4KJDA

Ratintestinal ap expressed in e. coli
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
Knots found
sequence length
478
structure length
407
Chain Sequence
b'VEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVTLRHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intestinal-type alkaline phosphatase 1
publication title Crystal structure of rat intestinal alkaline phosphatase - Role of crown domain in mammalian alkaline phosphatases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 148
structure length 407
sequence length 478
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4kjdA00
4B56A 4LRFA 1ED9A 4NWJA 5GOVA 3NKNA 4ZG6A 5EGHA 2GSUA 3WAVA 1ZEDA 1B8JA 1ALHA 1ALIA 5IJSA 2XR9A 3T02A 3TG0A 3WBHA 1EJJA 1SHNA 5L0BA 3BDGB 4UPKA 3A52A 4MY4A 3T00A 5LRNA 5DLWA 3UO0A 5TJ3A 3UN3A 2W5TA 1AJAA 1ED8A 3Q3QA 1URAA 4CXSA 1ALKA 4GTXA 5LQQA 1E2SP 4KJGA 4LR9A 5EGEA 2GLQA 4LRCA 4N7TA 1AJCA 4LREA 1ELXA 2IUCB 4MIVA 3CMRA 3IGZB 5INHA 3MK1A 5DLVA 4LR2A 2XRGA 1E33P 1Y7AA 2IUCA 1KHJA 2IFYA 2GSOA 3MK2A 4NWXA 4TN0A 3SZZA 1KH4A 1ZEFA 4LRAA 4ZGAA 1Y6VA 3WAWA 2W5QA 3TWZA 3NKRA 1AUKA 1EI6A 3OT9A 5K4PA 3ED4A 1SHQA 3UNYA 1E1ZP 2W8DA 1AJBA 4LRBA 1E3CP 4QAXA 3KD8A 1HQAA 4KM4A 3BDGA 3MK0A 4LR7A 3NKPA 4UOPA 1N2KA 1KH5A 3M7VA 4ZG7A 1URBA 1ELZA 3NKQA 3E2DA 1ANJA 3T01A 1KHKA 3M8ZA 4UPHA 1KHNA 1N2LA 2W5RA 5IJQA 3TX0A 1HDHA 3SZYA 2ZKTA 4GTZA 1AJDA 5L0KA 1KHLA 2ANHA 4LQYA 2QZUA 2VQRA 4KJDA 3WAXA 4CYRA 2W8SA 1EW9A 1K7HA 2W5WA 4CXKA 2W5XA 5HRTA 3NVLA 1O98A 1ANIA 4FDJA 3UN5A 5L0EA 2GA3A 4FDIA 5KXAA 2GSNA 5C66A 1ELYA 5AJ9A 4KAYA 2RH6A 4UPIA 3NKOA 4MHXA 5LIAA 2D1GA 1KH7A 1HJKA 2W5SA 1P49A 3BDHA 1ZEBA 3LXQA 4GTYA 4LR8A 4CYSA 2G9YA 4UORA 3NKMA 3M8WA 2W5VA 3BDFA 3DYCA 4ZG9A 5DLTA 3IGYB 4YR1A 4UPLA 3UN2A 4LRDA 4KAVA 1ALJA 5LRMA 4UOOA 3M8YA 1FSUA 3IDDA 1EW8A 4GTWA 4CXUA 5GRRA 3WAYA 1EW2A 1KH9A 1O99A 3B5QA 1EQJA 2X98A 3DPCA
chains in the Genus database with same CATH superfamily
4B56A 4LRFA 1ED9A 4NWJA 5GOVA 3NKNA 4ZG6A 5EGHA 2GSUA 3WAVA 1ZEDA 1B8JA 1ALHA 1ALIA 5IJSA 2XR9A 3T02A 3TG0A 3WBHA 1EJJA 1SHNA 5L0BA 3BDGB 4UPKA 3A52A 4MY4A 3T00A 5LRNA 5DLWA 3UO0A 5TJ3A 3UN3A 2W5TA 1AJAA 1ED8A 3Q3QA 1URAA 4CXSA 1ALKA 4GTXA 5LQQA 1E2SP 4KJGA 4LR9A 5EGEA 2GLQA 4LRCA 4N7TA 1AJCA 4LREA 1ELXA 2IUCB 4MIVA 3CMRA 3IGZB 5INHA 3MK1A 5DLVA 4LR2A 2XRGA 1E33P 1Y7AA 2IUCA 1KHJA 2IFYA 2GSOA 3MK2A 4NWXA 4TN0A 3SZZA 1KH4A 1ZEFA 4LRAA 4ZGAA 1Y6VA 3WAWA 2W5QA 3TWZA 3NKRA 1AUKA 1EI6A 3OT9A 5K4PA 3ED4A 1SHQA 3UNYA 1E1ZP 2W8DA 1AJBA 4LRBA 1E3CP 4QAXA 3KD8A 1HQAA 4KM4A 3BDGA 3MK0A 4LR7A 3NKPA 4UOPA 1N2KA 1KH5A 3M7VA 4ZG7A 1URBA 1ELZA 3NKQA 3E2DA 1ANJA 3T01A 1KHKA 3M8ZA 4UPHA 1KHNA 1N2LA 2W5RA 5IJQA 3TX0A 1HDHA 3SZYA 2ZKTA 4GTZA 1AJDA 5L0KA 1KHLA 2ANHA 4LQYA 2QZUA 2VQRA 4KJDA 3WAXA 4CYRA 2W8SA 1EW9A 1K7HA 2W5WA 4CXKA 2W5XA 5HRTA 3NVLA 1O98A 1ANIA 4FDJA 3UN5A 5L0EA 2GA3A 4FDIA 5KXAA 2GSNA 5C66A 1ELYA 5AJ9A 4KAYA 2RH6A 4UPIA 3NKOA 4MHXA 5LIAA 2D1GA 1KH7A 1HJKA 2W5SA 1P49A 3BDHA 1ZEBA 3LXQA 4GTYA 4LR8A 4CYSA 2G9YA 4UORA 3NKMA 3M8WA 2W5VA 3BDFA 3DYCA 4ZG9A 5DLTA 3IGYB 4YR1A 4UPLA 3UN2A 4LRDA 4KAVA 1ALJA 5LRMA 4UOOA 3M8YA 1FSUA 3IDDA 1EW8A 4GTWA 4CXUA 5GRRA 3WAYA 1EW2A 1KH9A 1O99A 3B5QA 1EQJA 2X98A 3DPCA
chains in the Genus database with same CATH topology
4B56A 4LRFA 1ED9A 4NWJA 5GOVA 3NKNA 4ZG6A 5EGHA 2GSUA 3WAVA 1ZEDA 1B8JA 1ALHA 1ALIA 5IJSA 2XR9A 3T02A 3TG0A 3WBHA 1EJJA 1SHNA 5L0BA 3BDGB 4UPKA 3A52A 4MY4A 3T00A 5LRNA 5DLWA 3UO0A 5TJ3A 3UN3A 2W5TA 1AJAA 1ED8A 3Q3QA 1URAA 4CXSA 1ALKA 4GTXA 5LQQA 1E2SP 4KJGA 4LR9A 5EGEA 2GLQA 4LRCA 4N7TA 1AJCA 4LREA 1ELXA 2IUCB 4MIVA 3CMRA 3IGZB 5INHA 3MK1A 5DLVA 4LR2A 2XRGA 1E33P 1Y7AA 2IUCA 1KHJA 2IFYA 2GSOA 3MK2A 4NWXA 4TN0A 3SZZA 1KH4A 1ZEFA 4LRAA 4ZGAA 1Y6VA 3WAWA 2W5QA 3TWZA 3NKRA 1AUKA 1EI6A 3OT9A 5K4PA 3ED4A 1SHQA 3UNYA 1E1ZP 2W8DA 1AJBA 4LRBA 1E3CP 4QAXA 3KD8A 1HQAA 4KM4A 3BDGA 3MK0A 4LR7A 3NKPA 4UOPA 1N2KA 1KH5A 3M7VA 4ZG7A 1URBA 1ELZA 3NKQA 3E2DA 1ANJA 3T01A 1KHKA 3M8ZA 4UPHA 1KHNA 1N2LA 2W5RA 5IJQA 3TX0A 1HDHA 3SZYA 2ZKTA 4GTZA 1AJDA 5L0KA 1KHLA 2ANHA 4LQYA 2QZUA 2VQRA 4KJDA 3WAXA 4CYRA 2W8SA 1EW9A 1K7HA 2W5WA 4CXKA 2W5XA 5HRTA 3NVLA 1O98A 1ANIA 4FDJA 3UN5A 5L0EA 2GA3A 4FDIA 5KXAA 2GSNA 5C66A 1ELYA 5AJ9A 4KAYA 2RH6A 4UPIA 3NKOA 4MHXA 5LIAA 2D1GA 1KH7A 1HJKA 2W5SA 1P49A 3BDHA 1ZEBA 3LXQA 4GTYA 4LR8A 4CYSA 2G9YA 4UORA 3NKMA 3M8WA 2W5VA 3BDFA 3DYCA 4ZG9A 5DLTA 3IGYB 4YR1A 4UPLA 3UN2A 4LRDA 4KAVA 1ALJA 5LRMA 4UOOA 3M8YA 1FSUA 3IDDA 1EW8A 4GTWA 4CXUA 5GRRA 3WAYA 1EW2A 1KH9A 1O99A 3B5QA 1EQJA 2X98A 3DPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B56 A;  4LRF A;  1ED9 A;  4NWJ A;  5GOV A;  3NKN A;  4ZG6 A;  5EGH A;  2GSU A;  3WAV A;  1ZED A;  1B8J A;  1ALH A;  1ALI A;  5IJS A;  2XR9 A;  3T02 A;  3TG0 A;  3WBH A;  1EJJ A;  1SHN A;  5L0B A;  3BDG B;  4UPK A;  3A52 A;  4MY4 A;  3T00 A;  5LRN A;  5DLW A;  3UO0 A;  5TJ3 A;  3UN3 A;  2W5T A;  1AJA A;  1ED8 A;  3Q3Q A;  1URA A;  4CXS A;  1ALK A;  4GTX A;  5LQQ A;  1E2S P;  4KJG A;  4LR9 A;  5EGE A;  2GLQ A;  4LRC A;  4N7T A;  1AJC A;  4LRE A;  1ELX A;  2IUC B;  4MIV A;  3CMR A;  3IGZ B;  5INH A;  3MK1 A;  5DLV A;  4LR2 A;  2XRG A;  1E33 P;  1Y7A A;  2IUC A;  1KHJ A;  2IFY A;  2GSO A;  3MK2 A;  4NWX A;  4TN0 A;  3SZZ A;  1KH4 A;  1ZEF A;  4LRA A;  4ZGA A;  1Y6V A;  3WAW A;  2W5Q A;  3TWZ A;  3NKR A;  1AUK A;  1EI6 A;  3OT9 A;  5K4P A;  3ED4 A;  1SHQ A;  3UNY A;  1E1Z P;  2W8D A;  1AJB A;  4LRB A;  1E3C P;  4QAX A;  3KD8 A;  1HQA A;  4KM4 A;  3BDG A;  3MK0 A;  4LR7 A;  3NKP A;  4UOP A;  1N2K A;  1KH5 A;  3M7V A;  4ZG7 A;  1URB A;  1ELZ A;  3NKQ A;  3E2D A;  1ANJ A;  3T01 A;  1KHK A;  3M8Z A;  4UPH A;  1KHN A;  1N2L A;  2W5R A;  5IJQ A;  3TX0 A;  1HDH A;  3SZY A;  2ZKT A;  4GTZ A;  1AJD A;  5L0K A;  1KHL A;  2ANH A;  4LQY A;  2QZU A;  2VQR A;  4KJD A;  3WAX A;  4CYR A;  2W8S A;  1EW9 A;  1K7H A;  2W5W A;  4CXK A;  2W5X A;  5HRT A;  3NVL A;  1O98 A;  1ANI A;  4FDJ A;  3UN5 A;  5L0E A;  2GA3 A;  4FDI A;  5KXA A;  2GSN A;  5C66 A;  1ELY A;  5AJ9 A;  4KAY A;  2RH6 A;  4UPI A;  3NKO A;  4MHX A;  5LIA A;  2D1G A;  1KH7 A;  1HJK A;  2W5S A;  1P49 A;  3BDH A;  1ZEB A;  3LXQ A;  4GTY A;  4LR8 A;  4CYS A;  2G9Y A;  4UOR A;  3NKM A;  3M8W A;  2W5V A;  3BDF A;  3DYC A;  4ZG9 A;  5DLT A;  3IGY B;  4YR1 A;  4UPL A;  3UN2 A;  4LRD A;  4KAV A;  1ALJ A;  5LRM A;  4UOO A;  3M8Y A;  1FSU A;  3IDD A;  1EW8 A;  4GTW A;  4CXU A;  5GRR A;  3WAY A;  1EW2 A;  1KH9 A;  1O99 A;  3B5Q A;  1EQJ A;  2X98 A;  3DPC A; 
#chains in the Genus database with same CATH topology
 4B56 A;  4LRF A;  1ED9 A;  4NWJ A;  5GOV A;  3NKN A;  4ZG6 A;  5EGH A;  2GSU A;  3WAV A;  1ZED A;  1B8J A;  1ALH A;  1ALI A;  5IJS A;  2XR9 A;  3T02 A;  3TG0 A;  3WBH A;  1EJJ A;  1SHN A;  5L0B A;  3BDG B;  4UPK A;  3A52 A;  4MY4 A;  3T00 A;  5LRN A;  5DLW A;  3UO0 A;  5TJ3 A;  3UN3 A;  2W5T A;  1AJA A;  1ED8 A;  3Q3Q A;  1URA A;  4CXS A;  1ALK A;  4GTX A;  5LQQ A;  1E2S P;  4KJG A;  4LR9 A;  5EGE A;  2GLQ A;  4LRC A;  4N7T A;  1AJC A;  4LRE A;  1ELX A;  2IUC B;  4MIV A;  3CMR A;  3IGZ B;  5INH A;  3MK1 A;  5DLV A;  4LR2 A;  2XRG A;  1E33 P;  1Y7A A;  2IUC A;  1KHJ A;  2IFY A;  2GSO A;  3MK2 A;  4NWX A;  4TN0 A;  3SZZ A;  1KH4 A;  1ZEF A;  4LRA A;  4ZGA A;  1Y6V A;  3WAW A;  2W5Q A;  3TWZ A;  3NKR A;  1AUK A;  1EI6 A;  3OT9 A;  5K4P A;  3ED4 A;  1SHQ A;  3UNY A;  1E1Z P;  2W8D A;  1AJB A;  4LRB A;  1E3C P;  4QAX A;  3KD8 A;  1HQA A;  4KM4 A;  3BDG A;  3MK0 A;  4LR7 A;  3NKP A;  4UOP A;  1N2K A;  1KH5 A;  3M7V A;  4ZG7 A;  1URB A;  1ELZ A;  3NKQ A;  3E2D A;  1ANJ A;  3T01 A;  1KHK A;  3M8Z A;  4UPH A;  1KHN A;  1N2L A;  2W5R A;  5IJQ A;  3TX0 A;  1HDH A;  3SZY A;  2ZKT A;  4GTZ A;  1AJD A;  5L0K A;  1KHL A;  2ANH A;  4LQY A;  2QZU A;  2VQR A;  4KJD A;  3WAX A;  4CYR A;  2W8S A;  1EW9 A;  1K7H A;  2W5W A;  4CXK A;  2W5X A;  5HRT A;  3NVL A;  1O98 A;  1ANI A;  4FDJ A;  3UN5 A;  5L0E A;  2GA3 A;  4FDI A;  5KXA A;  2GSN A;  5C66 A;  1ELY A;  5AJ9 A;  4KAY A;  2RH6 A;  4UPI A;  3NKO A;  4MHX A;  5LIA A;  2D1G A;  1KH7 A;  1HJK A;  2W5S A;  1P49 A;  3BDH A;  1ZEB A;  3LXQ A;  4GTY A;  4LR8 A;  4CYS A;  2G9Y A;  4UOR A;  3NKM A;  3M8W A;  2W5V A;  3BDF A;  3DYC A;  4ZG9 A;  5DLT A;  3IGY B;  4YR1 A;  4UPL A;  3UN2 A;  4LRD A;  4KAV A;  1ALJ A;  5LRM A;  4UOO A;  3M8Y A;  1FSU A;  3IDD A;  1EW8 A;  4GTW A;  4CXU A;  5GRR A;  3WAY A;  1EW2 A;  1KH9 A;  1O99 A;  3B5Q A;  1EQJ A;  2X98 A;  3DPC A; 
#chains in the Genus database with same CATH homology
 4B56 A;  4LRF A;  1ED9 A;  4NWJ A;  5GOV A;  3NKN A;  4ZG6 A;  5EGH A;  2GSU A;  3WAV A;  1ZED A;  1B8J A;  1ALH A;  1ALI A;  5IJS A;  2XR9 A;  3T02 A;  3TG0 A;  3WBH A;  1EJJ A;  1SHN A;  5L0B A;  3BDG B;  4UPK A;  3A52 A;  4MY4 A;  3T00 A;  5LRN A;  5DLW A;  3UO0 A;  5TJ3 A;  3UN3 A;  2W5T A;  1AJA A;  1ED8 A;  3Q3Q A;  1URA A;  4CXS A;  1ALK A;  4GTX A;  5LQQ A;  1E2S P;  4KJG A;  4LR9 A;  5EGE A;  2GLQ A;  4LRC A;  4N7T A;  1AJC A;  4LRE A;  1ELX A;  2IUC B;  4MIV A;  3CMR A;  3IGZ B;  5INH A;  3MK1 A;  5DLV A;  4LR2 A;  2XRG A;  1E33 P;  1Y7A A;  2IUC A;  1KHJ A;  2IFY A;  2GSO A;  3MK2 A;  4NWX A;  4TN0 A;  3SZZ A;  1KH4 A;  1ZEF A;  4LRA A;  4ZGA A;  1Y6V A;  3WAW A;  2W5Q A;  3TWZ A;  3NKR A;  1AUK A;  1EI6 A;  3OT9 A;  5K4P A;  3ED4 A;  1SHQ A;  3UNY A;  1E1Z P;  2W8D A;  1AJB A;  4LRB A;  1E3C P;  4QAX A;  3KD8 A;  1HQA A;  4KM4 A;  3BDG A;  3MK0 A;  4LR7 A;  3NKP A;  4UOP A;  1N2K A;  1KH5 A;  3M7V A;  4ZG7 A;  1URB A;  1ELZ A;  3NKQ A;  3E2D A;  1ANJ A;  3T01 A;  1KHK A;  3M8Z A;  4UPH A;  1KHN A;  1N2L A;  2W5R A;  5IJQ A;  3TX0 A;  1HDH A;  3SZY A;  2ZKT A;  4GTZ A;  1AJD A;  5L0K A;  1KHL A;  2ANH A;  4LQY A;  2QZU A;  2VQR A;  4KJD A;  3WAX A;  4CYR A;  2W8S A;  1EW9 A;  1K7H A;  2W5W A;  4CXK A;  2W5X A;  5HRT A;  3NVL A;  1O98 A;  1ANI A;  4FDJ A;  3UN5 A;  5L0E A;  2GA3 A;  4FDI A;  5KXA A;  2GSN A;  5C66 A;  1ELY A;  5AJ9 A;  4KAY A;  2RH6 A;  4UPI A;  3NKO A;  4MHX A;  5LIA A;  2D1G A;  1KH7 A;  1HJK A;  2W5S A;  1P49 A;  3BDH A;  1ZEB A;  3LXQ A;  4GTY A;  4LR8 A;  4CYS A;  2G9Y A;  4UOR A;  3NKM A;  3M8W A;  2W5V A;  3BDF A;  3DYC A;  4ZG9 A;  5DLT A;  3IGY B;  4YR1 A;  4UPL A;  3UN2 A;  4LRD A;  4KAV A;  1ALJ A;  5LRM A;  4UOO A;  3M8Y A;  1FSU A;  3IDD A;  1EW8 A;  4GTW A;  4CXU A;  5GRR A;  3WAY A;  1EW2 A;  1KH9 A;  1O99 A;  3B5Q A;  1EQJ A;  2X98 A;  3DPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...