4KJDA

Ratintestinal ap expressed in e. coli
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
Knots found
sequence length
478
structure length
407
Chain Sequence
VEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVTLRHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rat intestinal alkaline phosphatase - Role of crown domain in mammalian alkaline phosphatases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Intestinal-type alkaline phosphatase 1
total genus 148
structure length 407
sequence length 478
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4kjdA00
1AJBA 1ALKA 3LXQA 1ZEFA 3MK1A 3UN2A 3NKQA 4KJDA 1SHNA 4FDIA 5EGEA 3KD8A 3SZZA 1E3CP 3NKOA 4UPHA 4CXSA 2ANHA 4NWXA 3MK0A 3TG0A 5C66A 1URAA 4GTWA 5AJ9A 3NKPA 1HJKA 5LRNA 1K7HA 2IUCA 5L0EA 2G9YA 4CXUA 1EJJA 2D1GA 2W8DA 3SZYA 3T01A 3DPCA 3Q3QA 4LQYA 4UPKA 4MHXA 3UN3A 1ED9A 1ELYA 1ELXA 1KH5A 4MIVA 3BDHA 3UNYA 3UN5A 4ZG9A 1Y7AA 1ALJA 4KAYA 3WAYA 4KJGA 2GA3A 1ALIA 2GSNA 1AJAA 4LR9A 1FSUA 1KHLA 3BDFA 4MY4A 2XRGA 1AUKA 4LRCA 5DLVA 5HRTA 4CYSA 3E2DA 1EQJA 5K4PA 1ZEDA 3WBHA 5IJQA 5TJ3A 3M8YA 3OT9A 1URBA 4LR7A 4LRFA 4UOPA 3NKMA 4ZGAA 1N2LA 2QZUA 3TX0A 4ZG6A 1O98A 1ANIA 4KAVA 5DLWA 3T00A 3TWZA 3BDGA 5DLTA 3T02A 1HQAA 1O99A 1EW8A 2VQRA 1ALHA 4YR1A 2GLQA 4QAXA 1P49A 1EW2A 4KM4A 1E1ZP 2IUCB 4LRAA 5LQQA 1AJCA 1ED8A 1HDHA 1Y6VA 3NKRA 2XR9A 3BDGB 3WAVA 3CMRA 5IJSA 5INHA 1KH9A 1KH4A 5GOVA 3UO0A 3M7VA 2W5SA 1KHJA 5L0KA 1EW9A 3WAXA 3A52A 5EGHA 3M8WA 4UPIA 4TN0A 3IGZB 4UOOA 4NWJA 5KXAA 3NVLA 3MK2A 1AJDA 3M8ZA 4FDJA 2W5QA 4LREA 1SHQA 1KHKA 4GTXA 5GRRA 5L0BA 4LR8A 2GSUA 2ZKTA 1E33P 1ZEBA 4LRBA 1ELZA 5LIAA 4ZG7A 2X98A 3IGYB 4N7TA 4UORA 1E2SP 2W5TA 2IFYA 2W5VA 4UPLA 1KH7A 4GTYA 3ED4A 1KHNA 3DYCA 2W5RA 4LRDA 2W5WA 4B56A 4CXKA 3WAWA 1B8JA 1ANJA 3NKNA 4LR2A 3B5QA 2RH6A 2GSOA 3IDDA 4CYRA 1EI6A 2W5XA 2W8SA 5LRMA 4GTZA 1N2KA
chains in the Genus database with same CATH superfamily
1AJBA 1ALKA 3LXQA 1ZEFA 3MK1A 3UN2A 3NKQA 4KJDA 1SHNA 4FDIA 5EGEA 3KD8A 3SZZA 1E3CP 3NKOA 4UPHA 4CXSA 2ANHA 4NWXA 3MK0A 3TG0A 5C66A 1URAA 4GTWA 5AJ9A 3NKPA 1HJKA 5LRNA 1K7HA 2IUCA 5L0EA 2G9YA 4CXUA 1EJJA 2D1GA 2W8DA 3SZYA 3T01A 3DPCA 3Q3QA 4LQYA 4UPKA 4MHXA 3UN3A 1ED9A 1ELYA 1ELXA 1KH5A 4MIVA 3BDHA 3UNYA 3UN5A 4ZG9A 1Y7AA 1ALJA 4KAYA 3WAYA 4KJGA 2GA3A 1ALIA 2GSNA 1AJAA 4LR9A 1FSUA 1KHLA 3BDFA 4MY4A 2XRGA 1AUKA 4LRCA 5DLVA 5HRTA 4CYSA 3E2DA 1EQJA 5K4PA 1ZEDA 3WBHA 5IJQA 5TJ3A 3M8YA 3OT9A 1URBA 4LR7A 4LRFA 4UOPA 3NKMA 4ZGAA 1N2LA 2QZUA 3TX0A 4ZG6A 1O98A 1ANIA 4KAVA 5DLWA 3T00A 3TWZA 3BDGA 5DLTA 3T02A 1HQAA 1O99A 1EW8A 2VQRA 1ALHA 4YR1A 2GLQA 4QAXA 1P49A 1EW2A 4KM4A 1E1ZP 2IUCB 4LRAA 5LQQA 1AJCA 1ED8A 1HDHA 1Y6VA 3NKRA 2XR9A 3BDGB 3WAVA 3CMRA 5IJSA 5INHA 1KH9A 1KH4A 5GOVA 3UO0A 3M7VA 2W5SA 1KHJA 5L0KA 1EW9A 3WAXA 3A52A 5EGHA 3M8WA 4UPIA 4TN0A 3IGZB 4UOOA 4NWJA 5KXAA 3NVLA 3MK2A 1AJDA 3M8ZA 4FDJA 2W5QA 4LREA 1SHQA 1KHKA 4GTXA 5GRRA 5L0BA 4LR8A 2GSUA 2ZKTA 1E33P 1ZEBA 4LRBA 1ELZA 5LIAA 4ZG7A 2X98A 3IGYB 4N7TA 4UORA 1E2SP 2W5TA 2IFYA 2W5VA 4UPLA 1KH7A 4GTYA 3ED4A 1KHNA 3DYCA 2W5RA 4LRDA 2W5WA 4B56A 4CXKA 3WAWA 1B8JA 1ANJA 3NKNA 4LR2A 3B5QA 2RH6A 2GSOA 3IDDA 4CYRA 1EI6A 2W5XA 2W8SA 5LRMA 4GTZA 1N2KA
chains in the Genus database with same CATH topology
1AJBA 1ALKA 3LXQA 1ZEFA 3MK1A 3UN2A 3NKQA 4KJDA 1SHNA 4FDIA 5EGEA 3KD8A 3SZZA 1E3CP 3NKOA 4UPHA 4CXSA 2ANHA 4NWXA 3MK0A 3TG0A 5C66A 1URAA 4GTWA 5AJ9A 3NKPA 1HJKA 5LRNA 1K7HA 2IUCA 5L0EA 2G9YA 4CXUA 1EJJA 2D1GA 2W8DA 3SZYA 3T01A 3DPCA 3Q3QA 4LQYA 4UPKA 4MHXA 3UN3A 1ED9A 1ELYA 1ELXA 1KH5A 4MIVA 3BDHA 3UNYA 3UN5A 4ZG9A 1Y7AA 1ALJA 4KAYA 3WAYA 4KJGA 2GA3A 1ALIA 2GSNA 1AJAA 4LR9A 1FSUA 1KHLA 3BDFA 4MY4A 2XRGA 1AUKA 4LRCA 5DLVA 5HRTA 4CYSA 3E2DA 1EQJA 5K4PA 1ZEDA 3WBHA 5IJQA 5TJ3A 3M8YA 3OT9A 1URBA 4LR7A 4LRFA 4UOPA 3NKMA 4ZGAA 1N2LA 2QZUA 3TX0A 4ZG6A 1O98A 1ANIA 4KAVA 5DLWA 3T00A 3TWZA 3BDGA 5DLTA 3T02A 1HQAA 1O99A 1EW8A 2VQRA 1ALHA 4YR1A 2GLQA 4QAXA 1P49A 1EW2A 4KM4A 1E1ZP 2IUCB 4LRAA 5LQQA 1AJCA 1ED8A 1HDHA 1Y6VA 3NKRA 2XR9A 3BDGB 3WAVA 3CMRA 5IJSA 5INHA 1KH9A 1KH4A 5GOVA 3UO0A 3M7VA 2W5SA 1KHJA 5L0KA 1EW9A 3WAXA 3A52A 5EGHA 3M8WA 4UPIA 4TN0A 3IGZB 4UOOA 4NWJA 5KXAA 3NVLA 3MK2A 1AJDA 3M8ZA 4FDJA 2W5QA 4LREA 1SHQA 1KHKA 4GTXA 5GRRA 5L0BA 4LR8A 2GSUA 2ZKTA 1E33P 1ZEBA 4LRBA 1ELZA 5LIAA 4ZG7A 2X98A 3IGYB 4N7TA 4UORA 1E2SP 2W5TA 2IFYA 2W5VA 4UPLA 1KH7A 4GTYA 3ED4A 1KHNA 3DYCA 2W5RA 4LRDA 2W5WA 4B56A 4CXKA 3WAWA 1B8JA 1ANJA 3NKNA 4LR2A 3B5QA 2RH6A 2GSOA 3IDDA 4CYRA 1EI6A 2W5XA 2W8SA 5LRMA 4GTZA 1N2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJB A;  1ALK A;  3LXQ A;  1ZEF A;  3MK1 A;  3UN2 A;  3NKQ A;  4KJD A;  1SHN A;  4FDI A;  5EGE A;  3KD8 A;  3SZZ A;  1E3C P;  3NKO A;  4UPH A;  4CXS A;  2ANH A;  4NWX A;  3MK0 A;  3TG0 A;  5C66 A;  1URA A;  4GTW A;  5AJ9 A;  3NKP A;  1HJK A;  5LRN A;  1K7H A;  2IUC A;  5L0E A;  2G9Y A;  4CXU A;  1EJJ A;  2D1G A;  2W8D A;  3SZY A;  3T01 A;  3DPC A;  3Q3Q A;  4LQY A;  4UPK A;  4MHX A;  3UN3 A;  1ED9 A;  1ELY A;  1ELX A;  1KH5 A;  4MIV A;  3BDH A;  3UNY A;  3UN5 A;  4ZG9 A;  1Y7A A;  1ALJ A;  4KAY A;  3WAY A;  4KJG A;  2GA3 A;  1ALI A;  2GSN A;  1AJA A;  4LR9 A;  1FSU A;  1KHL A;  3BDF A;  4MY4 A;  2XRG A;  1AUK A;  4LRC A;  5DLV A;  5HRT A;  4CYS A;  3E2D A;  1EQJ A;  5K4P A;  1ZED A;  3WBH A;  5IJQ A;  5TJ3 A;  3M8Y A;  3OT9 A;  1URB A;  4LR7 A;  4LRF A;  4UOP A;  3NKM A;  4ZGA A;  1N2L A;  2QZU A;  3TX0 A;  4ZG6 A;  1O98 A;  1ANI A;  4KAV A;  5DLW A;  3T00 A;  3TWZ A;  3BDG A;  5DLT A;  3T02 A;  1HQA A;  1O99 A;  1EW8 A;  2VQR A;  1ALH A;  4YR1 A;  2GLQ A;  4QAX A;  1P49 A;  1EW2 A;  4KM4 A;  1E1Z P;  2IUC B;  4LRA A;  5LQQ A;  1AJC A;  1ED8 A;  1HDH A;  1Y6V A;  3NKR A;  2XR9 A;  3BDG B;  3WAV A;  3CMR A;  5IJS A;  5INH A;  1KH9 A;  1KH4 A;  5GOV A;  3UO0 A;  3M7V A;  2W5S A;  1KHJ A;  5L0K A;  1EW9 A;  3WAX A;  3A52 A;  5EGH A;  3M8W A;  4UPI A;  4TN0 A;  3IGZ B;  4UOO A;  4NWJ A;  5KXA A;  3NVL A;  3MK2 A;  1AJD A;  3M8Z A;  4FDJ A;  2W5Q A;  4LRE A;  1SHQ A;  1KHK A;  4GTX A;  5GRR A;  5L0B A;  4LR8 A;  2GSU A;  2ZKT A;  1E33 P;  1ZEB A;  4LRB A;  1ELZ A;  5LIA A;  4ZG7 A;  2X98 A;  3IGY B;  4N7T A;  4UOR A;  1E2S P;  2W5T A;  2IFY A;  2W5V A;  4UPL A;  1KH7 A;  4GTY A;  3ED4 A;  1KHN A;  3DYC A;  2W5R A;  4LRD A;  2W5W A;  4B56 A;  4CXK A;  3WAW A;  1B8J A;  1ANJ A;  3NKN A;  4LR2 A;  3B5Q A;  2RH6 A;  2GSO A;  3IDD A;  4CYR A;  1EI6 A;  2W5X A;  2W8S A;  5LRM A;  4GTZ A;  1N2K A; 
#chains in the Genus database with same CATH topology
 1AJB A;  1ALK A;  3LXQ A;  1ZEF A;  3MK1 A;  3UN2 A;  3NKQ A;  4KJD A;  1SHN A;  4FDI A;  5EGE A;  3KD8 A;  3SZZ A;  1E3C P;  3NKO A;  4UPH A;  4CXS A;  2ANH A;  4NWX A;  3MK0 A;  3TG0 A;  5C66 A;  1URA A;  4GTW A;  5AJ9 A;  3NKP A;  1HJK A;  5LRN A;  1K7H A;  2IUC A;  5L0E A;  2G9Y A;  4CXU A;  1EJJ A;  2D1G A;  2W8D A;  3SZY A;  3T01 A;  3DPC A;  3Q3Q A;  4LQY A;  4UPK A;  4MHX A;  3UN3 A;  1ED9 A;  1ELY A;  1ELX A;  1KH5 A;  4MIV A;  3BDH A;  3UNY A;  3UN5 A;  4ZG9 A;  1Y7A A;  1ALJ A;  4KAY A;  3WAY A;  4KJG A;  2GA3 A;  1ALI A;  2GSN A;  1AJA A;  4LR9 A;  1FSU A;  1KHL A;  3BDF A;  4MY4 A;  2XRG A;  1AUK A;  4LRC A;  5DLV A;  5HRT A;  4CYS A;  3E2D A;  1EQJ A;  5K4P A;  1ZED A;  3WBH A;  5IJQ A;  5TJ3 A;  3M8Y A;  3OT9 A;  1URB A;  4LR7 A;  4LRF A;  4UOP A;  3NKM A;  4ZGA A;  1N2L A;  2QZU A;  3TX0 A;  4ZG6 A;  1O98 A;  1ANI A;  4KAV A;  5DLW A;  3T00 A;  3TWZ A;  3BDG A;  5DLT A;  3T02 A;  1HQA A;  1O99 A;  1EW8 A;  2VQR A;  1ALH A;  4YR1 A;  2GLQ A;  4QAX A;  1P49 A;  1EW2 A;  4KM4 A;  1E1Z P;  2IUC B;  4LRA A;  5LQQ A;  1AJC A;  1ED8 A;  1HDH A;  1Y6V A;  3NKR A;  2XR9 A;  3BDG B;  3WAV A;  3CMR A;  5IJS A;  5INH A;  1KH9 A;  1KH4 A;  5GOV A;  3UO0 A;  3M7V A;  2W5S A;  1KHJ A;  5L0K A;  1EW9 A;  3WAX A;  3A52 A;  5EGH A;  3M8W A;  4UPI A;  4TN0 A;  3IGZ B;  4UOO A;  4NWJ A;  5KXA A;  3NVL A;  3MK2 A;  1AJD A;  3M8Z A;  4FDJ A;  2W5Q A;  4LRE A;  1SHQ A;  1KHK A;  4GTX A;  5GRR A;  5L0B A;  4LR8 A;  2GSU A;  2ZKT A;  1E33 P;  1ZEB A;  4LRB A;  1ELZ A;  5LIA A;  4ZG7 A;  2X98 A;  3IGY B;  4N7T A;  4UOR A;  1E2S P;  2W5T A;  2IFY A;  2W5V A;  4UPL A;  1KH7 A;  4GTY A;  3ED4 A;  1KHN A;  3DYC A;  2W5R A;  4LRD A;  2W5W A;  4B56 A;  4CXK A;  3WAW A;  1B8J A;  1ANJ A;  3NKN A;  4LR2 A;  3B5Q A;  2RH6 A;  2GSO A;  3IDD A;  4CYR A;  1EI6 A;  2W5X A;  2W8S A;  5LRM A;  4GTZ A;  1N2K A; 
#chains in the Genus database with same CATH homology
 1AJB A;  1ALK A;  3LXQ A;  1ZEF A;  3MK1 A;  3UN2 A;  3NKQ A;  4KJD A;  1SHN A;  4FDI A;  5EGE A;  3KD8 A;  3SZZ A;  1E3C P;  3NKO A;  4UPH A;  4CXS A;  2ANH A;  4NWX A;  3MK0 A;  3TG0 A;  5C66 A;  1URA A;  4GTW A;  5AJ9 A;  3NKP A;  1HJK A;  5LRN A;  1K7H A;  2IUC A;  5L0E A;  2G9Y A;  4CXU A;  1EJJ A;  2D1G A;  2W8D A;  3SZY A;  3T01 A;  3DPC A;  3Q3Q A;  4LQY A;  4UPK A;  4MHX A;  3UN3 A;  1ED9 A;  1ELY A;  1ELX A;  1KH5 A;  4MIV A;  3BDH A;  3UNY A;  3UN5 A;  4ZG9 A;  1Y7A A;  1ALJ A;  4KAY A;  3WAY A;  4KJG A;  2GA3 A;  1ALI A;  2GSN A;  1AJA A;  4LR9 A;  1FSU A;  1KHL A;  3BDF A;  4MY4 A;  2XRG A;  1AUK A;  4LRC A;  5DLV A;  5HRT A;  4CYS A;  3E2D A;  1EQJ A;  5K4P A;  1ZED A;  3WBH A;  5IJQ A;  5TJ3 A;  3M8Y A;  3OT9 A;  1URB A;  4LR7 A;  4LRF A;  4UOP A;  3NKM A;  4ZGA A;  1N2L A;  2QZU A;  3TX0 A;  4ZG6 A;  1O98 A;  1ANI A;  4KAV A;  5DLW A;  3T00 A;  3TWZ A;  3BDG A;  5DLT A;  3T02 A;  1HQA A;  1O99 A;  1EW8 A;  2VQR A;  1ALH A;  4YR1 A;  2GLQ A;  4QAX A;  1P49 A;  1EW2 A;  4KM4 A;  1E1Z P;  2IUC B;  4LRA A;  5LQQ A;  1AJC A;  1ED8 A;  1HDH A;  1Y6V A;  3NKR A;  2XR9 A;  3BDG B;  3WAV A;  3CMR A;  5IJS A;  5INH A;  1KH9 A;  1KH4 A;  5GOV A;  3UO0 A;  3M7V A;  2W5S A;  1KHJ A;  5L0K A;  1EW9 A;  3WAX A;  3A52 A;  5EGH A;  3M8W A;  4UPI A;  4TN0 A;  3IGZ B;  4UOO A;  4NWJ A;  5KXA A;  3NVL A;  3MK2 A;  1AJD A;  3M8Z A;  4FDJ A;  2W5Q A;  4LRE A;  1SHQ A;  1KHK A;  4GTX A;  5GRR A;  5L0B A;  4LR8 A;  2GSU A;  2ZKT A;  1E33 P;  1ZEB A;  4LRB A;  1ELZ A;  5LIA A;  4ZG7 A;  2X98 A;  3IGY B;  4N7T A;  4UOR A;  1E2S P;  2W5T A;  2IFY A;  2W5V A;  4UPL A;  1KH7 A;  4GTY A;  3ED4 A;  1KHN A;  3DYC A;  2W5R A;  4LRD A;  2W5W A;  4B56 A;  4CXK A;  3WAW A;  1B8J A;  1ANJ A;  3NKN A;  4LR2 A;  3B5Q A;  2RH6 A;  2GSO A;  3IDD A;  4CYR A;  1EI6 A;  2W5X A;  2W8S A;  5LRM A;  4GTZ A;  1N2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...