4KIGA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with 4-hydroxyphenylpyruvic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
332
structure length
332
Chain Sequence
SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 122
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kigA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kigA02
4N9IA 1B42A 1KR5A 2Q8KA 1M6YA 2C7QA 2JHAA 1K7AA 3AXTA 1J75A 3T1BA 4KYWA 1JG1A 2OKCA 5L3FA 1ZG5A 3ELYA 4EKIA 3DFGA 1LDJA 4G94A 2A69F 1RI2A 5FTWA 3KP4A 3D2LA 3RYRA 4MEYF 1RJEA 3F23A 1W7PA 3D0SA 5A2QK 2ZBQA 5FFZA 3KPWA 5FB2A 2XKPA 3JWHA 4JK1X 1IUYA 3G2PA 3PX2A 2QLZA 2AVDA 1BJAA 4RTSA 2R6ZA 1WXWA 5HLIA 1PUEE 1S7OA 1HW1A 2YXEA 4PYKA 3IKTA 1DDNA 5LRRA 2DULA 2IA2A 3GRVA 2F5CA 1MDMA 3F8NA 4ER3A 2XAHA 5BQTA 1O3RA 1XGSA 2Y1WA 4CTJA 3IWZA 5EG5A 1HNNA 3SVZA 1HSJA 1XMKA 3VFZA 4D0PA 2VBXA 2JJQA 3EGEA 3GGDA 2O0YA 3LBFA 2XAQA 3OZRA 2MLGA 2RN7A 1E17A 1JTEA 2UYHA 2GS9A 1G8SA 1R8XA 5H20A 5K1YA 3DKWA 2NNNA 1BIBA 1VE3A 3C3PA 4IWNA 4WX9A 2ETHA 1MDMB 3HHGA 1P92A 3EVGA 5FLXK 5HOOA 4C4AA 3WSTA 3ERED 1D2GA 2XBMA 3KPUA 4BP1A 4UV9A 1EJ0A 1GXQA 3OZTA 1NW5A 3F22A 2O03A 4ER6A 2H09A 1QAQA 3HCEA 2E1CA 1YIOA 3ER8A 5C1IA 5L3EA 1L9KA 4QTTB 2QBYA 1TW2A 4RVGA 3T0YA 5E1DA 1YW8A 2P3QA 2O3FA 2PVCA 2EA4A 4OMZA 1W5TA 1FBNA 4DMGA 3CTAA 2DBBA 3F8BA 4BNCA 1U78A 2GWRA 3LSTA 3OOPA 3JSPA 1PJZA 1O9GA 2NP7A 1D2CA 1HW2A 5HDKA 4HQEA 3EDPA 2FNAA 1ZHFA 3FUXA 4DM3A 3KP5A 1PDNC 5HS9A 2ACJA 2HOEA 1EV7A 2PBIA 4AZSA 3BZBA 1KHHA 2ELHA 3BWCA 2AN3A 4PINA 3PX3A 1IAWA 4RGSA 4YIFA 4RVHA 2Z9OA 4EKGA 1FJXA 4XUEA 1JHHA 3J80Z 4EVIA 5CD1A 3Q87B 4DQ2A 4YFNF 3HCCA 1I1SA 4U0WA 2D45A 2E1NA 1YO5C 2C7PA 1T39A 3DQVC 4RGUA 3HEMA 1G6NA 1G55A 1CF7A 1P4AA 2P7VB 3RJPA 5HLGA 1J0RA 3VODA 2O57A 3L8DA 2ZZMA 2ZBRA 2QYOA 4E2ZA 4Q48A 1YF3A 1ZAOA 3J7AO 4PYOA 5CVEA 1Z91A 4HQMA 5HIMA 3CGGA 3BZ6A 2P8TA 2VONA 3FPJA 1W7PD 3REOA 2PWYA 1X1CA 4AZTA 2F8LA 1L3CA 4QWQA 5LEKA 3OE4A 4PONA 3G3ZA 3SR4A 1O3QA 1INLA 4KW7A 2DFIA 1RJFA 3GNLA 3LGAA 1XB4A 4G8XA 3HVKA 4KN7X 3AJDA 3G2OA 3R9XB 2IH4A 4NHJA 3EVEA 1FT9A 5HEKA 6PAXA 1G3YA 2HWKA 1FLIA 2ZIFA 2CFXA 3HRSA 2QZ8A 4R05A 4MGRA 3FMSA 4TV7A 3THRA 3BROA 2YR2A 3DXZA 1FOKA 3G89A 4P7FA 2HZTA 5E1OA 1SD4A 2IW5A 4B09A 4O6JA 1D8JA 4KDPA 3SQNA 4EK9A 2C7RA 2OY0A 2OBPA 4DNCA 3TO6A 5LRSA 1LEAA 3X0DA 3GFIA 4YV2A 2XAJA 1YW9A 2PBFA 9MHTA 1FPQA 1B1BA 1IN6A 3SHFA 3OU6A 5FHQA 1ON1A 1QO0D 4HAMA 2Y75A 4AZWA 3G7UA 2A3SA 1QZZA 2FU4A 2ZWVA 3WTXC 4EJWA 3FRHA 4M6YA 3TQSA 2COMA 3GXOA 2ZLBA 3V97A 1J5YA 3QOXA 3M33A 3GRZA 2XV4S 5IKMA 2ZBPA 3BPVA 1F3LA 2XYRA 2AVNA 3ZN1A 3DUWA 2L54A 3RKXA 3MTEA 1AQJA 2XUBA 3S2WA 5K0FA 4GEKA 4XUCA 1ZKDA 3IHUA 4KIBA 5D8KB 2IRFG 4BHCA 1SUSA 4LG0A 1Z3CA 4HLXA 1OR7A 2MA3A 4M37A 4KRGA 2ZNZA 1RI7A 3O2PE 4CXMA 1HKQA 4A0XA 1KYZA 1IXCA 5CUQA 2ZZKA 2XVCA 2AS5F 4ZYEA 2IIPA 3EQLF 1S7AA 1JR4A 4KMFA 1SQGA 4R8RA 3RKYA 5E8JA 3GU3A 3O6BB 2ISZA 3M8FA 4EGZA 2EV6A 2HKXA 2F2EA 4HTFA 4QVKA 5K0NA 3VC1A 5J8FA 1TNTA 2DO7A 2FCAA 4BLUA 2M8EA 4YG2F 1R8YA 1GHCA 3TDUC 5ILUA 3B73A 3EEYA 3A7EA 8MHTA 3IWFA 1IN8A 4PYJA 3DXJF 4WF2A 3OCJA 1LEBA 3WE2A 1BI2A 4M9SA 5BOXA 4KDCA 4ZYDA 5ICEA 4QQKA 4HH4A 4HV5A 3GF2A 3PLAE 1FSEA 4FP9A 3LA3A 1DPUA 1QGPA 3UWPA 3FZGA 2WTEA 4RGXA 4P5OA 2IPQX 4AIKA 4L18B 4MQ4A 4GO1A 4UHTA 3RW9A 4O5VA 3WGIA 3FPEA 2Q41A 3TR6A 2PT6A 3FUVA 3RPQA 2HTEA 3I54A 4LK1F 3KKZA 4L9TA 4XLNF 2FA5A 3UJCA 4UOEA 3T8RA 1SMTA 2K27A 3J80K 5LQUA 3KFWX 5K5OA 2HR1A 2Z6AA 3T7SA 1TLHB 5HIJA 1X1DA 2BYVE 5BPIA 3TPZA 4HX4A 5DCMA 1IY9A 5D4SA 3BXOA 5KS2A 4MTDA 3EVFA 2E5WA 2RNJA 2P5KA 3QRFF 2QRVB 3IRQA 2ZWAA 3AWIA 3NVMB 3K1NA 3IRRA 4RTNA 1HBXG 5EZSA 2OQGA 3NWEA 2OZUA 1REPC 4P7GA 2Y48A 2M87A 1P6RA 5ERIA 4CGZA 2EWNA 4MIKA 3TFWA 3F8MA 3ISPA 2DQLA 4BLWA 2QWWA 1DUXC 4BLVA 2XVAA 3GEZA 3I71A 5KK1A 5DM0A 4A2UA 2D1VA 1TW3A 4ZZDA 5IT9K 5M5BA 1RI3A 4OMYA 4EM2A 4IRIA 4QDKA 4RTMA 5DCMB 4YUVA 5F2OA 5DRTA 5J6XA 3ZMTA 3VSEA 4XBFA 3A25A 1OYIA 2OU2A 1LDKB 5K5QA 4YUWA 3M7GA 3BWGA 1D8KA 2FXAA 4RS8A 3C3YA 2O8XA 2NRAC 4YV0A 1IN5A 1YYVA 3UJBA 3PTAA 1ONVA 4FS8A 2IT0A 1I4WA 4UNOA 4EQQA 4G7ZF 1FYLA 4FSDA 3HVHA 2B25A 4CXFA 2AZTA 3IC7A 3E6MA 3KPYA 1BN5A 4Y2HA 2ZSUA 5EMLA 1BBYA 5H6RA 2NXEA 4Y15A 3GVAA 1I9GA 4XSXF 5DX0A 1G6Q1 1JTFA 2CMGA 2VC0A 5FWAA 3ZN0A 4OA8A 3IEIA 3LX6A 3NEUA 2RVCA 5FCDA 1IW7F 1I1NA 2JH9A 1Q0TA 3K6RA 2EFNA 5B1SA 2PX2A 1AOYA 1FNNA 1BI0A 2EFOA 1KGSA 3M6WA 5FO5A 5BW4A 1D2HA 1TQMA 4RYLA 4OIRF 4UXNA 3SSMA 1JG2A 5EC8A 1FWZA 3E5UA 2DLLA 4FZVA 1RJGA 4YUYA 4IJAA 4KMUX 4P58A 4YV1A 2YVLA 4EV0A 4PCAA 5JFRA 5DTQA 2ORED 3TLJA 4YUXA 1FYKA 5DRYA 5FGMA 2PY6A 5EVJA 2WV0A 1B9MA 1R18A 1R36A 1IRFA 3WG9A 4C05A 5DUIA 2PLYA 3N4MA 3HRTA 3KQYA 4QPPA 3GFMA 4X1OA 2X4HA 3P2KA 4BHPA 2A6EF 2OPBA 3R61A 2NXJA 4WCGA 3LWFA 3LA7A 2W84A 3C18A 4RTRA 2KRFA 3UZUA 5LEJA 3Q7EA 2RGVA 1IXSB 1C0WA 4PZJA 5JR3A 3B89A 2IBSA 2P5VA 1XSDA 2DAOA 2WA1A 2ZCJA 1BC8C 3CCFA 3P9IA 4I2OA 2EG5A 3LHDA 3V8LA 2PGXA 1NV8A 4KFCA 2OAZA 2LF7A 2CO5A 4UUVA 1R6AA 1VP3A 5JUWA 5LQJA 2PSSA 1P91A 2JSCA 3KQSA 1TPYA 2G1PA 1WSUA 3KP2A 1OPCA 4PYQA 4RB2C 4RAZA 1QNTA 2IVMA 2OQRA 5HDNA 2H1RA 1R23A 1O57A 1DP7P 2JHCA 2UYQA 2B2CA 4ASNA 4EJVA 2R7FA 1RUOA 3E6BA 4A0YA 3JWJA 1XTPA 3LKZA 3A7DA 3F8FA 4G7HF 2G71A 2M5WA 1K78B 1TQIA 2BGCA 3B3FA 2AN4A 1WKMA 2QBYB 3EVDA 1XCVA 1B9NA 4DZRA 1VLMA 2PMUA 5DX8A 4MEXF 4E2YA 3E23A 3EVCA 5BXYA 2TDXA 2HDCA 1S3JA 3T7TA 4RGRA 3ABUA 5E9WA 3K0LA 2PLWA 2VXZA 1DCTA 5DPMA 2OXTA 1IM8A 1E2XA 2PJDA 4GBED 3GWZA 1R1VA 3MCZA 3C6MA 2CKDA 1R7JA 3TM5A 5EMJA 3GYHX 3G88A 4OINF 3I59B 1U2ZA 1YUBA 3GIWA 2FPOA 5GIPE 3JTHA 5E8IA 3UJ8A 5DDGA 1N7IA 3QOPA 1GVJA 2X0LA 4E2XA 3CC8A 3PT9A 1G3TA 1ZH5A 2OB1A 2ZMEB 2XRNA 1NV9A 4BAYA 4H0NA 3CJTA 3QOWA 2WC2A 4KA4A 1SMYF 2BV6A 2R3SA 4HF1A 2GA9A 1ZLKA 1YS6A 4L5IA 2QM3A 1FBSA 3ZQ7A 4L5JA 1YS7A 1T38A 2XYQA 1OYWA 2EFQA 1XGMA 2PI0A 3IYLW 3DMHA 5CIYA 3CUQB 1IXRC 5K05A 2AOUB 2YUIA 4CYDA 3G2QA 3MTIA 2HYGD 1IF1A 2YU3A 2UZKA 3GLXA 1IRGA 2VDWA 3DLCA 3DPLC 1PP7U 4RTOA 1XVAA 2V74B 2CSOA 2OD5A 3L09A 1BHJA 1IZ1A 2GXGA 2VBZA 1OYYA 1F4KA 1X19A 3EEOA 1XCLA 5EEGA 5DM1A 4P9UA 4UVAA 1SFEA 3OV8A 5EMMA 4LWOA 3KR2A 1SFUA 2OBFA 3C6KA 2KKOA 1QZYA 1G8AA 4M36A 5E17F 3HM2A 3OE5A 4WVLA 2WWYA 1XXLA 3EETA 5F6FA 5BS6A 2K4JA 2VC1A 4U7BA 3G5TA 1I6XA 3F8CA 2FE3A 1DUSA 1A04A 3PFIA 2OA4A 3V7SA 2EFPA 1RUNA 2FBHA 1RIOH 3WTYC 1SD5A 2YXLA 5AONA 4DKJA 1ZLJA 1O3TA 5CVUA 2HWVA 2WA2A 5A2QZ 2BEOA 1ZRFA 3A26A 1H0MA 2YTZA 3FUUA 4IHSA 3TOAA 3GJYA 3KZZA 2O6GE 3OZSA 2ZXJA 3OPNA 3RKWA 5DM2A 4EJUA 3HCDA 5MHTA 4AZVA 1KPGA 2YX7A 4ZYHA 2Q2EA 2FBKA 1FBUA 3KQOA 4BYYA 3D5LA 2CQKA 5K0LA 4OX9Y 1J2XA 3Q9VA 1JQEA 2PKWA 2JRTA 3ZMUA 1VQ1A 4AWXB 2G8NA 3TOBA 2VN2A 1W4MA 2YX4A 3N97A 2VODA 2EB7A 2EV0A 4HBLA 1FZPB 3FF5A 3FM5A 3MQ2A 3P9CA 3TQNA 2HFHA 4CO8A 3K69A 2OZ6A 4M72A 2H94A 5D1NA 4AUKA 2CWEA 2FSWA 2P8JA 2XYVA 1L3LA 4LFUA 1B6AA 3NMUF 4AIJA 3ID6C 1KU3A 1MJAA 3JAMZ 1VL5A 3UJ9A 3DTNA 4M6XA 5K0GA 5HILA 2L4AA 3LDFA 5EZQA 3HRUA 1WRJA 4HC4A 1BIAA 5LBQA 3G8BA 4ER5A 1Z7UA 1JSZA 3AXSA 4WWCA 4HGZA 2A5YB 4RB1A 4KUMA 1HSTA 2V9VA 1G4DA 4POOA 4EMSA 2VBYA 3LQQA 2PN6A 3B5IA 1Y8CA 2BZGA 2I9KA 2XKOA 4GOMD 3LCVB 5GWXA 3TO9A 1AQIA 2ZO4A 4FT8A 3LPMA 5FA5A 2FRXA 5K0EA 3GFLA 2PEXA 1BKYA 3V7RA 1Z6TA 2CYYA 2UXNA 2STWA 2YXDA 3FPGA 1ON2A 2B3TA 4ZTBA 5ED4A 2UWMA 3OFKA 4GQBA 1O7LA 3K1PA 1TNSA 3P9KA 2Z3YA 4N9HA 2OO3A 3KR1A 4PYMA 4BHBA 4OA5A 3GDHA 2KW5A 4U7TB 1Q0SA 1RI5A 3BGVA 4Q5SF 3BDDA 1O54A 2GAFA 1SD7A 2GA2A 1O7FA 4OIQF 2EFJA 3DLIA 5JHUA 3HA5A 1JQ3A 2MBFA 5F64A 3E8SA 5ILVA 3W6KB 2ZW9A 3SM3A 2LDUA 2BM8A 4RAYA 1P2FA 2P41A 5K0CA 5CJ9A 1F9NA 2ZIEA 1H1DA 3CBGA 3P97A 5GOZA 3R4KA 3KCCA 1RNLA 2P1DA 3UJ6A 5LSAA 2P5LC 3BJAA 3MB5A 2K7LA 3GO5A 1NW6A 4C07A 3QP6A 2QVOA 4XSZF 5LGTA 2RDPA 2O06A 3A27A 2QQBA 1BOAA 4HF2A 2NYXA 4KNYA 4IXAA 3PS9A 2HQNA 3WTWC 3EPPA 2L01A 5ICFA 4S04A 2I6GA 2HYFA 4IKPA 4R1HA 4DQ0A 2PWPA 5DLYA 2HTJA 3KLNA 1JXSA 3F3XA 1FP1D 3TM4A 3GRRA 3QP5A 4RSRA 4F84A 4G7OF 3C1DA 4MHTA 3BP8A 1R5GA 1T43A 4AD9A 3R6TA 3I0TA 3V8VA 1U5TC 1O9HA 3DR5A 3QPHA 5ILSA 2GQQA 2CW0F 2PV0A 5G02A 1ZRDA 3QU3A 2J5PA 4PCLA 3UBTA 3ZMSA 2VZ9A 1B59A 2LKPA 1KU9A 3HTSB 3G73A 1LQ1A 2ZVJA 4ISCA 4IPAA 4C04A 3L00A 5KYGA 2PMHA 4HV6A 3HVJA 5HDGA 4CKCA 1USTA 4LLLA 2G70A 2JPCA 3ZMZA 2B0LA 3RDIA 1KU7A 4FX0A 4KICA 1X3UA 4HW0A 1RZ4A 4OIOF 2ZZNA 3JAMK 1YTYA 4P9FA 3DP7A 4YUZA 4PNEA 1XSXA 2P4WA 2LNBA 2KJCA 3U81A 3W6JB 1XN7A 2FF4A 4HGYA 3DMFA 2NAZA 2CG4A 3KQWA 4YFKF 5E1BA 5BPDA 4X60A 1M6EX 4RX1A 7MHTA 3EYYA 2GLUA 4U0YA 3EMBA 3MEXA 2ZBKA 5L3CA 5F1RA 4L9NA 2Z99A 2Y0MA 5GINE 4K2EA 2G72A 1AV6A 2Z6UA 4EJTA 1UB9A 2HQRA 5DCFA 5TRDA 4AX8A 4G9YA 4I01A 2D2WA 2FMLA 2LF8A 4NQWA 1F5TA 1WWXA 2VE9A 1PRYA 2GPYA 2CL5A 2P3OA 4CWAA 2V79A 5DYMA 2EA2A 4JQFA 2L02A 3A4TA 2G9WA 3BKXA 3CUOA 2RKHA 4DCGA 3CO6C 3V7CA 1N7JA 4GGGA 3ABTA 3I53A 3GRYA 4KVZA 1AF7A 4A0ZA 1UFMA 2QUFA 1T2KA 1NBIA 3R24A 1OR8A 1YLFA 3E7PA 5E8RA 3P7NA 1IXKA 3WE3A 5HS8A 1K79A 1MJFA 3HOTA 1ORIA 1Z1DA 2AN5A 1S29A 3GFJA 2ZIGA 1YFHA 1QANA 3SSOA 4M73A 3K2ZA 1LB2A 4IRHA 2PG4A 1J59A 5T6BA 1F38A 5E9JA 1H9GA 1NW8A 1ZGAA 2V6CA 4BQAA 2VDUE 4P7JA 1QAMA 5DSXA 4HA8A 2ESNA 3R60A 2GXBA 3L7WA 1YW7A 5EOVA 3GW2A 5LHIA 3RIEA 4PGGA 5DX1A 3WTVC 3NWBA 1JHFA 1ULYA 5E9QA 2ESHA 2XGXA 3V4GA 1HQCA 3LL7A 1DL5A 5EHIA 3R0QA 1EIZA 4L0ZB 4PYNA 4BY9E 2F5DA 1EQAA 4R6XA 1OMIA 5D5WB 1SFXA 1U5TB 4XCXA 5LGNA 1KPIA 3HHHA 3ULQB 1D5VA 3WTUC 3LDUA 4FSXA 4YMHA 1XD7A 1ZG1A 3ERCA 3FX3A 1L1EA 1XGOA 4OU0A 4C03A 3NDJA 2VT3A 4EM0B 1V3FA 5K01A 2M45A 4E33A 2FNPA 2RC4A 1MKMA 2P3LA 4RVFA 2ADUA 3E05A 4MTLA 5GP1A 1ZARA 3B3GA 2IDJA 4CKEA 1R22A 3P9NA 1MD0A 5IT3A 2EV5A 4UV8A 5D4RA 4A5NA 5HS7A 3U9GA 3FMQA 1QYRA 1VPTA 3CJQA 5FLXZ 1VBFA 5DTRA 1MZBA 4EQZA 2FHPA 2AOWA 2NP6A 3F6VA 3SGLA 3M6VA 3FTEA 4MHGA 5FULA 2JHPA 3HYIA 4PCQA 2AS0A 5DV5A 3FUWA 1T0FA 4OIPF 3L9FA 4UVCA 5LHHA 1JSXA 5E2BA 5F2NA 3V8JA 1MJBA 1UHMA 2KIMA 1USSA 3VOEA 1SQFA 3H92A 2QQ9A 4RTLA 4LJZF 1WXXA 4QLCU 4Q47A 4ON0A 3RPUA 4E31A 3GZ6A 3IV6A 3UJ7A 4AIHA 4B8XA 2MC3A 3F6OA 4M9ZA 1VP9A 4F86A 5LQCA 3KP3A 3ME5A 3FZVA 2YX1A 4V0QA 2JH8A 5LQNA 4IF4A 2KIFA 4JXJA 4C06A 5BMZA 1WI9A 3ELDA 4O3MA 3ECHA 2W57A 3KZYA 4GOLD 3GCZA 3RYPA 5D6EA 5H6QA 4ER0A 5D5VB 4YIIA 2IJLA 1LVAA 3P2EA 1FY7A 2IBTA 4QDJA 5L3BA 5CCBA 1NKVA 2PX5A 4PIPA 2XAGA 3RTRA 3EVBA 3EMDA 4H0EA 3BOQA 5CVJA 3R3HA 1UCRA 3NVKI 4ENJA 3TOSA 1KU2A 1KYWA 1U2WA 4KIGA 3CLOA 2NS0A 1P1CA 4EM1A 3WU1B 3LQRA 4WXHA 4ATNA 5DXAA 4RVDA 2QRVA 4G6QA 2IDKA 1HKSA 3BGDA 2A68F 2BBYA 3J81Z 3WGHA 3HOSA 1AWCA 2FYTA 3F72A 3E3VA 1L3IA 3TKYA 5DM4A 3SFZA 5F2KA 3R6SA 1L3BA 1YZHA 5LQAA 3P2IA 2ISYA 4HTFB 1BI1A 3ML6A 5J8CA 1F1ZA 1XDSA 4KIFA 5K0JA 1WQ2A 4HSGA 5P8WA 3SSNA 4EGYA 1K6OA 1FP2A 2KJBA 1ODDA 4P96A 3M6UA 5HZMA 3GUDA 4QVGA 2AOTB 4Z2YA 4RTJA 3T8TA 3DF8A 1YB2A 1ORHA 2F5FA 3SX0A 2E7WA 3K9TA 5E20A 4X41A 4FT2A 4JBAA 3UA4A 5FA8A 2G7HA 3BY6A 3DXXA 3KQVA 2DU9A 2UYOA 3LKDA 3CO7C 2BM9A 1ZG3A 4GC9A 1Y0UA 1SG9A 4BXUA 2FOKA 5K8VA 3PQJA 2ADMA 4Y13A 2P6TA 3MZHA 2HNKA 3GO4A 5K03A 3HVIA 3MGGA 5GM2A 3M6XA 3BGIA 3HA7A 5IT9Z 4M7RA 1WY7A 2VS1A 1X1AA 2O07A 4ZZLA 2ZFWA 2V7EA 4QPNA 4A12A 4M71A 1NW3A 5FWDA 1O3SA 1KPHA 2AOUA 3KQPA 1S8NA 1OKRA 5LQRA 2O05A 2OYRA 2WK1A 2UZ4A 5L3GA 1XCBA 2PX8A 1T98A 4N0BA 2D1HA 10MHA 5DD8A 5T64A 1I1GA 4HX8A 1RJDA 3JWIA 1B4AA 3I5UA 4FX4A 1Z05A 2G7UA 3H3UA 4R8SA 3B7PA 3PFHA 1U5TA 5C9ZA 1PP8F 1DPRA 4CTKA 2ZJ2A 1SVUA 4V0RA 3FWEA 1G3WA 5ERGB 3JSOA 1LJ9A 2A07F 1RI1A 1P4WA 3ZPLA 4R6WA 2ZTHA 3MFKA 1QPMA 2I7CA 3BPXA 4ETSA 3SZPA 2EX4A 4F85A 4UVBA 2DK8A 2F5EA 2ZFUA 5DXJA 1Z6RA 3LA2A 5E2AA 3SMQA 2K86A 4GYIA 5DEQA 5GIOE 2K4BA 4ESBA 2JTVA 1ZN2A 2HV9A 1H9TA 5EQJB 2GIVA 2XHKA 2MLKA 1R1TA 3DV8A 3UJAA 1IN7A 1EG2A 4AVPA 2FQ3A 3E6DA 2AOVA 5D1HA 3R0JA 4IHTA 1NT2A 5EKXA 1KXZA 5LLQA 1W5SA 3O31A 5HVQC 2LD4A 4CHUA 4ER7A 3CJRA 4F7ZA 4X63A 3VYWA 1BI3A 3HSFA 3HA3A 1YQAA 4CKBA 2QENA 1V39A 1JG4A 2ESRA 1U8RA 3RI4A 2DPMA 3LCCA 1TBXA 4L0YB 2ONYA 2V1XA 1BM9A 4LGWA 5EIFA 4XUDA 3P8ZA 1XGNA 2VE8A 4G6DA 5LQKA 2VP3A 3FXQA 2O61A 1YZ3A 1SKMA 1UWVA 5FQNA 4LLNA 2B78A 3KHKA 1BOOA 1ZQ9A 3QV2A 3WTSC 2RV8A 4PYIA 2Y1XA 3G2MA 1EAMA 2BR4A 3EVZA 3GRUA 3KEOA 4NECA 2XROA 2ZNYA 5BW5A 3RIRA 2VOPA 4HF0A 3OU7A 1FYMA 3H3ZA 2Z33A 5JVTA 3Q5FA 1HMYA 4LECA 4FGZA 1P4XA 2VT2A 2QY6A 4HX7A 3CUQC 2VBWA 1P39A 4HG2A 5DWQA 2LSOA 2PJPA 3H2BA 3FPHA 2M1BA 2A14A 5LHGA 2P40A 4FT4A 3PVCA 1TTYA 4DCMA 2P7CB 4PGHA 4A6DA 1KIAA 2ZULA 3QAHA 3ER9A 1UFKA 2UXXA 5TJJA 1J7KA 1QAOA 4RTQA 4RV9A 3I9FA 3UJDA 2XIGA 4I0AA 4RB0A 1SD6A 4GOOD 3E97A 1FSHA 1QQIA 1T6SA 1EJ6A 3COAC 2B9EA 3P71T 3SXJA 5FHRA 2AOXA 3J81K 3KPJA 3O4FA 2YPRA 5FUBA 3KEQA 3LCUA 3I58A 4NB5A 3HTUA 2MD5A 2HMYB 2AXLA 3AAFA 3S68A 3K1MA 4OBXA 5L3DA 4I7HA 3WGGA 2NNYA 5CVRA 3BWBA 5EPEA 3WTTC 4IV0A 3EUHA 3QPTA 3FTDA 1ZRCA 3UFBA 3GX4X 3ELKA 2PX4A 4PIMA 4HRAA 2MH2A 4M9XA 2NXCA 4BP3A 2O0LA 5LR6A 2GZWA 5C0OE 2QQAA 1R74A 4U0VA 2YQZA 4Y30A 3TO7A 2GA1A 4E30A 5FD5A 5CLSA 5E1MA 2W25A 4FHTA 1S6LA 2DPDA 3KETA 3CUQA 3ROUA 1V4RA 3CKKA 4IVNA 2YR0A 4A5MA 2W24A 4LD5A 1MGTA 4EJOA 3FHZA 4GUAA 5HIKA 5CM2Z 5CVDA 4KN4X 3TGNA 4RB3C 3ZMVA 4I0BA 3MZYA 5BP7A 3HNRA 2L4MA 2QE6A 3KPVA 4ENKA 3M8EA 1RI4A 5HLHA 5AIPA 3M9AA 2H6CA 4P55A 4M74A 2ONZA 4KWCA 3KLOA 1P1BA 4L9JA 1R00A 4E2WA 3NDIA 4PWYA 4FR0A 1YG2A 4HOBA 4E70A 3NJRA 4XLPF 3T5XA 1IN4A 4R8HA 2K02A 4MQ9F 4CICA 2H00A 2H11A 3LBYA 2DPUA 5DSTA 1BC7C 2K4MA 3HUGA 3O3KA 4RTPA 1FBQA 5CYVA 2IH2A 3Q9SA 1Q1HA 1TQPA 2N47A 3WU0A 3RODA 2STTA 3C7JA 4GYGA 1M0EA 4R79A 1ZREA 1VTNC 3KU1A 2XASA 3FXUA 3FPFA 5FFXA 3CDHA 2IGTA 5DUKA 3SXYA 4U7PB 2L3DA 5D5UB 4KDRA 2C7OA 1UHWA 1QBJA 3ANXA 2OZVA 4IRGA 3TDZC 4GCVA 5U4XA 1YFJA 3B3JA 3I64A 5EIWA 4HDVA 3TKAA 2NNWB 2FEZA 1W7PB 1LNWA 3FYCA 1JG3A 2AR0A 4O29A 3FTFA 5HIIA 4K6MA 3PB3A 1NE2A 3QU6A 5CVIA 3U1DA 5K09A 4I09A 3IHTA 2R7DA 3KQMA 3B02A 2XVMA 1KQ8A 3EVAA 4G56A 3BUSA 2DT5A 5FADA 2M30A 3E5XA 3JW4A 2A61A 3MERA 4GC5A 2NYUA 3FTCA 2E7XA 1EH7A 3GZ5A 3K0BA 4MWZA 4DA4A 3DEUA 3VB2A 4Q4ZF 3BWYA 1YFLA 4S05A 3LECA 2H6BA 3HCBA 2HS5A 1I5ZA 4WK8F 2KIUA 4GOND 1GXPA 1G3SA 4HDUA 2ZKZA 2GH1A 4MTEA 3VC2A 5D5XB 5EHGA 3KR9A 1ZGJA 1CGPA 2EJUA 4I02A 1FC3A 4ENNA 4C08A 3L2CA 1U6GA 1HW5A 3WTZA 1HXDA 4CDGA 4PYLA 2JPBA 3E5QA 3BT7A 4U7DA 4YFXF 1HKTA 3SZTA 2MH9A 2PXXA 2Q0OA 3ELUA 2I62A 3FXRA 3ZMDA 3NQOA 1SAXA 2GAUA 2EK5A 3LFKA 2JG3A 2IP2A 2V1DA 2PT9A 5HFJA 4RWZA 1JE8A 3KP7A 3KE2A 5KVRA 2C6YA 2J5OA 1STZA 4LWPA 2W85A 4QTUB 3T0IA 2EJRA 3OFJA 3HSEA 3R0AA 2HGCA 2JZYA 3FRIA 4U88A 5DTMA 4ZYGA 2FRHA 1NW7A 3V8KA 2Z5UA 3ELWA 2P7IA 1KQ9A 1J9IA 3MWMA 4LG0B 3TRKA 3DPTA 2BE5F 2CGPA 1CF7B 1XMAA 2HTSA 3FM3A 3PQKA 3O7WA 5KQRA 3F21A 5ICCA 5EGSA 3T7RA 2HR3A 1NBHA 2P7HA 4HYEA 1WZNA 4LK0F 4A6EA 3FMRA 1SUIA 3C3WA 3NW9A 2JT1A 5DD4A 2CWWA 2NXNA 2IFTA 1G38A 2IA1A 3LDGA 4IV8A 2DW4A 5E1WA 3AY0A 5K0BA 2FBIA 2FK8A 3NTVA 5HOQA 1MJ9A 3I59A 4E32A 4GXOA 1N2XA 3OU2A 3HSRA 4PDKA 4MQVA 3M1EA 3KQQA 1FX7A 3E6CC 3HCFA 1XDZA 2UYCA 3MHTA 1L0OC 1LDDA 3BWMA 3I4PA 1KP9A 2FMYA 4ESJA 2HEOA 4RTKA 4KT5C 1EH6A 3EYIA 1UIRA 3DH0A 4CZZA 5T67A 1MHTA 4MNUA 5E1XA 3ORHA 1XSVA 5EMKA 4BH9A 3VEPA 3THSA 2ZMEA 3KR0A 4GF5A 2PFBA 3FUTA 4B17A 4X61A 4LB5A 2AOTA 4OQEA 3LAJA 3HTXA 4QQNA 5LGUA 5ICGA 5CCXA 2BR3A 3DULA 2XAFA 3DMGA 1WG8A 3MCTA 4L9VA 1R5HA 3FYDA 2A6HF 3WODF 4LB6B 1R58A 1NHAA 5EEHA 2DI3A 4ZH4F 3G8AA 1VIDA 3HRMA 3BJ6A 2ERCA 5EKUA 2GB4A 3JTGA 3KP6A 1JGSA 1JQDA 2CMHA 3DOUA 3UA3A 2Z6QA 4LG1A 4LMYA 3M4XA 2IPXA 4P7KA 1I27A 2VDVE 2HKOA 1R1UA 3PFGA 1D3YA 2VOOA 5GM1A 2EJTA 2YSRA 5D8LB 3CVOA 5E8GA 2PXCA 2H27A 2IA0A 4L7VA 2DQRA 3G5LA 3M70A 4DF3A 2P35A 3MAJA 1U3EM 2OB2A 5KVAA 5E18F 5E1ZB 5IH3A 4I98B 3KQTA 5FQOA 4XRFA 4YMGA 3MAGA 3IL2A 2DK5A 2EFWA 4M38A 2BR5A 5AIQA 2PXAA 5K5RA 1XDUA 4ESFA 1EH8A 4WXDA 1G60A 2BH2A 2IH5A 2ZCWA 3NRVA 5KQSA 3IKVA 1ZYRF 3CJNA 3HCAA 5H02A 1BC5A 4LLGF 3HP7A 4ENMA 3BKWA 4OQDA 5CVVA 3EGIA 1XCJA 2P6SA 4WXCA 3ECOA 1KA8A 3BJOA 3U2RA 2V1UA 5JI6A 5FD6A 4OOIA 2FK7A 3EGVA 3DXYA 5D6FA 3C0KA 3F4KA 3TMAA 1KQ0A 2DTRA 1WS6A 3LAPA 2RQPA 3JWGA 4HLYA 1X1BA 5DT2A 1K78A 3MQ0A 4OBWA 3HIFA 4HZFA 2PQ8A 3ZP5A 1XJ5A 1Z9CA 4Y17A
chains in the Genus database with same CATH superfamily
2FR8C 2MD0A 2C3UA 4WZZA 3ZCPA 4RIHA 3D8UA 4JDPA 5IAEA 4MPJA 1Q2UA 2ZR0A 5BYAA 2AXPA 1VPLA 4QGFA 1KYXA 1OREA 4UM7A 4IZ6A 4WNIA 4PR0A 2VYCA 4G37A 5FNVF 1QPZA 4IDDA 3K4PA 2OKCA 1BW6A 3SZGA 2F1OA 1U9JA 3ELYA 2I2DA 3DFGA 3J7YJ 3V6LA 3PTZA 1WW8A 4MFEA 4ISBA 3PM1A 1EVKA 3VHLB 3D2LA 4Z0PA 1AHHA 2A1TR 3PXUA 1RJEA 4MEYF 1LWOA 3VH3A 2J87A 2CV2A 1W7PA 1P44A 5A2QK 3OJWA 4U8GA 2V0NA 3QQ5A 2CCJA 1BW9A 5FB2A 1N1EA 3AETA 3H8VA 3JWHA 3LY7A 2JFOA 3HCWA 5LDHA 4Q39A 3G2PA 4UCXA 4ZDIA 4FHFA 1D6MA 1K4YA 3PNVA 2F67A 4XNFA 3GWGA 2QX9A 1I4LD 4R1OA 1J4AA 2R6ZA 4X6UA 2WE7A 2V59A 2P81A 3TL3A 2HA5A 4PJNA 4OMDA 5J5CA 4A0HA 4W4TA 4BFTA 2ZQYA 2GTPA 4GMKA 3JAMA 4NJMA 2RGBA 4M3EA 2EFGA 5AI8A 3GTOJ 4UTVA 1PKEA 3D3WA 4WCDA 4JMLA 4B47A 1G291 1Z56C 2PBLA 2YXEA 3L8EA 3LFTA 1DDNA 4PYKA 4ENWA 5LRRA 2DULA 1R6DA 3ROEA 1OLUA 1ZELA 4F55A 3JZAA 3GJSA 2F5CA 2WILA 3EFBA 3VZRA 1Z4QA 1OLXB 3A2MA 3HFSA 3N2KB 1FVFA 2O2GA 4HDKB 3BULA 4AO8A 4B3GA 1QKKA 1NUQA 1T8SA 5IT9A 3ZJUA 2IODA 4D3YA 5BQTA 5EUQB 3V3TA 2C9DA 4DB4A 1ICEA 2D0IA 2P6UA 2RGYA 3NC4A 4GNRA 1Q0UA 3EPHA 2VA9A 3QW2A 4MR8A 3G0BA 1ODLA 2X8JA 1KY5A 1WB9A 4IJKA 4ARVA 3CW9A 4RDHA 3U3OA 1YVUA 3AM4A 1HSJA 3OHPA 1NWCA 4FMDF 3WLMA 1N6RA 2IHUA 4V3BA 1K2VN 2F3QA 3SBXA 4V0SA 2GF2A 1IHPA 1QHHA 2LMDA 2XUFA 1D0SA 1I7PA 4G1VA 3STUA 5KINB 1PFGA 2JLYA 4CEHB 3DHWC 3GGDA 5LKAA 2O0YA 5J5AA 2ASVA 1UPFA 4W7HA 2MLGA 1E17A 4R2XA 2W83A 2TMGA 1PWYE 1C81A 1XL1A 4ZWNA 3K32A 1L4BA 1W2WB 1GTMA 3OZDA 4PG8A 5I4KA 2XXAB 3JRCA 1R37A 2FRDC 3NNNA 1SRRA 3EXHB 2QKMB 3SIWA 1IG7A 1WMSA 3DKWA 2NNNA 2OTJI 1VE3A 2FWJA 2JCBA 1Y9JA 3BX1A 2DR3A 4MZXA 4ZDJA 3I2YX 4NDNE 1ES9A 5J3LA 4JYBA 1MDMB 3IP7A 2VHUA 3MTAA 1TJ5A 1XRRA 5B3SH 2J0UA 4TQ9A 1XF9A 4RZ2A 3WSTA 5A5DA 2B9VA 3QFFA 3ZCVA 2H8RA 3OP4A 5JNTA 3J80A 4AXXA 4EG1A 4UV9A 1UBLS 1FUIA 2QVGA 2FOXA 4LRXA 4MQEB 1NW5A 3JVIA 3F22A 3K92A 2O03A 2ABWA 2ZIWB 2H09A 1E6MA 3DVLA 2IYVA 3NRBA 4K8OA 2DA6A 2QZ9A 1V43A 2GYVA 1WHSB 1X94A 3GEIA 4PPFA 5L3EA 1E2DA 2PZLA 2K3PA 2Y92A 2EX0A 3W2TA 1MVOA 2VPRA 5GAHJ 3PICA 3ZW9A 1FS4A 1TW2A 1QVTA 2FOIA 1USIA 2GJ4A 3PQ8A 1JALA 4QUDA 1KVTA 4HR7A 1YMUA 5HX7A 2CU7A 1A9PA 2FJ0A 3CZRA 5K6TA 5FUYA 5B1DA 2G80A 1KU6A 5J2TB 3ZZTA 1A8UA 1HGXA 1OV4A 2GLXA 5BV2P 3ZVMA 1FBNA 2I0FA 5CH5A 1GWNA 4RAFA 3ZXIA 4DA0A 4OMFG 5JD4A 5CCEA 4RSGA 4YC7A 2GWRA 1U4SA 1YK1A 4FLEA 5DCWA 1IJWC 2QRJA 3WGNA 3JSPA 2D7CA 5AKLA 1PJ3A 5FAKA 4U7HA 3VNUA 4PQYA 5JANA 3R7SA 1JDBC 3V48A 4HQEA 4D99A 2FNAA 1V8DA 2JZNA 2TMYA 4L95C 3WRWA 1GN9A 1E1DA 3AERA 3FUXA 5BWOA 1PDNC 3S3NA 2R6CA 4TXMA 2N0SA 1EV7A 3L1PA 1HLPA 2JB9A 1TD9A 1ENYA 2O1WA 3GF4A 4YRQA 1NXQA 2VQHA 1G0OA 2F3TA 3BWCA 5A3VA 5A5VA 5EE9A 3S17J 4KQ1A 3UPDA 1IAWA 2I4TA 1ADFA 5FDFA 4A36A 1DQSA 2QMHA 3NRCA 1SEPA 4DR6B 1L4LA 1OT3A 1VJ0A 3JVVA 3O90A 4GMDA 4O63O 3WBBA 1A88A 2VJBA 1NBME 2WWHA 3HCCA 1SU8A 2PUEA 2E1NA 2YYYA 5A05A 3VV3A 1JU4A 3IVCA 2IUSA 5J4VA 1Z68A 3OT1B 2Y0PA 4RQBA 5J2UB 1ETVA 3DQVC 3O4GA 2ECFA 2HRRA 1YL6A 3NP7A 4LTNA 4MZDA 3T06B 1CF7A 3X1ZA 1L1RA 2ISCA 3RJPA 4G0QA 4HZGA 1EB9A 1WCYA 4FNAA 4ZDWA 3L8DA 2WYVA 5BYBA 2QL6A 4YMWA 5P21A 5K0JA 6ADHA 1Y8RB 1T25A 2WUEA 3DMNA 4MWDA 3B9RA 4Q6BA 1WXHA 5FUBA 4LTMA 2BKEA 3J7AO 5D8DA 4PYOA 2DXIA 1X2MA 5CVEA 3DAOA 5KAMA 2A05A 3BRQA 2PZJA 1SEUA 2V54A 2Y2UA 4F72A 2Z8ZA 3MUOA 3D1LA 4IDPA 4UUMA 3JRAA 2QJOA 4DGQA 3CGGA 3BZ6A 3BC1A 3GAFA 4U39A 2GZDA 2RHJA 3D6VA 2BEVB 2Q3DA 4MWTA 4DZJA 4CMEC 4EHAA 3VDNB 4YAGA 3BICA 4JQYA 3UATA 2JDID 2GFIA 3V7UA 3FHJA 3EIEA 4LFBB 4EP1A 1L3CA 5JROA 3AG4H 2C97A 2WABA 3SDZA 1OISA 3QBEA 4NFSA 1E3TA 5KWVA 1UZMA 4PONA 5IJZA 3SR4A 5DP1A 3MGAA 4AMVA 4PJ0C 3DHVA 5TQJA 1L8QA 2BW3A 1K8ZB 2OR3A 4J0EA 1INLA 3SEQA 1M2VB 4KFUA 3PKJA 3D8HA 3QPUA 3L9WA 4MJ7A 1RJFA 1FSSA 1JVNA 1T8UA 1AOXA 2QM0A 4QZVA 3IS3A 3UMMA 2ECOA 2SCUA 1ETKA 2ME6A 4EVQA 4D98A 3H7IA 3GLHE 5HKKD 4NHJA 2AJLI 2PCJA 4C2TA 1EFLA 1YQEA 2E5NA 1Y1RA 4GZ6A 2BW0A 1Q0LA 3O21A 2XCSB 4TLLB 4FYXA 5HEKA 1K63A 2JAHA 1WCWA 1G3YA 2BUBA 1WDKA 1FLIA 1TTQB 1FSGA 1G5HA 1WTAA 2ZIFA 1C0PA 4PSUA 4REQA 2GM5A 5ADVA 2IS6A 4DNOA 2IKSA 2A92A 4TV7A 2XVXA 3HUFA 3I2GA 3SZOA 4CM5A 1I7QB 1PNTA 1BTOA 2VAMA 1QG4A 3UK7A 3S2YA 4KI7A 3VZPA 1WDLA 1DCFA 1TCCA 4Q9DA 4TL9A 5JSHA 1BVYF 2C4KA 1P6UA 1LPSA 3KOUA 2IW5A 3K10A 3H13A 1N5DA 1PT9A 1WW2A 2YASA 4C3OB 4BXOA 1JBKA 2XSDC 3H9GA 1J5XA 2HQOA 3A0RB 3H1EA 1FFHA 4UJ3A 4OL0A 4KDPA 1YACA 4YIKA 3FGOA 2CSXA 4ZV4A 3H87A 1LPAB 1PS8A 2NVUA 1IDOA 1QR2A 1WH7A 2VPQA 1GADO 2QK4A 1NBMA 2ZI7A 5G4KB 3VH2A 1Z37A 3QEJA 1U7UA 3G2NA 3AKYA 3D81A 3W5IA 1ZMOA 2FQYA 3WMFA 4JLKA 3RUIA 2C7RA 4ZHSA 1WMBA 1F2UA 3RDPA 1CUJA 1TC1A 5IAJA 2JAUA 1TU4A 4DNCA 4XKCA 1F9AA 1ZJZA 2HPZA 3UICA 4YV2A 3STWA 9MHTA 1T91A 1FPQA 2V0CA 5HF8A 1TAGA 4TRMA 3VBCA 4RM3A 1Z2AA 2AR7A 3DTVA 4DADA 4HUQB 1JEEA 3THWA 3CRNA 1ON1A 4RFVA 1RQPA 2JFGA 1KQOA 3CR3C 3THYA 4DQUA 4JEMA 3AF3A 3AL0B 3O83A 4TYYA 2O52A 4HVTA 3DDZX 4OJQA 2QT1A 4C6SA 2FU4A 1X2EA 3JQPA 4XQ0A 5AI0A 3WTXC 4ZOLB 2QYSA 4EJWA 2PNFA 3CF6R 3A4VA 3K0FB 1NHGA 3FK6A 1AXEA 3HWRA 3LO8A 5HF6A 1T36B 3TQSA 2IUEA 4B46A 2Q46A 1AIPA 2COMA 3TSOA 4BVBA 3ZVNA 3B38A 1J5YA 2CVOA 3GMDA 1Y1VJ 1GT91 1QIJA 3GRZA 4GWGA 4CIYA 1RRPA 3H83A 5IKMA 3PRKE 4DEYA 1Q1GA 4L72A 3SC4A 5DM6F 1JYFA 1IH8A 5JZBA 3CRMA 4NFYA 4EM6A 4MW7A 1FEXA 3PIOF 2P4HX 3RKXA 1ISHA 2GD6A 5LMUB 5B4UA 3OJLA 4X5OA 1HDRA 3ESWB 3BR2A 3F6YA 3IEKA 3CO5A 2H8WA 2HMSA 2VTBA 4Q3CA 3AF1A 2XDVA 4B2YA 1SUEA 3GLLA 1PR3A 3MGBA 3QLUC 1UFRA 4LVNA 3HZHA 2F43B 4L5EA 2CLKB 3JZIA 1CZKA 3IUOA 2I1LA 3CN7A 5FPSA 4DEVA 2C99A 1A9SA 4QSHA 4BHCA 1AE1A 1ZNZA 4JP0A 1ZQ1A 2J7PD 2QGNA 3TLEA 4URVR 3BZCA 4YIHA 1RYEA 1VCIA 2IGOA 2OF7A 2SHKA 4MCAA 5D00A 4QG7A 4LG0A 1GKKA 1WCIA 1KYIA 2C20A 3NBFA 4HLXA 1EWYA 1OR7A 5LYJB 5TC4A 4A3LJ 1A6IA 2ZNZA 1RI7A 1FLAA 2GDZA 2H5EA 1K3TA 2DWQA 2ZTUA 4IOKA 3UV7A 4BWYA 3CTPA 3FMIA 5EG0B 2WD8A 4A0XA 3QX3A 4IVPA 3FTNA 2I71A 4LCJA 1TYZA 3A4CA 2WAXA 4KR9A 1Z4NA 1IPEA 1T1SA 3ZU4A 1K6EA 5ALRA 1ND6A 2GSDA 5EMHA 3MKZA 2AS5F 2QZ4A 3ITEA 4ZYEA 3JZDA 2LG4A 1RBZA 2HO5A 2PIAA 2C3OA 3HOWJ 1CETA 3HJAA 3PUWA 4OF4A 4XOUA 4KMFA 2OHFA 2AUTA 4PAQA 5ALXA 4KVAA 1NNI1 2V7QD 2VWPA 2AI3A 1E6KA 3GU3A 2ISZA 2FSIA 3HB1A 3M9LA 1ESDA 4EGZA 1DJLA 1YB1A 3LNCA 4I6EA 2AC4A 4QVKA 5D6NA 2ZIUB 1S8FA 1W8IA 3CH6A 2BGNA 5J8FA 4HBGA 4JX9A 3U39A 1QIEA 4MKGA 5KJ6A 3OYDA 4CLRB 2PWAA 2W6QA 2EYQA 3KHTA 3MWEB 4GT1A 3HADA 2R7TA 3S2GA 3V1LA 3M89A 3ET4A 3GBPA 5AVUA 1Y82A 4X8HA 4BLUA 2COEA 4YR9A 1A5AB 1PJAA 1GZDA 4F1JA 5HK9A 4BVEA 4MIMA 1WP4A 3ROKA 2BVNA 2A0YA 1EFKA 3OA2A 4TPKA 3DXJF 1XVTA 2B34A 3OCJA 1OW3B 4TTSA 3G79A 4CUGA 1LEBA 3H0KA 3WE2A 3HLYA 3IUJA 3FSJX 4M9SA 3WDKA 5BOXA 5CB6A 5EJ6A 5CNIA 1NOJA 2B4KA 5ICEA 4Q1AA 3S8PA 4OQXA 4QX6A 3KJNA 1PK9A 4HH4A 1DCMA 2QHXA 4M2LA 1KKLA 3QLEA 4PEVA 3RS2A 3OKCA 4BUJA 1E6EA 5I4BA 1YOVB 4JP1A 2PFSA 1FSEA 3NR2A 3NLLA 3LZCA 3TAHA 5CD9A 5KSWB 1HE5A 1DPUA 3BTJA 4MS4B 2WZCA 1SCUB 1PR0A 4P5OA 1G3QA 2O14A 5IYZB 4L18B 1BXKA 1SB8A 1BJRE 1ZP6A 3CUSA 4P2BA 3B70A 2C9BA 3N2LA 3LU1A 3O26A 1X70A 4KN8A 3HU1A 5JQWA 3UJHA 1ZJWA 4RW0A 3O9ZA 5JDCA 3Q3EA 5D2CA 3I9NA 3T15A 2FB9A 3NGXA 2IL1A 4KSYA 1JJ7A 3EXG1 3I12A 1Y37A 1QJCA 2HTEA 3I54A 5J43A 3JX9A 4LN1A 1KRXA 1WQ1R 3DMTA 4XLNF 5A9SA 5JEEA 2GVZC 1PL0A 1ULUA 1ZJ5A 1A3CA 1O94C 4IUYA 4BE2A 3KFWX 1ZK0A 3K9WA 1SH7A 3H7AA 5BPFA 1YDHA 4RHYA 4B4CA 3VSCA 1MX1A 1PR5A 3OLCX 5DCMA 2QSFX 1IY9A 3BXOA 2LKCA 3MFYA 3WKDA 4BNVA 5KS2A 1NJFA 3EPJA 2BM1A 4GYWA 3QK7A 1PD0A 1O58A 3ABOB 4BEBA 3RROA 2AJTA 3SJCA 1VG0B 3F4LA 4BFCA 1JZQA 5E3OA 5HVNA 3AYZB 1YB6A 5D7NA 1WTCA 1MEEA 1Y63A 2CEAA 4TKMA 2WWVD 5EZGA 4TLMB 3RBVA 5CDGA 1MB2A 1DT5A 4RLFA 3RCOA 1VQ4I 4B4DA 3RWMB 2GXAA 1QHSA 3HG7A 4KH1A 3SHTA 3Q1KA 4DW8A 2YBEA 1R6RA 5HRUA 2OZUA 2E4VA 2NSDA 2R6GA 4KREA 5MFPA 4P7GA 3RSQA 5EQFA 1E7WA 1UM9B 3HNOA 2FMTA 4C2AA 1SVIA 1L7VC 3RUCA 1D1BA 3PUKA 4BLWA 1AS0A 1NF3A 4RZSA 3VR5H 1ABBA 5BYJA 5CPFA 4GMFA 2XVAA 2GZ2A 1VE5A 3I71A 3G2HA 4RXUA 1BR1A 1Z74A 2PLFA 5CMLA 2W00A 4DRYA 1BQ3A 4NBSA 5DM0A 2RB4A 2H9IA 4A2UA 4C3HJ 1P2BA 1G9SA 4XKVA 1TW3A 5IC5A 5IT9K 4KQCA 4BMZA 4ZOQI 1RI3A 5TQVA 4EM2A 4QDKA 4KIWA 4H7IA 2BFEB 1XP5A 2OXEA 5KWIA 1EFPB 3TIXB 1GQRA 5SYNA 1XMVA 2H65A 2CXSA 2IHYA 3H99A 1B3RA 3ZMTA 1UT5A 2V97A 1DP4A 4XBFA 2GYYA 3A25A 3AJ9A 4MAMA 3VSEA 2Q9AA 3W9SA 2EQAA 2R68A 4ZD6A 2VJOA 1U7WA 4YUWA 1GUZA 1T8TA 2NGRA 2MYUA 3M7GA 1DWQA 2VTVA 1POGA 1EXVA 1KHTA 1DZIA 2FP4A 1WBDA 3SPXA 3SS9X 2FFQA 1SC6A 3NHRA 1IFXA 3K6GA 2FZKA 4BBAA 2JGKA 3L8MA 3U44A 1GLVA 3UJPA 1KZ6A 4MUXA 1IN5A 1YYVA 1CNEA 1ODCA 1ONVA 2ZKIA 3K4KA 2QGFA 3CMMA 4LITA 2IT0A 2CHFA 2LY1A 2HHAA 4UNOA 2NTJA 3Q85A 5KQLA 1HETA 1GZ6A 1E3MA 1MMSA 3A10A 1VYVA 1JH8A 4DDMA 3BRSA 3TTYA 4HAYA 4AW9A 1SZDA 4BQIA 2YQ5A 1K61A 5T7BA 1NX9A 4YCBA 2O8KA 5F5NA 2WLSA 5E3IA 1QFMA 1WBJB 1E8DA 5H6RA 1VKOA 1W76A 1XIVA 3RVNA 2C7GA 3ELBA 4K9OA 4WKNA 3W5SA 5B30A 4YRGA 3DBLB 5KSZA 4AKSA 2ID9A 3T7EA 3EZLA 3MWYW 4CF5A 1LSOA 5EJ9A 2UUCB 3D0OA 4IX1A 5AJXA 1H4SA 2BIFA 3SVTA 1EP1B 2QUZA 2EP7A 1G6Q1 2XB5A 4WZAA 4BO6A 1JH9A 4GPIB 2WAFA 2HW8A 3AK4A 2DP4E 7AT1A 3VI4B 3IEIA 4L5BA 5JCJD 2CFIA 1BXRA 3BK2A 2DFNA 5FCDA 2AUMA 4MLDA 1M8JA 1T3SA 2E48A 4FFWA 1CUDA 3TLGA 1AOYA 1FNNA 4CM1A 3FFWA 2QB5A 2EFOA 4HDRA 5FBQB 2B20A 3G71I 4B6OA 5FX2A 1QBGA 4KPGA 4OJMX 5FO5A 3QX7A 1CERA 1SIWA 3KSDO 4N4AA 3LP6A 1TQMA 1C2TA 1CUBA 4NMHA 5D3QA 1TLLA 3BGWA 3UOAB 4COOA 5IJ0A 4M6VA 3O2NA 1IEVA 4IAOA 5DASA 2R7WA 5DGDA 2X77A 4PSVA 1YV9A 3TRIA 4JK3A 5KTRA 3TGLA 2XKKA 5IDYA 3A6PC 4J00A 2ZSHA 2Q8QA 4L9AA 4IJAA 1XTIA 1XGKA 4BJ5A 5I7EA 4P58A 1DE0A 2YVLA 4BEVA 4YV1A 2KQRA 5JFRA 1PEDA 1TTHA 5DTQA 3DL7A 4A3JJ 5EFOA 1T5HX 1XEXB 1LB1B 2B7LA 2M8GX 2F64A 3CH7A 3A6EA 4QWWA 3H5WA 4X7BA 5DRYA 5FGMA 4C6TB 1S6YA 1ZHOA 4I55F 2YDXA 1B9MA 2PLAA 3GA5A 4UE6A 1R18A 1G8GA 1R36A 4E4TA 2PMZA 3FPLA 1UJNA 3UUFA 2WTAA 1F4LA 3NWSA 4B3AA 1PEKE 2A0FA 2PUGA 1TT5B 4E7KA 3A3KA 2QPLA 1UP6A 3PDJA 2K9SA 3QQAA 1Y98A 4QOJA 1ONNA 3TLYA 3I55I 3W2IA 1HDCA 2GBCA 4HQKA 3FVQA 2A6EF 3QNUA 1A9TA 4OB7A 2OJED 1IBKB 3KOZA 3NBYC 2DLNA 4WCGA 4HB0A 3OZEA 3FDZA 3C18A 3RU2A 4RTRA 3TBIA 1YGYA 2GQ0A 4JU8A 3QPVA 3VI3B 2PN1A 1A0OA 4F4JA 1ZINA 2ZSAA 5DGTA 4N5LA 2HDDA 5JR3A 5AW3A 3S1RJ 2YJNA 2DFPA 3N28A 3SF8A 1UAYA 4U7WA 2WU3A 1XA0A 3L8YA 3Q8KA 1Y5LA 2W4MA 4MDYA 4UBMA 4ZALA 4B0PA 3H1GA 1HZJA 3UHFA 3LUAA 3IAM6 5IN4A 1A9XB 4I2OA 2EG5A 3LHDA 4X7RA 1RRGA 3RU9A 3IULA 2WF9A 3TH5A 1GVNB 2R5WA 3A11A 3IUBA 3KT6A 3M82A 2VHQA 2R751 3MOSA 4M0UA 4PLFA 4DZPA 3CINA 4KBFA 3UQZA 4FCYA 2AG0A 2FMFA 2ID8A 3L4BA 2R8RA 2AF4C 4UUVA 5FNVB 5CYOA 5DNAA 1QGOA 4FD3A 1Z2CA 1BO6A 3NHBA 3WDMA 1C14A 4GLLA 3ZLUA 1X1EA 1QMGA 3DBOB 4CLRA 2ZBUA 2BGGA 1P91A 5A6SB 4F5YA 5C51B 1T9GS 4QU9A 2BBSA 1AS3A 5KOIA 1GV0A 5LIPA 2XZLA 3TGWA 1T6NA 2KHZA 3S2IA 3HEAA 4YCAA 9LDBA 2DYSH 1QGUB 1SQSA 2EG9A 1C3VA 2IHKA 5SZJA 2VHJA 2DYKA 3DLPX 4X85A 3UXEA 5BQ3A 1II8A 2UYQA 2B2CA 4ASNA 4EJVA 2IT1A 5GPCA 4C3IJ 2VB6A 1DTEA 2JK3A 3W4IA 2R7FA 2ZT8A 5BWBA 4D02A 5BSUA 1FMVA 1C7QA 1XTPA 8LDHA 1EWRA 2V6GA 3I72A 4CYCB 2ZUTA 3V4LA 1MENA 1Y1PA 3A7DA 3I45A 3FOZA 1DV1A 2G71A 3QYJA 1W0CA 1OF1A 1XZNA 3PUZA 5CX1B 1NYLA 2JA8J 2BGCA 3DJYA 2OYCA 3RR2A 3W79A 5LZ4A 4MDEA 1SAYA 2A0UA 3KU4A 4EY3A 3AR2A 1JIQA 3AUYA 4RA2A 5AHKA 1RYBA 2MTBA 4JEHA 5IVHA 2WD7A 4DZRA 4TV9B 3U3RA 4X90A 2HUPA 3TQTA 1U8YA 3Q0EA 3M4JA 2A9PA 4X64B 1UKAA 3E23A 3TR0A 5DKFA 5BXYA 2YWHA 5MF6A 1R0LA 2HDCA 1E79D 1ZY2A 4P38A 2CVZA 1CQIA 2R4QA 3UPUA 2I7VA 3BYZA 1D5WA 1DKLA 1DUVG 4XIFA 3T7TA 3OJ0A 2PLWA 2FMKA 1PFKA 2B5OA 3FKIJ 3HRIA 1ISMA 4FWBA 5K0ZA 3OI7A 4QDXA 1BDMA 1HDPA 5AM4A 4ARZA 5DPMA 3KJXA 3LVFO 1WB5A 4QO7A 2BM0A 1J97A 1H2YA 2W37A 3WB0A 1M2GA 1Y3DE 3VYSB 3OOWA 3DAPA 3ZK7A 5C3UA 4MIEA 4GBED 3KKMA 3VSDA 2Y0DA 1DAKA 1E3QA 3C6MA 3ORFA 2QTNA 4PHGA 1R7JA 2X6OA 2ECCA 1TIBA 3JD4A 4US1R 1LLFA 3TM5A 4D9EA 5J2TF 1BL0A 3TSCA 7YASA 1ADYA 2HEIA 1U2ZA 1YUBA 1E0KA 3C85A 4IX9A 1P60A 4KLRA 4Y9DA 2DODA 4B5LA 1AV7A 1BDIA 3ICWA 2X1VA 1ENPA 1KJIA 5DHTA 5DDGA 3P2YA 5IP6A 5FLKA 2PUBA 1A9ZA 3M1IA 1R9NA 1JSLA 5ISMA 1G3TA 2XNDA 3FCEA 4PGMA 4BMVA 3RKRA 1HTWA 4YDSA 4L5AA 1GGMA 3GTKJ 1Z62A 3GLHA 4H0NA 4N0QA 5IC6A 3D6JA 3ZIAA 5MN5A 2RHWA 1A96A 2POQX 2EZ9A 1NPTO 2RBGA 3IP4B 2FMHA 5JOQA 2NZJA 4EBBA 4DR7B 4ZJPA 5DNYB 3HJGA 4PLCA 2HGZA 3OX1A 3ZKAA 3DB1A 3DYIA 4I50B 4PS1A 4AUEA 4NMXB 3RGGA 3EC1A 4YJGB 1MCZA 1KY4A 2BEWB 1LU9A 1YJCA 4F4DA 1AMOA 2OQ2A 1V4VA 1ORVA 4IZOA 5KNBA 2Y9YA 2PI0A 1GRNA 3FI0A 1Z8NA 3FYSA 3G9UA 3KSMA 3UT6A 1PSDA 4J7UA 1ZW6A 1TWAJ 4BFLA 5IOZA 8AT1A 4FDTA 3EULA 5FXMA 2RCNA 3IR7A 4J7AA 2A0WA 4UHCA 3CUQB 4DYRA 1JHQA 4IEIA 3D59A 2EERA 2F9LA 3MAAC 2YUIA 2CVHA 2ZT7A 3GNTA 2WFZA 4CCNA 2OFWA 3QGMA 4I1UA 3GTPJ 1F1BA 2YU3A 5IKOA 3WOVA 3L6UA 3TMOA 3PGXA 4TWIA 3R1IA 3WU2C 1V1MB 4NZMA 4ZO6A 4KQXA 2ZUFA 1ISRA 1CQJA 3NT4A 4WL0A 1C3XA 4KI0A 3DO5A 3HOYJ 5HZGA 1YBVA 3SIPA 2X51A 3MRSA 1GQOA 3U5ZB 2EH3A 1PP7U 2O3QA 1XVAA 2W22A 4G5XA 2IV7A 4AQYB 5IVIA 4DKXA 5IDWA 2P9TA 1OYYA 4G89A 1CC1S 4BKUA 4BO7A 4BP8A 4Q00A 4BUCA 2CBGA 5DNDA 4KXNA 4N8SA 5EJIA 5CDSA 2QQ0A 5EMMA 3M6FA 4M49A 2VK8A 1L5NA 1C0IA 5CLIA 3NHAA 5IPAA 1PGJA 1PFWA 1Q15A 1NVUQ 2R1VA 4FC6A 1SN7A 2P5UA 1DZ3A 3K0AB 3L92A 3MW8A 2RNGA 4ZCIA 2E36A 1NW4A 1UFQA 4IQ8A 1QZYA 5ITZB 1TQ6A 1LKZA 3OE5A 3HM2A 4PXSA 3M07A 1UC4B 3OCVA 5BSKA 2R8BA 2ZC2A 3BCBA 2QLNA 4YJ3A 4C20A 5AW8A 5IZCA 5GJWC 2UAGA 1EEHA 1IBMB 3UKJA 2IPLA 2JJ2A 3ANSA 4FUQA 1QOPB 2Q5LA 1OFGA 3KT8A 4MCJA 5DGHA 4B31A 1UBOS 1H6DA 4QU0A 4XYEA 4YALA 4IOCF 4BY7J 4BJ1A 1KRHA 4CNBA 5C37A 5H4GA 3BH7A 1WD7A 2OA4A 3V7SA 3DZCA 1Z38A 3UFXA 2C9ZA 4P1WA 1FOEB 1WJ5A 3OZUA 4G6ZA 4WJKB 4UAUA 1JAIA 1MB3A 1VXOA 2AKYA 4IKOA 4DR2B 4FN5A 4BQSA 1RIOH 1RRFA 5AONA 3I1JA 1ZLJA 3ANTA 4BNNA 2HWVA 1Q83A 2WA2A 3DZHA 4YV7A 4BX8A 3EDRA 1ZRFA 1U2RA 4D8YA 1VQPI 1XKLA 2G88A 3L2UA 1QO9A 4IHSA 1NSTA 3JYQA 5DISB 3TOAA 3GG9A 3CZAA 4QSMA 4DBZA 5DLDA 2O6GE 5IBQA 4LHEA 1IY8A 3DEZA 4FHDA 3UGTA 4I5EA 4AJJA 2IYEA 3BMCA 2FVXA 4K46A 4EJUA 4KXQA 1MW9X 1ORDA 4RGQA 3OIUA 4F9FA 5CAEA 2JFHA 4BJHB 5MHTA 4H7HA 3HWX1 4K5QA 3UANA 1SXJE 3B6AA 3GAMA 3I42A 1H2ZA 1TD1A 3ESDA 3KQOA 3LE8A 3ESZA 4N9QA 3SSAA 3B20A 4MUEA 2QUIA 4GDMA 1W49A 2D1QA 2JJMA 1EFRD 1IHUA 2P6NA 3FF4A 2PKWA 4GQIA 1XC7A 4ZT3A 1GARA 5JSYA 2JRTA 1Z29A 2Z0MA 3RJMA 3T1OA 1OIWA 1VQ1A 2QTVA 3DDUA 4BN5A 3TOBA 4HDNB 4TMYA 4LPSA 3ICCA 4MWOA 4TKLA 3KWFA 4BGUA 4TV9F 2IX3A 3FIWA 2WRZA 1FZPB 1NUTA 2QJRA 4DLBA 3V1YA 2QZSA 3LYLA 5LD2B 5LBTA 5D1NA 1X1SA 3ZQJA 2H94A 2CMFA 1I3KA 2E2HJ 4TVOA 5K3CA 4WFJA 2RE8A 2Z2KA 1NXXA 1PQWA 2H4YA 1NVWQ 1FFAA 3NYIA 1DFGA 3NGLA 5KTMA 4KPYA 3IESA 4A0FA 3HB7A 3JQBC 4EG8A 2WY7Q 4KO2S 4AIJA 4LC0A 4J4TA 3T35A 3GMSA 1B0AA 1Z77A 3LMMA 4RFSA 1UQTA 3FGNA 5A0TA 2LLKA 1F48A 5EP1A 3G0DA 2PRYA 4INJA 3PSFA 5ETJA 4LZAA 1ZWKA 3EIWA 4D41A 2R5ZB 4KE8A 3VOSA 3W06A 4Z3KA 5K0GA 5F76A 3UMRA 4MKFA 3ABKH 4LHYA 2I65A 5AVTA 3OX4A 3ML1A 3S55A 3HRUA 3GJ4A 1CQZA 1XTJA 3QYEA 1KEWA 1R5JA 2WVGA 3DMRA 3KWMA 5HK8A 4E2FA 1FDRA 1ZJYA 2IEAA 3EUFA 2ODTX 1E6CA 1FYWA 1Y4UA 1NZJA 3G8BA 4PLWA 3VPSA 4BQEA 1V8ZA 2FQQA 3OPYI 2DH6A 2WWRA 2IOFA 3OICA 4QDTA 1Z08A 3AB8A 2JA1A 4P36A 4KN9S 3B1JA 4EF6A 5HCUA 1EP9A 5BY2A 2AWNA 1SOUA 5HRCA 4C22A 2FPXA 2O0KA 4G5YA 4XCQA 2RK3A 2TRSB 5F78A 2Q6TA 4ZCMA 5JJBA 3TECE 1ZVMA 3SJBA 3NTLA 2FLWA 2G28A 3OFNA 4POOA 5A0VA 1FUYB 1MRZA 5KPJA 1F2VA 4TS3A 2XQKA 3HJUA 2VBYA 1SOAA 3ASYA 4PHCA 1F12A 1PTKA 5K8TA 4RV5A 3TSAA 1DHRA 4BO4A 4BNLA 1CK4A 1GAXA 2HHCA 4R54A 3B5IA 1TL8A 4QC2A 4DNQA 3JATA 3AONB 4DCJA 3INRA 2OAP1 3LUPA 3PSAA 4B76A 4D9IA 3DXFA 1I10A 2FH5B 4XA8A 2GCNA 5EAIA 4GPZA 3LPMA 3V32A 4OGWA 1OAKA 2LTPA 1BS2A 3D3JA 2GO1A 5BSMA 1G8PA 1BKYA 1VJCA 2QG9A 5AUQA 4QDUA 5CG2A 2DJNA 1QE5A 2FKNA 4EA6A 5JMTA 1DU4A 2JGAA 3LTNC 4ZTBA 5KVCA 1J39A 1KYYA 3LS2A 3VPBA 4Q9HA 1DKQA 3IB6A 3P9KA 4B6SA 1SVOA 1LRLA 3AEKA 3NB0A 4W99A 5L4LA 4BHBA 1R6VA 4KQEA 4MVJG 4LSGA 1CZHA 1XU7A 3AHIA 1EF4A 3GYGA 2V7XA 3RARA 5JNSA 4YQEA 5LBUA 3ZU5A 3OPVA 4E5UA 2AHOA 4AU7A 4Y2SA 1JHXA 2R6AA 2B37A 3BGVA 4GHWA 4W7IA 1GZ3A 1E2KA 1M2OA 1JILA 3AESA 3ONQA 5BN4B 3ZQQA 1AKQA 1N2CB 3TLXA 5KYWB 1JQ3A 1VMKA 4UDYX 2VPLA 3O74A 3E8SA 1KDPA 3W6KB 2AN1A 2JIDA 2WD9A 1IUPA 4OHKA 4K9RA 5CBPA 1Z5UA 2DOFA 2LDUA 4QGGA 1Q77A 2QVYX 2P41A 1GV2A 4K81B 3B8HA 2QP3A 1F9NA 4WD3A 3IXMA 1S3FA 4OREX 3BR3A 4UBOA 4XRGA 4JXKA 5GOZA 3FCSB 3CIOA 3H16A 5LSAA 2P5LC 1N0IA 4QBTA 3ZC3A 1EK2A 4ALMA 2VIIA 4NULA 4BE0A 2NIPA 3DTTA 2HL6A 2C4WA 3FMVA 3PIRA 4G1MB 3NXKA 1G8YA 1LDMA 4B45A 1TF7A 4DWWA 5KSOA 1E1LA 2J9XB 3A6ZA 1RS0A 2MIIA 3ZXUB 2XQJA 4BMDA 1D1QA 4LZOA 1USVA 4EHBA 4WESB 4XSZF 4OKIA 1AO3A 3WFZA 2RDPA 4FE4A 2YFYA 4W5OA 1AMUA 3K70D 3FAZA 3R5HA 4FUTA 4KNYA 3WO1A 2VZ8A 1V54H 1G16A 4A2WA 3OYAA 1UKEA 4EUEA 5T4EA 3WTWC 2D8AA 3ZXSA 2A0KA 3FNHA 4I3HA 2OGSA 3A6DA 4N0EA 2I6QA 3QFCA 4DCVA 4KCGA 4EL0A 1ZC3A 4IKPA 4R1HA 4YRFA 1JDJA 2EHDA 1K7XB 3JQFC 4L15A 5DLYA 3T5CA 1X14A 4YXWD 3IJPA 3KVVA 2HD4A 5TPZD 1MAWA 1SWWA 2DT6A 3TM4A 2XF5A 1M34A 1UBGA 1NC3A 4MQBA 4P22A 4DQVA 4X66B 4ACAA 1IM2A 5F1KA 2C57A 3VHRA 1R5GA 1XRLA 3WSVA 3RNOA 1T43A 3M1LA 4FDAA 1WE2A 2JVJA 1TA4A 4H1HA 4S1VA 4HXEB 2JJ7A 2PKRA 3H3FA 3I32A 1F2TA 1CJMA 3W2EA 2I4RA 3CV3A 1BA2A 1T8PA 3RI3A 3RT9A 3Q2OA 5JYBA 2QSZA 3KUKA 4WZBA 3CP8A 5KHLB 3CF4G 4J3FA 2ACWA 2VP9A 1B59A 2LKPA 1Q7TA 3H19A 3BGOS 4ZVVA 2WG1A 4ZI5A 3AH8A 2NZUG 2RB5A 3A4LA 3T3GA 1LQ1A 4WFKA 3LBAA 4G0UA 2H7VA 3A0BC 4IPAA 3GJQA 3ZE1B 2DERA 1MFPA 4BMOB 3NAGA 1YFZA 5L3SA 4MUAA 1U0JA 2V4ZA 3AHDA 3J81A 3ZE2B 1U7HA 3J7AC 4DIKA 2R7NA 1E6LA 3L9XA 2P9GA 1V3QE 2JPCA 1W5AA 4LX8A 1UADA 1ZIXA 3RUEA 4FX0A 1Q0ZA 3FPBA 4OAYA 4KICA 1KC3A 5CB0A 2VQEB 3MFQA 4LPKA 4V2UA 4UTNA 1X2NA 2O8EB 5EWLA 1U1FA 4IIJB 4OL9A 3GN1A 4MUYA 3DKKA 2JAOA 3PL1A 3IAUA 3MILA 4NF2A 2NTEA 3HBNA 4EEXA 3UAWA 2AW5A 4OM8A 4PNEA 3AC0A 3RJ9A 1K4SA 4BQRA 4C78A 2LNBA 1SZCA 5G3YA 5E3LA 1NAIA 5F2EA 1NATA 1NXOA 3A3NA 4R1PA 3WLHA 2DUMA 5AHOA 1AHPA 1GZSA 5ESRA 4YFKF 3IC5A 2LP0A 1TC2A 2X19A 5BMVB 2HIMA 3KQKA 1YJ8A 1U63A 2Y8EA 2EFHB 4PX3A 4RX1A 3WYDA 4Z9YA 1CFZA 1JJ6C 3J7ZI 2X9QA 4DV0B 2GLUA 4OP3A 3W9BA 2JASA 4PZEA 1S8AA 2GWHA 1N5IA 2DPXA 2ZJ5A 3EMBA 3VBEA 4BNJA 1X7ZA 2O7SA 4JOBA 4BLQA 2R7RA 1S01A 5LLSA 4EW6A 4Z4QA 2CXPA 1BAPA 3TUJC 2W6ZA 1G20A 4IJWA 4LXYA 5L3CA 1VM6A 3G0GA 5KDOA 2Y0MA 4G0YA 1ZITA 4FJ0A 2G72A 3T95A 4YREA 3F98A 1WXIA 2BY1A 3K9GA 3PVSA 1HMPA 1KS9A 4B79A 3BFXA 4C3UA 2B83A 3AZPA 4U6SA 4HNSA 5TMDA 3TVDA 3ILSA 1ISFA 3S32A 1U0LA 1UK6A 1IWPB 4K3VA 3H04A 1Y9AA 4OHVA 2C5LA 3HSKA 2GPYA 1IDZA 2FMLA 3BTLA 4G01B 5IAGA 1SVLA 2VE9A 1E2IA 2PD4A 2PSFA 4MLZA 4Z9XA 2WFLA 3G3EA 4II7A 3EG9B 3LCJA 5D84A 3WRYC 2V79A 3BD6A 1T2AA 1Y6RA 2IPMA 3RYCB 5JVDF 3AWDA 1XQWA 1NXTA 4L9SA 2QPOA 1B72B 4ETIA 2BW3B 1YE9A 3V7CA 1Z8HA 2HIGA 3GZTB 4G67A 1TZBA 2VDNB 4KAXA 3MMXA 3GRYA 4KVZA 4LWZA 4U9HS 1WZIA 1UFMA 2QUFA 2D1FA 1NBIA 5ESWA 2HQAA 1DQUA 1H1LA 1JLHA 1YLFA 1OR8A 2SCUB 3EZGA 1FRQA 2ORWA 3PUJA 3Q41A 4HTAA 4YJDA 3P7NA 4CR6A 1MIOB 3WE3A 5HS8A 4F3YA 3L4KA 3IAM2 3U4QA 1G4HA 2W43A 3DVAA 5GAJA 1AGYA 3O8OA 4IILA 1PW5A 1AF4A 1LRKA 2LR8A 1ZVJA 2AN5A 2VWGA 2C07A 3E82A 4F4CA 3PNPA 3GFJA 1Z28A 5BN5A 2WKRA 3O2QB 1XJCA 2ZRGA 1HLDA 2AZMA 5A6VA 3IP9A 1ONPA 4UW9A 1C30A 4PSDA 1YFHA 4Q21A 4WAUA 5L95A 1BMTA 1AQLA 3C74A 1OWLA 4QREA 5EIAA 2FPIB 4IRHA 3DA8A 1P7VA 3DQQA 3OIWA 4C7XA 4E6KG 3ZX4A 1F38A 5E9JA 1PJRA 5AW7A 3TZLA 3EA4A 2Y4OA 2ZWPA 3U7FB 1JHMA 2CUKA 2NTYC 1NW8A 2ZROA 1XTUA 1GGHA 2ZUUA 3EEIA 1JKQC 1H4QA 4L57A 4LXXA 3UGKA 4HA8A 4YJ2A 2ESNA 1NK2P 2G7ZA 1SK9A 2LV8A 4KVFA 4MO7A 5M34A 2PRJA 3L7WA 3II6X 3QE3A 1KP2A 2Y0BA 3HXMA 4O1IA 2RG1A 5LHIA 4BVKA 5KUTA 4Z1MA 1W30A 3SC6A 4HFJA 3NWBA 3PZRA 3ZHVA 2OK7A 4BHTA 2JVIA 2QRKA 1CWUA 2UZ3A 3VR5D 3FWKA 1YE5A 3V4GA 4WN9A 3CVVA 2HI0A 2XQFA 1RQ7A 1DL5A 3DE3X 5AI5A 4DNPA 1E7RA 1ETOA 4C0LA 4ZU6X 1VLLA 4A8HA 1BKDR 2H5JA 2OEPA 1EIZA 3SD7A 3ZVRA 4W7SA 4O59O 5AI9A 1Z67A 1MC8A 3DEJA 1O5TA 3EUEA 2F5DA 3P9PA 5A9TA 3UWOA 5H16A 2P4QA 4R6XA 1I3LA 4DV1B 3L8CA 3WLOA 4HQRA 3FXLA 1JSRA 4ZVOA 3U62A 3C2HA 5D5WB 1U5TB 1XYVA 2ZTVA 4HSEA 4IRMA 4P35A 5AH0A 1KPIA 4F04A 3NHLA 2K9LA 1LF0A 3OYNA 3A32A 3HHHA 3I83A 1XF1A 5CG1A 4JP5A 2VLIA 2ZRAA 3QMMA 5F27A 1DMRA 4JLBA 3E5NA 4YMHA 1ZG1A 5JS2A 4Z0NA 5JHGB 3ERCA 2V03A 1Y9DA 4V39A 3ZTWA 4PQEA 4UTOA 4H6XA 1QCZA 3WFIA 1MAUA 3NDJA 3QFSA 4MVJH 1IGNA 4KQ6A 4BFVA 4DLNA 5K01A 3UWSA 3G85A 4E33A 3FOCA 2Z5FA 4L0DA 1MKMA 3ZGNA 1C0EA 4JYCA 2OO5A 5DTEA 4JFRA 3U3ZA 2PUAA 2ADUA 3MT7A 3QXJA 3HY4A 5E3MA 3RSLA 3M4YA 1MHPA 1L7RA 3ZWCA 2GYWA 2VTBB 3DZBA 1R22A 5C5DA 4MLCA 2OORC 3QUCA 4J4BA 4IO9F 2IXEA 4P7BA 1IY2A 1NN1A 4LRUA 3D4PA 2IUFA 2HU9A 4QIHA 3ZCSA 3FHTA 4PLPA 1ESZA 5AW9A 3SXUA 3AJ8A 3HFJA 4ZT2A 2EF0A 4XD2A 1I1HA 3DC2A 4OEHA 1A5TA 1JXAA 2G09A 4IDEA 5DTIA 3TUIC 3UF0A 1QYRA 3CJQA 3H1BA 5FLXZ 2BFWA 3ZCUA 1R1DA 1HCRA 5BVHA 3JTEA 4EQZA 1PBNA 1AN0A 2F9FA 2Q3JA 4C7BA 4Y1EA 3LXMA 3WHPA 2F1RA 5FYQA 1EM8A 3SHWA 5HKAA 5KYYB 3F6VA 1AJEA 1JKMA 2X1MA 3U21A 4U2FA 2BRUA 4F12A 4MHGA 1OT5A 2JHPA 5FULA 3TZCA 3SNKA 3ZCXA 2JA5J 3RPUD 4ZJUA 2HXIA 2QRGA 4PCQA 4UTPA 1VE1A 1YVDA 1M33A 2A88A 1OGJA 1V37A 4AVYA 3WGZA 1K89A 3FUWA 5DH9A 3T3DA 4F4UA 1PJTA 4UVCA 3ECSA 1HE2A 1XVUA 3UG6A 3K6KA 3MTDA 2QPAA 1ZEJA 2PZKA 4E5SA 1USSA 3A6HA 3H4VA 1MTZA 3R0ZA 4HAUA 4NXMB 3IBCA 1X86B 1UAGA 1XHFA 1U2PA 4JBXA 1HDZA 4YLYA 3DBHB 5CP8A 2WU4A 1NJ1A 3OIGA 4EFDA 1OTYA 4HUJA 4QLCU 3IBTA 3IBYA 4ESHA 3IH5A 1X7DA 4CCOA 3CUYA 4P31A 1R4NB 1K0UA 1SNYA 2WHQA 4O33A 2JS7A 6ABPA 1IXYA 4UTZA 3IV6A 3UJ7A 5I9MA 4B8XA 2WJZB 1P5FA 1S7GA 4B85A 3INNA 3F6OA 1RBYA 4IM7A 5E4JA 4RZXA 5JE8A 4DC0A 2SKDA 3BEOA 5AVXA 4P5PA 4CM8A 4MINA 1RE1A 3C3MA 4P84A 2O4UX 3O4JA 4Z86A 4XVCA 2UXCB 5JMOA 2JH8A 1WPGA 4FYMA 4U0JA 2WSBA 2VT6A 4KQ2A 4IF4A 2KIFA 1J0DA 4FDVA 2HHHB 1UMDA 2BGJA 2LFBA 3G5MA 4WY2A 1Z9BA 2CN1A 3KT3A 4GZLA 3KZYA 2YHSA 4IIFA 3LHFA 3LM8A 4RWEA 3SXUB 4EA7A 4DWJA 4ZN6A 1RVV1 3FIJA 4KLNA 4E5VA 4ER0A 1Q7CA 1QGUA 1V5IA 2IJLA 1K7YA 2LYCA 1JLLB 4WV3A 3P2EA 4OCZA 1E99A 1N0HA 1VQ7I 3L43A 4GU5A 4QDJA 2IBTA 5JQGF 5JYEA 1BG6A 4HVAA 2CKMA 3HXPA 3RTRA 1SPXA 3DVQX 1L4KA 1R9GA 3EMDA 3NAQA 4H35A 5FLYA 3GCXA 5DYTA 3TAXA 3R3HA 1UCRA 3VM6A 4LIUA 3TOSA 1I7LA 1U2WA 4MKIA 4MVCA 4ZHQB 5ELXA 1JWAB 3C2GA 2I66A 4LOAA 3WLAA 1K2WA 1P1CA 5C8ZA 3WU1B 1EK5A 3FFXA 4WXHA 3RHFA 5EP2A 3I6MA 2I4NA 3IAS6 3DB2A 3NBQA 1G5FA 2FPPA 2ZXWH 2FZVA 4RCZA 3BL8A 3NKFA 4HPXB 4ZGBA 3WGJA 4FKZA 5JC8A 1AWCA 3HOSA 1HT0A 2PT7A 1T0JB 3ABLH 2P9HA 3OZWA 2RAUA 2FYTA 1NBEA 3QVJA 3MINB 2G40A 2WFAA 2Q5OA 2WAOA 1L3IA 2A7XA 4HRXA 4C4TA 2BBWA 5DM4A 4ALJA 5A7FA 3R6SA 5DGIA 3S1SA 2VQDA 1CB0A 4X24A 4CZCA 4NC9A 5H5JA 2OQVA 3JR7A 1RCTE 5SYMA 2FSFA 2HDOA 5AOVA 2GPSA 2YMPA 2Z16A 2VH5R 2V8OA 2L9NA 1E1MA 2J5KA 2ARKA 4YAKA 3D3NA 1AA9A 4HSGA 1WJDA 3TFQA 5P8WA 4BDZA 5FROA 2FXIA 1SQ5A 2QEXI 1CFJA 3GELA 3SSNA 1K6OA 4D44A 5ANRB 3U4GA 5BQOA 2X14A 5CTAA 2IEDA 3UBTA 3PJGA 5GPAA 3QVUA 4I1IA 4OXXA 4EITA 4Z2YA 1FTGA 2PBZA 5EA2A 2XKAA 1YB2A 2QQGA 3OWXA 1S0UA 2ZRJA 3UGQA 2OFOA 2WY8Q 2N1BA 3SEFA 3SX0A 2XSZD 2XGCA 3PUFA 1ODIA 1V1JA 2NT3A 2VHTA 4H7KA 3RREA 3ZQLA 1E3HA 2AE1A 2R00A 3C2BA 3R3ZA 4Z0HO 3ZE6A 1NQWA 1IRIA 4FI3C 5FH9A 3X2FA 2G7HA 2VAXA 2R93J 1MP0A 3G17A 3GVPA 1BYIA 4EHIA 2DU9A 1DADA 1M2HA 3CO7C 1OFVA 3LKDA 3UJ3X 3HBFA 5ITVA 1EI9A 2D59A 3D02A 4OH7A 5A4IS 3DE0X 5KIAA 4GC9A 3I5YA 3H5AA 1UMCA 3AEUB 2MFZA 1AXGA 4E51A 3FYHA 4ZHQA 5CBKA 1MZVA 1WL8A 2O8VA 3PQJA 3A9CA 4QBFA 3FWYA 1QB8A 1RADA 1JJIA 2ADMA 2QD2A 3MZHA 3GO4A 4MUFA 2XT9A 4KVGA 1KKMA 4HMOA 4JSYA 4O3FA 4CMKA 1SKAA 3RKQA 3U13A 3TLMA 5DM60 3M6XA 3IMGA 2FU5C 3UMGA 1PL7A 3K9CA 3HA7A 4I50A 1LJUA 1Y3BE 2PFGA 5HJ2A 2ZCVA 1RFGE 3KCQA 1WY7A 2VS1A 3SC2A 1HO3A 2RH4A 3I3OA 3S14J 1FQKA 3JS5A 1WV0A 5EF6A 2EZKA 4G26A 2DLCX 5A7GA 2R9VA 4Q1EA 4AKGA 3QVOA 3IIKA 4K9QA 3DDHA 5NLLA 2HXOA 4A12A 1NW3A 1Y1QA 1O3SA 3M8JA 2YIJA 5FWDA 3WGLA 3ZUGA 3KQPA 3KKPA 1B41A 4E3ZA 1OKRA 2R00C 5LQRA 3IRUA 1JQKA 1MX3A 2VH1A 2CXTA 3H2GA 1O9BA 4M55A 2R7VA 1M9NA 1XXHA 2Q5FA 4J0KA 5HDQA 5JNLA 2UZ4A 1TA0A 4CZ2A 4D97A 4ZI7A 1GSHA 1U9YA 2QN7A 3NTRA 4UM9B 3TLGB 4N0BA 2BMVA 2H4XA 5TX7A 1HNXB 1G5TA 3DE1X 2EILH 2WWTA 1MQSA 4DUGA 1I1GA 1RXIA 4JVSB 5H70A 1B4AA 2ZPTX 3I5UA 2Q5IA 4WZAB 1G7TA 2OLKA 1DOAA 1N7GA 1F36A 1EP3B 3B7PA 1X1PA 1BH6A 4QPDA 4NZZA 4H17A 4BKXA 4NIMA 1SVUA 2WDPA 2GJAA 3VGPA 1TIPA 5FEUA 1JJAA 4HXFB 3TDKA 4V24A 1RI1A 3F9CA 1I3OA 2CD7A 1KIFA 2BJVA 2JHFA 2ZSBA 5CFRA 4S35A 1SG6A 2HCTA 3EF3A 4NC8A 3DFUA 4F6RA 2VK4A 1JAHA 2YW9A 1T9DA 4UXIA 2C2KA 4OJYA 3UAVA 4C6TA 2W6ID 4CT5A 1G7SA 2JCVA 1AS2A 3SZPA 1VJDA 2CHGA 4R1TA 3CW2A 4XAQA 5JXIA 3ZZNA 2BY0A 4H77A