4KIIA

Beta-lactoglobulin in complex with cp*rh(iii)cl n,n-di(pyridin-2-yl)dodecanamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
156
Chain Sequence
b'IVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title Structural Basis for Enantioselectivity in the Transfer Hydrogenation of a Ketone Catalyzed by an Artificial Metalloenzyme
doi rcsb
molecule tags Transport protein
total genus 38
structure length 156
sequence length 161
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4kiiA00
1I04A 5F58A 1T0VA 1PMPA 2LKKA 1MX7A 2NP1A 5HWZA 4BVMA 2GTFX 2AL0X 2N93A 4IAXA 4IB6A 2HYSA 4M7MA 4HPAA 3ZQ3A 1R0UA 3KFFA 1JJJA 3FA9A 3I0AA 5LJKA 1E5PA 2W2AA 4MVKA 2RQ0A 1A3YA 4ES7A 4A1HA 1GX9A 2HLVA 1BBPA 5C0NA 4ORXA 2AT8X 5DG4A 1A57A 3FR5A 4EFGA 4GE1A 2F73A 2OVEA 4TQ2A 4YMYA 1CBSA 3P6FA 1T68X 3WJEA 5HA1A 1SA8A 4TJZA 3NX2A 2CM4A 1CBIA 1FTPA 4EXZA 4ORSA 2RA6A 2HMBA 1EQDA 1B0OA 1X8QA 4YKOA 1FEMA 5L8NA 4NNTA 2WWPA 2AH7X 4PSQA 4D6BA 5LJBA 1KT4A 3BDRA 1CBQA 1D2UA 1GXAA 5IO6A 2A13A 1HBPA 1AQBA 4QGVA 4IMOA 3STKA 2MM3A 4ORRA 3D95A 3APVA 3U0DA 5D45A 3B2IA 4AYHA 1B4MA 5HZ8A 2ACPX 1GGLA 4YCHA 2ANSA 2IFBA 2OZQA 1RBPA 1LIDA 4QZTA 5LJEA 4I9RA 1ZNEA 4GRJA 3WJDA 4R0BA 4A8ZA 1B8EA 3FELA 1LKEA 1I06A 5F6ZA 5H9AA 2KTDA 3HWDA 1HQPA 1PBOA 1FDQA 3CBCA 3DSZA 5L8IA 3FEKA 3HWGA 1MDCA 1DZKA 5F1EA 4LKPA 5KIDA 4TNNA 2XSTA 2P8GA 2AT5X 1SXYA 2LFOA 1X8OA 2G7BA 3KQ0A 5LJCA 1OBPA 2FT9A 1EW3A 3FEPA 1ZRYA 3WJFA 4RUNA 2G79A 1BSOA 4GH7A 2HNXA 1YWCA 1X8NA 1BWYA 1N0SA 5F6BA 1SY0A 4N7DA 1JZUA 2A2GA 4XMFA 4I3CA 3JSQA 1LF7A 1TOUA 4ORWA 3HWEA 1KT5A 2CZTA 4Y0RA 5EZ2A 3HK1A 3KFHA 5LJGA 2AT6X 1TW4A 5HZ6A 3PP6A 5HCDC 1GKAB 5HCCC 3T1DA 1QFVA 4XMDA 1YP6A 3UEUA 3U9PC 2X45A 3EM0A 3NPOA 5BVQA 2G78A 2WQAE 4IBAA 1BEBA 1KZXA 5D8JA 4IMNA 2JOZA 4LZUA 1VPRA 1NP4A 3VG6A 2JN3A 1DV9A 3B2KA 1JJXA 4XMCA 1LICA 1HMSA 2FR2A 3FMZA 1UREA 1SXUA 1KT3A 5K06A 2Q39A 2Q2PA 3CBSA 1E02A 4ZHCA 3AKMA 1XCAA 4GETA 1GT5A 3STMX 4ZHFA 5HAEA 2AT3X 4YGZA 4QGXA 1JYDA 2JU3A 3C76X 3L4RA 3TGCA 4TKHA 2DM5A 3RSWA 4YDBA 1SXWA 2Q9SA 3I17A 5LJHA 1FE3A 4HFOA 2AT0X 1DZMA 1BJ7A 1BSQA 3PEDA 1ERXA 4XMEA 3RZYA 3C77X 4AZMA 4YDAA 1IIUA 2L5PA 3F8AA 1PEEA 1OBQA 2RD7C 1U0XA 4WFUA 1GX8A 3VG2A 3HWFA 1ZNGA 2AMMX 5EEEA 5H9LA 5F7GA 2WR6A 4QGWA 1P6PA 2JU8A 4M6SA 4OS8A 4OS0A 2O62A 3O22A 1YWBA 4GNYA 4D6AA 1GT4A 4DQ4A 1OEEA 4GNWA 5DPQA 2A3FX 2CM9A 1DFVA 3P6GA 1L6MA 5KHPA 4WBKA 2W2BA 1KOIA 2OFRX 4NLIA 5EDCA 2R74A 1ADLA 3SAOA 4AZQA 1BM5A 3VG5A 3K3LA 1FELA 2OVAA 3NX1A 1LNMA 1MVGA 1QQSA 3P6EA 4ZHGA 3C78X 3KFGA 1IKEA 2GC9A 2Q4NA 1A2DA 1RLBE 1YWAA 3FR4A 5LKEA 4ZGUA 1TVQA 1VYFA 2QO4A 4QAEA 3WBGA 4O9SA 1CRBA 2FS6A 4A1YA 4ZH9A 3VG3A 4ZR2A 1IFCA 1ICMA 3VG7A 2E4JA 4AZOA 5B29A 1ZNKA 4BOEA 3TGBA 3ZUIA 2LBVA 1HMRA 4AW8A 2ACOA 1LPJA 2XKLA 1QY1A 2FR3A 3STNA 3CQNA 5D47A 2A0AA 3BSZE 3UEXA 4NP1A 3WXQA 3P6CA 1EPBA 4NYRA 3BX8A 1KQWA 3ELZA 2POAA 3U03A 1EUOA 5AQ6A 4AZRA 2K23A 4YFQA 4EDEA 2QOSC 5HTDA 1CJ5A 4UU2A 1AELA 2RCQA 1HMTA 1MUPA 1KT7A 1OPBA 4ORYA 4NYQA 3JS1A 2WSJA 1ERBA 4KIIA 1XKIA 3EYCA 3B2HA 1GT1A 1ZNHA 4ZJ0A 5EPQA 1SY1A 2KT4B 1E00A 3PECA 3PH6A 2ASNX 4ZH6A 1S44A 2FLJA 2FRSA 2L9CA 3FENA 4NNSA 4TLJA 1SXXA 2JU7A 4YGHA 4YGGA 1I05A 3NP1A 2K62A 1NP1A 1DF3A 1DC9A 3QKGA 3P6HA 1AB0A 1BRQA 5H9KA 1BSYA 2A2UA 4YCEA 2CBRA 1MX8A 3WVMA 1EPAA 1X89A 1OBUA 4UU3A 1VYGA 3NQ9A 4Y0SA 3O2YA 1X71A 5HZQA 4ALOA 1KGLA 2QM9A 3BLGA 3D97A 3FA6A 1BRPA 3Q6LA 4OS3A 1GM6A 1I4UA 1LIEA 5CE4A 1KT6A 2OVDA 2YG2A 1EIOA 2QO6A 3EBWA 4IB9A 4AZNA 4XMHA 3UEVA 4BQUA 1QFTA 3TGAA 3FA8A 4ARHA 4IB8A 2R73A 1GT3A 3B2LA 3TF6A 1JV4A 1HN2A 1AVGI 3CR6A 1QABE 5JR8A 3MVFA 1GKAA 4Y0PA 1ICNA 2NNDA 3MBTA 4TKJA 4HPCA 3FW5A 1LIFA 3CQRA 1FENA 5HBSA 4IB7A 1TOWA 3IA8A 5IO5A 4CK4A 3GAQA 4YBUA 4DQ3A 1QY2A 4ODDA 4I3BA 4OMXA 2WQ9A 1E06A 1LFOA 5EEDA 1YWDA 5IO7A 3O19A 3P6DA 1BLRA 3S26A 1U18A 4N7CA 1G7NA 2L68A 1ALBA 3EBKA 3BU9A 4EEJA 5FFHA 3F9DA 1KQXA 2EU7X 4QYPA 3BU1A 3FIQA 2CBSA 3OJYC 1U17A 1H91A 1OEJA 3APUA 3CWKA 1ML7A 4ALBA 2FWVA 2WEWA 3G7XA 3NQ3A 4XMGA 4YBPA 4ZFXA 2CZUA 1IFBA 3PH5A 4LZVA 3B2JA 2HZQA 3BS2A 5HCEC 5L8OA 2OFMX 1YP7A 4ORUA 3BX7A 2PY1A 3DTQA 1YIVA 5H9NA 1OPAA 5D4AA 3APXA 3VG4A 2Q2MA 4GKCA 1NGLA 1JBHA 3WJBA 2WUTA 1ZNDA 4IAWA 1EALA 4RUUA 2X46A 4OMWA 1DZJA 1Z24A 4YKMA 4ZHHA 4NLJA 5B27A 4A60A 1O8VA 4MVLA 1DZPA 2RCTA 2WEXA 3ELXA 5H8TA 3PPTA 5HTEA 2ALLX 1JYJA 1A18A 4QYNA 1HBQA 4ZCBA 4WFVA 1QY0A 5LJDA 4QZUA 1ACDA 3BRNA 5BVTA 5BVSA 1CBRA 1D3SA 1O1UA 3FW4A 3WJGA 1ZNLA 1IKJA 1KXOA 3UEWA 1LIBA 2MO5A 2NNQA 3CMPA 1G5WA 1X8PA 3AKNA 5LKFA 2L67A 1YUPA 1G74A 2R56A 3IFBA 3FLLA 4YH0A 5HA0A 2QO5A 1PM1X 1O1VA 2GJ5A 3D96A 1KZWA 4ZHDA 5HZ9A 1OEKA 3TZSA 1SY2A 1IW2A 4TKBA 2LBAA 3FA7A 3BY0A 4LKTA 3WJCA 1S7DA 2AKQA 1QWDA 5EDBA 5FENA 1QG5A 1SY3A 1UZ2X 3NR3A 4YFPA 5KICA 5D48A 1X8UA 2W2FA 4AZPA 4HPDA 2NNEA 3APWA 2FTBA 4I9SA 4Y0QA 1T8VA 4HPBA 1G85A 4I3DA 4MVIA 4YFRA 2LB6A 1EXSA 2MJIA 1B56A 2BLGA 1S2PA 5FAZA 2HZRA 1TXLA 3NADA 3FR2A 3ZUOA 4K19A 2FS7A 1EIIA 3KFIA 5HZ5A 3EMMA 3KZAA
chains in the Genus database with same CATH superfamily
1I04A 5F58A 1VWMB 1W6FA 3KVNA 2HKDA 1SWOA 5CHKA 1T0VA 3T2XA 5AJCA 4CPHA 1PMPA 2LKKA 1MX7A 1VWBB 2NP1A 5HWZA 4BVMA 2GTFX 4Z6JA 4L1NA 2AL0X 2N93A 3E3CA 1HQQA 4IAXA 2RTQB 2X8FA 4IB6A 2DJGA 1SWAA 2HYSA 4M7MA 2F01A 1E2TA 1I9HA 4HPAA 3ZQ3A 1R0UA 3KFFA 1JJJA 3FA9A 3I0AA 5LJKA 2Y32A 1VWPB 3RY1A 1E5PA 5IRWA 1LCVA 2W2AA 1SRGA 3X00A 4MVKA 3AUMO 2RQ0A 1A3YA 1Y9LA 2G5LA 4ES7A 4A1HA 2RTHB 4NV7A 3WYQA 1GX9A 2A8GA 2HLVA 2RTCB 2X34A 3CKGA 1BBPA 1UYOX 5C0NA 4ORXA 2AT8X 5DG4A 1A57A 3FR5A 4EFGA 4GE1A 2F73A 1SWKA 5B2AO 3ZWEA 2OVEA 2I5VO 2RTLA 4TQ2A 3MM0A 3PK2A 4YMYA 2FHNX 4INNA 1CBSA 3P6FA 4GJVA 1T68X 1VWLB 3WJEA 5HA1A 3SLOA 1SA8A 4TJZA 1JMZA 2JGSA 3NX2A 3NQKA 2CM4A 3OBLA 1CBIA 2WPUA 3RY2A 1FTPA 4EXZA 4BGFA 4ORSA 2RA6A 1SWLA 4O4SA 1MEPA 1EQDA 1B0OA 1X8QA 2HMBA 4EKVA 4O4OA 3RDUA 3PDFA 1FEMA 4YKOA 5K67A 5L8NA 2FHLA 4NNTA 2WWPA 3LTWA 2AH7X 2MF6A 1JQPA 4PSQA 3MX7A 4D6BA 5IXGA 1SRFA 5L3YA 5LJBA 1KT4A 3BDRA 1CBQA 1D2UA 1GXAA 2GTLO 5IO6A 2A13A 1HBPA 1AQBA 4QGVA 4IMOA 3STKA 2MM3A 4ORRA 3D95A 1IJ8A 3APVA 4CDFA 3EC5A 3U0DA 5D45A 2RTJA 3RE6A 2I5ZO 1SWJA 3B2IA 3LHNA 4AYHA 4BX7A 1B4MA 4BX6B 5HZ8A 3WYPA 2ACPX 1GGLA 4YCHA 2ANSA 2IFBA 2OZQA 1RBPA 1LIDA 4QZTA 1LCWA 1SWNA 4I9RA 1ZNEA 4FGIB 4GRJA 5K68A 4WHIA 4R0BA 3WJDA 4A8ZA 1B8EA 3FELA 1LKEA 1I06A 5F6ZA 4MVEA 5H9AA 2FKJA 2KTDA 3HWDA 1HQPA 1PBOA 1SRHA 1FDQA 3CBCA 3DSZA 5L8IA 3FEKA 3HWGA 1MDCA 3RWXA 3GE2A 4JNJA 1DZKA 2OF8A 4LKPA 5F1EA 3ZW2A 5KIDA 4TNNA 2XSTA 2P8GA 2AT5X 2G8CO 2IZJA 4O3ZA 1SXYA 2LFOA 1X8OA 2G7BA 3KQ0A 5LJCA 1OBPA 2FT9A 1EW3A 1N9MA 3FEPA 2BC3A 1ZRYA 2IZAA 3WJFA 4RUNA 2G79A 1BSOA 3SZJA 4GH7A 2HNXA 4U9CA 1YWCA 1X8NA 1K3BA 1NBXA 1BWYA 4Z2OA 1N0SA 3WOVA 1K24A 5F6BA 1SY0A 4N7DA 1JZUA 2A2GA 3T6LA 4XMFA 1RSTB 4I3CA 2BSZA 3EW2A 3JSQA 4DCBA 1LF7A 3MG5A 1TOUA 2BHVA 2CAMA 3FDCA 1KT5A 2CZTA 3HWEA 4O4XA 4ORWA 4Y0RA 5EZ2A 3ZW1B 3HK1A 3KFHA 5LJGA 2AT6X 4GZVA 1TW4A 2RN4A 5HZ6A 3PP6A 2RTNB 5HCDC 1GKAB 5HCCC 3T1DA 4U8UN 1QFVA 4XMDA 4GU8A 1YP6A 4Y59A 3UEUA 3SLTA 2Z4IA 3U9PC 2X45A 3EM0A 3NPOA 5BVQA 2G78A 3SOTA 3RDXA 2WQAE 4OEMA 1KL4A 4IBAA 1BEBA 1AVEA 1KZXA 5D8JA 1VWKB 4IMNA 1SREA 2JOZA 2AF5A 1VPRA 1NP4A 4LZUA 3VG6A 2JN3A 1DV9A 2ZAIA 3B2KA 1JJXA 4XMCA 1LICA 1HMSA 2FR2A 3FMZA 4YVBA 3ZW0A 1UREA 3FYFA 1SXUA 1KT3A 3ZI8A 2QMIA 2QCBA 5K06A 2Q39A 2Q2PA 4MISA 3CBSA 1E02A 4ZHCA 3AKMA 4ID2A 5CSEA 1XCAA 4GETA 4BX5A 2UYWA 1SWUA 3LV4A 1GT5A 3STMX 1Y0GA 4ZHFA 5HAEA 4ML7B 2IZFB 2AT3X 2IZHB 4YGZA 4QGXA 1JYDA 2JU3A 3C76X 3L4RA 4KCAA 4TKHA 2DM5A 3TGCA 3RSWA 3QQ2A 1SXWA 2Q9SA 4JHQA 3I17A 4YDBA 5LJHA 2KD2A 1SRIA 1FE3A 4HFOA 2AT0X 2A5CA 5CYBA 1DZMA 1BJ7A 1BSQA 3PEDA 1ERXA 1MOYA 4KH8A 4XMEA 3C77X 3RZYA 4AZMA 4YDAA 1IIUA 2L5PA 2OFAA 3F8AA 1OBQA 1PEEA 2RD7C 1U0XA 3HOLA 4GDAA 4WFUA 1VWNB 1GX8A 4Z27A 2RTEB 3HWFA 3OE3A 4LQZA 1ZNGA 2IZEB 1N43A 2AMMX 3VG2A 3CKFA 1Y53X 3FIDA 5EEEA 5H9LA 5F7GA 2GTLN 2WR6A 1W5RA 4QGWA 1P6PA 2JU8A 4Y5DA 3SZIA 2RTOB 4M6SA 3N91A 1SLFB 1N4JA 4OS8A 5B3MO 4CSBA 4OS0A 4O4UA 3PQUA 2O62A 3O22A 1YWBA 5B5GA 2KTSA 4GNYA 4D6AA 1GT4A 2Y3FA 4DQ4A 1OEEA 4GNWA 5DPQA 2A3FX 2CM9A 4O3XB 1PBYA 1DFVA 2PI3O 1L6MA 3P6GA 3VU1A 5KHPA 4WBKA 5FQ6E 2W2BA 4CDEA 2C1SA 4OELA 4PJ2A 4JGLA 4U8UM 3VPJE 1KOIA 2OFRX 4NLIA 5EDCA 2R74A 4I6SA 1ADLA 3SAOA 4QNIA 4Z2PA 4AZQA 4CDCA 1BM5A 1SMPI 3VG5A 3K3LA 1FELA 1VYOA 2OVAA 2YMSA 2BS5A 3NX1A 4O3YA 1LNMA 1MVGA 1QQSA 3P6EA 4ZHGA 1SWTA 3C78X 3KFGA 1IKEA 2GC9A 2Q4NA 1A2DA 1RLBE 1YWAA 3FR4A 5LKEA 1KL3A 2OL8O 1TVQA 1VYFA 2QO4A 4QAEA 3WBGA 4O9SA 4ZGUA 1CRBA 1SLDB 1NDJA 2FS6A 4A1YA 4ZH9A 3VG3A 1STSB 4CPFA 2JW1A 4ZR2A 4CDDA 1IFCA 1ICMA 3RBYA 2E4JA 3VG7A 4AZOA 1ZNKA 4FQBB 4BOEA 5B29A 1NQNA 4GGRA 3TGBA 2AVIA 3ZUIA 2LBVA 1HMRA 1SLEB 2Z4HA 4AW8A 2ACOA 3JQOA 1LPJA 2XKLA 1QY1A 2FR3A 3STNA 3CQNA 5D47A 1OSPO 2A0AA 3BSZE 4NP1A 3UEXA 3P6CA 3VE1A 1VWIB 1EPBA 1LELA 3BX8A 1KQWA 3ELZA 2POAA 4NYRA 2OF9A 3U03A 1EUOA 1N7YA 4L3RA 5AQ6A 4AZRA 2K23A 2X8SA 5KICA 1HXLA 4YFQA 2IZIA 4JO6A 2BT9A 1SRJA 4EDEA 2QOSC 4EQAC 5HTDA 1CJ5A 4UU2A 1VWEB 1AELA 2FGSA 2RCQA 4ZGFA 1HMTA 1MUPA 1KT7A 1OPBA 1SWFA 2X4MA 4ORYA 4GJSA 3JS1A 2RTFB 2WSJA 4NYQA 3D9WA 4BCSA 5FQ7E 1ERBA 1KL5A 4GDZA 4KIIA 1XKIA 3HTYA 3EYCA 3B2HA 1GT1A 1ZNHA 2RTBB 4ZJ0A 5EPQA 1SY1A 3T6FA 2KT4B 1E00A 3PECA 3PH6A 2ASNX 4CPEA 4ZH6A 2OY1O 1S44A 2FLJA 2FRSA 2L9CA 3FENA 1RAVA 4NNSA 4TLJA 4U3QA 1SXXA 2JU7A 4KC7A 4IRWA 1VWQB 4YGHA 4YGGA 1I05A 2GTLM 3NP1A 2K62A 1NP1A 1DF3A 1DC9A 3P24A 3P6HA 3QKGA 3ZW0B 2X55A 1AB0A 1BRQA 1EI5A 2A5BA 2IZGB 5H9KA 4CPHB 1BSYA 1UYNX 2A2UA 4YCEA 2CBRA 2FKGA 1MX8A 3WVMA 2C1QA 1EPAA 2Y3EA 1X89A 1OBUA 4UU3A 1VYGA 3NQ9A 3WZPA 4Y0SA 3O2YA 3S60A 2RTAA 1X71A 5HZQA 4ALOA 1RXHA 1KGLA 2QM9A 3BLGA 2RTGB 3D97A 3NBXX 3FA6A 1BRPA 3Q6LA 4OS3A 1GM6A 1I4UA 1STPA 4KT5A 1LIEA 1NQMA 2RTPB 1VWFB 4I60A 5CE4A 1KT6A 2OVDA 3PQSA 2MWHA 2YG2A 1EIOA 2QO6A 1MK5A 2RTDB 3EBWA 4IB9A 4AZNA 4XMHA 3RDOA 3UEVA 4BQUA 1QFTA 5AEOA 3TGAA 3FA8A 4ARHA 3RKGA 4IB8A 2R73A 1GT3A 3B2LA 3TF6A 1JV4A 1HN2A 1AVGI 4HWMA 3ZW1A 3CR6A 1QABE 5JR8A 1SWDA 4FBVA 3MVFA 3RDQA 1GKAA 4Y0PA 1ICNA 1VWGB 2NNDA 3MBTA 2JMBA 4TKJA 2C4IA 4HPCA 1SWEA 1RXKA 1LIFA 2MHDA 3FW5A 3S5XA 3CQRA 1FENA 1RXJA 1SWGA 5HBSA 4IB7A 5F2BA 1SWSA 4FBRA 1TOWA 1VWRB 3IA8A 5IO5A 4CK4A 3GAQA 4YBUA 4DQ3A 1QY2A 1LUQA 1SWHA 4I3BA 2F09A 4ODDA 3SZHA 2OY8A 4OMXA 5B5FA 2WQ9A 1E06A 3WZQA 3T2WA 1LFOA 1SWBA 1YWDA 5EEDA 3O19A 3P6DA 2IZCB 3S26A 5IO7A 1BLRA 1U18A 4N7CA 1G7NA 2L68A 4NW4A 1ALBA 1I78A 1DF8A 4QRLA 3EBKA 3BU9A 4EEJA 5FFHA 3F9DA 5B11O 1KQXA 1AVDA 2EU7X 4QYPA 3BU1A 4BX7B 4Z28A 3FIQA 2CBSA 3OJYC 2VFBA 1U17A 3SLJA 1H91A 1OEJA 1W4TA 3APUA 3CWKA 1ML7A 4NV8A 4ALBA 2FWVA 2WEWA 3G7XA 5BYPA 4I95A 3NQ3A 3RDMA 2OYBO 1Y9TA 4XMGA 4YBPA 4ZFXA 2CZUA 1IFBA 1VWOB 3PH5A 4LZVA 1VWCB 1SWCA 3B2JA 4BBOA 1KFFA 2HZQA 3BS2A 1HXZA 1SWPA 2M4LA 2X8TA 2X32A 5HCEC 2OFMX 5L8OA 1YP7A 1LDQA 3RE5A 4ORUA 4GD9A 1LCZA 3BX7A 2PY1A 2RTKA 3DTQA 1YIVA 5FQ8E 3V8UA 1VWJB 5H9NA 3VGWA 1OPAA 2OL7A 5AJBA 5D4AA 2OVSA 3APXA 4KC8A 2GH7A 3VG4A 4MIRA 3ZZVA 1WBIA 3VHMA 2Q2MA 4GKCA 1NGLA 1VWDB 1JBHA 3AEHA 3WJBA 4MEEA 2ZAGA 2WUTA 1ZNDA 4QQ1A 3WZOA 2IZKA 1GX3A 2OFBA 4IAWA 3EW1A 4RUUA 2X46A 4FBOA 1RSUB 1DZJA 1Z24A 2RTMA 4OMWA 4YKMA 4GUZA 4NLJA 4ZHHA 2ZSCA 1N9YA 5B27A 4A60A 3Q34A 5IRAA 2RTRB 1O8VA 3HPEA 1DZPA 2RCTA 2WEXA 3ELXA 4MVLA 4O49A 5H8TA 3PPTA 5LJEA 5HTEA 1HY2A 2ALLX 2LA7A 3UAQA 1JYJA 1JMXA 4O3WA 1SLGB 1A18A 4QYNA 2X56A 3P02A 1HBQA 2QOMA 4GGZA 4ZCBA 4WFVA 1QY0A 5LJDA 4QZUA 1ACDA 3BRNA 5BVTA 5BVSA 3VHHA 4C5PA 1CBRA 1D3SA 1NC9A 1O1UA 1PTSA 3FW4A 1ZNLA 1JJUA 1IKJA 1KXOA 2BS6A 3WJGA 4BX6A 1FJ1E 1MM9A 3UEWA 4COTA 1EALA 1LIBA 2MO5A 2NNQA 3CMPA 1VWHB 4GK9A 2OY5O 1G5WA 1X8PA 3AKNA 5LKFA 1Y52X 2L67A 1YUPA 1G74A 1SWRA 2R56A 3IFBA 4OKAA 3VE2A 3FLLA 4YH0A 5HA0A 2QO5A 1PM1X 1O1VA 2UZ2A 1JIWI 2GJ5A 3D96A 3F6ZB 4GGTA 3VHIA 4CV7A 1KZWA 4Z2VA 1Y55X 4U46A 3WXQA 4ZHDA 5HZ9A 1OEKA 1VWAB 1LDOA 1SY2A 3TZSA 2OY7A 3D4RA 1IW2A 4TKBA 2DJFA 2LBAA 4BX5B 5B10O 3FA7A 3BY0A 4LKTA 3WJCA 1S7DA 2AKQA 1QWDA 5EDBA 3HOEA 1QG5A 1SY3A 1UZ2X 3NR3A 4YFPA 5FENA 5D48A 4ON1A 1X8UA 2RTIB 2W2FA 4AZPA 4HPDA 4DNEA 2NNEA 3APWA 2FTBA 4I9SA 4Y0QA 1T8VA 4HPBA 1G85A 2KW1A 4I3DA 4MVIA 4YFRA 3H3IA 3OD9A 2LB6A 3RDSA 1WUBA 1SWQA 1EXSA 2MJIA 1B56A 2VDFA 2BLGA 1S2PA 5JD2A 2IZDB 3S5VA 5FAZA 1TXLA 2HZRA 3NADA 4IABA 4B55A 1STRB 3WZNA 4CPIA 3FR2A 2VFCA 3ZUOA 4K19A 4BJ8A 2FS7A 1EIIA 3KFIA 5HZ5A 2IZLB 5IRUA 3EMMA 3KZAA 2IZBA 2OL6O 4U8UO
chains in the Genus database with same CATH topology
1I04A 5F58A 1T0VA 5AJCA 1PMPA 2LKKA 1MX7A 2NP1A 5HWZA 4BVMA 2GTFX 4L1NA 2AL0X 2N93A 3E3CA 4IAXA 2X8FA 4IB6A 2HYSA 4M7MA 4HPAA 3ZQ3A 1R0UA 3KFFA 1JJJA 3FA9A 3I0AA 5LJKA 1E5PA 2W2AA 4MVKA 2RQ0A 1A3YA 1Y9LA 4ES7A 4A1HA 1GX9A 2HLVA 1BBPA 5C0NA 4ORXA 2AT8X 5DG4A 1A57A 3FR5A 4EFGA 4GE1A 2F73A 3ZWEA 2OVEA 4TQ2A 4YMYA 4INNA 1CBSA 3P6FA 1T68X 3WJEA 5HA1A 1SA8A 4TJZA 3NX2A 3NQKA 2CM4A 3OBLA 1CBIA 1FTPA 4EXZA 4ORSA 2RA6A 4O4SA 2HMBA 1EQDA 1B0OA 1X8QA 4O4OA 4YKOA 1FEMA 5L8NA 4NNTA 2WWPA 2AH7X 4PSQA 3MX7A 4D6BA 5LJBA 1KT4A 3BDRA 1CBQA 1D2UA 1GXAA 2GTLO 5IO6A 2A13A 1HBPA 1AQBA 4QGVA 4IMOA 3STKA 2MM3A 4ORRA 3D95A 3APVA 3U0DA 5D45A 3B2IA 3LHNA 4AYHA 1B4MA 5HZ8A 2ACPX 1GGLA 4YCHA 2ANSA 2IFBA 2OZQA 1RBPA 1LIDA 4QZTA 5LJEA 4I9RA 1ZNEA 4FGIB 4GRJA 3WJDA 4WHIA 4R0BA 4A8ZA 1B8EA 3FELA 1LKEA 1I06A 5F6ZA 4MVEA 5H9AA 2KTDA 3HWDA 1HQPA 1PBOA 1FDQA 3CBCA 3DSZA 5L8IA 3FEKA 3HWGA 1MDCA 3RWXA 3GE2A 3ZW2A 1DZKA 5F1EA 4LKPA 5KIDA 4TNNA 2XSTA 2P8GA 2AT5X 4O3ZA 1SXYA 2LFOA 1X8OA 2G7BA 3KQ0A 5LJCA 1OBPA 2FT9A 1EW3A 3FEPA 1ZRYA 3WJFA 4RUNA 2G79A 1BSOA 4GH7A 2HNXA 4U9CA 1YWCA 1X8NA 1BWYA 1N0SA 3WOVA 5F6BA 1SY0A 4N7DA 1JZUA 2A2GA 4XMFA 4I3CA 3JSQA 1LF7A 1TOUA 2BHVA 3HWEA 4O4XA 1KT5A 2CZTA 4ORWA 4Y0RA 5EZ2A 3ZW1B 3HK1A 3KFHA 5LJGA 2AT6X 4GZVA 1TW4A 2RN4A 5HZ6A 3PP6A 5HCDC 1GKAB 5HCCC 3T1DA 4U8UN 1QFVA 4XMDA 4GU8A 1YP6A 3UEUA 2Z4IA 3U9PC 2X45A 3EM0A 3NPOA 5BVQA 2G78A 3SOTA 2WQAE 4IBAA 1BEBA 1KZXA 5D8JA 4IMNA 2JOZA 4LZUA 1VPRA 1NP4A 3VG6A 2JN3A 1DV9A 2ZAIA 3B2KA 1JJXA 4XMCA 1LICA 1HMSA 2FR2A 3FMZA 3ZW0A 1UREA 3FYFA 1SXUA 1KT3A 3ZI8A 2QMIA 5K06A 2Q39A 2Q2PA 4MISA 3CBSA 1E02A 4ZHCA 3AKMA 4ID2A 1XCAA 4GETA 3LV4A 1GT5A 3STMX 4ZHFA 5HAEA 4ML7B 2AT3X 4YGZA 4QGXA 1JYDA 2JU3A 3C76X 3L4RA 4KCAA 4TKHA 2DM5A 3TGCA 3RSWA 4YDBA 1SXWA 2Q9SA 3I17A 5LJHA 2KD2A 1FE3A 4HFOA 2AT0X 5CYBA 1DZMA 1BJ7A 1BSQA 3PEDA 1ERXA 4KH8A 4XMEA 3RZYA 3C77X 4AZMA 4YDAA 1IIUA 2L5PA 3F8AA 1PEEA 1OBQA 2RD7C 1U0XA 3HOLA 4WFUA 1GX8A 3OE3A 3HWFA 4LQZA 3VG2A 1ZNGA 2AMMX 5EEEA 5H9LA 5F7GA 2GTLN 2WR6A 4QGWA 1P6PA 2JU8A 4M6SA 3N91A 4OS8A 4CSBA 4OS0A 4O4UA 3PQUA 2O62A 3O22A 1YWBA 2KTSA 4GNYA 4D6AA 1GT4A 4DQ4A 1OEEA 4GNWA 5DPQA 2A3FX 2CM9A 4O3XB 1DFVA 3P6GA 1L6MA 3VU1A 5KHPA 4WBKA 5FQ6E 2W2BA 4PJ2A 4JGLA 4U8UM 3VPJE 1KOIA 2OFRX 4NLIA 5EDCA 2R74A 4I6SA 1ADLA 3SAOA 4QNIA 4AZQA 1BM5A 1SMPI 3VG5A 3K3LA 1FELA 2OVAA 2YMSA 2BS5A 3NX1A 4O3YA 1LNMA 1MVGA 1QQSA 3P6EA 4ZHGA 3C78X 3KFGA 1IKEA 2GC9A 2Q4NA 1A2DA 1RLBE 1YWAA 3FR4A 5LKEA 4ZGUA 1TVQA 1VYFA 2QO4A 4QAEA 3WBGA 4O9SA 1CRBA 2FS6A 4A1YA 4ZH9A 3VG3A 2JW1A 4ZR2A 1IFCA 1ICMA 3RBYA 2E4JA 3VG7A 4AZOA 1ZNKA 4FQBB 4BOEA 5B29A 3TGBA 3ZUIA 2LBVA 1HMRA 2Z4HA 4AW8A 2ACOA 3JQOA 1LPJA 2XKLA 1QY1A 2FR3A 3STNA 3CQNA 5D47A 2A0AA 3BSZE 3UEXA 4NP1A 3VE1A 3P6CA 3WXQA 1EPBA 4NYRA 3BX8A 1KQWA 3ELZA 2POAA 3U03A 1EUOA 4L3RA 5AQ6A 4AZRA 2K23A 2X8SA 5KICA 4YFQA 2BT9A 4EDEA 2QOSC 4EQAC 5HTDA 1CJ5A 4UU2A 1AELA 2RCQA 4ZGFA 1HMTA 1MUPA 1KT7A 1OPBA 4ORYA 4NYQA 3JS1A 2WSJA 5FQ7E 1ERBA 4GDZA 4KIIA 1XKIA 3HTYA 3EYCA 3B2HA 1GT1A 1ZNHA 4ZJ0A 5EPQA 1SY1A 2KT4B 1E00A 3PECA 3PH6A 2ASNX 4ZH6A 1S44A 2FLJA 2FRSA 2L9CA 3FENA 4NNSA 4TLJA 4U3QA 1SXXA 2JU7A 4KC7A 4YGHA 4YGGA 1I05A 2GTLM 3NP1A 2K62A 1NP1A 1DF3A 1DC9A 3P24A 3P6HA 3QKGA 3ZW0B 1AB0A 1BRQA 1EI5A 5H9KA 1BSYA 2A2UA 4YCEA 2CBRA 1MX8A 3WVMA 1EPAA 1X89A 1OBUA 4UU3A 1VYGA 3NQ9A 4Y0SA 3O2YA 3S60A 1X71A 5HZQA 4ALOA 1KGLA 2QM9A 3BLGA 3D97A 3NBXX 3FA6A 1BRPA 3Q6LA 4OS3A 1GM6A 1I4UA 4KT5A 1LIEA 5CE4A 1KT6A 2OVDA 3PQSA 2MWHA 2YG2A 1EIOA 2QO6A 3EBWA 4IB9A 4AZNA 4XMHA 3UEVA 4BQUA 5AEOA 1QFTA 3TGAA 3FA8A 4ARHA 3RKGA 4IB8A 2R73A 1GT3A 3B2LA 3TF6A 1JV4A 1HN2A 1AVGI 4HWMA 3ZW1A 3CR6A 1QABE 5JR8A 4FBVA 3MVFA 1GKAA 4Y0PA 1ICNA 2NNDA 3MBTA 2JMBA 4TKJA 4HPCA 2MHDA 1LIFA 3FW5A 3S5XA 3CQRA 1FENA 5HBSA 4IB7A 4FBRA 1TOWA 3IA8A 5IO5A 4CK4A 3GAQA 4YBUA 4DQ3A 1QY2A 4ODDA 4I3BA 2F09A 4OMXA 2WQ9A 1E06A 1LFOA 5EEDA 1YWDA 5IO7A 3O19A 3P6DA 1BLRA 3S26A 1U18A 4N7CA 1G7NA 2L68A 4NW4A 1ALBA 4QRLA 3EBKA 3BU9A 4EEJA 5FFHA 3F9DA 1KQXA 2EU7X 4QYPA 3BU1A 3FIQA 2CBSA 3OJYC 1U17A 1H91A 1OEJA 3APUA 3CWKA 1ML7A 4ALBA 2FWVA 2WEWA 3G7XA 5BYPA 4I95A 3NQ3A 1Y9TA 4XMGA 4YBPA 4ZFXA 2CZUA 1IFBA 3PH5A 4LZVA 3B2JA 2HZQA 3BS2A 2X8TA 2M4LA 5HCEC 5L8OA 2OFMX 1YP7A 4ORUA 3BX7A 2PY1A 3DTQA 5FQ8E 1YIVA 3V8UA 5H9NA 1OPAA 5AJBA 5D4AA 2OVSA 3APXA 4KC8A 3VG4A 4MIRA 3ZZVA 2Q2MA 4GKCA 1NGLA 1JBHA 3WJBA 2ZAGA 2WUTA 1ZNDA 4QQ1A 4IAWA 1EALA 4RUUA 2X46A 4FBOA 4OMWA 1DZJA 1Z24A 4YKMA 4ZHHA 4NLJA 5B27A 4A60A 1O8VA 4MVLA 1DZPA 2RCTA 2WEXA 3ELXA 4O49A 5H8TA 3PPTA 5HTEA 2ALLX 2LA7A 3UAQA 1JYJA 4O3WA 1A18A 4QYNA 3P02A 1HBQA 4ZCBA 4WFVA 1QY0A 5LJDA 4QZUA 1ACDA 3BRNA 5BVTA 5BVSA 1CBRA 1D3SA 1O1UA 3FW4A 3WJGA 1ZNLA 2BS6A 1IKJA 1KXOA 3UEWA 4COTA 1LIBA 2MO5A 2NNQA 3CMPA 4GK9A 1G5WA 1X8PA 3AKNA 5LKFA 2L67A 1YUPA 1G74A 2R56A 3IFBA 3VE2A 3FLLA 4YH0A 5HA0A 2QO5A 1PM1X 1O1VA 4CV7A 1JIWI 2GJ5A 3D96A 3F6ZB 1KZWA 4ZHDA 5HZ9A 1OEKA 3TZSA 1SY2A 3D4RA 1IW2A 4TKBA 2LBAA 3FA7A 3BY0A 4LKTA 3WJCA 1S7DA 2AKQA 1QWDA 5EDBA 3HOEA 1QG5A 1SY3A 1UZ2X 3NR3A 4YFPA 5FENA 5D48A 4ON1A 1X8UA 2W2FA 4AZPA 4HPDA 2NNEA 3APWA 2FTBA 4I9SA 4Y0QA 1T8VA 4HPBA 1G85A 2KW1A 4I3DA 4MVIA 4YFRA 3H3IA 3OD9A 2LB6A 1EXSA 2MJIA 1B56A 2BLGA 1S2PA 3S5VA 5FAZA 2HZRA 1TXLA 3NADA 4IABA 3FR2A 3ZUOA 4K19A 2FS7A 1EIIA 3KFIA 5HZ5A 3EMMA 3KZAA 4U8UO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I04 A;  5F58 A;  1T0V A;  1PMP A;  2LKK A;  1MX7 A;  2NP1 A;  5HWZ A;  4BVM A;  2GTF X;  2AL0 X;  2N93 A;  4IAX A;  4IB6 A;  2HYS A;  4M7M A;  4HPA A;  3ZQ3 A;  1R0U A;  3KFF A;  1JJJ A;  3FA9 A;  3I0A A;  5LJK A;  1E5P A;  2W2A A;  4MVK A;  2RQ0 A;  1A3Y A;  4ES7 A;  4A1H A;  1GX9 A;  2HLV A;  1BBP A;  5C0N A;  4ORX A;  2AT8 X;  5DG4 A;  1A57 A;  3FR5 A;  4EFG A;  4GE1 A;  2F73 A;  2OVE A;  4TQ2 A;  4YMY A;  1CBS A;  3P6F A;  1T68 X;  3WJE A;  5HA1 A;  1SA8 A;  4TJZ A;  3NX2 A;  2CM4 A;  1CBI A;  1FTP A;  4EXZ A;  4ORS A;  2RA6 A;  2HMB A;  1EQD A;  1B0O A;  1X8Q A;  4YKO A;  1FEM A;  5L8N A;  4NNT A;  2WWP A;  2AH7 X;  4PSQ A;  4D6B A;  5LJB A;  1KT4 A;  3BDR A;  1CBQ A;  1D2U A;  1GXA A;  5IO6 A;  2A13 A;  1HBP A;  1AQB A;  4QGV A;  4IMO A;  3STK A;  2MM3 A;  4ORR A;  3D95 A;  3APV A;  3U0D A;  5D45 A;  3B2I A;  4AYH A;  1B4M A;  5HZ8 A;  2ACP X;  1GGL A;  4YCH A;  2ANS A;  2IFB A;  2OZQ A;  1RBP A;  1LID A;  4QZT A;  5LJE A;  4I9R A;  1ZNE A;  4GRJ A;  3WJD A;  4R0B A;  4A8Z A;  1B8E A;  3FEL A;  1LKE A;  1I06 A;  5F6Z A;  5H9A A;  2KTD A;  3HWD A;  1HQP A;  1PBO A;  1FDQ A;  3CBC A;  3DSZ A;  5L8I A;  3FEK A;  3HWG A;  1MDC A;  1DZK A;  5F1E A;  4LKP A;  5KID A;  4TNN A;  2XST A;  2P8G A;  2AT5 X;  1SXY A;  2LFO A;  1X8O A;  2G7B A;  3KQ0 A;  5LJC A;  1OBP A;  2FT9 A;  1EW3 A;  3FEP A;  1ZRY A;  3WJF A;  4RUN A;  2G79 A;  1BSO A;  4GH7 A;  2HNX A;  1YWC A;  1X8N A;  1BWY A;  1N0S A;  5F6B A;  1SY0 A;  4N7D A;  1JZU A;  2A2G A;  4XMF A;  4I3C A;  3JSQ A;  1LF7 A;  1TOU A;  4ORW A;  3HWE A;  1KT5 A;  2CZT A;  4Y0R A;  5EZ2 A;  3HK1 A;  3KFH A;  5LJG A;  2AT6 X;  1TW4 A;  5HZ6 A;  3PP6 A;  5HCD C;  1GKA B;  5HCC C;  3T1D A;  1QFV A;  4XMD A;  1YP6 A;  3UEU A;  3U9P C;  2X45 A;  3EM0 A;  3NPO A;  5BVQ A;  2G78 A;  2WQA E;  4IBA A;  1BEB A;  1KZX A;  5D8J A;  4IMN A;  2JOZ A;  4LZU A;  1VPR A;  1NP4 A;  3VG6 A;  2JN3 A;  1DV9 A;  3B2K A;  1JJX A;  4XMC A;  1LIC A;  1HMS A;  2FR2 A;  3FMZ A;  1URE A;  1SXU A;  1KT3 A;  5K06 A;  2Q39 A;  2Q2P A;  3CBS A;  1E02 A;  4ZHC A;  3AKM A;  1XCA A;  4GET A;  1GT5 A;  3STM X;  4ZHF A;  5HAE A;  2AT3 X;  4YGZ A;  4QGX A;  1JYD A;  2JU3 A;  3C76 X;  3L4R A;  3TGC A;  4TKH A;  2DM5 A;  3RSW A;  4YDB A;  1SXW A;  2Q9S A;  3I17 A;  5LJH A;  1FE3 A;  4HFO A;  2AT0 X;  1DZM A;  1BJ7 A;  1BSQ A;  3PED A;  1ERX A;  4XME A;  3RZY A;  3C77 X;  4AZM A;  4YDA A;  1IIU A;  2L5P A;  3F8A A;  1PEE A;  1OBQ A;  2RD7 C;  1U0X A;  4WFU A;  1GX8 A;  3VG2 A;  3HWF A;  1ZNG A;  2AMM X;  5EEE A;  5H9L A;  5F7G A;  2WR6 A;  4QGW A;  1P6P A;  2JU8 A;  4M6S A;  4OS8 A;  4OS0 A;  2O62 A;  3O22 A;  1YWB A;  4GNY A;  4D6A A;  1GT4 A;  4DQ4 A;  1OEE A;  4GNW A;  5DPQ A;  2A3F X;  2CM9 A;  1DFV A;  3P6G A;  1L6M A;  5KHP A;  4WBK A;  2W2B A;  1KOI A;  2OFR X;  4NLI A;  5EDC A;  2R74 A;  1ADL A;  3SAO A;  4AZQ A;  1BM5 A;  3VG5 A;  3K3L A;  1FEL A;  2OVA A;  3NX1 A;  1LNM A;  1MVG A;  1QQS A;  3P6E A;  4ZHG A;  3C78 X;  3KFG A;  1IKE A;  2GC9 A;  2Q4N A;  1A2D A;  1RLB E;  1YWA A;  3FR4 A;  5LKE A;  4ZGU A;  1TVQ A;  1VYF A;  2QO4 A;  4QAE A;  3WBG A;  4O9S A;  1CRB A;  2FS6 A;  4A1Y A;  4ZH9 A;  3VG3 A;  4ZR2 A;  1IFC A;  1ICM A;  3VG7 A;  2E4J A;  4AZO A;  5B29 A;  1ZNK A;  4BOE A;  3TGB A;  3ZUI A;  2LBV A;  1HMR A;  4AW8 A;  2ACO A;  1LPJ A;  2XKL A;  1QY1 A;  2FR3 A;  3STN A;  3CQN A;  5D47 A;  2A0A A;  3BSZ E;  3UEX A;  4NP1 A;  3WXQ A;  3P6C A;  1EPB A;  4NYR A;  3BX8 A;  1KQW A;  3ELZ A;  2POA A;  3U03 A;  1EUO A;  5AQ6 A;  4AZR A;  2K23 A;  4YFQ A;  4EDE A;  2QOS C;  5HTD A;  1CJ5 A;  4UU2 A;  1AEL A;  2RCQ A;  1HMT A;  1MUP A;  1KT7 A;  1OPB A;  4ORY A;  4NYQ A;  3JS1 A;  2WSJ A;  1ERB A;  4KII A;  1XKI A;  3EYC A;  3B2H A;  1GT1 A;  1ZNH A;  4ZJ0 A;  5EPQ A;  1SY1 A;  2KT4 B;  1E00 A;  3PEC A;  3PH6 A;  2ASN X;  4ZH6 A;  1S44 A;  2FLJ A;  2FRS A;  2L9C A;  3FEN A;  4NNS A;  4TLJ A;  1SXX A;  2JU7 A;  4YGH A;  4YGG A;  1I05 A;  3NP1 A;  2K62 A;  1NP1 A;  1DF3 A;  1DC9 A;  3QKG A;  3P6H A;  1AB0 A;  1BRQ A;  5H9K A;  1BSY A;  2A2U A;  4YCE A;  2CBR A;  1MX8 A;  3WVM A;  1EPA A;  1X89 A;  1OBU A;  4UU3 A;  1VYG A;  3NQ9 A;  4Y0S A;  3O2Y A;  1X71 A;  5HZQ A;  4ALO A;  1KGL A;  2QM9 A;  3BLG A;  3D97 A;  3FA6 A;  1BRP A;  3Q6L A;  4OS3 A;  1GM6 A;  1I4U A;  1LIE A;  5CE4 A;  1KT6 A;  2OVD A;  2YG2 A;  1EIO A;  2QO6 A;  3EBW A;  4IB9 A;  4AZN A;  4XMH A;  3UEV A;  4BQU A;  1QFT A;  3TGA A;  3FA8 A;  4ARH A;  4IB8 A;  2R73 A;  1GT3 A;  3B2L A;  3TF6 A;  1JV4 A;  1HN2 A;  1AVG I;  3CR6 A;  1QAB E;  5JR8 A;  3MVF A;  1GKA A;  4Y0P A;  1ICN A;  2NND A;  3MBT A;  4TKJ A;  4HPC A;  3FW5 A;  1LIF A;  3CQR A;  1FEN A;  5HBS A;  4IB7 A;  1TOW A;  3IA8 A;  5IO5 A;  4CK4 A;  3GAQ A;  4YBU A;  4DQ3 A;  1QY2 A;  4ODD A;  4I3B A;  4OMX A;  2WQ9 A;  1E06 A;  1LFO A;  5EED A;  1YWD A;  5IO7 A;  3O19 A;  3P6D A;  1BLR A;  3S26 A;  1U18 A;  4N7C A;  1G7N A;  2L68 A;  1ALB A;  3EBK A;  3BU9 A;  4EEJ A;  5FFH A;  3F9D A;  1KQX A;  2EU7 X;  4QYP A;  3BU1 A;  3FIQ A;  2CBS A;  3OJY C;  1U17 A;  1H91 A;  1OEJ A;  3APU A;  3CWK A;  1ML7 A;  4ALB A;  2FWV A;  2WEW A;  3G7X A;  3NQ3 A;  4XMG A;  4YBP A;  4ZFX A;  2CZU A;  1IFB A;  3PH5 A;  4LZV A;  3B2J A;  2HZQ A;  3BS2 A;  5HCE C;  5L8O A;  2OFM X;  1YP7 A;  4ORU A;  3BX7 A;  2PY1 A;  3DTQ A;  1YIV A;  5H9N A;  1OPA A;  5D4A A;  3APX A;  3VG4 A;  2Q2M A;  4GKC A;  1NGL A;  1JBH A;  3WJB A;  2WUT A;  1ZND A;  4IAW A;  1EAL A;  4RUU A;  2X46 A;  4OMW A;  1DZJ A;  1Z24 A;  4YKM A;  4ZHH A;  4NLJ A;  5B27 A;  4A60 A;  1O8V A;  4MVL A;  1DZP A;  2RCT A;  2WEX A;  3ELX A;  5H8T A;  3PPT A;  5HTE A;  2ALL X;  1JYJ A;  1A18 A;  4QYN A;  1HBQ A;  4ZCB A;  4WFV A;  1QY0 A;  5LJD A;  4QZU A;  1ACD A;  3BRN A;  5BVT A;  5BVS A;  1CBR A;  1D3S A;  1O1U A;  3FW4 A;  3WJG A;  1ZNL A;  1IKJ A;  1KXO A;  3UEW A;  1LIB A;  2MO5 A;  2NNQ A;  3CMP A;  1G5W A;  1X8P A;  3AKN A;  5LKF A;  2L67 A;  1YUP A;  1G74 A;  2R56 A;  3IFB A;  3FLL A;  4YH0 A;  5HA0 A;  2QO5 A;  1PM1 X;  1O1V A;  2GJ5 A;  3D96 A;  1KZW A;  4ZHD A;  5HZ9 A;  1OEK A;  3TZS A;  1SY2 A;  1IW2 A;  4TKB A;  2LBA A;  3FA7 A;  3BY0 A;  4LKT A;  3WJC A;  1S7D A;  2AKQ A;  1QWD A;  5EDB A;  5FEN A;  1QG5 A;  1SY3 A;  1UZ2 X;  3NR3 A;  4YFP A;  5KIC A;  5D48 A;  1X8U A;  2W2F A;  4AZP A;  4HPD A;  2NNE A;  3APW A;  2FTB A;  4I9S A;  4Y0Q A;  1T8V A;  4HPB A;  1G85 A;  4I3D A;  4MVI A;  4YFR A;  2LB6 A;  1EXS A;  2MJI A;  1B56 A;  2BLG A;  1S2P A;  5FAZ A;  2HZR A;  1TXL A;  3NAD A;  3FR2 A;  3ZUO A;  4K19 A;  2FS7 A;  1EII A;  3KFI A;  5HZ5 A;  3EMM A;  3KZA A; 
#chains in the Genus database with same CATH topology
 1I04 A;  5F58 A;  1VWM B;  1W6F A;  3KVN A;  2HKD A;  1SWO A;  5CHK A;  1T0V A;  3T2X A;  5AJC A;  4CPH A;  1PMP A;  2LKK A;  1MX7 A;  1VWB B;  2NP1 A;  5HWZ A;  4BVM A;  2GTF X;  4Z6J A;  4L1N A;  2AL0 X;  2N93 A;  3E3C A;  1HQQ A;  4IAX A;  2RTQ B;  2X8F A;  4IB6 A;  2DJG A;  1SWA A;  2HYS A;  4M7M A;  2F01 A;  1E2T A;  1I9H A;  4HPA A;  3ZQ3 A;  1R0U A;  3KFF A;  1JJJ A;  3FA9 A;  3I0A A;  5LJK A;  2Y32 A;  1VWP B;  3RY1 A;  1E5P A;  5IRW A;  1LCV A;  2W2A A;  1SRG A;  3X00 A;  4MVK A;  3AUM O;  2RQ0 A;  1A3Y A;  1Y9L A;  2G5L A;  4ES7 A;  4A1H A;  2RTH B;  4NV7 A;  3WYQ A;  1GX9 A;  2A8G A;  2HLV A;  2RTC B;  2X34 A;  3CKG A;  1BBP A;  1UYO X;  5C0N A;  4ORX A;  2AT8 X;  5DG4 A;  1A57 A;  3FR5 A;  4EFG A;  4GE1 A;  2F73 A;  1SWK A;  5B2A O;  3ZWE A;  2OVE A;  2I5V O;  2RTL A;  4TQ2 A;  3MM0 A;  3PK2 A;  4YMY A;  2FHN X;  4INN A;  1CBS A;  3P6F A;  4GJV A;  1T68 X;  1VWL B;  3WJE A;  5HA1 A;  3SLO A;  1SA8 A;  4TJZ A;  1JMZ A;  2JGS A;  3NX2 A;  3NQK A;  2CM4 A;  3OBL A;  1CBI A;  2WPU A;  3RY2 A;  1FTP A;  4EXZ A;  4BGF A;  4ORS A;  2RA6 A;  1SWL A;  4O4S A;  1MEP A;  1EQD A;  1B0O A;  1X8Q A;  2HMB A;  4EKV A;  4O4O A;  3RDU A;  3PDF A;  1FEM A;  4YKO A;  5K67 A;  5L8N A;  2FHL A;  4NNT A;  2WWP A;  3LTW A;  2AH7 X;  2MF6 A;  1JQP A;  4PSQ A;  3MX7 A;  4D6B A;  5IXG A;  1SRF A;  5L3Y A;  5LJB A;  1KT4 A;  3BDR A;  1CBQ A;  1D2U A;  1GXA A;  2GTL O;  5IO6 A;  2A13 A;  1HBP A;  1AQB A;  4QGV A;  4IMO A;  3STK A;  2MM3 A;  4ORR A;  3D95 A;  1IJ8 A;  3APV A;  4CDF A;  3EC5 A;  3U0D A;  5D45 A;  2RTJ A;  3RE6 A;  2I5Z O;  1SWJ A;  3B2I A;  3LHN A;  4AYH A;  4BX7 A;  1B4M A;  4BX6 B;  5HZ8 A;  3WYP A;  2ACP X;  1GGL A;  4YCH A;  2ANS A;  2IFB A;  2OZQ A;  1RBP A;  1LID A;  4QZT A;  1LCW A;  1SWN A;  4I9R A;  1ZNE A;  4FGI B;  4GRJ A;  5K68 A;  4WHI A;  4R0B A;  3WJD A;  4A8Z A;  1B8E A;  3FEL A;  1LKE A;  1I06 A;  5F6Z A;  4MVE A;  5H9A A;  2FKJ A;  2KTD A;  3HWD A;  1HQP A;  1PBO A;  1SRH A;  1FDQ A;  3CBC A;  3DSZ A;  5L8I A;  3FEK A;  3HWG A;  1MDC A;  3RWX A;  3GE2 A;  4JNJ A;  1DZK A;  2OF8 A;  4LKP A;  5F1E A;  3ZW2 A;  5KID A;  4TNN A;  2XST A;  2P8G A;  2AT5 X;  2G8C O;  2IZJ A;  4O3Z A;  1SXY A;  2LFO A;  1X8O A;  2G7B A;  3KQ0 A;  5LJC A;  1OBP A;  2FT9 A;  1EW3 A;  1N9M A;  3FEP A;  2BC3 A;  1ZRY A;  2IZA A;  3WJF A;  4RUN A;  2G79 A;  1BSO A;  3SZJ A;  4GH7 A;  2HNX A;  4U9C A;  1YWC A;  1X8N A;  1K3B A;  1NBX A;  1BWY A;  4Z2O A;  1N0S A;  3WOV A;  1K24 A;  5F6B A;  1SY0 A;  4N7D A;  1JZU A;  2A2G A;  3T6L A;  4XMF A;  1RST B;  4I3C A;  2BSZ A;  3EW2 A;  3JSQ A;  4DCB A;  1LF7 A;  3MG5 A;  1TOU A;  2BHV A;  2CAM A;  3FDC A;  1KT5 A;  2CZT A;  3HWE A;  4O4X A;  4ORW A;  4Y0R A;  5EZ2 A;  3ZW1 B;  3HK1 A;  3KFH A;  5LJG A;  2AT6 X;  4GZV A;  1TW4 A;  2RN4 A;  5HZ6 A;  3PP6 A;  2RTN B;  5HCD C;  1GKA B;  5HCC C;  3T1D A;  4U8U N;  1QFV A;  4XMD A;  4GU8 A;  1YP6 A;  4Y59 A;  3UEU A;  3SLT A;  2Z4I A;  3U9P C;  2X45 A;  3EM0 A;  3NPO A;  5BVQ A;  2G78 A;  3SOT A;  3RDX A;  2WQA E;  4OEM A;  1KL4 A;  4IBA A;  1BEB A;  1AVE A;  1KZX A;  5D8J A;  1VWK B;  4IMN A;  1SRE A;  2JOZ A;  2AF5 A;  1VPR A;  1NP4 A;  4LZU A;  3VG6 A;  2JN3 A;  1DV9 A;  2ZAI A;  3B2K A;  1JJX A;  4XMC A;  1LIC A;  1HMS A;  2FR2 A;  3FMZ A;  4YVB A;  3ZW0 A;  1URE A;  3FYF A;  1SXU A;  1KT3 A;  3ZI8 A;  2QMI A;  2QCB A;  5K06 A;  2Q39 A;  2Q2P A;  4MIS A;  3CBS A;  1E02 A;  4ZHC A;  3AKM A;  4ID2 A;  5CSE A;  1XCA A;  4GET A;  4BX5 A;  2UYW A;  1SWU A;  3LV4 A;  1GT5 A;  3STM X;  1Y0G A;  4ZHF A;  5HAE A;  4ML7 B;  2IZF B;  2AT3 X;  2IZH B;  4YGZ A;  4QGX A;  1JYD A;  2JU3 A;  3C76 X;  3L4R A;  4KCA A;  4TKH A;  2DM5 A;  3TGC A;  3RSW A;  3QQ2 A;  1SXW A;  2Q9S A;  4JHQ A;  3I17 A;  4YDB A;  5LJH A;  2KD2 A;  1SRI A;  1FE3 A;  4HFO A;  2AT0 X;  2A5C A;  5CYB A;  1DZM A;  1BJ7 A;  1BSQ A;  3PED A;  1ERX A;  1MOY A;  4KH8 A;  4XME A;  3C77 X;  3RZY A;  4AZM A;  4YDA A;  1IIU A;  2L5P A;  2OFA A;  3F8A A;  1OBQ A;  1PEE A;  2RD7 C;  1U0X A;  3HOL A;  4GDA A;  4WFU A;  1VWN B;  1GX8 A;  4Z27 A;  2RTE B;  3HWF A;  3OE3 A;  4LQZ A;  1ZNG A;  2IZE B;  1N43 A;  2AMM X;  3VG2 A;  3CKF A;  1Y53 X;  3FID A;  5EEE A;  5H9L A;  5F7G A;  2GTL N;  2WR6 A;  1W5R A;  4QGW A;  1P6P A;  2JU8 A;  4Y5D A;  3SZI A;  2RTO B;  4M6S A;  3N91 A;  1SLF B;  1N4J A;  4OS8 A;  5B3M O;  4CSB A;  4OS0 A;  4O4U A;  3PQU A;  2O62 A;  3O22 A;  1YWB A;  5B5G A;  2KTS A;  4GNY A;  4D6A A;  1GT4 A;  2Y3F A;  4DQ4 A;  1OEE A;  4GNW A;  5DPQ A;  2A3F X;  2CM9 A;  4O3X B;  1PBY A;  1DFV A;  2PI3 O;  1L6M A;  3P6G A;  3VU1 A;  5KHP A;  4WBK A;  5FQ6 E;  2W2B A;  4CDE A;  2C1S A;  4OEL A;  4PJ2 A;  4JGL A;  4U8U M;  3VPJ E;  1KOI A;  2OFR X;  4NLI A;  5EDC A;  2R74 A;  4I6S A;  1ADL A;  3SAO A;  4QNI A;  4Z2P A;  4AZQ A;  4CDC A;  1BM5 A;  1SMP I;  3VG5 A;  3K3L A;  1FEL A;  1VYO A;  2OVA A;  2YMS A;  2BS5 A;  3NX1 A;  4O3Y A;  1LNM A;  1MVG A;  1QQS A;  3P6E A;  4ZHG A;  1SWT A;  3C78 X;  3KFG A;  1IKE A;  2GC9 A;  2Q4N A;  1A2D A;  1RLB E;  1YWA A;  3FR4 A;  5LKE A;  1KL3 A;  2OL8 O;  1TVQ A;  1VYF A;  2QO4 A;  4QAE A;  3WBG A;  4O9S A;  4ZGU A;  1CRB A;  1SLD B;  1NDJ A;  2FS6 A;  4A1Y A;  4ZH9 A;  3VG3 A;  1STS B;  4CPF A;  2JW1 A;  4ZR2 A;  4CDD A;  1IFC A;  1ICM A;  3RBY A;  2E4J A;  3VG7 A;  4AZO A;  1ZNK A;  4FQB B;  4BOE A;  5B29 A;  1NQN A;  4GGR A;  3TGB A;  2AVI A;  3ZUI A;  2LBV A;  1HMR A;  1SLE B;  2Z4H A;  4AW8 A;  2ACO A;  3JQO A;  1LPJ A;  2XKL A;  1QY1 A;  2FR3 A;  3STN A;  3CQN A;  5D47 A;  1OSP O;  2A0A A;  3BSZ E;  4NP1 A;  3UEX A;  3P6C A;  3VE1 A;  1VWI B;  1EPB A;  1LEL A;  3BX8 A;  1KQW A;  3ELZ A;  2POA A;  4NYR A;  2OF9 A;  3U03 A;  1EUO A;  1N7Y A;  4L3R A;  5AQ6 A;  4AZR A;  2K23 A;  2X8S A;  5KIC A;  1HXL A;  4YFQ A;  2IZI A;  4JO6 A;  2BT9 A;  1SRJ A;  4EDE A;  2QOS C;  4EQA C;  5HTD A;  1CJ5 A;  4UU2 A;  1VWE B;  1AEL A;  2FGS A;  2RCQ A;  4ZGF A;  1HMT A;  1MUP A;  1KT7 A;  1OPB A;  1SWF A;  2X4M A;  4ORY A;  4GJS A;  3JS1 A;  2RTF B;  2WSJ A;  4NYQ A;  3D9W A;  4BCS A;  5FQ7 E;  1ERB A;  1KL5 A;  4GDZ A;  4KII A;  1XKI A;  3HTY A;  3EYC A;  3B2H A;  1GT1 A;  1ZNH A;  2RTB B;  4ZJ0 A;  5EPQ A;  1SY1 A;  3T6F A;  2KT4 B;  1E00 A;  3PEC A;  3PH6 A;  2ASN X;  4CPE A;  4ZH6 A;  2OY1 O;  1S44 A;  2FLJ A;  2FRS A;  2L9C A;  3FEN A;  1RAV A;  4NNS A;  4TLJ A;  4U3Q A;  1SXX A;  2JU7 A;  4KC7 A;  4IRW A;  1VWQ B;  4YGH A;  4YGG A;  1I05 A;  2GTL M;  3NP1 A;  2K62 A;  1NP1 A;  1DF3 A;  1DC9 A;  3P24 A;  3P6H A;  3QKG A;  3ZW0 B;  2X55 A;  1AB0 A;  1BRQ A;  1EI5 A;  2A5B A;  2IZG B;  5H9K A;  4CPH B;  1BSY A;  1UYN X;  2A2U A;  4YCE A;  2CBR A;  2FKG A;  1MX8 A;  3WVM A;  2C1Q A;  1EPA A;  2Y3E A;  1X89 A;  1OBU A;  4UU3 A;  1VYG A;  3NQ9 A;  3WZP A;  4Y0S A;  3O2Y A;  3S60 A;  2RTA A;  1X71 A;  5HZQ A;  4ALO A;  1RXH A;  1KGL A;  2QM9 A;  3BLG A;  2RTG B;  3D97 A;  3NBX X;  3FA6 A;  1BRP A;  3Q6L A;  4OS3 A;  1GM6 A;  1I4U A;  1STP A;  4KT5 A;  1LIE A;  1NQM A;  2RTP B;  1VWF B;  4I60 A;  5CE4 A;  1KT6 A;  2OVD A;  3PQS A;  2MWH A;  2YG2 A;  1EIO A;  2QO6 A;  1MK5 A;  2RTD B;  3EBW A;  4IB9 A;  4AZN A;  4XMH A;  3RDO A;  3UEV A;  4BQU A;  1QFT A;  5AEO A;  3TGA A;  3FA8 A;  4ARH A;  3RKG A;  4IB8 A;  2R73 A;  1GT3 A;  3B2L A;  3TF6 A;  1JV4 A;  1HN2 A;  1AVG I;  4HWM A;  3ZW1 A;  3CR6 A;  1QAB E;  5JR8 A;  1SWD A;  4FBV A;  3MVF A;  3RDQ A;  1GKA A;  4Y0P A;  1ICN A;  1VWG B;  2NND A;  3MBT A;  2JMB A;  4TKJ A;  2C4I A;  4HPC A;  1SWE A;  1RXK A;  1LIF A;  2MHD A;  3FW5 A;  3S5X A;  3CQR A;  1FEN A;  1RXJ A;  1SWG A;  5HBS A;  4IB7 A;  5F2B A;  1SWS A;  4FBR A;  1TOW A;  1VWR B;  3IA8 A;  5IO5 A;  4CK4 A;  3GAQ A;  4YBU A;  4DQ3 A;  1QY2 A;  1LUQ A;  1SWH A;  4I3B A;  2F09 A;  4ODD A;  3SZH A;  2OY8 A;  4OMX A;  5B5F A;  2WQ9 A;  1E06 A;  3WZQ A;  3T2W A;  1LFO A;  1SWB A;  1YWD A;  5EED A;  3O19 A;  3P6D A;  2IZC B;  3S26 A;  5IO7 A;  1BLR A;  1U18 A;  4N7C A;  1G7N A;  2L68 A;  4NW4 A;  1ALB A;  1I78 A;  1DF8 A;  4QRL A;  3EBK A;  3BU9 A;  4EEJ A;  5FFH A;  3F9D A;  5B11 O;  1KQX A;  1AVD A;  2EU7 X;  4QYP A;  3BU1 A;  4BX7 B;  4Z28 A;  3FIQ A;  2CBS A;  3OJY C;  2VFB A;  1U17 A;  3SLJ A;  1H91 A;  1OEJ A;  1W4T A;  3APU A;  3CWK A;  1ML7 A;  4NV8 A;  4ALB A;  2FWV A;  2WEW A;  3G7X A;  5BYP A;  4I95 A;  3NQ3 A;  3RDM A;  2OYB O;  1Y9T A;  4XMG A;  4YBP A;  4ZFX A;  2CZU A;  1IFB A;  1VWO B;  3PH5 A;  4LZV A;  1VWC B;  1SWC A;  3B2J A;  4BBO A;  1KFF A;  2HZQ A;  3BS2 A;  1HXZ A;  1SWP A;  2M4L A;  2X8T A;  2X32 A;  5HCE C;  2OFM X;  5L8O A;  1YP7 A;  1LDQ A;  3RE5 A;  4ORU A;  4GD9 A;  1LCZ A;  3BX7 A;  2PY1 A;  2RTK A;  3DTQ A;  1YIV A;  5FQ8 E;  3V8U A;  1VWJ B;  5H9N A;  3VGW A;  1OPA A;  2OL7 A;  5AJB A;  5D4A A;  2OVS A;  3APX A;  4KC8 A;  2GH7 A;  3VG4 A;  4MIR A;  3ZZV A;  1WBI A;  3VHM A;  2Q2M A;  4GKC A;  1NGL A;  1VWD B;  1JBH A;  3AEH A;  3WJB A;  4MEE A;  2ZAG A;  2WUT A;  1ZND A;  4QQ1 A;  3WZO A;  2IZK A;  1GX3 A;  2OFB A;  4IAW A;  3EW1 A;  4RUU A;  2X46 A;  4FBO A;  1RSU B;  1DZJ A;  1Z24 A;  2RTM A;  4OMW A;  4YKM A;  4GUZ A;  4NLJ A;  4ZHH A;  2ZSC A;  1N9Y A;  5B27 A;  4A60 A;  3Q34 A;  5IRA A;  2RTR B;  1O8V A;  3HPE A;  1DZP A;  2RCT A;  2WEX A;  3ELX A;  4MVL A;  4O49 A;  5H8T A;  3PPT A;  5LJE A;  5HTE A;  1HY2 A;  2ALL X;  2LA7 A;  3UAQ A;  1JYJ A;  1JMX A;  4O3W A;  1SLG B;  1A18 A;  4QYN A;  2X56 A;  3P02 A;  1HBQ A;  2QOM A;  4GGZ A;  4ZCB A;  4WFV A;  1QY0 A;  5LJD A;  4QZU A;  1ACD A;  3BRN A;  5BVT A;  5BVS A;  3VHH A;  4C5P A;  1CBR A;  1D3S A;  1NC9 A;  1O1U A;  1PTS A;  3FW4 A;  1ZNL A;  1JJU A;  1IKJ A;  1KXO A;  2BS6 A;  3WJG A;  4BX6 A;  1FJ1 E;  1MM9 A;  3UEW A;  4COT A;  1EAL A;  1LIB A;  2MO5 A;  2NNQ A;  3CMP A;  1VWH B;  4GK9 A;  2OY5 O;  1G5W A;  1X8P A;  3AKN A;  5LKF A;  1Y52 X;  2L67 A;  1YUP A;  1G74 A;  1SWR A;  2R56 A;  3IFB A;  4OKA A;  3VE2 A;  3FLL A;  4YH0 A;  5HA0 A;  2QO5 A;  1PM1 X;  1O1V A;  2UZ2 A;  1JIW I;  2GJ5 A;  3D96 A;  3F6Z B;  4GGT A;  3VHI A;  4CV7 A;  1KZW A;  4Z2V A;  1Y55 X;  4U46 A;  3WXQ A;  4ZHD A;  5HZ9 A;  1OEK A;  1VWA B;  1LDO A;  1SY2 A;  3TZS A;  2OY7 A;  3D4R A;  1IW2 A;  4TKB A;  2DJF A;  2LBA A;  4BX5 B;  5B10 O;  3FA7 A;  3BY0 A;  4LKT A;  3WJC A;  1S7D A;  2AKQ A;  1QWD A;  5EDB A;  3HOE A;  1QG5 A;  1SY3 A;  1UZ2 X;  3NR3 A;  4YFP A;  5FEN A;  5D48 A;  4ON1 A;  1X8U A;  2RTI B;  2W2F A;  4AZP A;  4HPD A;  4DNE A;  2NNE A;  3APW A;  2FTB A;  4I9S A;  4Y0Q A;  1T8V A;  4HPB A;  1G85 A;  2KW1 A;  4I3D A;  4MVI A;  4YFR A;  3H3I A;  3OD9 A;  2LB6 A;  3RDS A;  1WUB A;  1SWQ A;  1EXS A;  2MJI A;  1B56 A;  2VDF A;  2BLG A;  1S2P A;  5JD2 A;  2IZD B;  3S5V A;  5FAZ A;  1TXL A;  2HZR A;  3NAD A;  4IAB A;  4B55 A;  1STR B;  3WZN A;  4CPI A;  3FR2 A;  2VFC A;  3ZUO A;  4K19 A;  4BJ8 A;  2FS7 A;  1EII A;  3KFI A;  5HZ5 A;  2IZL B;  5IRU A;  3EMM A;  3KZA A;  2IZB A;  2OL6 O;  4U8U O; 
#chains in the Genus database with same CATH homology
 1I04 A;  5F58 A;  1T0V A;  5AJC A;  1PMP A;  2LKK A;  1MX7 A;  2NP1 A;  5HWZ A;  4BVM A;  2GTF X;  4L1N A;  2AL0 X;  2N93 A;  3E3C A;  4IAX A;  2X8F A;  4IB6 A;  2HYS A;  4M7M A;  4HPA A;  3ZQ3 A;  1R0U A;  3KFF A;  1JJJ A;  3FA9 A;  3I0A A;  5LJK A;  1E5P A;  2W2A A;  4MVK A;  2RQ0 A;  1A3Y A;  1Y9L A;  4ES7 A;  4A1H A;  1GX9 A;  2HLV A;  1BBP A;  5C0N A;  4ORX A;  2AT8 X;  5DG4 A;  1A57 A;  3FR5 A;  4EFG A;  4GE1 A;  2F73 A;  3ZWE A;  2OVE A;  4TQ2 A;  4YMY A;  4INN A;  1CBS A;  3P6F A;  1T68 X;  3WJE A;  5HA1 A;  1SA8 A;  4TJZ A;  3NX2 A;  3NQK A;  2CM4 A;  3OBL A;  1CBI A;  1FTP A;  4EXZ A;  4ORS A;  2RA6 A;  4O4S A;  2HMB A;  1EQD A;  1B0O A;  1X8Q A;  4O4O A;  4YKO A;  1FEM A;  5L8N A;  4NNT A;  2WWP A;  2AH7 X;  4PSQ A;  3MX7 A;  4D6B A;  5LJB A;  1KT4 A;  3BDR A;  1CBQ A;  1D2U A;  1GXA A;  2GTL O;  5IO6 A;  2A13 A;  1HBP A;  1AQB A;  4QGV A;  4IMO A;  3STK A;  2MM3 A;  4ORR A;  3D95 A;  3APV A;  3U0D A;  5D45 A;  3B2I A;  3LHN A;  4AYH A;  1B4M A;  5HZ8 A;  2ACP X;  1GGL A;  4YCH A;  2ANS A;  2IFB A;  2OZQ A;  1RBP A;  1LID A;  4QZT A;  5LJE A;  4I9R A;  1ZNE A;  4FGI B;  4GRJ A;  3WJD A;  4WHI A;  4R0B A;  4A8Z A;  1B8E A;  3FEL A;  1LKE A;  1I06 A;  5F6Z A;  4MVE A;  5H9A A;  2KTD A;  3HWD A;  1HQP A;  1PBO A;  1FDQ A;  3CBC A;  3DSZ A;  5L8I A;  3FEK A;  3HWG A;  1MDC A;  3RWX A;  3GE2 A;  3ZW2 A;  1DZK A;  5F1E A;  4LKP A;  5KID A;  4TNN A;  2XST A;  2P8G A;  2AT5 X;  4O3Z A;  1SXY A;  2LFO A;  1X8O A;  2G7B A;  3KQ0 A;  5LJC A;  1OBP A;  2FT9 A;  1EW3 A;  3FEP A;  1ZRY A;  3WJF A;  4RUN A;  2G79 A;  1BSO A;  4GH7 A;  2HNX A;  4U9C A;  1YWC A;  1X8N A;  1BWY A;  1N0S A;  3WOV A;  5F6B A;  1SY0 A;  4N7D A;  1JZU A;  2A2G A;  4XMF A;  4I3C A;  3JSQ A;  1LF7 A;  1TOU A;  2BHV A;  3HWE A;  4O4X A;  1KT5 A;  2CZT A;  4ORW A;  4Y0R A;  5EZ2 A;  3ZW1 B;  3HK1 A;  3KFH A;  5LJG A;  2AT6 X;  4GZV A;  1TW4 A;  2RN4 A;  5HZ6 A;  3PP6 A;  5HCD C;  1GKA B;  5HCC C;  3T1D A;  4U8U N;  1QFV A;  4XMD A;  4GU8 A;  1YP6 A;  3UEU A;  2Z4I A;  3U9P C;  2X45 A;  3EM0 A;  3NPO A;  5BVQ A;  2G78 A;  3SOT A;  2WQA E;  4IBA A;  1BEB A;  1KZX A;  5D8J A;  4IMN A;  2JOZ A;  4LZU A;  1VPR A;  1NP4 A;  3VG6 A;  2JN3 A;  1DV9 A;  2ZAI A;  3B2K A;  1JJX A;  4XMC A;  1LIC A;  1HMS A;  2FR2 A;  3FMZ A;  3ZW0 A;  1URE A;  3FYF A;  1SXU A;  1KT3 A;  3ZI8 A;  2QMI A;  5K06 A;  2Q39 A;  2Q2P A;  4MIS A;  3CBS A;  1E02 A;  4ZHC A;  3AKM A;  4ID2 A;  1XCA A;  4GET A;  3LV4 A;  1GT5 A;  3STM X;  4ZHF A;  5HAE A;  4ML7 B;  2AT3 X;  4YGZ A;  4QGX A;  1JYD A;  2JU3 A;  3C76 X;  3L4R A;  4KCA A;  4TKH A;  2DM5 A;  3TGC A;  3RSW A;  4YDB A;  1SXW A;  2Q9S A;  3I17 A;  5LJH A;  2KD2 A;  1FE3 A;  4HFO A;  2AT0 X;  5CYB A;  1DZM A;  1BJ7 A;  1BSQ A;  3PED A;  1ERX A;  4KH8 A;  4XME A;  3RZY A;  3C77 X;  4AZM A;  4YDA A;  1IIU A;  2L5P A;  3F8A A;  1PEE A;  1OBQ A;  2RD7 C;  1U0X A;  3HOL A;  4WFU A;  1GX8 A;  3OE3 A;  3HWF A;  4LQZ A;  3VG2 A;  1ZNG A;  2AMM X;  5EEE A;  5H9L A;  5F7G A;  2GTL N;  2WR6 A;  4QGW A;  1P6P A;  2JU8 A;  4M6S A;  3N91 A;  4OS8 A;  4CSB A;  4OS0 A;  4O4U A;  3PQU A;  2O62 A;  3O22 A;  1YWB A;  2KTS A;  4GNY A;  4D6A A;  1GT4 A;  4DQ4 A;  1OEE A;  4GNW A;  5DPQ A;  2A3F X;  2CM9 A;  4O3X B;  1DFV A;  3P6G A;  1L6M A;  3VU1 A;  5KHP A;  4WBK A;  5FQ6 E;  2W2B A;  4PJ2 A;  4JGL A;  4U8U M;  3VPJ E;  1KOI A;  2OFR X;  4NLI A;  5EDC A;  2R74 A;  4I6S A;  1ADL A;  3SAO A;  4QNI A;  4AZQ A;  1BM5 A;  1SMP I;  3VG5 A;  3K3L A;  1FEL A;  2OVA A;  2YMS A;  2BS5 A;  3NX1 A;  4O3Y A;  1LNM A;  1MVG A;  1QQS A;  3P6E A;  4ZHG A;  3C78 X;  3KFG A;  1IKE A;  2GC9 A;  2Q4N A;  1A2D A;  1RLB E;  1YWA A;  3FR4 A;  5LKE A;  4ZGU A;  1TVQ A;  1VYF A;  2QO4 A;  4QAE A;  3WBG A;  4O9S A;  1CRB A;  2FS6 A;  4A1Y A;  4ZH9 A;  3VG3 A;  2JW1 A;  4ZR2 A;  1IFC A;  1ICM A;  3RBY A;  2E4J A;  3VG7 A;  4AZO A;  1ZNK A;  4FQB B;  4BOE A;  5B29 A;  3TGB A;  3ZUI A;  2LBV A;  1HMR A;  2Z4H A;  4AW8 A;  2ACO A;  3JQO A;  1LPJ A;  2XKL A;  1QY1 A;  2FR3 A;  3STN A;  3CQN A;  5D47 A;  2A0A A;  3BSZ E;  3UEX A;  4NP1 A;  3VE1 A;  3P6C A;  3WXQ A;  1EPB A;  4NYR A;  3BX8 A;  1KQW A;  3ELZ A;  2POA A;  3U03 A;  1EUO A;  4L3R A;  5AQ6 A;  4AZR A;  2K23 A;  2X8S A;  5KIC A;  4YFQ A;  2BT9 A;  4EDE A;  2QOS C;  4EQA C;  5HTD A;  1CJ5 A;  4UU2 A;  1AEL A;  2RCQ A;  4ZGF A;  1HMT A;  1MUP A;  1KT7 A;  1OPB A;  4ORY A;  4NYQ A;  3JS1 A;  2WSJ A;  5FQ7 E;  1ERB A;  4GDZ A;  4KII A;  1XKI A;  3HTY A;  3EYC A;  3B2H A;  1GT1 A;  1ZNH A;  4ZJ0 A;  5EPQ A;  1SY1 A;  2KT4 B;  1E00 A;  3PEC A;  3PH6 A;  2ASN X;  4ZH6 A;  1S44 A;  2FLJ A;  2FRS A;  2L9C A;  3FEN A;  4NNS A;  4TLJ A;  4U3Q A;  1SXX A;  2JU7 A;  4KC7 A;  4YGH A;  4YGG A;  1I05 A;  2GTL M;  3NP1 A;  2K62 A;  1NP1 A;  1DF3 A;  1DC9 A;  3P24 A;  3P6H A;  3QKG A;  3ZW0 B;  1AB0 A;  1BRQ A;  1EI5 A;  5H9K A;  1BSY A;  2A2U A;  4YCE A;  2CBR A;  1MX8 A;  3WVM A;  1EPA A;  1X89 A;  1OBU A;  4UU3 A;  1VYG A;  3NQ9 A;  4Y0S A;  3O2Y A;  3S60 A;  1X71 A;  5HZQ A;  4ALO A;  1KGL A;  2QM9 A;  3BLG A;  3D97 A;  3NBX X;  3FA6 A;  1BRP A;  3Q6L A;  4OS3 A;  1GM6 A;  1I4U A;  4KT5 A;  1LIE A;  5CE4 A;  1KT6 A;  2OVD A;  3PQS A;  2MWH A;  2YG2 A;  1EIO A;  2QO6 A;  3EBW A;  4IB9 A;  4AZN A;  4XMH A;  3UEV A;  4BQU A;  5AEO A;  1QFT A;  3TGA A;  3FA8 A;  4ARH A;  3RKG A;  4IB8 A;  2R73 A;  1GT3 A;  3B2L A;  3TF6 A;  1JV4 A;  1HN2 A;  1AVG I;  4HWM A;  3ZW1 A;  3CR6 A;  1QAB E;  5JR8 A;  4FBV A;  3MVF A;  1GKA A;  4Y0P A;  1ICN A;  2NND A;  3MBT A;  2JMB A;  4TKJ A;  4HPC A;  2MHD A;  1LIF A;  3FW5 A;  3S5X A;  3CQR A;  1FEN A;  5HBS A;  4IB7 A;  4FBR A;  1TOW A;  3IA8 A;  5IO5 A;  4CK4 A;  3GAQ A;  4YBU A;  4DQ3 A;  1QY2 A;  4ODD A;  4I3B A;  2F09 A;  4OMX A;  2WQ9 A;  1E06 A;  1LFO A;  5EED A;  1YWD A;  5IO7 A;  3O19 A;  3P6D A;  1BLR A;  3S26 A;  1U18 A;  4N7C A;  1G7N A;  2L68 A;  4NW4 A;  1ALB A;  4QRL A;  3EBK A;  3BU9 A;  4EEJ A;  5FFH A;  3F9D A;  1KQX A;  2EU7 X;  4QYP A;  3BU1 A;  3FIQ A;  2CBS A;  3OJY C;  1U17 A;  1H91 A;  1OEJ A;  3APU A;  3CWK A;  1ML7 A;  4ALB A;  2FWV A;  2WEW A;  3G7X A;  5BYP A;  4I95 A;  3NQ3 A;  1Y9T A;  4XMG A;  4YBP A;  4ZFX A;  2CZU A;  1IFB A;  3PH5 A;  4LZV A;  3B2J A;  2HZQ A;  3BS2 A;  2X8T A;  2M4L A;  5HCE C;  5L8O A;  2OFM X;  1YP7 A;  4ORU A;  3BX7 A;  2PY1 A;  3DTQ A;  5FQ8 E;  1YIV A;  3V8U A;  5H9N A;  1OPA A;  5AJB A;  5D4A A;  2OVS A;  3APX A;  4KC8 A;  3VG4 A;  4MIR A;  3ZZV A;  2Q2M A;  4GKC A;  1NGL A;  1JBH A;  3WJB A;  2ZAG A;  2WUT A;  1ZND A;  4QQ1 A;  4IAW A;  1EAL A;  4RUU A;  2X46 A;  4FBO A;  4OMW A;  1DZJ A;  1Z24 A;  4YKM A;  4ZHH A;  4NLJ A;  5B27 A;  4A60 A;  1O8V A;  4MVL A;  1DZP A;  2RCT A;  2WEX A;  3ELX A;  4O49 A;  5H8T A;  3PPT A;  5HTE A;  2ALL X;  2LA7 A;  3UAQ A;  1JYJ A;  4O3W A;  1A18 A;  4QYN A;  3P02 A;  1HBQ A;  4ZCB A;  4WFV A;  1QY0 A;  5LJD A;  4QZU A;  1ACD A;  3BRN A;  5BVT A;  5BVS A;  1CBR A;  1D3S A;  1O1U A;  3FW4 A;  3WJG A;  1ZNL A;  2BS6 A;  1IKJ A;  1KXO A;  3UEW A;  4COT A;  1LIB A;  2MO5 A;  2NNQ A;  3CMP A;  4GK9 A;  1G5W A;  1X8P A;  3AKN A;  5LKF A;  2L67 A;  1YUP A;  1G74 A;  2R56 A;  3IFB A;  3VE2 A;  3FLL A;  4YH0 A;  5HA0 A;  2QO5 A;  1PM1 X;  1O1V A;  4CV7 A;  1JIW I;  2GJ5 A;  3D96 A;  3F6Z B;  1KZW A;  4ZHD A;  5HZ9 A;  1OEK A;  3TZS A;  1SY2 A;  3D4R A;  1IW2 A;  4TKB A;  2LBA A;  3FA7 A;  3BY0 A;  4LKT A;  3WJC A;  1S7D A;  2AKQ A;  1QWD A;  5EDB A;  3HOE A;  1QG5 A;  1SY3 A;  1UZ2 X;  3NR3 A;  4YFP A;  5FEN A;  5D48 A;  4ON1 A;  1X8U A;  2W2F A;  4AZP A;  4HPD A;  2NNE A;  3APW A;  2FTB A;  4I9S A;  4Y0Q A;  1T8V A;  4HPB A;  1G85 A;  2KW1 A;  4I3D A;  4MVI A;  4YFR A;  3H3I A;  3OD9 A;  2LB6 A;  1EXS A;  2MJI A;  1B56 A;  2BLG A;  1S2P A;  3S5V A;  5FAZ A;  2HZR A;  1TXL A;  3NAD A;  4IAB A;  3FR2 A;  3ZUO A;  4K19 A;  2FS7 A;  1EII A;  3KFI A;  5HZ5 A;  3EMM A;  3KZA A;  4U8U O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...