ZA 3TSWA 2EV5A 4MITA 1WO8A 2GPYA 3TR0A 2M30A 2C61A 1VL5A 1QVZA 2YFQA 3NOQA 2ACJA 1FYMA 1V6AA 2OO3A 4Y15A 1CDOA 2J5BA 3AP2A 3LW8A 1IQ0A 2IHZA 5K6RA 4ARCA 1Q0PA 3DJYA 4BYGA 1SUDA 5F64A 1ZW1A 2P6NA 3JRWA 1II8B 5CCEA 1U0JA 4US2R 3IXLA 1U0BB 1N5RA 4NMWA 4E03A 3DLPX 1KRXA 4HF0A 1HWYA 2HIMA 1XZCA 1FDOA 2F4NA 3LHFA 4HAXA 4BATA 2VBCA 2WB2A 4DBLC 4BE7B 4Q3DA 2Q0OA 4HY3A 3PLAE 2V7FA 2X6QA 3ICVA 4K7JA 1DLIA 3I54A 3OG9A 4R69A 1V7ZA 1XMSA 4WDRA 2BKEA 1D2CA 1G3MA 2JW5A 1BN6A 3G5LA 3NEAA 1OBFO 1MOSA 2XPCA 4XA8A 5LWHA 3L1UA 3L2QA 4F8JA 4IBOA 1KI6B 5JSZA 3WHIA 1UWCA 1Z2AA 1DUVG 1X1EA 221PA 1TWAJ 1YI0A 5E8GA 3WTXC 1G20B 2BOVA 2D2VA 1IG0A 2RBEA 2WYUA 4QVGA 1C3JA 5BW6B 5EJEA 3NKLA 2REQB 5HCIA 4HYQA 4OM7A 1IVNA 2B9VA 2OQRA 3UANA 3LNQA 1IU9A 3IB6A 2L7KA 3OTWA 3KZKA 4TQUS 5BN4B 4R41A 5E3HA 2XWPA 1Z7GA 3HKBB 2ZGVA 3K5IA 5F2OA 1PUIA 1L5YA 3A4VA 2E5NA 2FPPA 1U5TB 3L7KA 5WRFA 4Q3KA 3BHNA 1ESZA 1YQQA 2W57A 1XQVA 2O1SA 2Z4SA 1RADA 4MPRA 5CR9A 3UKDA 2HCTA 2AW3A 3VTFA 4RFSB 3NT5A 5L3QA 3PUVA 3GBPA 3U3ZA 3WB0A 1ZD8A 1V1JA 1VB5A 4BXUA 3E9YA 4IJ5A 2Y0PA 4TMYA 1FVOA 1QH9A 1YS2X 4XYGA 5ECDA 3Q12A 1YV9A 2R2GA 3V42A 4JBAA 3CMYA 1XF1A 2XE4A 3HBAA 2HMTA 4TXJA 3GVPA 2OBFA 2WUWE 3GB9A 3H65A 4QUGA 4RAYA 4Z86A 1R6RA 4YRTA 3SKYA 4YYZA 2MH2A 2RQPA 1SKAA 3FTNA 2FUEA 3HU2A 4M71A 3LL4A 4BQAA 3UUGA 4Z7JA 1ESCA 1N8NA 2J9ZB 2ADUA 2Z5FA 1EEHA 3BRWA 5FWDA 2VT7A 2BF4A 2R66A 1UOOA 2XTZA 1PWYE 1K83J 2BFBA 2KSQA 3LK6A 4PF1A 4FS8A 3W4KA 5LXTF 4NZZA 1TQ6A 1XZ8A 1KP3A 2GARA 3KTDA 1GFSA 1Z4OA 4MB2A 4WHMA 5HRUA 4LHYA 5LRRA 3EXFA 5FO0A 1MX1A 3U7QB 3CPJB 3JRXA 5JHUA 3K73O 3PNBA 3WGNA 5IFKA 3AVVA 1P6RA 3AL0B 2NS0A 2RG7A 3KTFA 4UUOA 2ZPAA 1DMRA 2XAGA 1ISGA 1AGXA 2Y1KA 1O96B 3PRHA 5BNFA 1K5GA 2D7DA 1JGGA 2LCQA 3SG0A 1QVVA 1SC6A 3Q7TA 4L9NA 1G8PA 2ZRCA 2ZULA 3FYUA 4ZP1A 4CMAA 4MQBA 1HNXB 5HJ2A 1EQAA 3S55A 3WGHA 3SQXA 3O2PE 1PJTA 1UR5A 3GLSA 4QQRA 2C2HA 4UAVA 5LR6A 1PG5A 3FD8A 2QEQA 1JR4A 3V7SA 2DMRA 4BPRA 4C20A 1CLUA 3CH5A 3DL4A 2R3SA 1HW5A 3DKKA 3MA0A 1K6JA 1LCIA 1E0JA 5CW1A 2P69A 4Y1GA 4ZXFA 1O7JA 1SUCA 4IJAA 1ZAKA 2GBPA 3G5AA 4UMEA 2LVSA 4UNRA 3TKYA 1WZNA 4FYYA 1YX3A 3DYVA 4JAVC 1B93A 1KXZA 3ZIDA 3NORA 1AB6A 4QNMA 3HDVA 2GOXB 3V8LA 3KG2A 5D5HA 1RM5A 1UWKA 2FGJA 4HDKA 5COQA 5EQFA 3K6SA 1Z67A 3AVWA 3ZRGA 4LTMA 4Z1MA 4LJAA 1KJ8A 3Q2KA 2GESA 5A6SB 5B7QA 4CLOA 2VPTA 4JY7A 2CVFA 3NHJA 4F21A 2FEWB 2IFTA 2QTMA 2RH5A 2ECPA 2L82A 5BN3B 2X9DA 1ETHA 3K5PA 3WSVA 4D0RA 3VISA 5ED0A 3BDAA 1L1EA 4A82A 1TZ2A 1TT5B 1P4HA 2JAOA 4A69C 2J5XA 2G7ZA 2XADA 2YJNA 3AX6A 3GW8A 3IQWA 1JJ7A 2HLDA 1D2GA 4D74A 4C22A 3KXKA 3NMUF 3WDLA 1GYQA 3DW1X 4DFDA 2G25A 4BAZA 3CVUA 3SQWA 1UWVA 3D0OA 1FMJA 1K7FB 4HV4A 1GN8A 2CLCX 3OR2C 1F60A 2PX2A 3BUSA 1LLQA 2PMFA 2VNSA 3R3VA 3G9XA 3NTQA 1LKXA 4BVJA 5KIAA 2A1TR 1AKYA 3LHSA 5D2CA 4BWVA 3BH6A 3MGBA 3WDSA 3ABOB 1IEWA 3K32A 1N6LA 5CDHA 3KZNA 2BW0A 4E94A 1CF2O 3E8MA 1ZJZA 1U7ZA 1V25A 5FTNA 4C21A 2W2PA 2GJ4A 2XUFA 2WYVA 4JZKA 5SICE 1FW6A 1EFRA 2YRXA 4UCQA 1ECGA 2NYXA 3HEMA 2RCYA 1KDYA 1XJQA 3E3LA 4ZYEA 1N2HA 4WIAA 4EA6A 3RK0A 5BNZA 4FQ8A 2B83A 4IJKA 3WFZA 1JDBB 5EP2A 3E03A 3ZHOA 3TTWA 2V1NA 4R05A