4KJDA

Ratintestinal ap expressed in e. coli
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
Knots found
sequence length
478
structure length
407
Chain Sequence
VEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVTLRHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intestinal-type alkaline phosphatase 1
publication title Crystal structure of rat intestinal alkaline phosphatase - Role of crown domain in mammalian alkaline phosphatases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 148
structure length 407
sequence length 478
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4kjdA00
5C66A 3OT9A 1HDHA 3MK1A 4CXKA 3T01A 1KHKA 4CYRA 4KAYA 2W5SA 4LREA 5EGEA 4CXSA 5LRNA 2X98A 2GLQA 1K7HA 1ZEDA 1Y6VA 1AUKA 4KJDA 4LR2A 5LIAA 1HJKA 2ANHA 5DLTA 2XR9A 5L0BA 3E2DA 4UPHA 3NKRA 1SHQA 1ED9A 5DLVA 3CMRA 1KH7A 2GSUA 2IUCB 3NKOA 1KH5A 2RH6A 5KXAA 1KH4A 3M8ZA 4MHXA 4NWXA 4UORA 1EW2A 1FSUA 1O99A 5INHA 3T02A 3M7VA 2QZUA 1E3CP 4ZGAA 1E1ZP 1E33P 4KJGA 3MK0A 3SZZA 1ZEFA 1ZEBA 4UPKA 5K4PA 4QAXA 5GOVA 3MK2A 3NKMA 1KHNA 1URAA 4FDIA 4N7TA 1ALJA 1KHJA 3BDHA 2W5WA 4ZG7A 1EI6A 1URBA 2W5TA 2G9YA 3NKPA 4LRFA 3IGYB 5DLWA 3UN2A 1ED8A 3Q3QA 2W5RA 1EJJA 1ELZA 4GTXA 3NVLA 3ED4A 4LRDA 1ALIA 3DYCA 2IFYA 4UPIA 1EW9A 3BDFA 1ALKA 4ZG6A 3WBHA 1N2LA 4GTYA 3BDGA 2GSOA 1P49A 4NWJA 5EGHA 3UNYA 3KD8A 3NKNA 3TG0A 1E2SP 3IDDA 5GRRA 3M8YA 1KHLA 5IJQA 4UPLA 2D1GA 3TX0A 3B5QA 3WAYA 1EQJA 3TWZA 5IJSA 4CYSA 3NKQA 4GTWA 1O98A 4LQYA 2GA3A 4YR1A 5LQQA 3SZYA 2W5VA 1KH9A 3T00A 2W5QA 4UOOA 1AJDA 1ELYA 5L0KA 1B8JA 4LR8A 1N2KA 1AJBA 3A52A 3WAXA 3BDGB 4TN0A 3UO0A 3LXQA 4GTZA 4KM4A 4MIVA 1ANJA 4MY4A 3WAVA 4KAVA 5TJ3A 5HRTA 2VQRA 1ALHA 1SHNA 2XRGA 3DPCA 3UN3A 4LR9A 3WAWA 5L0EA 1AJAA 5LRMA 4LRCA 2ZKTA 4LRBA 2W8DA 2GSNA 4B56A 4FDJA 2IUCA 1ELXA 1Y7AA 3IGZB 1EW8A 4LRAA 4LR7A 4UOPA 4CXUA 2W8SA 3UN5A 4ZG9A 1HQAA 1ANIA 5AJ9A 3M8WA 1AJCA 2W5XA
chains in the Genus database with same CATH superfamily
5C66A 3OT9A 1HDHA 3MK1A 4CXKA 3T01A 1KHKA 4CYRA 4KAYA 2W5SA 4LREA 5EGEA 4CXSA 5LRNA 2X98A 2GLQA 1K7HA 1ZEDA 1Y6VA 1AUKA 4KJDA 4LR2A 5LIAA 1HJKA 2ANHA 5DLTA 2XR9A 5L0BA 3E2DA 4UPHA 3NKRA 1SHQA 1ED9A 5DLVA 3CMRA 1KH7A 2GSUA 2IUCB 3NKOA 1KH5A 2RH6A 5KXAA 1KH4A 3M8ZA 4MHXA 4NWXA 4UORA 1EW2A 1FSUA 1O99A 5INHA 3T02A 3M7VA 2QZUA 1E3CP 4ZGAA 1E1ZP 1E33P 4KJGA 3MK0A 3SZZA 1ZEFA 1ZEBA 4UPKA 5K4PA 4QAXA 5GOVA 3MK2A 3NKMA 1KHNA 1URAA 4FDIA 4N7TA 1ALJA 1KHJA 3BDHA 2W5WA 4ZG7A 1EI6A 1URBA 2W5TA 2G9YA 3NKPA 4LRFA 3IGYB 5DLWA 3UN2A 1ED8A 3Q3QA 2W5RA 1EJJA 1ELZA 4GTXA 3NVLA 3ED4A 4LRDA 1ALIA 3DYCA 2IFYA 4UPIA 1EW9A 3BDFA 1ALKA 4ZG6A 3WBHA 1N2LA 4GTYA 3BDGA 2GSOA 1P49A 4NWJA 5EGHA 3UNYA 3KD8A 3NKNA 3TG0A 1E2SP 3IDDA 5GRRA 3M8YA 1KHLA 5IJQA 4UPLA 2D1GA 3TX0A 3B5QA 3WAYA 1EQJA 3TWZA 5IJSA 4CYSA 3NKQA 4GTWA 1O98A 4LQYA 2GA3A 4YR1A 5LQQA 3SZYA 2W5VA 1KH9A 3T00A 2W5QA 4UOOA 1AJDA 1ELYA 5L0KA 1B8JA 4LR8A 1N2KA 1AJBA 3A52A 3WAXA 3BDGB 4TN0A 3UO0A 3LXQA 4GTZA 4KM4A 4MIVA 1ANJA 4MY4A 3WAVA 4KAVA 5TJ3A 5HRTA 2VQRA 1ALHA 1SHNA 2XRGA 3DPCA 3UN3A 4LR9A 3WAWA 5L0EA 1AJAA 5LRMA 4LRCA 2ZKTA 4LRBA 2W8DA 2GSNA 4B56A 4FDJA 2IUCA 1ELXA 1Y7AA 3IGZB 1EW8A 4LRAA 4LR7A 4UOPA 4CXUA 2W8SA 3UN5A 4ZG9A 1HQAA 1ANIA 5AJ9A 3M8WA 1AJCA 2W5XA
chains in the Genus database with same CATH topology
5C66A 3OT9A 1HDHA 3MK1A 4CXKA 3T01A 1KHKA 4CYRA 4KAYA 2W5SA 4LREA 5EGEA 4CXSA 5LRNA 2X98A 2GLQA 1K7HA 1ZEDA 1Y6VA 1AUKA 4KJDA 4LR2A 5LIAA 1HJKA 2ANHA 5DLTA 2XR9A 5L0BA 3E2DA 4UPHA 3NKRA 1SHQA 1ED9A 5DLVA 3CMRA 1KH7A 2GSUA 2IUCB 3NKOA 1KH5A 2RH6A 5KXAA 1KH4A 3M8ZA 4MHXA 4NWXA 4UORA 1EW2A 1FSUA 1O99A 5INHA 3T02A 3M7VA 2QZUA 1E3CP 4ZGAA 1E1ZP 1E33P 4KJGA 3MK0A 3SZZA 1ZEFA 1ZEBA 4UPKA 5K4PA 4QAXA 5GOVA 3MK2A 3NKMA 1KHNA 1URAA 4FDIA 4N7TA 1ALJA 1KHJA 3BDHA 2W5WA 4ZG7A 1EI6A 1URBA 2W5TA 2G9YA 3NKPA 4LRFA 3IGYB 5DLWA 3UN2A 1ED8A 3Q3QA 2W5RA 1EJJA 1ELZA 4GTXA 3NVLA 3ED4A 4LRDA 1ALIA 3DYCA 2IFYA 4UPIA 1EW9A 3BDFA 1ALKA 4ZG6A 3WBHA 1N2LA 4GTYA 3BDGA 2GSOA 1P49A 4NWJA 5EGHA 3UNYA 3KD8A 3NKNA 3TG0A 1E2SP 3IDDA 5GRRA 3M8YA 1KHLA 5IJQA 4UPLA 2D1GA 3TX0A 3B5QA 3WAYA 1EQJA 3TWZA 5IJSA 4CYSA 3NKQA 4GTWA 1O98A 4LQYA 2GA3A 4YR1A 5LQQA 3SZYA 2W5VA 1KH9A 3T00A 2W5QA 4UOOA 1AJDA 1ELYA 5L0KA 1B8JA 4LR8A 1N2KA 1AJBA 3A52A 3WAXA 3BDGB 4TN0A 3UO0A 3LXQA 4GTZA 4KM4A 4MIVA 1ANJA 4MY4A 3WAVA 4KAVA 5TJ3A 5HRTA 2VQRA 1ALHA 1SHNA 2XRGA 3DPCA 3UN3A 4LR9A 3WAWA 5L0EA 1AJAA 5LRMA 4LRCA 2ZKTA 4LRBA 2W8DA 2GSNA 4B56A 4FDJA 2IUCA 1ELXA 1Y7AA 3IGZB 1EW8A 4LRAA 4LR7A 4UOPA 4CXUA 2W8SA 3UN5A 4ZG9A 1HQAA 1ANIA 5AJ9A 3M8WA 1AJCA 2W5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C66 A;  3OT9 A;  1HDH A;  3MK1 A;  4CXK A;  3T01 A;  1KHK A;  4CYR A;  4KAY A;  2W5S A;  4LRE A;  5EGE A;  4CXS A;  5LRN A;  2X98 A;  2GLQ A;  1K7H A;  1ZED A;  1Y6V A;  1AUK A;  4KJD A;  4LR2 A;  5LIA A;  1HJK A;  2ANH A;  5DLT A;  2XR9 A;  5L0B A;  3E2D A;  4UPH A;  3NKR A;  1SHQ A;  1ED9 A;  5DLV A;  3CMR A;  1KH7 A;  2GSU A;  2IUC B;  3NKO A;  1KH5 A;  2RH6 A;  5KXA A;  1KH4 A;  3M8Z A;  4MHX A;  4NWX A;  4UOR A;  1EW2 A;  1FSU A;  1O99 A;  5INH A;  3T02 A;  3M7V A;  2QZU A;  1E3C P;  4ZGA A;  1E1Z P;  1E33 P;  4KJG A;  3MK0 A;  3SZZ A;  1ZEF A;  1ZEB A;  4UPK A;  5K4P A;  4QAX A;  5GOV A;  3MK2 A;  3NKM A;  1KHN A;  1URA A;  4FDI A;  4N7T A;  1ALJ A;  1KHJ A;  3BDH A;  2W5W A;  4ZG7 A;  1EI6 A;  1URB A;  2W5T A;  2G9Y A;  3NKP A;  4LRF A;  3IGY B;  5DLW A;  3UN2 A;  1ED8 A;  3Q3Q A;  2W5R A;  1EJJ A;  1ELZ A;  4GTX A;  3NVL A;  3ED4 A;  4LRD A;  1ALI A;  3DYC A;  2IFY A;  4UPI A;  1EW9 A;  3BDF A;  1ALK A;  4ZG6 A;  3WBH A;  1N2L A;  4GTY A;  3BDG A;  2GSO A;  1P49 A;  4NWJ A;  5EGH A;  3UNY A;  3KD8 A;  3NKN A;  3TG0 A;  1E2S P;  3IDD A;  5GRR A;  3M8Y A;  1KHL A;  5IJQ A;  4UPL A;  2D1G A;  3TX0 A;  3B5Q A;  3WAY A;  1EQJ A;  3TWZ A;  5IJS A;  4CYS A;  3NKQ A;  4GTW A;  1O98 A;  4LQY A;  2GA3 A;  4YR1 A;  5LQQ A;  3SZY A;  2W5V A;  1KH9 A;  3T00 A;  2W5Q A;  4UOO A;  1AJD A;  1ELY A;  5L0K A;  1B8J A;  4LR8 A;  1N2K A;  1AJB A;  3A52 A;  3WAX A;  3BDG B;  4TN0 A;  3UO0 A;  3LXQ A;  4GTZ A;  4KM4 A;  4MIV A;  1ANJ A;  4MY4 A;  3WAV A;  4KAV A;  5TJ3 A;  5HRT A;  2VQR A;  1ALH A;  1SHN A;  2XRG A;  3DPC A;  3UN3 A;  4LR9 A;  3WAW A;  5L0E A;  1AJA A;  5LRM A;  4LRC A;  2ZKT A;  4LRB A;  2W8D A;  2GSN A;  4B56 A;  4FDJ A;  2IUC A;  1ELX A;  1Y7A A;  3IGZ B;  1EW8 A;  4LRA A;  4LR7 A;  4UOP A;  4CXU A;  2W8S A;  3UN5 A;  4ZG9 A;  1HQA A;  1ANI A;  5AJ9 A;  3M8W A;  1AJC A;  2W5X A; 
#chains in the Genus database with same CATH topology
 5C66 A;  3OT9 A;  1HDH A;  3MK1 A;  4CXK A;  3T01 A;  1KHK A;  4CYR A;  4KAY A;  2W5S A;  4LRE A;  5EGE A;  4CXS A;  5LRN A;  2X98 A;  2GLQ A;  1K7H A;  1ZED A;  1Y6V A;  1AUK A;  4KJD A;  4LR2 A;  5LIA A;  1HJK A;  2ANH A;  5DLT A;  2XR9 A;  5L0B A;  3E2D A;  4UPH A;  3NKR A;  1SHQ A;  1ED9 A;  5DLV A;  3CMR A;  1KH7 A;  2GSU A;  2IUC B;  3NKO A;  1KH5 A;  2RH6 A;  5KXA A;  1KH4 A;  3M8Z A;  4MHX A;  4NWX A;  4UOR A;  1EW2 A;  1FSU A;  1O99 A;  5INH A;  3T02 A;  3M7V A;  2QZU A;  1E3C P;  4ZGA A;  1E1Z P;  1E33 P;  4KJG A;  3MK0 A;  3SZZ A;  1ZEF A;  1ZEB A;  4UPK A;  5K4P A;  4QAX A;  5GOV A;  3MK2 A;  3NKM A;  1KHN A;  1URA A;  4FDI A;  4N7T A;  1ALJ A;  1KHJ A;  3BDH A;  2W5W A;  4ZG7 A;  1EI6 A;  1URB A;  2W5T A;  2G9Y A;  3NKP A;  4LRF A;  3IGY B;  5DLW A;  3UN2 A;  1ED8 A;  3Q3Q A;  2W5R A;  1EJJ A;  1ELZ A;  4GTX A;  3NVL A;  3ED4 A;  4LRD A;  1ALI A;  3DYC A;  2IFY A;  4UPI A;  1EW9 A;  3BDF A;  1ALK A;  4ZG6 A;  3WBH A;  1N2L A;  4GTY A;  3BDG A;  2GSO A;  1P49 A;  4NWJ A;  5EGH A;  3UNY A;  3KD8 A;  3NKN A;  3TG0 A;  1E2S P;  3IDD A;  5GRR A;  3M8Y A;  1KHL A;  5IJQ A;  4UPL A;  2D1G A;  3TX0 A;  3B5Q A;  3WAY A;  1EQJ A;  3TWZ A;  5IJS A;  4CYS A;  3NKQ A;  4GTW A;  1O98 A;  4LQY A;  2GA3 A;  4YR1 A;  5LQQ A;  3SZY A;  2W5V A;  1KH9 A;  3T00 A;  2W5Q A;  4UOO A;  1AJD A;  1ELY A;  5L0K A;  1B8J A;  4LR8 A;  1N2K A;  1AJB A;  3A52 A;  3WAX A;  3BDG B;  4TN0 A;  3UO0 A;  3LXQ A;  4GTZ A;  4KM4 A;  4MIV A;  1ANJ A;  4MY4 A;  3WAV A;  4KAV A;  5TJ3 A;  5HRT A;  2VQR A;  1ALH A;  1SHN A;  2XRG A;  3DPC A;  3UN3 A;  4LR9 A;  3WAW A;  5L0E A;  1AJA A;  5LRM A;  4LRC A;  2ZKT A;  4LRB A;  2W8D A;  2GSN A;  4B56 A;  4FDJ A;  2IUC A;  1ELX A;  1Y7A A;  3IGZ B;  1EW8 A;  4LRA A;  4LR7 A;  4UOP A;  4CXU A;  2W8S A;  3UN5 A;  4ZG9 A;  1HQA A;  1ANI A;  5AJ9 A;  3M8W A;  1AJC A;  2W5X A; 
#chains in the Genus database with same CATH homology
 5C66 A;  3OT9 A;  1HDH A;  3MK1 A;  4CXK A;  3T01 A;  1KHK A;  4CYR A;  4KAY A;  2W5S A;  4LRE A;  5EGE A;  4CXS A;  5LRN A;  2X98 A;  2GLQ A;  1K7H A;  1ZED A;  1Y6V A;  1AUK A;  4KJD A;  4LR2 A;  5LIA A;  1HJK A;  2ANH A;  5DLT A;  2XR9 A;  5L0B A;  3E2D A;  4UPH A;  3NKR A;  1SHQ A;  1ED9 A;  5DLV A;  3CMR A;  1KH7 A;  2GSU A;  2IUC B;  3NKO A;  1KH5 A;  2RH6 A;  5KXA A;  1KH4 A;  3M8Z A;  4MHX A;  4NWX A;  4UOR A;  1EW2 A;  1FSU A;  1O99 A;  5INH A;  3T02 A;  3M7V A;  2QZU A;  1E3C P;  4ZGA A;  1E1Z P;  1E33 P;  4KJG A;  3MK0 A;  3SZZ A;  1ZEF A;  1ZEB A;  4UPK A;  5K4P A;  4QAX A;  5GOV A;  3MK2 A;  3NKM A;  1KHN A;  1URA A;  4FDI A;  4N7T A;  1ALJ A;  1KHJ A;  3BDH A;  2W5W A;  4ZG7 A;  1EI6 A;  1URB A;  2W5T A;  2G9Y A;  3NKP A;  4LRF A;  3IGY B;  5DLW A;  3UN2 A;  1ED8 A;  3Q3Q A;  2W5R A;  1EJJ A;  1ELZ A;  4GTX A;  3NVL A;  3ED4 A;  4LRD A;  1ALI A;  3DYC A;  2IFY A;  4UPI A;  1EW9 A;  3BDF A;  1ALK A;  4ZG6 A;  3WBH A;  1N2L A;  4GTY A;  3BDG A;  2GSO A;  1P49 A;  4NWJ A;  5EGH A;  3UNY A;  3KD8 A;  3NKN A;  3TG0 A;  1E2S P;  3IDD A;  5GRR A;  3M8Y A;  1KHL A;  5IJQ A;  4UPL A;  2D1G A;  3TX0 A;  3B5Q A;  3WAY A;  1EQJ A;  3TWZ A;  5IJS A;  4CYS A;  3NKQ A;  4GTW A;  1O98 A;  4LQY A;  2GA3 A;  4YR1 A;  5LQQ A;  3SZY A;  2W5V A;  1KH9 A;  3T00 A;  2W5Q A;  4UOO A;  1AJD A;  1ELY A;  5L0K A;  1B8J A;  4LR8 A;  1N2K A;  1AJB A;  3A52 A;  3WAX A;  3BDG B;  4TN0 A;  3UO0 A;  3LXQ A;  4GTZ A;  4KM4 A;  4MIV A;  1ANJ A;  4MY4 A;  3WAV A;  4KAV A;  5TJ3 A;  5HRT A;  2VQR A;  1ALH A;  1SHN A;  2XRG A;  3DPC A;  3UN3 A;  4LR9 A;  3WAW A;  5L0E A;  1AJA A;  5LRM A;  4LRC A;  2ZKT A;  4LRB A;  2W8D A;  2GSN A;  4B56 A;  4FDJ A;  2IUC A;  1ELX A;  1Y7A A;  3IGZ B;  1EW8 A;  4LRA A;  4LR7 A;  4UOP A;  4CXU A;  2W8S A;  3UN5 A;  4ZG9 A;  1HQA A;  1ANI A;  5AJ9 A;  3M8W A;  1AJC A;  2W5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...