4KIGA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with 4-hydroxyphenylpyruvic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
332
structure length
332
Chain Sequence
SEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 122
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kigA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kigA02
4CYDA 4RB1A 2O03A 4QTUB 3O7WA 2E7WA 3FHZA 1JQDA 2M8EA 3DMFA 1F9NA 1USSA 3FUXA 1NW3A 2Z9OA 1W4MA 4HX7A 2HNKA 2FOKA 4F85A 1G8SA 1G3SA 4KICA 3I59A 1RJEA 3CBGA 1Z7UA 4M37A 1AQJA 3V4GA 2LNBA 3RKWA 1HW1A 3DXZA 2B2CA 4MIKA 3GW2A 4Y30A 2FEZA 3EVBA 5EHGA 1O7FA 2DBBA 2WV0A 1Z3CA 1ORIA 2BZGA 4HLXA 2VP3A 1MJBA 4M74A 1D8KA 3KQQA 5EKUA 1JQEA 3GEZA 1FLIA 1HMYA 3B7PA 3F23A 5E8JA 2H6CA 1KU9A 1HSJA 5DX0A 3DPTA 4NQWA 4QWQA 4LD5A 3DXYA 4G6QA 1QPMA 4AIKA 3NVMB 3Q9VA 1OMIA 1FNNA 2XKPA 5FADA 2KKOA 5K09A 4A0XA 2CWEA 4YUVA 4S05A 3FTCA 1X1DA 3O3KA 4IKPA 4FGZA 3QOPA 3RODA 3GXOA 3FZVA 4BHPA 1JXSA 3AY0A 5LQKA 2AOXA 2PY6A 2IA1A 10MHA 3H92A 3M6VA 3VYWA 4O5VA 1B9MA 1I27A 5CVJA 3RTRA 1B6AA 3KKZA 2NP6A 4OMZA 3SZTA 4HV6A 4RVDA 3WU0A 2W57A 2CG4A 5L3BA 3MB5A 4XCXA 1XSDA 2OZ6A 1EH7A 2IA0A 2OO3A 1ON1A 4C4AA 4ASNA 3A27A 1D8JA 1T6SA 3J81Z 4M73A 3JWGA 2EA4A 4DZRA 2EWNA 3NWEA 4ER7A 3NVKI 1Q0SA 4ZH4F 2ISZA 3KQOA 1EAMA 3TO7A 3E5XA 4G7HF 3KQSA 4RVHA 4I0AA 1SFXA 4PZJA 4A5NA 2P7IA 4RTJA 1KQ0A 3TGNA 5HOQA 5ICEA 5ERIA 3D0SA 3M33A 4U7TB 2VZ9A 3J80K 2FA5A 4IJAA 1MDMB 3RPUA 2AS0A 3U81A 4WVLA 4JQFA 1XDZA 4UXNA 4CGZA 1WXWA 2O06A 3B3GA 2STTA 5E8IA 2BR5A 5HIJA 3I9FA 4R79A 4KNYA 5GOZA 3R60A 1P6RA 1PJZA 1XSXA 1RZ4A 2ZBQA 3PB3A 5U4XA 1LNWA 2YXDA 3LECA 4M9ZA 4YUZA 1QNTA 2VN2A 2GXGA 3HVKA 2ZKZA 2KJCA 5DSXA 2AXLA 3HCDA 4YV0A 3WU1B 5F2KA 2AVDA 4EJOA 2FHPA 4MHTA 1KU2A 1ODDA 3BY6A 4FX4A 3GRZA 3LFKA 5K0BA 3M6XA 4U0VA 1KA8A 3K1PA 3OZRA 4HGYA 2OYRA 3EMDA 3RW9A 3LCUA 5G02A 4MTEA 3I59B 1GXPA 4KVZA 2PWPA 1HSTA 2XUBA 1ZH5A 1Z6TA 3T0YA 1EIZA 4AZVA 2OY0A 4IHSA 4GC9A 2H27A 1ZG5A 4AZWA 3TM4A 3FTEA 1QZYA 1U2ZA 4HZFA 3COAC 4R6WA 4CKEA 4XLPF 4PGHA 3VEPA 2JHAA 3FPHA 1XD7A 2AZTA 2XGXA 4XSXF 4AIJA 3FRHA 2K02A 4BLWA 1VLMA 1O3QA 1MJAA 2W24A 1WI9A 3OE5A 2WK1A 3FUUA 2HKXA 2MH9A 3HHGA 1ZQ9A 3TPZA 1CF7A 2BH2A 3IKTA 1K79A 1X1AA 4GOND 4NECA 4HH4A 4B17A 2AOTA 2QENA 3CGGA 5FFXA 1T2KA 5H20A 1LEBA 2UXNA 2AVNA 1RI4A 5GM1A 1OYYA 1AQIA 3H3ZA 4GGGA 2YR2A 2FRHA 5ILUA 3WTYC 2ZZKA 2P7HA 4RWZA 1SVUA 3C3PA 3ER9A 2DFIA 4PYQA 3MQ2A 3NQOA 2I7CA 3TKYA 5K5QA 4LLNA 3CDHA 4F86A 4Q5SF 2CKDA 1MJFA 1UHMA 2ESNA 2OZVA 1ZRCA 3WTSC 2GXBA 3BKWA 1AV6A 2LKPA 2MA3A 4LK1F 4RYLA 2BM9A 2VBYA 2H09A 2IBTA 5HLHA 4E2ZA 3VSEA 4XUDA 1YFLA 2PMUA 4KDCA 1FBQA 1RI2A 1X1CA 2PBIA 4HA8A 2DT5A 4QQKA 1P2FA 5J8CA 1REPC 3LKZA 4U0WA 4EMSA 2R7DA 2V9VA 2ZIEA 3BGIA 2KJBA 3KZZA 5HLGA 4JXJA 2FNAA 3JTHA 1JTFA 2JG3A 1L1EA 4PCAA 1P39A 3MAJA 3L7WA 3TQSA 3HEMA 3KPUA 3JW4A 5K01A 2ONYA 3GIWA 1HNNA 5EG5A 1KYWA 1SD4A 3ECHA 2FU4A 3KP7A 2M1BA 1DUXC 1YW8A 1FSHA 4UOEA 4UV8A 3EDPA 5EEGA 1T43A 4GOOD 4I09A 2W85A 2IDKA 1J2XA 5A2QZ 1JQ3A 5LLQA 2UYOA 4G7ZF 3V8LA 4A2UA 2QBYA 3D2LA 4MQVA 2OPBA 1FYLA 4G56A 2LF7A 4RB0A 3U1DA 4HF0A 4ENKA 3F8FA 4TV7A 3LAPA 4L9TA 1NKVA 3FPGA 4PGGA 2HV9A 2PV0A 4FT8A 5K8VA 3C6MA 3G8AA 4E2WA 3E6BA 4N0BA 1IRFA 3RPQA 2PLWA 4EJTA 4ESJA 4KN4X 1TBXA 3FWEA 1L3BA 2PI0A 5AONA 2VBWA 4HLYA 4IRHA 5CVEA 1M0EA 3SSNA 5HIMA 4A0ZA 4LJZF 5T67A 2M5WA 2NNWB 3EGEA 4MEYF 2WC2A 2NXEA 4I2OA 1FP1D 4HTFA 4LLLA 5FHQA 2P4WA 4CHUA 4Y2HA 1FT9A 3SX0A 2YTZA 3OU6A 5F6FA 2K4JA 4HG2A 1T0FA 2HFHA 2KIFA 3F3XA 4KW7A 4I98B 3HCBA 3V7RA 3MQ0A 4PNEA 1BN5A 1RI7A 2HS5A 2V79A 3J80Z 1L3LA 3TR6A 2WTEA 3IWZA 2K27A 2XAHA 1RJDA 2I62A 2RKHA 3KP2A 4LB6B 2FE3A 5FQOA 3E5UA 2LDUA 2GAUA 2HWKA 3CC8A 4RTMA 3ID6C 3M4XA 1R5HA 5JHUA 4PYNA 2XRNA 2PKWA 4PYIA 1LDJA 3ZPLA 1RI3A 5FFZA 2O07A 4RTRA 2GPYA 3GNLA 5CM2Z 2FYTA 3TDUC 2PX4A 4NB5A 3V8KA 4YV1A 4KDPA 3EGVA 3P97A 9MHTA 3H3UA 2FBIA 3FPEA 2G71A 1N7IA 5IT9Z 4GCVA 2COMA 4M71A 1R22A 3JAMK 3E5QA 5L3DA 4C07A 3MERA 3IWFA 3CLOA 5P8WA 3K2ZA 3HRUA 4EM0B 4A6DA 3FUVA 4DCGA 1J9IA 4DF3A 4HGZA 3UWPA 1PP8F 1RJFA 2N47A 2YVLA 4AD9A 5H02A 3GRUA 4ER5A 2PXXA 4RAYA 3P9NA 5K0GA 5D4RA 1XDSA 3BDDA 5CVVA 2IH4A 1B9NA 5AIQA 2B3TA 4HF2A 2IFTA 5DD4A 3MZYA 3CVOA 3EVZA 3U9GA 1R23A 3GYHX 1SAXA 5FB2A 3HRMA 4DQ2A 5KQRA 1NW5A 3ELUA 3UBTA 3B73A 3NWBA 4L18B 1EJ6A 3WGHA 3PLAE 3ULQB 3P2KA 4OQEA 4C04A 3F22A 4DMGA 4ER6A 2ERCA 1BI0A 3BJ6A 4IV0A 1WWXA 3WTUC 5CYVA 5L3FA 2XAGA 3HA7A 1RI5A 3HVJA 3ELKA 2P5KA 3NEUA 3C6KA 1IN4A 4U0YA 4FT2A 3CKKA 4KIBA 3L2CA 1KGSA 4MTLA 1OR7A 5L3GA 1MD0A 3N4MA 2QBYB 3HSEA 3TFWA 4V0QA 5CD1A 3RDIA 2HDCA 1U2WA 2IIPA 1XMKA 3SR4A 4L0ZB 3OOPA 5D5VB 1XN7A 3IHUA 2G72A 4XSZF 5BW4A 2G7HA 5DWQA 4XRFA 4AIHA 5LGTA 4HX4A 3GWZA 3C3WA 3NW9A 2G1PA 3FRIA 4LECA 4DM3A 1D2HA 3W6JB 3I71A 4KIFA 3DTNA 3E8SA 1WG8A 3EUHA 4HDVA 3R4KA 3T8TA 4YMGA 3NDIA 5FD5A 3IKVA 2KW5A 3WTXC 3VC1A 1S3JA 4LGWA 2MC3A 2P3OA 4BP3A 3KP6A 1TPYA 3TLJA 3MFKA 3BKXA 3QOWA 4ETSA 2ZW9A 1H0MA 4E31A 2RV8A 4LMYA 4EJWA 5IT3A 5D5WB 2AOVA 2ZBKA 3WSTA 1TNSA 3PX3A 4MQ4A 4EQZA 5ILSA 1KQ8A 1L9KA 3FM3A 1NV8A 1ON2A 2VBXA 4HTFB 2IDJA 2PT9A 5E17F 1G38A 4GYGA 3OFKA 4CO8A 4ZZDA 3E97A 4FZVA 1DUSA 4XLNF 2B0LA 2MBFA 1OKRA 2J5PA 4P7GA 1MDMA 3KR2A 1FJXA 1M6EX 4K6MA 1RI1A 2F8LA 4P7KA 3DFGA 1S29A 3LDFA 5KYGA 5E1OA 3UFBA 1QGPA 5FGMA 4RTPA 1PUEE 4HW0A 3FZGA 4L9JA 4M36A 5LR6A 1UIRA 3LCCA 2JHCA 4EKIA 1O7LA 2JH8A 1VP9A 4HV5A 1VTNC 3ZMDA 5DCMB 2EFJA 2JRTA 4DKJA 5LBQA 1SQGA 3L00A 4N9IA 3RKYA 4PIMA 3FM5A 4XBFA 2QYOA 3ZP5A 3ER8A 3M7GA 3I54A 1YS6A 3SMQA 4ER3A 2QQAA 3KPJA 7MHTA 3FMRA 2H1RA 3WE2A 1F38A 4L9NA 2ZCJA 2DK5A 4KN7X 2GQQA 1ZYRF 4GXOA 2KIMA 2PT6A 2YSRA 3ZMVA 3SQNA 2MLGA 4G94A 3P8ZA 1VP3A 2HGCA 3LBYA 1U5TB 4IRIA 2VDUE 2XAFA 5D8LB 3QU6A 5HLIA 1ZRFA 1ORHA 2ZNYA 4FSDA 5J8FA 3HSRA 3F6OA 2O8XA 2BE5F 2DO7A 4PIPA 1R36A 3LA7A 1UFMA 2V1XA 3FYCA 2PQ8A 4U7DA 2B9EA 1R6AA 2WWYA 3IRQA 3I5UA 4YG2F 2HYGD 2BR3A 5A2QK 1R8XA 1D2GA 4PCLA 4PINA 3IV6A 1S6LA 5ERGB 4YV2A 3K9TA 1I6XA 2O57A 1ZARA 1H9GA 1W5TA 1U78A 2A69F 5BS6A 3QU3A 1R58A 1X1BA 2ZBRA 1GXQA 4Q48A 4KDRA 1XJ5A 5FCDA 3IHTA 1AWCA 2D1VA 3F6VA 5DSTA 3MGGA 4EK9A 3GFJA 3O2PE 3GO4A 4HRAA 2ZLBA 4CTJA 3DLCA 5ICGA 3IRRA 4CWAA 2HZTA 2M45A 2IGTA 1IN5A 5D6EA 1XCLA 2EJRA 3E6MA 1C0WA 5EMJA 2HR3A 4PYOA 5E2BA 1LVAA 2EK5A 2GWRA 1KR5A 4YUXA 1I5ZA 1VIDA 2PXAA 2UYCA 2NS0A 5LEKA 3ABTA 5L3EA 4GEKA 4DA4A 2FNPA 5DM1A 2JHPA 3JAMZ 4B09A 1V3FA 1YZHA 2HKOA 1J5YA 4KYWA 4KA4A 4ATNA 5FUBA 2EFWA 5L3CA 2VT2A 2FSWA 2AN3A 3FPJA 1TLHB 4OA8A 4U7BA 2CMHA 1UCRA 2MLKA 3KEQA 5ICFA 3JSOA 3LPMA 2V1UA 1KXZA 4HQMA 3UJDA 4QVKA 2KRFA 8MHTA 2JSCA 4I02A 1J0RA 2CQKA 1RJGA 2BV6A 4PYKA 2OB1A 4KFCA 1SQFA 3K69A 2XYVA 1XGMA 3CUQB 4WF2A 1BC8C 3GRVA 1B59A 2IW5A 4OA5A 2IVMA 3BP8A 1AOYA 1UB9A 3GU3A 5K5RA 2X0LA 1NE2A 1ZHFA 5E9QA 1KPIA 5E8GA 1JTEA 3EYYA 3ERCA 3DXJF 1O54A 1ZAOA 1XGNA 2VC1A 1JR4A 5EZSA 3LX6A 3SGLA 5IT9K 3CTAA 3WG9A 4HC4A 3V8VA 2P6SA 3Q9SA 4YFXF 3KQVA 2DW4A 3KHKA 2OD5A 3GRYA 3GGDA 3ORHA 5F2NA 2Z99A 3G5TA 1JSXA 5BP7A 4KMFA 2FK7A 5JVTA 2NYXA 3DLIA 3FF5A 3K0BA 4EGYA 5LQRA 4GO1A 1QQIA 3DP7A 4P96A 4MNUA 5F1RA 5E1BA 1IZ1A 5DPMA 2ETHA 3KP4A 4HX8A 2IPQX 4E2XA 3GO5A 5T64A 2DI3A 2XVMA 3HM2A 2QE6A 3GX4X 3EEYA 4RTKA 3FXUA 2EV5A 3P9IA 1YB2A 3LWFA 1DDNA 1UHWA 2ZMEA 4R6XA 3G7UA 1SD6A 2OZUA 2ZNZA 1KYZA 3E7PA 4R8SA 3DQVC 2G9WA 2L01A 1PRYA 1R8YA 2AN4A 2EFNA 3ZN1A 2O61A 1ONVA 3KQMA 3LAJA 5EHIA 3KLNA 1JE8A 2ONZA 1QAOA 3DPLC 1YTYA 1NV9A 3EVFA 4BHCA 2Y0MA 2R6ZA 5EEHA 1B42A 3NRVA 4H0EA 1BJAA 5HDKA 1GHCA 2A6EF 4BHBA 1YO5C 2ZIGA 4IHTA 4KMUX 3B5IA 1YFHA 3OU7A 4QPNA 5E1DA 4QDKA 3LKDA 5LSAA 4CTKA 3ISPA 2XAJA 2HMYB 3TO6A 3ELDA 2ZTHA 2R7FA 4KWCA 4OBWA 3A26A 3GJYA 4HDUA 1F5TA 1PDNC 2PJPA 5E2AA 2TDXA 4A12A 3JTGA 3FTDA 2IH2A 1U5TC 2BGCA 3QV2A 1R5GA 4ON0A 3Q5FA 2WA2A 3M1EA 4U88A 1TQIA 4A6EA 3EVDA 2E1CA 4G7OF 4BLUA 2IRFG 3LBFA 4B8XA 5CUQA 1LJ9A 4PYLA 5K0NA 1Y0UA 1IXRC 4NHJA 2HR1A 1V4RA 4R8RA 3ZMZA 3R6TA 3DMHA 4BYYA 5J6XA 2KIUA 5DEQA 3LDUA 3CJNA 2YPRA 3AAFA 4BXUA 4LWPA 2DPDA 5LHGA 2NNNA 5BQTA 1P92A 5FWDA 3B02A 3SFZA 3MEXA 4I01A 3K1NA 3F4KA 3WE3A 2ORED 5LQAA 2F5CA 5FLXZ 4X41A 5EVJA 3RIRA 3V7SA 3WODF 1XSVA 2Y1XA 4L7VA 2HQRA 1R74A 2BYVE 4YUWA 4I0BA 1IUYA 2UYHA 5CJ9A 4RGRA 5K0FA 1FBSA 4MTDA 2GA9A 4OIPF 3EVGA 3GCZA 3RIEA 5D6FA 4IRGA 3BGDA 2K4BA 1I1NA 5BXYA 4A0YA 1P91A 5TRDA 5HIKA 2VONA 4AX8A 2BM8A 3HYIA 2GIVA 1HW2A 5DRYA 5C1IA 2ZULA 4L5IA 3V7CA 2D2WA 3KZYA 3DXXA 2A6HF 3DH0A 4MGRA 2I9KA 1BM9A 5DD8A 5LQJA 1G6Q1 4OU0A 2VOOA 5E1ZB 2H00A 2I6GA 1LDKB 2DQLA 4IVNA 3F8NA 4IF4A 1NW6A 5K03A 3DR5A 5K5OA 2OU2A 1RUNA 2UZ4A 4P7FA 3T1BA 3P9KA 4F7ZA 4M72A 1G3WA 2IA2A 4GC5A 2A3SA 2ZMEB 2CW0F 3WTTC 1G4DA 5D5UB 5JFRA 1DPUA 2P7CB 1BI1A 5M5BA 5LQCA 2QUFA 4LG0B 2QRVA 3T5XA 3TQNA 3T7RA 3NDJA 1BOOA 2Q2EA 3P9CA 5DTMA 1BIAA 3GDHA 1W7PB 3JWHA 1L3CA 2XASA 1M6YA 4YIIA 3CUQC 4LB5A 4GF5A 5FQNA 2DULA 3OCJA 2CO5A 1QBJA 5C0OE 4HAMA 5CVDA 3M8EA 5GP1A 1JG2A 1ZLJA 1R7JA 1O57A 2L4MA 3I58A 1O3RA 5KK1A 1VQ1A 3WGGA 2V1DA 4D0PA 3KE2A 3FX3A 4IV8A 5DCMA 3KETA 1XCVA 2B78A 3TMAA 2L02A 3BPVA 3G73A 1HQCA 5LQUA 2C7PA 2STWA 1OYWA 3M6WA 1DCTA 2IBSA 2A5YB 5D8KB 4Q4ZF 5GM2A 2VXZA 3TM5A 2D45A 4DCMA 1Z05A 4MWZA 4FT4A 4QPPA 1HXDA 2QM3A 1V39A 2P3LA 3TOBA 5FO5A 1YS7A 3LDGA 1TW3A 2PMHA 3ZMTA 5CVRA 4ZYEA 5GIPE 1WSUA 2P8JA 2PX8A 1G55A 3LL7A 2BBYA 2XKOA 5FA8A 2ZXJA 1U5TA 2C7RA 3T0IA 2O0YA 1IN6A 5ICCA 2CMGA 5DT2A 1BC5A 1TQPA 5HS7A 1KU3A 2P5LC 4I7HA 2F5EA 2DQRA 3I64A 2XVAA 4KRGA 5C9ZA 1Z91A 3AWIA 5EMMA 4L9VA 1FY7A 3OU2A 2M87A 3WTZA 1LB2A 4PCQA 2P40A 3C1DA 3MTEA 2ZWAA 1SFEA 2P7VB 4R1HA 4FSXA 3MCZA 4QDJA 1VL5A 4HSGA 3NJRA 5EQJB 2VDWA 2ADUA 4BQAA 2P41A 3T7SA 2M30A 5BPDA 5IKMA 3IYLW 4WCGA 4M6YA 2Z3YA 3Q87B 4R05A 5IH3A 1IXKA 2HTJA 3LHDA 1O9HA 3CUOA 1STZA 4EJUA 1NW7A 1QANA 1TW2A 5MHTA 2K4MA 1T98A 2HEOA 3FUWA 1IW7F 3TOAA 2ELHA 5EKXA 4UVAA 3BUSA 4G9YA 4BY9E 3HA3A 4RTNA 2DTRA 3HA5A 1QZZA 1LDDA 3MTIA 2EV6A 4E32A 1EH8A 1JG3A 1HW5A 1VE3A 3R24A 4ENJA 3KR1A 4EVIA 1Q0TA 2NNYA 1P1CA 3EMBA 4UUVA 1JG4A 1UWVA 4CDGA 2FQ3A 4X1OA 3RYRA 2ZWVA 3T7TA 1XVAA 3BJAA 3KU1A 1E2XA 2HOEA 3G5LA 5CIYA 3KR9A 5BPIA 5HEKA 5CCXA 2J5OA 1OPCA 4U7PB 2WA1A 1P4AA 1ZG3A 2FK8A 1TTYA 2MH2A 2XBMA 1A04A 2QRVB 1BI3A 2GZWA 3QAHA 5E1XA 1QO0D 4FHTA 3J7AO 1H1DA 5CVIA 3AXTA 3PFHA 1YZ3A 2OQGA 2JTVA 3HCCA 2RNJA 1O3TA 2F5DA 1HBXG 4UV9A 2OAZA 5D1NA 3T8RA 5KVRA 4GOMD 1WY7A 2V74B 3ANXA 3CUQA 3OZTA 3HTSB 1F3LA 3HUGA 3AXSA 1UFKA 3BROA 1TNTA 4IPAA 2C7QA 2QVOA 3K6RA 4EV0A 2EFQA 1QAQA 2DK8A 2QLZA 3P7NA 3OZSA 3MZHA 5EIWA 3MHTA 1IN7A 2FRXA 4OINF 2RVCA 1X3UA 3G2MA 3HVHA 1FP2A 4ZZLA 4HQEA 1S7OA 3TOSA 4WK8F 3HTUA 5HIIA 2HWVA 2ZCWA 4MEXF 2W84A 3BPXA 4RVFA 3NMUF 1U6GA 1SD7A 3NTVA 3OE4A 2VE9A 4PONA 4P58A 1FPQA 2HQNA 4DNCA 1ZGJA 3WGIA 4L0YB 3BWCA 2NP7A 5GWXA 4HYEA 1L3IA 2PJDA 2GS9A 1WXXA 3GVAA 2AOUA 3G89A 2B25A 2G7UA 2OKCA 5FHRA 2HYFA 2YXEA 3I4PA 1S8NA 2O05A 4OBXA 5EMKA 2JPBA 3HIFA 1WQ2A 3BWMA 3LGAA 4RTOA 1YFJA 1YQAA 3DOUA 2VE8A 5EOVA 2RGVA 5FLXK 3OFJA 1MJ9A 1BBYA 3GRRA 3DULA 1YUBA 3U2RA 1ZREA 3Q7EA 3VOEA 1XMAA 2L54A 2OQRA 4LLGF 2PEXA 1G3YA 1O3SA 2A61A 1XXLA 5FA5A 3WTWC 5DXAA 4BP1A 1E17A 3P71T 3EPPA 3A4TA 3C0KA 5HDGA 3DEUA 4YFNF 3PQJA 3HSFA 4CXFA 5GIOE 4M38A 3SXJA 5JR3A 1YYVA 5LHHA 3EYIA 5E9WA 5E1WA 4R8HA 4EJVA 2GA2A 3BZBA 3KR0A 2CSOA 4KT5C 3RJPA 2NXNA 4Y15A 4WXHA 5D1HA 5H6RA 2A68F 2VC0A 4M9SA 1N2XA 1OR8A 2GLUA 2FPOA 3BWYA 2GB4A 3V8JA 1MHTA 2ZZMA 1KIAA 1JSZA 5HZMA 2O3FA 4AWXB 3TKAA 1KP9A 4PYMA 5DLYA 3F21A 2P6TA 3GF2A 1EH6A 4IWNA 3TRKA 4N9HA 4H0NA 3BWGA 4RVGA 3EVEA 4WX9A 3ML6A 4OMYA 3LCVB 3X0DA 1G60A 5HOOA 5E8RA 2IH5A 1N7JA 5EPEA 4CKCA 3JWIA 1JHHA 3KPVA 1F1ZA 1USTA 3WTVC 4O29A 2QY6A 3JSPA 3PT9A 1W7PD 4EKGA 4AZSA 5E18F 3BJOA 4UHTA 2C7OA 3QPHA 1ZGAA 5DUKA 2EJUA 2NXCA 1JHFA 5ILVA 5B1SA 5T6BA 1VPTA 2O0LA 3S68A 1GVJA 1FSEA 2GH1A 4JBAA 1K78B 3M70A 2ISYA 3SVZA 5K1YA 1BI2A 3ECOA 2P35A 5HILA 2EX4A 4LFUA 1EQAA 1XCJA 2QQ9A 2V7EA 3QOXA 4FP9A 2YX7A 2F2EA 1IM8A 3SM3A 3E23A 2OB2A 2ADMA 3F8MA 1G6NA 3ELWA 3BT7A 2YR0A 2Q8KA 1JG1A 2FMLA 3FMQA 2NAZA 5LHIA 2EB7A 1I9GA 5K0CA 3G2QA 3KQTA 2XYRA 5TJJA 3M6UA 2V6CA 1JGSA 5HDNA 3GFLA 4P55A 5HVQC 5CCBA 4GYIA 2RN7A 1J59A 1ZLKA 3PFIA 2AS5F 1VBFA 3FXRA 1FZPB 2NXJA 5EC8A 1DP7P 2G70A 2AOUB 2PG4A 2VODA 3E05A 4KIGA 3B3JA 3VC2A 1HKSA 1IF1A 3VODA 1YW7A 2AN5A 3G88A 4POOA 1ZN2A 1K6OA 5KS2A 1CGPA 3F8CA 3R3HA 2FMYA 1X19A 3SZPA 1O9GA 2YX4A 5FD6A 2H11A 2XYQA 3K1MA 2ACJA 2JH9A 3UJAA 5DM2A 2ZZNA 5K0LA 5HS9A 4LG0A 3UA4A 1KPHA 2K7LA 1EG2A 1DL5A 5DCFA 2HTEA 1W7PA 2Y48A 3FMSA 3I0TA 1Q1HA 3CO7C 1B4AA 2NRAC 2UZKA 4QVGA 2Y1WA 4M7RA 3W6KB 2FCAA 3KQPA 1ULYA 1WKMA 1R1TA 1FWZA 2P5VA 4RTQA 3L09A 2Z33A 3KP5A 1R18A 1SG9A 5DXJA 1YLFA 2ZJ2A 3UJ8A 3I53A 2YX1A 3A7EA 3HTXA 2UWMA 4RTSA 2BR4A 3S2WA 3GZ5A 5DDGA 1BOAA 3KP3A 3R0AA 3R6SA 5D5XB 2UXXA 1ZKDA 1J75A 3F8BA 2RQPA 3CCFA 1D5VA 4Q47A 6PAXA 2PX5A 4LWOA 4BLVA 1Y8CA 3FUTA 1MZBA 3FYDA 1EV7A 2OBPA 1J7KA 3G8BA 5DV5A 3EVAA 1MKMA 2W25A 3UZUA 3QP6A 3BXOA 1LQ1A 2JPCA 2JZYA 3ZMUA 2E5WA 2GAFA 3DMGA 2PXCA 2G8NA 2OXTA 1FBUA 4ZYHA 3THRA 4BAYA 1NW8A 5DTQA 3PS9A 3P2EA 2A07F 3HCFA 4RGXA 5DYMA 4XUCA 2ZIFA 3QRFF 4YUYA 1SUSA 4E33A 3ABUA 4PWYA 5DX8A 2DPMA 2FBKA 2L4AA 3KEOA 1KPGA 1FC3A 4HF1A 5EMLA 2FXAA 4Y13A 2C6YA 2IP2A 2HTSA 3EETA 5D4SA 3EQLF 1AF7A 3UJ9A 2QWWA 3D5LA 3GFIA 4FR0A 3THSA 3HCAA 1I1GA 2VDVE 5F2OA 2QZ8A 2YXLA 1S7AA 5DM4A 5BOXA 2PFBA 4P9UA 3EGIA 1P4XA 4OIRF 4PYJA 1SD5A 1P4WA 2XIGA 2EFPA 2H6BA 1WS6A 4AZTA 2IJLA 1P1BA 3MCTA 4E2YA 2BEOA 1ZG1A 3PVCA 1BIBA 3REOA 5LQNA 3P2IA 3G2PA 2YUIA 2EJTA 4CZZA 4QTTB 2RC4A 3KPWA 3SSOA 1YF3A 1XGOA 4RV9A 1IXCA 3DF8A 3R0JA 4X61A 3QPTA 3ROUA 2VT3A 4MHGA 4UVBA 2O6GE 3FPFA 4OIQF 3GLXA 4ZTBA 2DAOA 5GINE 4RX1A 1R1VA 3KCCA 4IXAA 2Z6QA 5FTWA 1SUIA 1YG2A 4ISCA 3KQWA 2LF8A 5LGUA 3R0QA 2CFXA 1SMYF 4O6JA 5K0JA 1SFUA 1XB4A 1ZRDA 3EVCA 2MD5A 2PN6A 3RKXA 1G8AA 4P5OA 1BC7C 4V0RA 3E6DA 4WXDA 1H9TA 5JI6A 3ZN0A 2JT1A 2PBFA 4XUEA 3GZ6A 2EA2A 3PX2A 1WZNA 3KQYA 2VBZA 3F72A 2Z6UA 3DKWA 4GOLD 4RB2C 4RGUA 3HP7A 2LD4A 4GBED 2X4HA 4ZYGA 2PX2A 4FX0A 3C7JA 3E3VA 1U3EM 5JUWA 3R61A 5FULA 2P1DA 5CLSA 3TDZC 1I1SA 3O31A 5KVAA 1IAWA 2ZFWA 4CXMA 1NT2A 4Y17A 2PWYA 5FWAA 1OYIA 1WRJA 1LEAA 3PQKA 2CYYA 3SSMA 2Y75A 1CF7B 2PGXA 3LA3A 1XDUA 1KHHA 4OX9Y 5E1MA 3PTAA 3C18A 3HRTA 3HOTA 3EEOA 3TO9A 4CICA 2L3DA 2AOTB 4AUKA 4A5MA 5ED4A 3B3FA 4E70A 4QLCU 3H2BA 2ZFUA 3M9AA 4ER0A 1KQ9A 5E9JA 1FYMA 2P3QA 1FX7A 3DUWA 2Z6AA 2ESHA 3MAGA 3KFWX 4YIFA 3RYPA 3B89A 1MGTA 1L0OC 5CVUA 4C03A 1I4WA 4OQDA 3MWMA 3VFZA 3SXYA 2NYUA 1D3YA 3E6CC 3J81K 4CKBA 2EV0A 4PDKA 3GFMA 1T39A 3A7DA 4EM2A 4HBLA 2ZO4A 5LEJA 1BHJA 1W5SA 3HCEA 3HOSA 2EG5A 5DM0A 1HKQA 5F64A 4UVCA 1RUOA 3BGVA 4FS8A 1TQMA 3DV8A 3O6BB 5DUIA 1T38A 4RSRA 1EJ0A 2QQBA 1IXSB 4X60A 4P9FA 2FBHA 3R9XB 4YMHA 3ELYA 1NBIA 3OPNA 5EZQA 2EFOA 1Z9CA 1NBHA 4EQQA 3QP5A 1BKYA 4RB3C 2GA1A 4QQNA 2YQZA 3IEIA 1Z1DA 4KUMA 4RS8A 3UA3A 3BWBA 3KLOA 4EGZA 2Z5UA 1IY9A 4C05A 4E30A 2OA4A 2IT0A 3RI4A 1XCBA 3LQRA 3HNRA 5EIFA 2ZBPA 3HHHA 1IRGA 3LSTA 3AJDA 4P7JA 3ME5A 4Z2YA 4OOIA 3KPYA 1YIOA 4S04A 1F4KA 1QAMA 2RDPA 2PSSA 3HVIA 5LGNA 4WWCA 3FTFA 2XHKA 1Z6RA 1KU7A 3ERED 2VS1A 4MQ9F 2Q41A 3PFGA 5HS8A 3FXQA 1YW9A 2XVCA 2Q0OA 5BMZA 4DQ0A 3IL2A 5AIPA 4C06A 3LA2A 1XTPA 3CO6C 3BZ6A 3CJQA 3ZMSA 1SMTA 2E7XA 1QYRA 5LRRA 4K2EA 5DTRA 2E1NA 4L5JA 4LK0F 1IN8A 2R3SA 2JJQA 3OV8A 2AOWA 4ENMA 3UJBA 2DLLA 3C3YA 4GQBA 4GUAA 5DRTA 1R1UA 1B1BA 3BOQA 3K0LA 1XGSA 3V97A 3N97A 5E20A 1FBNA 3GUDA 4LG1A 2F5FA 2XROA 2H94A 3G2OA 3ZQ7A 2ZVJA 4BNCA 2XAQA 4YFKF 5KQSA 4JK1X 3G3ZA 2YU3A 2A14A 1FYKA 1FOKA 4G6DA 4M6XA 3UJ6A 3LQQA 3HRSA 4AVPA 4EM1A 4RAZA 2FF4A 2P8TA 2DPUA 3UJ7A 4G8XA 4RGSA 5LRSA 4OIOF 3JWJA 4ZYDA 4C08A 2CGPA 1K78A 3CJRA 2K86A 3CJTA 1INLA 4UNOA 4HOBA 2AR0A 3L8DA 4F84A 2UYQA 5BW5A 2VOPA 3A25A 3O4FA 1D2CA 2CL5A 1R00A 4WXCA 4RTLA 3VB2A 1HKTA 1SKMA 1RNLA 4BH9A 2PLYA 2OBFA 2XV4S 4ENNA 5EGSA 1DPRA 1G3TA 1RIOH 5H6QA 2D1HA 2IPXA 4X63A 5K0EA 5HFJA 1PP7U 1NHAA 1U8RA 1K7AA 2ZSUA 3SHFA 4ESFA 3UJCA 5DX1A 2CWWA 4ESBA 4M9XA 3M8FA 3L9FA 4O3MA 2ESRA 5K05A 2DU9A 2PVCA 2LSOA 3IC7A
chains in the Genus database with same CATH superfamily
4GG1A 3FHZA 4MRMA 2H92A 1A82A 4JZYA 1I1OA 1UC9A 2Z9OA 1E3PA 1IJEA 4XIDA 2Z1NA 3QVKA 4BQOA 2ZXFA 4BGVA 1GRNA 2LBFA 1M5TA 3WRVA 5JC1A 4N40A 4RFSA 2DBBA 2H54A 4YJFB 1SZJG 4MOWA 3RVQA 2VP3A 3D4LA 4II7A 3CCMI 3KZIC 4GYKA 3LSRA 1OXMA 2WTBA 3B48A 4RC9A 3NKFA 2NVTJ 3JAWA 2VDQB 1N9KA 1T2AA 3T7KA 4IKPA 4UEQA 3FIJA 4O1MA 3ZDRA 1GM5A 4BU2A 1D9ZA 5C4XJ 3R77A 4UQPA 3NHAA 1UT6A 1N7HA 5F4BA 3ESCA 1XYVA 3KKZA 5I4KA 2B82A 3QUAA 2E19A 2G1AA 1U9ZA 1Z0AA 5KSYA 3UXHA 4XCXA 1XSDA 3VU9B 3NO4A 1QRUA 1ZONA 2QJWA 4LXIA 1KKLA 4Z9YA 1L7RA 2MC4A 5BWLA 4IKFA 3VR2D 3KQOA 3VGJA 2JFVA 1QG4A 2VJYA 5IK2D 3M33A 1ZA2A 1HG0A 1UMCB 2Z8YA 3GT3A 3DMDA 1MVLA 2X8JA 3RANA 2QK4A 3Q0UA 3RCOA 4JXKA 3ND8A 4Z6YA 4OHZA 3HO1A 2BR5A 5ALEA 3Q0IA 4YS6A 1P9NA 4POAA 3EUEA 4UPEA 4H60A 4EHKA 2FQ1A 3O82A 1WCV1 1UJ5A 2GXGA 3FKSD 3COWA 1LQUA 2ISQA 2R5ZB 5BPHA 3Q9LA 5I5EA 2LY9A 2F3UA 3U4CA 1PZMA 3OTOB 5ESRA 2FEXA 1MAVA 3EDYA 3AJAA 5A1JA 3P2JA 1OH6A 2W6QA 1MBGA 1Z6TA 3F9RA 4N12A 4GC9A 2IOFA 1M8JA 1VMDA 3H16A 3PCTA 2FY8A 2WF5A 1I7NA 3IBFA 2NUTB 3Q88A 3FPHA 1A9TA 3FRHA 4EG4A 5HS6A 3QXCA 3L07A 3UR3C 5K99A 1CF7A 1E2NA 3A1DA 4U4AA 3H2ZA 5MFZA 2QVBA 1W76A 3IESA 4DADA 1MC8A 1PR0A 1WUYA 3VJRA 4LGVA 1LEBA 2BFOA 1XTBA 1QYCA 3L1UA 1ZGZA 4PQEA 3O95A 1XJQA 1P5JA 3PUIA 4Q4JB 3CDHA 3NC0C 3CVUA 5C5EA 1UZLA 4PO1A 3ZDDA 1FSSA 3JYOA 1K6IA 1SC1A 1TTTA 4MRSA 3BK7A 3E2IA 1RM4A 4DQUA 4KDCA 2JFGA 1E92A 3N87A 2IHVA 4XARA 3SEFA 3V2HA 2PX6A 1REPC 4U0WA 1BW9B 3JTHA 1RU3A 3TZ6A 4A3LJ 3EIXA 1PS0A 3OZEA 3ZE1B 5HFNA 4E7SA 3A6GA 2WPNA 5FLEX 1ODCA 5HNFA 2QNRA 4J07A 3PLRA 1XJWA 5F3WB 4RKWA 2Y93A 2HIGA 1J9GA 3MTAA 3VAYA 5JNVA 3WLIA 4MVJE 4KYIB 4DIKA 3OFNA 3LAPA 4ME6A 1NKVA 4O33A 1U9NA 3KAKA 4XTCS 3OHPA 5FR1A 4E5YA 4KV9A 3P52A 1DJQA 2Z2XA 2PKQO 1OISA 2QUBA 1LBSA 5CVEA 3GFQA 4GZLA 1LFBA 2M5WA 2W6PA 2NNWB 4I2OA 2IU4A 1K6EA 2EARA 2P4WA 1CP3A 1EDZA 1T0PA 1JDNA 3ZQCA 2WIGA 2EZHA 5GONB 1U7UA 2Q7DA 4C01A 3PPIA 2DBZA 4YI5A 1U4SA 4WJLA 4PNEA 3D81A 3J80Z 3P5BA 3HY6A 3K16A 4MV6A 4ML3A 4HX5A 4HAIA 5FQOA 1XZEA 4MVJD 2QPOA 3ID6C 1YAHA 1ZNZA 1A9RA 4V1CA 3HKZA 5CK4A 4D97A 4X0EA 2Y92A 2X0EA 3C1TA 2FW9A 1LQ2A 5B3JA 3BICA 3K4NA 4M71A 5EZ5A 2DAPA 1C2TA 1ULSA 5AM5A 1P0CA 1NVKA 1PP8F 2AB0A 1MZVA 4F2PA 1ORTA 3BDDA 3FNQA 5FYDA 1FX0A 2XC7A 1YJBA 4OQMA 5DD4A 4J19A 3RYHB 1M1EB 2XXAB 1Z15A 2ADFA 3H3XA 3OCWA 5NULA 4DRYA 5IUNC 3IV9A 4AXBA 2AZ4A 1BI0A 2IKSA 2A58A 3L4EA 4HDSB 3NDBB 1NJ2A 4ZHQA 1IN4A 4I9FA 4DDTA 1NOJA 5D5VB 2HQ5A 4B4WA 2G7HA 3L3BA 3DT9A 4Q3NA 1JIJA 3WFIA 5AIAA 4AICA 1Z0JA 3IKVA 3WBJA 4H7FA 2HBQA 3FUCA 3FVWA 3GHYA 3WWPA 2GBFA 2H2IA 2O2JA 4JA0A 1IOVA 4JNCA 4KT6A 4QLAA 3E81A 3PX3A 2NPFA 3R40A 4IUDS 4OSOA 3GFPA 1NTCA 1PV1A 1Z34A 3AERA 4MA4A 4CEJA 5HF9A 4Y2TA 3FOZA 4RVCA 1RI1A 4P7KA 2C31A 3RRXA 4PG4A 4ZI2A 4QFDA 4WOPA 3NV7A 1X8LA 2UYGA 4N6NA 3K6SB 3LDHA 1AKHA 2MT9A 4BMOB 1NVXQ 1UBCA 3KD2A 1SQGA 2FRDC 1VG0B 1BN6A 2LCFA 1T0BA 1Z75A 1CK4A 5LLDA 2CJPA 4M55A 3RTBA 3O74A 4G1MB 2MLGA 2ZT5A 4B0OA 1G8HA 3P8ZA 1OZ0A 2ZBEA 2OD7A 2VQLA 5ULLA 5B5SA 2UUZA 4U8HA 3R75A 1ORHA 3R8XA 3HEBA 3HSRA 2WU1A 3KYJB 1L8OA 1SRRA 1WW8A 3HYCA 1NUSA 3DZ8A 2FHSA 1QU2A 4Z3DA 1KDZA 3HHPA 1TAGA 1TDJA 3I2IA 4A5SA 4OB7A 2HYGD 1CR4A 1I33A 5DHRA 4LJ4A 1ZCAA 2B63J 1THMA 1FP4B 3IP7A 4YP7A 5LA6A 4MVJF 2FUNB 5AOBA 1T36A 4HVLA 2CF6A 3ZXYA 5FI3A 2XXJA 4B32A 4MV9A 3LW8A 1FFHA 4OHYA 3I56I 1PEKE 3T34A 3FMIA 4O4LF 1KR5A 4JWTA 1Y9ZA 2OD9A 4KPYA 1NRIA 3C7KA 2DQKA 5FBLB 2RBKA 1GARA 5L6LB 2Y9PB 5AXBA 4NYIR 5FUBA 1BXRA 4KE7A 1RMYA 2X0KA 3FPJA 3D6AA 4U7BA 1FTTA 5H9WA 2II6A 1B00A 3H5LA 3UJDA 5AVWA 2ZI5A 3HYNA 3PSFA 1R6BX 1CETA 3I9NA 4R69A 1SQFA 5JJCA 2B6HA 1H69A 4WF2A 4F71A 1ZC3A 4YALA 1NDQA 2KLBA 1AOYA 4EX6A 1IBKB 2QMOA 2PUWA 4CM9D 3C48A 3OR1C 3KXKA 3M9XA 3K20A 2ZTLA 2G5TA 2BMWA 1JR4A 3VPDA 2YH2A 5DLPA 3KHKA 3GRYA 3USES 2Z99A 5CB4B 5IVPA 2VHVA 4UEWA 3PC8A 4WADA 1E77A 2WSIA 4LMRA 2XVXA 1ZOOA 1B2LA 1LTHR 5AJWA 1PG0A 3K09A 4X3CA 5J1TB 4X6XA 4XWGA 2EV5A 3S15J 1NFFA 1MU0A 1NU6A 1TRHA 2VJ4A 2E82A 4LN1A 2OZUA 3RJMA 2JA1A 2CUNA 2ZYHA 2AN4A 5DASA 1BQEA 1SB8A 4WXPA 4MI3A 2C58A 1HORA 3DPLC 1B6SA 1G21A 5C2JB 4ZC8A 1I2AA 3P32A 5EEHA 1T3GA 4H0EA 1I3NA 5D51S 2XJ9A 2QAIA 3HJUA 3KZ1E 4KLZA 1OPXA 1VHWA 5CEFA 5BRJA 2CUTA 4N76A 1HE3A 1E59A 2NTVA 2GXQA 3QFFA 2AJTA 3BE5A 2W9XA 3C2QA 3ELDA 4N6OA 4CMEA 2DBVO 3FTDA 3EFOB 3EXAA 4NS4A 1P77A 3Q5FA 3N70A 3TTUA 4L8YA 2IRFG 2WAEA 5I4BA 4R2MA 4Q7LA 2PUFA 3ROQA 4IPTA 1XDDA 4WTOA 1P92A 1WW3A 1LC3A 2VCHA 3WE3A 3ZWOA 1PR9A 2QAJA 3HBFA 2IELA 4AX4A 2HQRA 3F1KA 4INPA 4MK4A 3WLMA 1MQSA 1Q84A 3OY7A 3EQ6A 1E5LA 3CZ6A 3QY9A 2GA9A 1W48A 1JXAA 2H7YA 1YIDA 3LM8A 5LZ4A 4Z9AA 2FI1A 4HEA6 4XSGA 1GKLA 3DH0A 1E2IA 5DCUA 1TJ3A 2R6DA 3FN4A 3V00A 2UZ4A 4P7FA 4X44A 4YK7A 2VIIA 4Z51A 2UZAA 3PQCA 2ZMEB 1H9CA 3RF6A 4LGCA 1NF9A 4D3YA 3HA2A 4IDFA 1TVKA 3UAGA 3UH0A 4DHEA 1W2HA 3KYDA 5A7GA 2J5QA 2PZGA 3ABRB 4OQ4A 4C3IJ 2YHAA 2L4MA 3Q0EA 1NJSA 2B78A 3NHKA 1HQCA 2HK6A 1XVUA 3H5IA 3K6JA 3EIFA 3HOZJ 2D45A 4DCMA 1CS0A 3DUFB 4ZDKA 1M2WA 1V39A 3TOBA 1U1GA 3ZMTA 3PJEA 2DUNA 4DMCA 3RC1A 3LL7A 4FKMA 1FSFA 4E3ZA 1Y8AA 4DSAA 1GQQA 1BC5A 1TQPA 5I7EA 2GD6A 1A5JA 5C81A 3X43A 4EFDA 1CP2A 4OMCA 2M87A 4PHGA 3I9V6 4FGKA 3W3AH 1RWBA 3CFYA 4LOIA 4EJ0A 1MW7A 4ZV9A 5F5NA 4P93A 5BSHA 2VEOA 2NVWA 3L9WA 5HODA 2HTJA 4BL0B 4YQFA 1CUEA 1HLDA 1NW7A 1TW2A 1VJDA 3PNSA 2QSHX 3ETJA 2LFBA 5JDIC 4RTNA 2IZ0A 3UTDA 4AF6A 3OZIA 621PA 2ZVPX 4AU1A 5D3KA 5IY5H 1NMEA 3OZVA 4MKHA 1N1GA 2YASA 3T7TA 4HRXA 2OK8A 2PL5A 4IHVA 3G49A 1QHIA 1ILWA 1VJTA 2YV5A 3DLAA 4EY7A 4DIDA 1E3EA 4IJKA 2A33A 3V8MA 4AZ3B 1NMXA 1A04A 5E1XA 4YP1A 1H1DA 1EFPA 3ZS8A 2WE7A 3KYCA 2QRNA 3QFTA 1NNEA 1M1YA 1VYTA 3E7LA 1FVHA 4KXWA 3GCXA 4LE1A 4BJ5C 3ZCRA 1XVTA 4XWOA 2Y69H 2DK8A 1C0PA 1UZMA 5DYTA 4U1RA 1UFQA 2HZBA 2QI9C 2RVCA 1D2MA 3ELBA 1FP2A 4HQOA 4IQ0A 1OH7A 2O4UX 5I7RA 1U6GA 3HCNA 3ECAA 2HU2A 4ILKA 4AB1A 4C5AA 6REQB 1V6AA 4MEAA 2PQ0A 3GVAA 3B2NA 1HWYA 1HZZA 4UBIA 2OM6A 1ZOPA 3CVYA 4HATA 4QXRA 1VMAA 5AW9A 3KX2A 2F2TA 1W0KA 1P7VA 1UOQA 4RQAA 4EA8A 4AJ1A 1BBYA 3H18A 1XNJA 2WWIA 3GRRA 3Q7EA 3VOEA 3CE9A 1XMAA 3H7IA 3OTQA 1J8VA 3MFQA 3F6CA 2XLBA 4HFNA 4PWZA 5H9VA 1OLSA 4ND8A 1X70A 1YACA 2M9MA 2E1RA 4I6JA 5JY6A 5FLMJ 4CL3A 4B85A 2VPYA 2V26A 1P3Y1 4AURA 1NC1A 4JJFA 3B9QA 1GUUA 3I5AA 1WLSA 3RU9A 1QR6A 5BVHB 4F1JA 3SQWA 1SVNA 1XLTA 1G5PA 4Y33A 1G60A 4HDMA 3GCWA 5K8JB 2C4KA 1Q0LA 4YR7A 2BUCA 6Q21A 1KMNA 3WYBA 3CRZA 3KUDA 4OLJA 3QPHA 1ZGAA 5EXDA 2A35A 3DR3A 1Z4QA 4LE0A 3DKXA 1O97C 1K78B 3Q5EA 2ISYA 3CLUC 5FL7A 2G6TA 4WKNA 2YX7A 4C7XA 1F36A 4A1OA 2EP5A 4OQZA 4UBKA 3X2FA 1S1CA 1ZAYA 5LHIA 5DLEA 5KVQA 2V3CC 4U3JA 3GFLA 2QJRA 2ON6A 5CCBA 3SQOA 2FD5A 1NA5A 1OWNA 3G1LA 1BKDR 2VODA 3GUVA 4KIGA 3PUFA 1Q17A 1Y1VJ 2V59A 1YCGA 4F9EA 5DV9A 2GN6A 3UJAA 1P0IA 3LP8A 3FSGD 4FR2A 2G04A 3HB5X 5KYYA 2X7XA 3UO8B 1PG5A 2VPZA 3EK2A 4I5GA 5ITSA 4JP0A 4FYXA 5JH7A 1R1TA 4XCQA 4X3PA 4LEIA 3KKMA 1N6HA 4G37A 5FBZA 3NVAA 1ONNA 3UJ8A 3QEMA 1TK9A 2AK2A 3S2WA 1F1JA 5KVVA 2ETVA 2XTMA 2DQYA 1UIMA 1B72A 3AHDA 4FHGA 4QUDA 2F4MB 1NYTA 3DTVB 1J7KA 3CCCA 4PJJA 1E6UA 4RETA 2NU7A 3FYTA 1YI1A 3D4OA 2UV1A 1ZN7A 5DYMA 3JQGB 4H0CA 1PVDA 3PL8A 1FTGA 5C3MA 1X94A 3I0ZA 3W5VA 1QIGA 1DQUA 5BSRA 2EFHB 4HJXA 2C6YA 1NLZA 2DHRA 5D5PA 4MQBA 3H0DA 1L5VA 1XXHE 3THYB 3VMFA 3MQ4A 4GZMA 5IKPA 4ZT6A 5CA1A 5BOXA 1H65A 1VDMA 5EAIA 2AWNA 4L4RA 4FFSA 1WH7A 3BL5A 3TL3A 1ECBA 5DNDA 1J70A 1C8VB 1YDEA 4ZGBA 1K0FA 4MYCA 4BEHB 1PSDA 4NV3A 1VKJA 5EFZA 5BR8B 1Z4KA 2HCFA 3KQWA 1G3UA 4WKBA 4EHDA 2O14A 3B6AA 3RVJA 1SFUA 2O3SA 3E18A 4RAGA 1CV2A 2QPAA 2ME0A 1AXRA 1FYFA 3ZZ1A 2PBFA 1TJPB 5K7ZA 1FNSA 2W6ZA 3KQYA 5BQFA 2RIRA 1M2HA 1RHKA 4HH3C 1CEYA 3DQPA 4OAYA 1AY0A 4EITA 3WKAA 1JB1A 2QSUA 2R7VA 2JZNA 1XRQA 3SKXA 2OCGA 5CX1A 3JR9A 4C0AC 3MCAA 5KTTA 3LD9A 3GFVA 5FWAA 2B4RO 3SSMA 3AW9A 4E22A 1D9XA 1XDUA 1OYVA 1XRRA 2FX2A 2I4LA 5CK5A 4EEKA 1OBVA 4CICA 2BJVA 1YSCA 4A5MA 1B0ZA 2LD5A 1JIXA 1RXCA 1Z5NA 1OUMA 4NI5A 1OCTC 2DFHA 5CB0A 2L2OA 5FUWA 2OO5A 3KFWX 4PC6A 2R11A 4Z7OB 3PUVA 1SKBA 4C4ZA 2XGDA 3QU7A 5GY7A 4IOCF 4ZKDA 4B73A 13PKA 3BDVA 4DVGA 3I52A 2JW5A 4UD2A 4WY8A 1Z77A 1USUA 2FR8A 2ZJZA 1UDRA 3WTBA 5EA2A 3RI3A 4G07A 4DSNA 5JMPA 3F73A 1NBIA 3KOXA 4U9UA 1KARA 4DDMA 3GF4A 4EEFG 2NO9A 4TSRA 4S3MA 3N05A 2LREA 3KKNA 4XW2A 5EIFA 3LSTA 1S7GA 4LXTA 2FMUA 2IYXA 2I1QA 4EI9A 1OSNA 5CCDA 3DU5A 1YBVA 1T13A 1T4GA 4MMYB 3NCHA 5HS8A 1EX6A 3WGLA 1ISIA 1FFYA 4DS3A 4YDRA 3LA2A 2W4IA 1ISSA 2YV2A 2JI4A 4MWDA 3GUYA 2IEZA 4GUAA 2EBUA 5EJEA 2QY9A 4QWWA 4NATA 3ZQ7A 4E09A 5MN6A 4G6DA 5IYZA 2LKDA 3QPUA 1WBDA 1WXHA 2XYGA 3BMCA 1Y6FA 3TR0A 5H4GA 1R00A 2RJOA 1JEDA 3LHKA 2NG1A 1QH1B 2CB0A 3CE6A 5EGSA 1IPHA 5HFJA 3DEKA 4K6KA 2CFOA 3A1YA 4O3MA 2XUIA 4FIDA 3EXHB 2PUVA 3E22B 4RB1A 2AD5A 4ENTA 1Z07A 4DANA 3CDLA 1KZ9A 4X71A 3L4BA 1UFVA 4F85A 3VH4A 1EVKA 3DBRB 4ITVA 4M37A 2ZU0C 3FHTA 4A3CJ 2W6IA 2YN2A 3OCXA 2O8BA 3OD1A 4X1YB 3DAGA 2XNJA 4Z4CA 5KYWA 1G5TA 3VZQA 4J0FA 3MJVA 4M74A 2K2WA 1GQRA 4M6VA 2XB0X 4HXYA 2IHKA 1N3IA 1YE9A 2Z4SA 3STTA 3DDOA 4LNUB 3DXYA 3BRWA 4AP6A 4AM3A 4UOZA 4FUTA 2J85A 2BHYA 4A0XA 2A1TS 3GBPA 2P91A 5C18A 4NNJA 2AEEA 3W4JA 1HXHA 4Z9BA 2YIMA 1E79A 4YFVA 1O9BA 4TRRA 3TVTA 5L4LA 1A8UA 4RVDA 2AWOA 4F3YA 3AUXA 1VJRA 1DU0A 1KAEA 3E2PA 4DZRA 2EWNA 4ER7A 2VTDA 2C2XA 3LKBA 3E5XA 3VKWA 1TRKA 2OBLA 3TGNA 1RQGA 5ICEA 2PM8A 3RQ4A 3OEEA 3U56A 3MUEA 4QUGA 3B7WA 3PKIA 5E6SB 1W29A 1VQKI 3U81A 3LOPA 4JXZA 3B3GA 2KZVA 5HIJA 5LXTB 3D3WB 4J03A 3ZEAA 1HKHA 4M9ZA 1SIOA 1GNPA 4A3MJ 3LOQA 1FQKA 3VOSA 4HFRA 2QUIA 2PGJA 3M6LA 4ZVLA 4WDRA 1U1EA 4C3HJ 1KRHA 4HGYA 1RXVA 5HYVA 2C82A 2NTNA 2C9YA 3QMVA 2P9CA 2PWPA 5IULC 2FPPB 1XTQA 5MGNA 1T0UA 3PXAA 3ZDYB 3MT0A 4NLLA 4JX5A 2JHAA 5B6IA 2ZE8A 1R0BA 3BMOA 1ZZGA 2K02A 1KJWA 2O8NA 4BLWA 1ACMA 1VLMA 4D99A 1ID8A 2AXEA 3WLSA 4GOND 3C14C 1YI2I 1YRYE 1ZP6A 1LPSA 3M3YJ 2K40A 2ZXHA 1IOZA 4GGGA 4BAUA 3GEBA 3WMRA 3NQOA 3ZBQA 2XTAA 1WPKA 2ESNA 2FSHA 4KDFA 4LC9A 1O6ZA 1VCIA 1TM5E 5JC8A 1AV6A 4HUQA 1MHPA 4AIIA 2VBYA 1DIBA 1J5XA 4XYBA 1DKOA 4ZDIA 1VE7A 3FTPA 4HA8A 1DBPA 4QQKA 2QG9A 4G12A 1SKYE 1H2HA 1KY5A 2AGVA 3QJGA 2OCYC 2GEFA 1YR8A 2IUEA 2ONYA 4LIVA 4YJDA 2O1SA 4ZO4A 3L7LA 2C5SA 4UV8A 1GG5A 4Z99A 4QPOA 1BE8A 4O4IB 4D9FA 5LZ8A 3W8RA 5FPYA 1VSTA 2OPBA 7MDHA 3G0OA 2J6HA 4PF1A 4LY3A 1MNMC 2EFDB 5A3RA 1ADCA 1Y9AA 3U3ZA 3MSCA 4RZSA 2GTHA 1E3SA 3I1JA 2EGUA 4PO8A 4CM5A 2ZU6A 4QDUA 3CC2I 3W7BA 2DMTA 2VBWA 2F1IA 2JK3A 1HDOA 2EBFX 4OHBA 2B1QA 2WDPA 3C2GA 1W87A 3QU2A 3D7RA 4TRNA 1GG2A 4NG4A 4LLLA 2B34A 1G20B 3BJEA 5GTIC 2GKGA 3BTVA 1NVFA 4LMAA 4FNMA 1DCKA 1I6LA 2VT6A 3FNHA 1L3LA 3S2SA 2WTEA 2ZYAA 2P81A 2XOEA 2K27A 2G9ZA 4A8JB 5AICA 3HOWJ 2DETA 3P0JA 4MLZA 3R41A 3OWTA 1GT6A 2BBWA 3A8TA 2GPYA 1JKJB 4XAQA 2MYPA 3IOBA 4W5RA 4GX2A 1DRKA 4F91B 4EM0B 3QE9Y 3FISA 1K8XB 4ENRA 4JY7A 3UGJA 1NTOA 4AD9A 4P8RA 3DJFA 4YRTA 2XRZA 1V1RA 3DBHB 1OGJA 2KP6A 2IFTA 2A9RA 4DYQA 1EZ4A 2D4AA 2ETXA 3LA6A 1ZM4A 2FKAA 1MAUA 1XNGA 4WZAA 1RQRA 4EIWA 3A0UA 3L8YA 3REQB 1XMOB 2XAGA 1DNPA 2IU3A 3T3IA 3NEUA 2CC2A 4KIBA 4LZAA 5CXXA 4R5MA 2NV2B 4DY6A 4TTPA 1WB9A 2HDCA 2I2DA 2RH5A 3QVGB 2BKEA 2P6OA 5T57A 4BUZA 4KIFA 4D9NA 1WG8A 2HXOA 1E2DA 1S4MA 3QVWA 5J9FA 3G2NA 4MUIA 3OJXA 4EDFA 5L95A 1QH0A 1QIJA 3FNGA 5LOVF 4ABTA 1DKPA 3N2GA 2WHEA 4GRAA 3H6GA 2JPDA 3W3CA 1KQ8A 1JI8A 1ON2A 4KQCA 4DLWA 3KKQA 4X84A 2DA4A 4C7BA 1JLMA 4AJNA 1LPBB 221PA 4RDIA 2EW2A 2BGMA 1DC6A 2OAQ1 2WHXA 3W3AD 4JMLA 5DS9A 4FE3A 2XGMA 4PSDA 4GYYA 3T5MA 3VDNB 5J1YA 4IBOA 4RCZA 3BXEA 2XT9A 1SHJA 2JIPA 4ER3A 1W0CA 2QQAA 3WQSB 7MHTA 1F6WA 1DZ3A 2R92J 2AQHA 1DAPA 2IXTA 2DHQA 2CUFA 5HOEA 5CT8A 4ENSA 5JQGF 2EEZA 4EGAA 1H4TA 1EU1A 2XUQA 1Q0UA 3VO2A 3WRXA 4BNZA 4HPQA 2ZNYA 1PU2A 1AS0A 3MRVA 1PVOA 5DHSA 1TUBB 5KQLA 1V45E 1QZEA 5HKOA 4E07A 2PQ8A 1FYVA 5J63A 4IIHA 3DVQX 1YRNA 1S6LA 5JCZA 1BVHA 1X1BA 3I6MA 3IAS2 3FHLA 3N7UA 4Q48A 1ENOA 1XJ5A 4LJRA 3IO3A 5A9SB 3MGGA 5F51A 1GPNA 3ZX4A 1H2WA 3F74A 4CKWA 5DGCA 3AL0C 1TU3A 1GEEA 3C7DB 3EQ2A 2Y1OA 3MUNA 4YUXA 1RXSA 1NE7A 1JP7A 4GEKA 1DBQA 5TS3A 1DQNA 2DMRA 3JAMZ 1V3FA 2AMVA 4L08A 1J5YA 4KYWA 4FGJA 4N3BA 2E4AA 1TA9A 4LF9B 1NN3A 1QLWA 3JSOA 2RHBA 2NU8B 2PSFA 4QVKA 1DC5A 4KX5A 5F77A 2Q5OA 3CR8A 3O8LA 2IVMA 1L8AA 4M98A 5F27A 2DECA 2PLRA 4B4KA 1E2QA 4RVNA 2WWFA 3HVUA 1W35A 3TUJC 3LX4A 1VSQA 2BF7A 3ABMH 4MW5A 1PR1A 3TDNA 1JU3A 4RHCA 1S5LC 1XK6A 4RA9A 2WE8A 1IZ1A 3T1TA 3U44B 3CN7A 2DI3A 3U49A 1NATA 3FXUA 1MD9A 1W1UA 1M67A 1PRYA 1F8YA 3OZGA 1GGHA 2ONZA 2QGUA 4JBHA 2GRAA 3JR3A 2FEKA 5FT9A 3WWEA 1A8HA 5E1DA 1J9ZA 1CQTA 2JRMA 3FE2A 1PQWA 4IJVA 3BCHA 2NO0A 5FXMA 4HDUA 2N75A 4QOHA 2AE1A 3CB2A 3OOYA 3VNUA 2VYND 1VPDA 4G7OF 3E0JB 4NSNA 2ZT6A 4PSKA 1LJ9A 1E3WB 1FXWA 2BYTA 1LXCA 3AC0A 4DLZA 4BUJA 4F11A 3QK7A 2DPGA 2JCYA 4ALJA 4YCLA 2VHYA 1JEYA 3MEXA 3C3BA 1GV1A 1SY7A 3ZHBA 4JI3B 3PQDA 2R7WA 4D4JA 2IL1A 1T2EA 4RIIA 1XSVA 2Y1XA 1OZGA 4AYBN 1OREA 8ADHA 3G6EI 1MBFA 3JASB 4F6RA 2JIBA 3TRIA 3O0DA 5J2TF 1O94D 1CR6A 3ZDQA 2VONA 2RFLA 4AX8A 3AI7A 1NI5A 4QBIA 4J0DA 5C1IA 1HEYA 2DKOA 2D2WA 3KZYA 1MJGA 3DXXA 3KWMA 3GRKA 3WIDA 1IZZA 1NG9A 2I6GA 3OM0A 4B2IA 1T1EA 1L1RA 1XMQB 3WXMA 1JKMA 4IICA 1NAIA 2IA2A 2Y0PA 1ULHA 3SC4A 3RE1A 1X0VA 2E4YA 3R4CA 3AH8A 4G63A 1I6WA 1O89A 3ADKA 4V2IA 5A4FS 4U8GA 3DC2A 1D0VA 4C1NA 2VK2A 4EO4A 2V9CA 1P2TA 1MGOA 5T3YA 3PUKA 3VU1A 4R71A 4F3CA 3I58A 2QVXX 2G3YA 5M5WJ 4XE5A 4K8RB 5DCMA 3E03A 4ALIA 2XCLA 1XCVA 1SCAA 2C7PA 4GXNA 3PG5A 4HGOA 3A9TA 1W75A 4KXQA 4OSEA 3WZMA 5A7FA 1HSZA 4FB4A 3JD4A 4MSUA 2FZ5A 5H7XA 3K4HA 3DYIA 4N5IX 3OIUA 3ZOZA 4WESA 4BFUA 3SI7A 2ZXJA 1N5MA 1VQLI 1L5LA 3ESYA 3UPUA 2DA5A 3FCAA 2XH8A 1Z91A 3VR5H 3PHJA 3C1DA 3S2FA 1DKLA 2NGRA 4RZXA 5KVCA 3GR6A 3MCZA 1KORA 1DEHA 2X9DA 2CSXA 3NJRA 5KX5F 5K4AA 5AJYA 5JI3E 4LJ6A 1S2OA 3N2KA 4KPEC 1E1RD 2AYZA 2VF5X 1ZGBA 2I8CA 8AT1A 4EGFA 2R1TB 3OT1B 4LZJA 1NPTO 1XEXA 2J33A 5BR4A 1I14A 2RGNA 5AK0A 1HW5A 1J21A 3R0IA 5CFLA 2YMLA 4X20B 1P1CA 4JC5A 4TMWA 3UF0A 4A92A 4W9RA 4LFAB 1M54A 1K6JA 4WWHA 2PCJA 3PU6A 2Q6KA 1RHMA 1NI3A 4PZAA 1M1UA 3JALB 2JS7A 3N6VA 4FHTA 1KZ4A 2NS8A 2GLTA 4CF5A 2GFIA 5LPNA 5F3RA 5KVRA 1XTSA 4YJKA 4LHEA 4R1PA 1TNTA 2A9QA 4M53A 1QAQA 1EGHA 1E8MA 4TM7A 1MBKA 4MUBA 2XUPA 3G2MA 3W5JA 3V8PA 1SCJA 1VIVA 3AR5A 4MEXF 1Z5UA 1CUIA 3H83A 2WIKA 3DCJA 1V5GA 2KPOA 1TB4A 4O2LA 4E6EA 2HMAA 4AG6A 1GPWB 3BQMB 3AQIA 1KY2A 2VTBB 3K0SA 3OPMA 1NBMA 3ESRA 2CMPA 1W36D 4M60A 5EJAA 4CYCA 1UBOS 3TG2A 1MJ9A 5SY6A 1QIDA 4LYYA 3DULA 2OXEA 2G1KA 1VZ0A 3WQRA 3DEZA 3KM0A 3TVDA 5CT4A 5AM1A 3EHDA 1V41E 5AHOA 1H0HA 4BP1A 4FFOA 3HP4A 1WCXA 2VAPA 2G7ZA 3DEUA 2XE8A 3N2EA 2F9FA 2H4WA 5C5IA 2J8ZA 4W5OA 2JGAA 4D0RA 3LE8A 4WXHA 5JYEA 3OMYA 1YE3A 4R1LA 4NZ9A 2H1CA 2G07A 3U48A 2OSBA 2GSWA 3Q3IA 4YJ2F 4DV2B 1MORA 4B47A 4AWXB 3ML6A 4AMYA 4JWKA 1JKPC 4NIMA 3BCBA 2CE7A 2FEPA 2GBLC 1D4FA 3VZCA 2QY6A 4Q4HA 3NP7A 1AKTA 3HDYA 2KFDA 3PUBA 4XM3A 1OXXK 5IUKC 2O0LA 1ULAA 5ENZA 1GRRA 2C03A 5AH0A 1XRNA 2GH1A 3EAQA 1HEIA 1WX1A 1YE8A 1R7RA 5DHAA 3QOXA 3JVDA 3IR7A 1SEUA 2K7FA 4LYDA 2MTBA 2VZEA 1ZFNA 3K4MA 4Q3AA 3CZQA 1JG1A 3SDZA 5K7SA 4MW9A 2LCQA 2VQ3A 4MKRA 3X1JA 5HDNA 5HVQC 1A5TA 3B3JA 3VC2A 5HNKA 1IF1A 1N2CB 1VB5A 4LE2A 2AJLI 4O8CA 2QQ8A 3QTTA 1OGIA 3PA8A 1H89C 3SS9X 4TTTS 2QUZA 2G36A 1JEAA 1JIKA 3HXQA 1R37A 2AEFA 1PYDA 2P2DA 2Y1WA 3KQPA 4O1IA 4PTLA 2YFHA 3CNQS 4MR8B 4RJ2A 5I8WA 1NTRA 5FNZA 1A72A 1PS8A 5D5XB 4BNLA 3VGPA 1ZKDA 2RQPA 3D9QX 2P0WA 1D5VA 1UEXC 4UHBA 3FYDA 4W1PA 1G9SA 3BL8A 3BXOA 2DSTA 3ZMUA 5IT4A 4EAAA 4FLMA 1FBUA 1NW8A 3RRZA 2VZ0A 4WK6A 2FGJA 2QIOA 3TZBA 2BUAA 2ATCA 2C5BA 5DI9A 2AUNA 3HKDA 2JASA 5EG0A 5CXQA 3VC3A 1PDOA 3BSFA 4HADA 4D5CA 1KMMA 1LFUP 2FXAA 3UY4A 2IP2A 3UJ9A 3G1UA 3IUEA 3ZWXA 2RGUA 2Z98A 4FR0A 3C7CB 4P36A 3OOHA 3LP6A 4QYIB 2GK7A 1WY5A 3BBLA 3IEVA 2XIGA 4PN3A 4BQFA 3UAOA 5HM8A 3A1CA 1J1UA 5ILGA 3CC7I 1KJ8A 3TW6A 4EKNB 3CX7A 4B83A 3BHJA 2VA8A 3ROUA 1F17A 3W8NA 4KQ9A 4S2UA 2LW7A 5GINE 1CY7A 1VL1A 3QYBA 2Z6QA 5FTWA 3KKPA 4KMOA 1UMQA 3ILSA 4N5DA 4BNXA 4ESOA 4O6JA 2X9QA 2QP9X 3RKRA 1G8AA 4A2QA 1JI0A 4MTCA 4LGMA 2DUJA 4KUEA 4MO2A 1GHTA 1WU7A 2OAP1 2QLBA 2Z6UA 3DKWA 2NT4A 4RU1A 2DBYA 1BCSA 2D7CA 3LQYA 2B8JA 3X1MA 2PD6A 3V1YA 3WGVA 5FULA 1PE0A 4CNBA 3EF3A 1M0SA 4OLHA 4RZQA 3QHQA 2BP7A 4D0SA 1EDOA 4HLCA 3TLGB 3LA3A 3C5EA 4ARUA 3WYCA 3TBKA 4CTMA 3OLCX 5AESA 3GLGB 3WNCA 1IUKA 2ZPTX 4RIFA 3PF8A 4JP8A 3IGFA 1CUYA 5B2ZA 1QHEA 2IZ5A 4FN5A 4KQJA 4LBZA 1AN0A 3HKCB 3ST7A 4TTVA 2ZRLA 4ZPJA 1SAUA 4PDKA 3L6CA 4CCAA 3C6ZA 1CJSA 1O6CA 3C1UA 5F64A 1UBJS 3I76A 5ECGC 4UCQA 4Q05A 1OW3B 1U8CB 1L4HA 1E64A 4EFLA 1PFGA 1N92A 4YMHA 1JU4A 5A5DA 1SQ6A 2W71A 4QQNA 2QN8A 3TX2A 1H6CA 3LLVA 3C43A 3HNRA 3OSUA 4Z2YA 2CJXA 1YKGA 3HVIA 4RL6A 3FTFA 2QMZA 4IMPA 3BJMA 5JAPA 1QYDA 2GN4A 3CO6C 2ZR9A 1QHFA 3MJSA 1U7DA 5B58T 1TTHA 4NCKA 4CUGA 4Z7JA 4FMDF 1B1BA 3V97A 4E7HA 4QT0A 5DLDA 3WGMA 3T7JA 3QGMA 2GDJA 3CP2A 2C9DA 4B4DA 1DO2A 4NBUA 1M34A 5F2EA 1PTJC 4IIJA 3RTCA 4GBGA 4MKIA 2FF4A 1YZUA 4QIHA 3IAEA 4M7OA 2R6CA 4URXR 2IV3A 1A98A 5NLLA 4CN9A 2ZJ0A 4V03A 2XT0A 3K4CA 3KL4A 3PNKA 5F1PA 1IZ7A 5GPAA 2VPWA 3SDBA 1PP7U 3H4IA 4NU6A 1B8IB 4RY9A 5C35A 1CCWA 4TZ6A 3BHIA 4M9XA 4JP3A 1LBQA 2G28A 2IA5A 3FXMA 2PVCA 1S8FA 5TQJA 1K8ZB 3FCYA 1L7MA 3CNHA 5L7TA 8ABPA 3W5UA 3OLQA 3F67A 1WJDA 1ZTRA 3P7MA 1C0EA 2X5NA 3N53A 4CDMA 2YDXA 4HX7A 3R2JA 4FFMA 2VJPA 1Z6XA 3KYIB 2OSVA 5A5GA 3H19A 3G1WA 1II8B 3L4SO 2W7NA 3CQZJ 1IHDA 1HDGO 5EWJB 3KQQA 5FLKA 2BFNA 3GVXA 3IP6A 3I45A 4RF5A 3CCQI 4QOGA 1PL0A 2J7PD 6GPBA 2QMHA 2YZNA 5JS8A 1NVUQ 3Q6NA 1ICEA 1CRWG 1Y1WJ 4X7PA 5AKJA 4C0WA 1F0KA 1V7PC 1Q16A 2CW7A 4HNAB 3QOPA 1U90A 2CNWD 4URVR 4N82A 5F7XA 3U1BA 3D5RC 2AG8A 1ETWA 2H16A 4JBXA 4ZO8A 3VNRA 3DEJA 4X91A 2NP6A 2A3RA 3E5MA 1V8BA 3KOZA 5J4YA 2CG4A 4IDEA 1YH3A 2C99A 2AHQA 5AHWA 3U4DA 1T6SA 4XOIA 4BWGA 2LVSA 3G0HA 4MINA 5GADJ 4C4RA 2REQB 2IP1A 3S1LA 4UM9B 2Q0QA 3M1YA 2O2SA 2QVCA 4RTJA 4KAAA 2C5LA 1AVTA 1GLGA 1HT1E 2ZGVA 4CKXA 1MH1A 4I2VA 3RPUA 3DV0A 2W2TA 2OD2A 3O94A 3AEKB 1V5WA 4HDKB 2O06A 2F1HA 2XQIA 4WNCA 3WK5A 1C81A 3TI9A 4R79A 1EE2A 1YJ9I 4G0WA 4LSGA 3SE0A 1PCXA 1CQIA 1NI4B 1MA0A 1DXOA 4BB5A 5BW8A 2HMUA 2J3KA 3N07A 3J80A 5DCYA 2AVDA 4C6TB 2VLBA 4LVCA 3K1PA 3DOEA 5G02A 2ZJOA 1W19A 4N9WA 4V19K 1GXPA 1VMKA 3ROXA 3MS7A 5BSWA 1EIZA 2HVSA 4GKKB 4KOEC 4OATA 2BHZA 1ZG5A 4ARBA 4CKEA 3WG7H 1YASA 2R2GA 4F4UA 3EQ9A 4ARCA 3EMKA 1WI9A 2IV2X 3B1WA 2VYCA 2RGCA 4MR7A 2YIJA 1YMVA 1UPXA 2FZWA 1T2KA 5EY5B 4MNTA 2GN9A 4L5BA 4CF6A 2C9CA 4MB0A 1AQIA 5J2UF 2DERA 5JSQA 3WAGA 3IUPA 4I6GA 3ZJYA 1FJGB 4RS4A 3WX0A 2K3FA 3K0FB 5LZ5A 3D0QA 4WKOA 2MA3A 4BKMA 4DCSA 3JY6A 5TVGA 2DB3A 1GU7A 3VO1A 1FUIA 3FZQA 3TQFA 1XV5A 5J8CA 1M0WA 2R7DA 1BVYF 2JF0A 3BGIA 2KJBA 2C88A 4KO4S 1L1EA 2Y2VA 2Q7OE 1P39A 1Z0DA 3UV3A 2Q5CA 4YT5A 2CFSA 2KHMA 2FU4A 1JMVA 1SKQA 3FMGA 2M6LA 4H1VA 1JXMA 3RC7A 5AK6A 4YAWA 5BOSA 3IVAA 2BFEA 3FW1A 1J2XA 5A2QZ 5LLQA 1FFEA 1YTLA 4DR2B 3RK1A 4G56A 1YE5A 2MYNA 4L3OA 4J76A 5JRDS 1GPYA 2GZHA 3VYRB 1NZFA 4PLHA 3DPIA 4RD4A 1TWCJ 2AFRA 3NHMA 2PJZA 5AM4A 3U7QB 4N0BA 2XKJE 5M5YJ 3F6SA 1QC5B 4AG5A 5JLXA 1TBXA 3D5SC 2LVBA 5KYXA 5KHOC 4HLYA 2X41A 3VH2A 4E7ZA 3H8WA 1VQMI 4MRPA 1RPJA 4NOLA 1XTKA 3WJ1A 4BUPA 1SR8A 5I47A 1ZHHA 4KXFB 4IO1A 3RKQA 3I30X 3TR6A 2I62A 2PNJA 3MN1A 2LDUA 2DHEA 3S99A 1F0NA 3ZQ4A 4P4SB 1R5NA 2NAPA 1DTWA 2NVXJ 4AWAA 4WBNB 3I23A 2O07A 3L0DA 4IHWA 1OAOC 5A06A 9MHTA 1IDZA 1IIBA 5T4BA 1UOEA 2FBIA 2O8FB 3OPYI 1U8UA 5IHPA 4MP3A 5EXPA 4P1ZA 2MSYA 2GWHA 4YJ3A 5ICSA 1ZIYA 2A94A 4HGZA 2DA2A 4HS9A 1GNQA 3GRUA 3FLMA 3P9NA 1WH5A 1THZA 4Y0AA 3HI4A 1TUIA 4YJFA 1SN7A 3QNUA 1SAXA 1RQPA 5FB2A 4ZOBA 1MV5A 2TYSB 2RAPA 2IE8A 3ZQQA 2QD3A 2K5UA 1G98A 5D85A 2B1RA 1CZUA 4V0NA 1KDRA 3KFLA 4ER6A 4L76A 5EVCA 2VNAA 1S96A 1OR7A 5F73A 2AQFA 4L8FA 1IG0A 5KTPA 5ALXA 3TIXB 3FG9A 4Q9LA 4LECA 4YN3A 3I71A 1TZ2A 4HDVA 2CLMB 1AKMA 3VU9A 3KP6A 1ECCA 2AO9A 4MHSA 5C7LO 2ZB2A 1P5FA 3ONVA 4M1TA 4PY2A 2WP0A 4PR0A 1P62B 3OLVA 1E9BA 3E15A 1X7XB 5ILSA 4EJSC 3K9GA 1SOVA 3AG5A 3AKYA 2R5YA 2Y66A 4CLOA 2GZDA 1CNEA 2H5LA 1S5PA 3U9SA 1UMCA 1KDVA 2YWHA 4BYGA 3HV2A 1LD3A 2PWZA 4RTPA 4KAJA 4FYKA 3VR5D 3NQ41 1AS2A 4BN0A 1NM5C 3EEFA 4FZ3A 3D02A 1VTNC 4KUHA 3A37A 5LBQA 3CF4A 2P0AA 3LUBA 2R5ZA 1UMDA 3MKZA 2YXNA 1Y80A 1YB5A 2ILTA 4CQLB 3WK4A 3ZMVA 4LTNA 1FYWA 4QU5A 1TTPB 4DJAA 3KVRA 2QL6A 5D8LB 3VR3D 4EO7A 2WVGA 5B58C 4HWSA 1WA5A 3BH7A 2QDXA 3QLUC 4LK3A 1JIQA 5G0SA 3GJ3A 5J1RA 5JAZA 3LC7O 3LSIA 4A8PA 3RNLA 1RP7A 1M2KA 3KVNA 1XVIA 1H9GA 3LUDA 4PM4A 2V55B 5E38A 5BUQA 1XZFA 1U0OC 4WA8A 1KH1A 1XCLA 1DLJA 2R0QC 3TK1A 2A5JA 1DHRA 2R6R1 3GLFB 5A2QA 1O0CA 3U4IA 1M5UA 3U2QA 3H0GJ 1Y0BA 5EP2A 5ICFA 1T6BY 4U7FA 1NVAA 2D0PB 1E2GA 2JAQA 2OB1A 4KFCA 3G0IA 1QH9A 3OLXA 3RHZA 1M73E 3FKJA 5BO5A 2IW5A 3HUGB 2OHXA 2KRHA 3JCUC 3E9EA 4MQ5A 1NUQA 2R8YA 4E5KA 3QG5A 2R6JA 2L7FP 1ISPA 1N5RA 2H3EA 1WMFA 3BCRA 1A76A 3GGDA 1ZRHA 2I4TA 3PWZA 3KJIA 5J58A 5JVTA 3Q7RA 4RV4A 4CCYB 5TR9A 3NXSA 3VR0A 1YQEA 4YYZA 4RADA 4P96A 5F1RA 3QPCA 2JEYA 2WU3A 2OPHA 4QBHA 2HA2A 2YJ3A 4XJSA 4ZO7A 4MQFB 5T64A 5TGZA 5FWXB 1M1NB 3O4RA 2GASA 4R6XA 1T6YA 3Q2KA 3PIPF 4ZQGA 1OI4A 3K30A 2Q2OA 3KJHA 4R2KA 3WP1B 4CHGA 4S1PA 3B5IA 3LSJA 5ECYA 1SOMA 1Y1RA 4QDKA 1VI6A 3LKDA 1RPTA 2QD1A 1JH9A 4RPJA 2HMYB 3CB4A 2IZ7A 2FUG6 3JTGA 4ZPXA 3UXYA 1LS1A 1KS9A 1R5GA 2Q1UA 5I5GA 2E1CA 4PBRA 1R3UA 3HDTA 4L16A 2IUTA 3RC3A 3GB9A 4AMBA 3IAUA 4R8RA 4CETA 3AVTA 3R6TA 2IEDA 2EQRA 3K10A 4PZEA 1WKCA 4ZCTA 2J41A 3CNOA 4XD7A 2R85A 5FWDA 2IY7A 4OOFA 5CH5A 2XKKA 5LQAA 2F5CA 4AM8A 3AG6A 3EBOA 2W4MA 4ZYAA 3GYGA 4Q4AA 5CDGA 2RREA 4ENWA 1ABBA 4RGRA 2ME6A 3ZOKA 4PJ0C 4QTZA 5D6FA 16PKA 2X4GA 1UJBA 4MW6A 4N7BA 1X9IA 2I7TA 3WGYA 1JN0A 2Y6VA 4I4TF 5DRYA 1IC8A 4A03A 4RS3A 3E3OA 3WE7A 1I3QJ 2DQLA 4MVJG 1FLVA 3CX3A 2XV1A 1A6IA 3P9KA 1M1XB 3L0SA 4A27A 4GC5A 5AOAA 3STWA 1N0HA 3OQ6A 5JFRA 3KOOA 2P7CB 1BI1A 4UQOA 2QUFA 5SY4A 2QRVA 3T7RA 3EXIA 4R51A 3ICOA 1OCCH 2BELA 4J0GA 1Y81A 2G88A 1M1ZA 2P0YA 2X2FA 2JGKA 1XMVA 5FP0A 3ZY4A 2RBGA 5CVDA 2O8DB 5KK1A 1RKTA 1RFGE 2RI0A 1HT2E 1CBUA 2YZKA 2JGDA 4G9BA 1IZ0A 5EQTA 1Z3IX 1OYWA 1SVLA 1K5PA 2PTHA 2BTEA 3ACBA 4EMBA 1ITZA 3V2UA 5IMBA 4W9NC 3CRQA 3VOAA 3GGCA 3M3HA 1H3NA 4KWTA 1GU0A 2O7RA 2O0YA 5DT2A 1ECGA 3AM5A 2XE4A 4YRSA 4GYWA 5IC6A 1AE1A 5BWMA 5HRAA 2J0UB 5BN3A 4M0MA 2HWYA 4NCJA 4ABYA 3TMYA 4V0OA 3GLSA 5LKRA 1NOKA 1CDEA 1ZD2P 4HQRA 4DNFA 2P41A 5BPDA 4B84A 5IKMA 1KI8A 1FP4A 4FQ5A 1O9HA 4RD3A 2DFNA 3FCXA 4XWTA 3L06A 1U3TA 3EWNA 2RHDA 1YU6A 2DTRA 3PBKA 5H5JA 3FXOA 4OX9B 2CUZA 4BEBA 2HUPA 2B8EA 1POGA 3Q98A 1H8HD 4HV4A 3ER6A 3C7TA 4TKUB 3A10A 3V3KA 1VKZA 1ZCBA 2X86A 2VF2A 1OIWA 1TX4B 1BVRA 1A4XA 2WA1A 3HOUJ 4E4HA 4L5AA 1RWMA 3QAHA 1ZVQA 1D6MA 3EZGA 2OGWA 3WBFA 2BZTA 1U0HC 3E5NA 1OZFA 1BGVA 3IAM2 3VPGA 5JMTA 5E2IA 4HQLA 2EKDA 3SLRA 3UJNA 3AXSA 1UFKA 1NJ8A 2BFCA 3P7NA 1NKTA 3OZSA 1I4LD 3CLKA 1GTL1 4CIDA 4NFHA 2VZ8A 4MW0A 1YIJI 4FZRA 3KJFA 1T6XA 4KGXA 1KJJA 4HDOB 3JQBA 5L45A 2HF7A 3WYGA 3BWCA 2OKCA 4F4CA 3WYNA 4BX2A 3RS8A 4C2BA 4OBXA 1MQAA 3WIEA 3AUUA 1J99A 4FJ2A 4IJ5A 4TL6A 4B7XA 3U2RA 4G36A 4JCCA 1N75A 2LZ0A 3IDAA 5CFOA 1T91A 3UB4A 4XPIB 4CG1A 2I3GA 2ZRIA 2HYDA 2VNKA 4AY5A 4G41A 1K6YA 4KXYA 2TMYA 4YJHA 3JX9A 3IAS1 3GP5A 1Y63A 1G8PA 4WD3A 4Q4LA 1YYVA 3HYTA 5E9WA 3EYIA 1MZPA 3BZBA 1NIPA 1JT6A 3UKOA 2NXNA 4DGQA 4TYMA 4BL5A 1ATIA 2P69A 3PC3A 1SZPA 2WJVA 1OR8A 2XB2A 1HETA 3A4LA 5IT0A 2Q2QA 3EULA 1JSZA 3UEOA 3GX1A 2P6TA 4ZK6A 4N9HA 1US8B 4N3GA 4CM6A 5EPEA 1JKXA 3WMWA 5C8YB 3WTVC 4QGBA 1TM7E 1X3WB 4UJ3A 1K4KA 5KREA 5I8ZA 4PFQA 4UCWA 4EKDA 2VWGA 2YKGA 1ETXA 3ONNA 2X3FA 4Y7DA 2DY1A 3AFMA 4X8MA 3KVOA 4ZTFA 5GVRA 1KSGA 5IOYA 4GMDA 1F0PA 4Y2YA 2ANBA 1YVUA 2CGEA 1OLXB 3SM3A 4LKOA 3ZU2A 2IAIA 3F8MA 1JBKA 2ARKA 2YR0A 2VH2A 2RK3A 4JP2A 5K0CA 1NSFA 1X38A 1B0UA 5TJJA 2OWDA 2BM1A 1D1TA 5KB3A 4B2YA 2LH9A 3L4KA 2R4QA 4AJPA 1CGPA 3SZPA 5FD6A 4I1SA 4BFLA 3G8DA 1GEGA 2ACJA 1Z35A 4Y9SA 2QDKA 4FHZA 4JI5B 3RUAA 2IYZA 4I66A 3RC8A 4ZARA 4ZI7B 1DL5A 2C4UA 3HUEA 1P5RA 3WGOA 2XDQA 3THXA 4DKXA 2Z33A 3KP5A 5K4HA 4LF4B 2WICA 3CLUD 1ZS9A 3QVTA 5LYJA 4FHEA 1VHQA 4AP5A 3GZ5A 1QGDA 2G06A 4B3CA 2V97A 1P3DA 3G1MA 1J75A 3TAHA 4BTEA 1Z21A 2BPOA 1IJKA 3RTEA 2BKXA 6PAXA 2BTQB 4XB2A 1Y8CA 3AZQA 3FWPA 4IHAA 3DUFA 3G8BA 3FJYA 4RKEA 3B6KA 1QVTA 4U6QA 2GN2A 3LWDA 3LC1O 3OT5A 4XUCA 1A35A 1J0CA 5IAEA 4R81A 4DR7B 2K7ZA 1EUZA 5D5QA 3TJMA 4MDHA 5F1JA 1V1MB 1R49A 3WSWA 1XPOA 3ZY2A 3U4HA 5HJ5A 3INTA 4YA6A 2VDVE 4YELA 4ZZIA 3DDNA 2DJIA 1W44A 2R751 3GBSA 1YA4A 4XDGA 4WNIA 3REOA 1FRFS 4BVAA 4YVFA 3H5NA 2QI9F 2CL0X 3A0RB