4KJYB

Complex of high-affinity sirp alpha variant fd6 with cd47
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
b'EEEVQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQRQGPFPRVTTISETTRRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFKSGAGTELSVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte surface antigen CD47
publication title Engineered SIRP alpha variants as immunotherapeutic adjuvants to anticancer antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kjyB01
3FT2B 1D6EB 1PKQA 1T03L 1VFMA 4I2XB 2H26B 3IDNA 4JLRB 3C9NA 5KZCB 1SQ2N 4JHZA 4D9LL 2VLKD 2FGZA 2BSSB 2GYSA 3ZDZF 5I1EL 1T80A 5E56A 3EFFA 4HWBA 4K2UL 4DKAA 2XA8H 3IAPA 1IFHH 3CAFA 3V7AG 2IQ9L 3LQAH 4KRPD 4DVRH 2EO9A 1RK0B 1WZLA 1IAKA 3RI5F 4P2RB 3IAGC 5I2IB 4P0DA 4LHJB 5E6ID 4F7TA 2OSLB 3TBWB 1ORQB 2VITB 3KYOB 2ARWA 2K3TA 3D3VB 1QPXA 3OX8A 3QIWD 3GIZL 3T2PA 2P43B 2PUQT 4GXVH 1RZFH 5J57B 5D1QC 4IRJB 2P44B 3C6LB 5DD1H 2D7TL 4UUJA 5GSRA 3MOAH 3P0GB 2YRZA 1UEMA 3KPMB 1RV6X 4EBQH 2DB8A 4NUGH 3WFHB 1P1ZA 4EDWL 4LCUA 2DLIA 5C08E 3FO9B 3GSWB 3SKJL 5IIEA 3FTGB 2FYYA 4M43L 3QG7H 4QHKJ 1JWUB 4PG2C 3SE3C 1KG0A 5FO9B 35C8H 3UZQA 4KK8D 2K9UA 4I9WD 4NDMA 5E9DB 4GJTB 3OKDA 1IZKA 2FLRT 4GRMB 3V6OC 2AJZA 3OJDB 3QDHA 1FNGA 1Q9OB 1WSST 3PDDA 2AK4A 4NQDE 5F7EL 5B4MC 4N1CA 3EO0A 4HHAA 1LO4H 4FABL 1W8OA 4F7PA 4GRWF 3MRPA 5BRZB 1DBBL 5LWYH 1T1XA 1FVEB 2W92A 4FQIH 4K23H 1GZQB 5LQBH 3PWPD 5BQ7A 4QWWC 1HILA 3BW9A 1S9VA 2Z91B 3FRUB 5C0ND 2CDGA 2CK0H 4RZCA 3SCMC 2OJEB 1K8DA 4Z7WB 1JL8A 1D5BB 1KTRL 1KNOA 2X1OA 4EUPG 2AK4D 4ZUWA 3UTTB 1WITA 3V52H 4LHUD 4K9EL 2ZCHH 5IB2B 1QBBA 4OSUH 3QEQD 2ZP0T 3BE1H 2YZ8A 4YO0A 2RHEA 2YD1A 1HHGB 4HBQA 4JPIB 4MQXC 1FO0B 2Z9TA 3MLUL 4IHOA 4FQCH 4HPYH 2VL5A 4XP6L 3IGAB 5D7JD 4J3OC 3QEHA 2VLJD 4S2SA 3FAXA 1UT9A 5D2LE 3D5OF 5J06A 3X3FH 4P3DA 1VSCA 4OLWH 4WUUD 1M6OA 3MV01 4KXZI 5ICZB 4KKAC 1FQ9C 4M61A 1TZIB 1BVLA 1S7VB 5C2UB 3DX8A 7FABL 4K3DH 4TPRL 1O7SA 2DQDH 2EXYD 3EDJA 3GB7A 3L3DB 1BQSA 3G04B 3QIBA 4QLRA 1U36A 3IU4H 5B8CC 2DICA 2WIIA 1S5IL 5IR1B 4HWBH 4OF8A 1JWSB 2HFGL 4PTTB 3F58H 1ONQB 3SKOB 2GSGB 2I9LA 5LG1A 2HT3D 1A1NA 2M2DA 5D6DA 3ZSSA 4GW5A 4I48A 1U8PA 2B0SL 3W0WE 3HC3L 1IAII 5FYKL 2AEIT 4MCZA 5TQ0L 2MCPH 3B8SA 5KSVA 1S78D 1RZ7L 2OTPA 4CN1A 1TJIH 3TWCL 1HHJB 1T7WA 5BVPL 1UA6L 4HKBB 5CKGA 1T1YB 4QRRA 2V2XA 3MR9A 4AK1A 1A1OA 1OSZA 1BJ1H 1P4BL 1KN4L 2B2XL 1YEEH 1VESA 1CDUA 2OJZL 4NP4H 4U2ZA 1DQML 2GUOA 2X7LA 2E8ZA 1ZHNA 3QIBD 2VXTH 4N8VG 1TZHB 3EJYD 3WDIA 2CRIA 4ZXBA 6FABH 1EVUA 3WSQL 1E4WL 3FHAA 1N26A 3RAJH 2CGRH 1EO5A 5DFVC 5F70A 4W6YB 5J0BA 4HWUA 2F5BL 1HHKB 3SDAA 4PRAA 4MNQE 2NY2C 2PYEB 2Y36L 1P7QB 3ZKXC 5IJKA 3BIBX 5C2BH 4NNPL 1IC4H 2YBRA 5JZ7C 4UINH 1PG7W 2OX5A 3IDUA 4GAGH 4U6HB 2C4XA 2V5MA 4OGYL 5FUOL 3MRDB 4PRIE 1K4DA 1ZT4A 4P5TD 5IHUH 1J8HD 3OKKB 2XQBH 4L1HA 1YMME 3CUPA 1T3FA 4YHMH 5FGRA 3WNOA 1OF2B 3IFNH 3VFMA 1A6TB 3ULVF 1BBJA 1IE5A 2R4RL 5C09B 3O9WA 5HI4D 3S3SA 3MBEC 4LSQH 3U7WH 3B6SB 2R2EA 1T66D 4EZMA 4KRMB 1X5ZA 1TIUA 4NSKA 2P1YA 1QFOA 1L0XA 3BKJL 2FX7L 3NFSH 5C08A 1QNZH 1S7WB 4LLWA 4JFDB 4LKCA 4XBEL 4JKPH 3GKWH 3P30H 2FD6H 4NFDA 2BOCB 3CVHL 5JOFB 3SE9L 1M05B 4CVXA 2Y6SD 3ALWA 1HI6A 1NBZA 2WBJA 4HFUL 1FJ1B 5GGTA 1T2QL 5T1LB 2IAMB 4NQDA 1D9KD 3H9ZA 2AK1H 3R8QA 4JFHD 1YUHA 5EU6B 1A22B 1CE6B 3O8XD 1ZHLB 3G6AA 3V5KB 4YHNB 3U83A 4P9HH 4XMKL 5H35A 1KT2B 2ICWJ 1DQQB 5EOQL 4KRPC 2IFFL 4HSQA 2HJFB 2WUCH 2BJMH 1R5WB 1DUZA 1JGLL 2H9GB 4JJHA 2WBJD 5E6IC 1P4IL 1AKJB 1UEYA 3FN3A 1XGYL 4N90D 5EO9B 4MNHB 5GGRA 5KVDH 1JGEA 2G60L 4LVOC 1AJ7L 2CLRB 4JANA 3V2AR 4Z78A 3JV5A 3QIWC 2DTSA 4HUVA 2I5YL 1ZHKB 1OWWA 3CSPA 5CIPB 5GRJL 5HY9A 1U8IA 5CEYA 2EDRA 4U6YA 1TQCB 3DXAE 1JRHH 4TRPL 5I9QB 4I0CC 5B3JF 5E2UH 2QSCH 1YEKH 4JPKL 3U1SH 3JWOL 4YC2B 4GBXB 3WJLC 3IDXH 1PDKA 1VHPA 3DMMC 1F3JB 4ODHL 5CILH 5J11B 5IEKA 1G1CA 4YHLL 4KVCH 2CK2A 4NKDB 4W68A 1I9RL 3ZE2E 1WZ1H 1QA9A 5EA0H 1CD1B 5EORL 2LE9A 1QSED 2J8UB 5E70A 1U6AL 4QNPF 3QXAA 4X0KB 1HH6A 2EEBA 2FZ3B 4RBPK 3W0WA 1I3UA 3EDFA 4Y4FA 1F6AB 4MX7A 4DN3H 1NLBH 3ULVD 2DI9A 1S3KH 5E8EB 5F3BA 5ACMA 1AGFA 1J7VR 3BWAB 4L3EB 1N64H 5J1AA 2FSEA 2QJDA 5HYSA 2WIMA 5C0NC 3MJ7B 4WW2B 5KJRL 3W9EA 3EYUL 4FQJH 2OI9B 2W9LA 4NO5A 5L7XH 3IT8D 5D4QA 1JGUH 3HE6D 1YMHA 3DRQA 4J7RA 3UYPA 5D6CA 3S35L 3VXUE 2YPLB 5I0ZA 5L2KA 1I9JH 4N68A 3ZHDA 1RUML 4WTZG 2X6MA 4J12A 4Y4FD 3TIDB 2NQCA 4OD1H 3KYKL 4H88L 32C2B 2QHRL 2P8LA 4NNXA 1EFQA 4PJXB 1I7ZB 2Z8SA 1S7RB 4FQQB 1QBAA 5T33L 1FH5L 3QDME 4LSUL 5D7JC 3RUGA 4MVBC 5GGTH 3IDYC 1YMMA 1VERA 2B20A 3T1FA 3WEXB 3RWFA 1A3QA 5GGUB 3DTXA 1C1EH 4ZYKB 3ZDXE 4L4VB 1CR9L 5MI0B 1CL7I 2Y07L 4YK4C 1URLA 2EXYC 3QCTL 1KIQB 5E2TH 2YEZB 3BZFB 2FX8L 5ANME 3FN9A 4ZQKB 5T3ZL 1GCFA 1MHPH 4NBZB 5EBLA 1OQXA 2YMXH 1JPTL 1UADC 3FZUD 1J0HA 3KNBB 1KLGA 3AUVA 1AGCA 5IFAL 3CCHB 4KY1L 4KMTH 3VD9A 4X6FA 1QBMH 1S78C 3JWNC 5K9KB 2C1OA 1BVKB 1WBXB 2Y06H 4PTUA 5DQJA 2JK5B 3HFML 4YHZL 2C7UB 2Y9RT 1R3HB 3CMGA 3O6FD 4IRSA 3LRHA 4XP4L 1UACL 5IVNA 1SBSH 1QSFD 1DJSA 5FGCE 3EJYC 4LCWB 5FYLE 5ACZA 1HOCA 4S1SL 3OR6A 3WKMH 5JOEA 2R1YA 1Z0NA 3HLAB 1WCQA 3ARWA 2W9DL 1DLHB 4G6AD 2LQRA 1LP9B 3QEUB 2X1PA 5I15H 3BKML 3TH4T 4R7DA 3N06B 2P7TB 1X5YA 5CEXB 2HVJA 3HCVB 4YHKH 1FL3A 1JGVH 2VDQH 3EYFA 5T1KA 2Z31A 4QGYA 1DFBL 4IRSD 4P5TC 2V2TA 2HT4C 4M02A 3P4MA 1CXLA 1F58L 1UWXK 4YNYB 1OSPL 4N9GA 2XOTA 3ET9F 3VWJA 2Q20A 2Q6WA 3C87A 3DHJA 2YHGA 4UNVA 3OXRB 1E4KA 5BS0B 3CZFA 5D5MB 1WICA 4XX1G 3TFKD 2YK1L 1AIFA 1AI1L 4NO0A 1AO7B 1DBML 4QOKE 2DIBA 5SX5H 5DGQA 4NO3B 3DROB 1ZS8A 3G5XA 1KPRA 2F53E 2VAAA 4GAYB 3ARRA 3HS0B 1TCMA 3GI9H 3VE0B 3FN0L 1MFDL 4KV5F 5T1KD 1PZUB 2IANB 2Z31D 1KJ2B 2V17L 5EBGA 5IWLC 4MXQD 5IVXF 2EIZB 1X4ZA 2I07A 2XWTA 3R06A 3FT4B 1ACYL 1YPZA 2Y6SC 5MERA 4NRXA 4P46D 2JIXA 3MO1B 3VWJD 3L3OB 2PYFB 2PCPA 4YIQA 2EDLA 4HKJB 1KPUB 2C3VB 4J3XA 4KQ3H 2NTSP 1OW0A 1BHGA 5EULV 3P4OA 3PHOA 4JKLA 2PO6D 4LSSH 3O8XC 5HHOE 5ESAA 3C5JA 2J4WH 1XH3A 2R56L 1G7PA 5EZIL 5I75C 3E6HA 1MJ7L 3NBNA 2Z92B 3GNML 3CSYA 1U91B 3IFLH 1KJ3L 1L4IA 1S9XB 3ALXA 2D9QB 2MCG1 15C8L 5ALBH 2ZUQB 3UJTL 3FFCD 1RIHH 3U9UB 2ITCB 4HUNB 3H2WA 5HHPA 1H8OA 4OTXL 3SEPA 3KHQA 4OM0H 3UJIH 1YEHL 5JQHC 2OLDA 3Q3GB 3DHMA 4PJ5A 4JY4B 3O11B 3S36L 4ELME 3MCLL 3GJEA 4KUZL 1KEMH 3TPUA 1N4XH 4KPHL 1JYXA 1RZJL 1I85A 3HE7A 3CH1A 1NCAH 4X98B 5T3XH 1XCQA 5ENWB 5IBTL 2A1WL 4MDJA 3V5DA 5I71C 2DLTA 3F5WB 1NBQA 4AT6A 3KJ4C 4HC1L 5FM4A 3EDEA 4WI8A 1RI8A 4LP4A 4GKOA 3CFBB 4Y0GA 3BOVA 2D4FA 5DR5H 3OGOE 4AJ0A 3O45B 2ZCKH 4XXDB 1A6PA 4TNWK 4UIKH 4ETYA 4PJ5D 4M5ZH 4KQ4L 4P2QE 1I1CA 4PJBF 1FNAA 4PJCF 4WJ5A 2UUDH 4NQEB 2ITDB 3HE7D 1EMTH 3ULVC 5GJSL 2BSTA 4QHMA 3T0ED 4ORZC 2WV3A 5CZXD 5MENA 5C0GA 5CUSH 2BVUA 4QRSB 1CGUA 5JLZB 4P2RE 2VLLA 3I2CH 3OKMB 2CUHA 3EYOA 4F9PC 4NT6A 4K8RL 2IQAA 5MEQB 3L3HA 1CLOL 4OV6F 5JXAH 2HTKD 1L7TH 1U2HA 3D3VE 3PNWA 5J6GA 4PD4K 4RAVA 3HE6C 2HT2D 5ADPL 4L29B 4WV1C 1UJTA 4HCRA 5K9JL 4RWYH 3AB0C 1XFPA 2Q76A 5D9SA 2NY4C 2NW3A 1I3RA 2FHFA 3ZE0F 2YZ1A 3MRRA 2KDGA 5C7XL 2ARJB 1M71B 2F54B 1YNTB 4UAOB 5ICXA 3FB8B 4M1GL 3LS5L 4O58L 2B4CL 5HVGB 4Q6YA 4Y5YC 3ZKXB 4IRZH 1LVEA 1CG9B 2R2CA 5DRWB 1A1MB 1NCUA 1YQ2A 1CLZL 5DJ0A 4MA7H 4LSDA 3WL9A 1A3LH 5DI8A 1MRDL 3KR3H 5IBLC 4FQHB 2D2OA 5C9JA 3OJ2C 2NY5L 1I4FA 4R26L 5F6HJ 4OI8A 3U30C 1E6OL 1MHCB 3EYVA 2VC2H 5EUKA 4QOKA 3QEGH 3I75A 4DK6A 5DJYB 1UB6B 4N0CD 4BZ1H 4ZO9A 5BRZE 5DD3H 2G9HA 4UV4L 4V2CB 3T09A 3W39A 4GG6A 2BSED 4MCYB 1IZJA 4NWTL 2GY7B 5ERWA 4I13B 4WWID 2IGFL 4M5YH 1T21B 3O41B 1MJUL 3D39B 2AEQL 2FX9H 1NGZA 3MOBL 4B7IA 1HZHL 1E28B 2VLRE 4UT6H 5EZOH 4Z8FL 1WAAA 2NY6C 3O6FC 4YUEL 3GO1H 5LGJA 1CD8A 3UTTE 4YQXH 1OAKL 3GFUA 5C0AA 4WGWB 5CLWA 5BVJB 4PRNA 2D31B 3LH2H 5CSBA 2FBJH 1JMXA 1L7IH 2NY1D 5CZKA 3O4LA 3SGDI 3FJTA 5E8DH 4G6AC 1S8DA 4M7KH 2C4FU 4DUWA 5HDLA 4XXCC 5M94B 4LCCB 5HGDB 1XF4B 1EEUA 4J8RB 3WFDL 5FO8B 1L6ZA 1T0MB 2B1AL 3QHFH 2ZG3A 4TTDC 4MQSB 5JIIA 1NL0L 4O02H 3UTQA 2UVFA 3IDGA 4OCYH 5HYJB 4HS6B 4YAQB 1RJYB 2ESVE 5K9OB 4LEOA 1IMHC 1LK3L 5F8RC 2NLJA 2CRMA 2EH8H 3HPJB 4GW4B 2AJUH 3BJLA 5IB3A 2L4OA 2O5XH 2W07A 3D25B 4LVOB 3VI3F 4BZ2L 1NC4D 1ED3B 1JNLL 3V4UL 3RY4A 5CP7B 5DA4A 2R29H 4JRXD 4BQBA 2X4UA 4X5LA 1IEAB 3G6JB 3MNZB 4F8QA 1S7UA 4NQVA 2DYPD 5L2JA 2HH0L 3PV6B 4OF6A 4YX2L 5D1ZC 3WFZA 1QTYT 1CVSC 4EQ2A 4XWOD 3MUHL 5H37G 4ZNEE 4P4RA 3K7UA 4MXQC 5T1MA 3DMMB 4HCRH 3RL2B 3JV6A 3PDOA 4ZTOH 3OKOB 3TGXA 1CICC 2EH7H 5H94A 4P2QA 2VDLH 4X6BB 3L3IB 4LAQL 5D96C 4DOHE 5EDXA 2V9TA 5I30H 2DKUA 4JJ5B 2PO6C 4PGJA 3E2HB 1QUNA 5C0IB 3UTPE 4QHLA 3MCKA 1FV1B 2QQLH 3EJZD 3MRFA 4NNYB 1RJZA 1GOGA 1I7UA 2VZSA 3LEXA 2Q86A 1E6JL 1EK3A 5GIRA 2OQJA 4YXHL 1G9EA 2FGWL 1HSBA 1HXMB 3GZKA 5EFIB 2BMKA 4LLYB 4N0YL 2HFTA 4PYHA 1WT5C 2ICWA 1F3RB 4HUMB 1JV5A 2BRRL 1G7MB 4FNLH 2RJMA 4U1MA 1J05A 4PB0L 2FJHA 3LN4A 3EBAA 3MROA 4HWEH 1JMZA 4HQQH 5AAWA 5K93A 3JWDC 4DGYH 4X6CB 3KPRA 1FGVH 2XG4A 4O2CB 1AGBB 2A83A 1SYSA 3NFPA 5FECA 1NPUA 3A6OA 1RZKL 5EH1A 4WVRA 4AIXA 1MJJB 4XMLL 4OZIF 4ALAL 2BNRB 3VFOA 3P9MB 3MLVH 4GW1B 1KPVB 2DKMA 1Q0YH 3IJHB 5TJWK 1FE8H 3V4VH 1S7SA 5I1DA 4Y2DC 2EDJA 4PJDA 5GS0C 2XZCL 1H3GA 4PV9A 5E8OA 4YK4B 5CZVH 4RQQB 3QDGD 4PP1D 1LE9B 2CH8A 4J3VA 5EU6E 1TJGL 1G6VK 3BGAA 3N1PC 4PJ9B 5IQ9B 5JQ6H 2BDNH 1V3MA 3S88H 4V1DA 4X4MA 2DL9A 2HFEA 2C4FT 5E5UB 3TZVB 5GGSB 1L9NA 5HHXH 1KCVL 3B5TA 4RMRA 1XGRA 2ZOLA 1PYWB 2H32B 2VLRA 1T03H 3X12B 4L8DA 2QQNL 2H8PA 1D5XA 4NPYB 3REWB 3RX5A 4JM2B 3U6RA 4LLAA 1FAIL 3S37L 2X4SA 2JELL 5IHZA 3HC0A 5I1EH 4OCRL 5MEOB 2OS7A 4K2UH 4XCNA 5IFJA 4NZTL 2GJZA 2HTKC 5SV3A 5GS1A 2IQ9H 4JR9L 5ALCH 4ZUVB 5D70L 3RHWF 1A7NL 2JE8A 5EU5A 4XP5L 3E8UH 4AH2B 4GT7A 4D8PA 3QZWB 5C0BD 1EZVX 5JW4R 4V1DD 4YHYC 4UU9A 1CTNA 4I4WA 1Q9WB 4U1JA 4XNMB 3GIZH 1BQHG 1EJ6A 3RWEB 3GK8L 5IKCB 2NY0D 4W70A 4PS4L 1T1ZA 5F7HA 4GRWB 5DRZB 1TTGA 2D7TH 2ESVA 4XAKD 5EU3A 3T4YA 5TFSH 4X99A 2GAZB 2UWEF 1MCNA 2J88L 3BUYB 3VXME 1RMFH 2VXQL 1IVLA 5C0FB 1R5VB 1VADB 2EDKA 4EDWH 4JQIL 4RRPG 4N8PA 2DQEL 3SKJH 4G5ZH 5FYKD 2D7PA 5I1LA 2J8UE 4ZFZB 1I1AC 3ARGB 1NQBA 3MJ9L 3U46A 4JO2H 2DIAA 3RNQB 1NJ9A 1UJ3B 4JY6A 2XNAB 5DJ8A 1IJ9A 3SDCB 3VFUA 4CADA 4PG9B 4G8FA 4PUBL 5BCAA 3NA9H 3WD5L 2ADJA 4Q0XL 1P7KB 5FV2A 5IMMA 4EN3D 2PW2B 1WQVT 2VXSL 2YUWA 3U79A 2XFXB 5J7CC 4MDIB 4PJ7E 4M8QA 1OQOA 3O3BB 1QRNE 4ZNEA 2VXUL 1QOKA 1KBGL 5C0EB 3MUZ1 3UBXG 5C3LD 3VG0H 3O0RL 3JTSB 2EE2A 1RVFL 4WDIA 4QRTA 1NBYB 1MIEL 1V05A 1X44A 5EO1B 5I1AA 4RA0C 4KTDL 3NCEB 5DRNB 4EOWL 3ARZA 2ADIA 4E42B 3WN5A 4OGZA 3HPLB 1N8ZA 2PXYB 3L5HA 5JUEL 4WFGE 2ERJB 4JFOB 4O4YL 4LRNH 5SWZE 5F96H 5GISL 2XN9B 2N1KA 3MGOB 4K9EH 4TUJA 2ZG2A 5KSAB 1ZSDA 3VI4F 3TT3H 1CVRA 5I75B 4Z7NF 4YE4L 3QI9D 2HN7A 3TCLB 2AXGB 1UB5A 2BX5A 4L4VE 3MLUH 5SWQA 1XIWD 2Q3AA 1RU9L 1VKXA 1RUKL 3DX7A 5KSUB 5E8PA 4OCXL 2DQFA 2CDEB 3GGWB 4HV8B 4OZ4A 5EBWB 2P8MA 1B0WA 5KG9B 2Z8VC 1YEJH 4DJMA 3MRCB 4F80A 3EAKA 3HRZB 4TPRH 3U0TA 3KPLB 2DS4A 1MY7A 2B7DT 3SGJC 3EFDL 5I1GL 4KDWA 1ZOXA 5SWSB 4JQXA 4JDVA 1KACB 3PWJA 1AD0A 1N5AA 4LPVA 1YYLL 4PJIB 4I5BB 5DJXB 2HFGH 1QPPA 1IGJB 4KKLD 5I71B 4XWOC 4YFLF 2B0SH 3FOLB 3ULUH 3HC3H 1VEOA 2NTFA 3PGCA 5TQ0H 1VFBA 4Y19A 5DD5L 1QLRA 2X4QB 4MD5A 1RZ7H 1FFNB 5BVPH 1G6RB 4LCWE 1M4KA 1NC2A 4WUKL 5IMOA 3EOBB 1FG2B 3OF6D 5DGRA 4R7NB 4XVSH 1LP9E 2WP3T 2EDTA 4Y1AD 4NHUB 3FQTA 2NW2A 2E7LA 3PQYA 4H26A 1T5WA 1ZA3B 3OKEB 2OYPA 1FVDB 2J2ZA 5F6IB 4HUXB 1I9EA 2F5BH 4EUPA 3LQMA 4JO1L 4NN6C 3FQXA 4Y19D 4YZFE 4RX4D 2Y36H 2JJWA 1J1XL 2LU4A 1DLFL 1NC2D 1V7NL 5GQBA 5IMKB 2QSVA 3MV7B 3KLAB 1XF5A 2OCFD 2X4PA 4DAGH 4YDKH 4FHBD 1HYSD 5BS0E 4WU5B 3T0VA 5IQ7H 1AO7E 4LCIH 5JPMA 3NZHH 3OKLB 4XRCA 4BSVB 4PJGB 2CIIB 1J1PL 4NQCD 3PQYD 4K07A 1A7RL 4PGBB 1BIIB 1VFAA 2VRAA 4LARH 3GSXB 3RJDA 3GI8L 3ULSB 5B38B 4Y5YB 1KC5L 3W9DA 3W5MA 3HAEA 1DZBA 3IETA 5E5RB 3C5ZB 1FPTL 3BKJH 2FX7H 3CDFA 4JFQA 4LLQA 1MCLA 4J6RL 3NCBB 3PGFL 2Q7YB 4IIQA 4XBEH 3VXPB 3I6GA 1YN7A 2W0FA 5E2JA 2AABL 4PP1C 1IC5L 1NANH 1TTFA 5F89B 5C3TA 3WV0A 4HFUH 2BFVH 1T2QH 3L95B 4PJ7A 2QV2A 5E08H 1JI2A 1IGIH 2JJTC 3A67L 1TZGH 1SHMA 1UQSB 4CMMB 2I26N 1MHEB 5F71A 4N8VA 4JZOA 4MXVE 1SMAA 3K4ZA 4LSRL 4WRLA 3BP4A 4KKNA 4XMKH 5DMIH 1C12A 5IOPA 1MAML 4YFDB 1Y6NR 5D7LD 1FO0L 2CSPA 1DDHB 1U41A 3G5ZB 4OQ1A 4WI4A 3VGBA 1P4IH 3S6CA 5HHMD 1XGYH 1U3HC 2YD8A 1E4XL 4TOYL 4Y5VA 4APQB 3STZB 2G60H 2YUZA 4HIIB 4DGVH 4M7ZC 3I84A 2I5YH 1FZKA 4A6YA 5CAYB 3WIHL 4YBLC 3MFFB 1KJMA 1C16B 3SJVA 1NCWL 4HK0B 1FFRA 1KB5A 5T3ZD 1GIGL 1MREL 2BVOB 4JPKH 3V4PL 1BFSA 1N3NB 4KGLA 5HYQA 4L4TD 3BRGC 4P3WA 2ATPB 3U48A 3IF1B 3P73B 4GAFB 4ODHH 4YHLH 1MFBH 3PGDB 4NQEE 3MLWL 1I9RH 1AGDB 3F7YA 4Z77A 3B9KD 3GM8A 1F2QA 4EUPH 5I76B 4EN3C 3RGVC 3WS6A 1A6ZA 1M1SA 2NNAA 5F21B 5F1IB 3BJ91 1U6AH 4S1RL 2WWMD 4O2EB 4YFLI 4HF5H 2E7BA 2ID5A 3FB6A 3WNPA 2ZSWA 2AJXL 2QSTA 2CUIA 2VISB 5D2LF 2EKSB 3L1OL 3UAJC 3S7GA 3KYMA 1MCDA 3VGDA 3OAUL 3VD7A 1D5MB 3D69A 3NPSB 3EOTL 1RIUH 3JUZA 4MD4A 3VXNA 2ZPKH 3O3EA 2FEEL 4XH2A 4LKXB 3PWVB 4JY5L 1MNUL 5DMGD 4FMFA 4X83A 3U0PA 3CC5A 2YD9A 4FTVB 4IJ3B 5F9WC 1CU4H 2PTVA 3L7EB 2IH1A 4U1KB 1JFQH 3QFJB 2F54E 3RKDD 3BSZH 2R1XB 3SGKC 3HAEH 4NRZB 3S35H 1RUMH 2WINA 4EXKA 5FYJE 2P5EA 3MA7B 1P9MC 4OI9A 3F7QA 3DPBA 5D1XA 3QI9C 3TPKA 3KPOA 2P5WB 4NJ9L 2BCKA 4H88H 4QHNB 2QHRH 3OPZH 3QUYD 1JRHI 3ZDYE 4WEBL 5FCUL 2H6PA 5C07B 5T33H 1XIWC 1FH5H 3ARBC 1NUDA 4LSUH 1BFTA 5DJZA 3VRLE 4DCQA 1AQDA 5E4EC 5ID1B 4WHTB 4LOUD 3STLB 4XX1E 3PJSA 3J7HA 5FXCH 3VFNA 1LO3L 4Q2ZB 4Z7VA 1CR9H 4YDVA 5JIHA 3VXQA 3ZE1E 1VEMA 3BP5A 1NFDA 1AR1D 4OZGF 5INDB 3QCTH 5CP3A 1CFNA 3V6ZA 2P5ED 2FX8H 3LMJL 5IB1A 4Y4KC 4IDJH 4G6JL 3D39E 2BNUA 4X5XA 2FLBT 2G75B 1N2RA 1ZAGA 2A9NL 1C08B 4HZAA 1PJ9A 5K9QG 4KKLC 4MAYA 4OV5B 5JDJA 1HNFA 1T83A 4KY1H 3WLWD 5J9PA 3MGAA 3SE8L 5HHQB 4OAWB 1WK0A 4QRQA 4Y2DB 3LZFH 5DD6B 3TEUA 1IQDB 4NKOB 1C5DB 4LNRB 1CFVL 3BPLC 3HFMH 4Q9BA 4YHZH 1ADQL 1YEFL 3P0YL 5F1OB 4A6YH 1MCEA 3KPQA 2YWYA 1MFAL 2NXYB 2F5AL 3DBXB 4HG4J 1T7VA 3TT1L 1LO5B 1Q94B 1UACH 5DMYA 3MLYH 2GTWB 1KB5H 1WEJL 3ZZ1A 1BZ7B 1NDMB 1LDSA 4N0UB 1F02I 2HVKB 4BQ8A 1CFTA 3DUSB 1DTUA 3FRPG 3LKRB 4XCEA 5JIPA 4MAYD 2D3VA 2W9DH 2H2PC 2PR4L 4ZS6C 4PRPA 4U1HB 1U8NB 4DWHA 1MCPL 5KSBB 4WU7B 3P9LA 5CJBA 4WTZA 4PR5A 3MRQB 3UMTA 5L8LB 4JRYE 4F7MA 1D7FA 2X9WA 4R3SA 2V7NB 2XPGB 3MLPA 1DFBH 1FGNL 5DF0A 2A74A 3BAEL 5FB8A 1HYSC 3JWOC 4XNZC 4Y4HD 3HUJE 1U3YA 3L3KB 3SE4A 2FR4A 2H1PL 4BQ9A 4PV8B 3AREA 4FQPA 1X5KA 5DVKA 1UH3A 5C0DA 1I9IL 4ERSL 4DZBA 2YK1H 3E6FB 1AI1H 4H25A 1DBMH 1N59B 4PRPD 2FIRT 2NX5B 3BDYL 3OTTA 4HIJA 3SOBL 2FJGB 4G7VH 1YNKH 1JN6B 1G7JA 1MFDH 3GUTA 2JB6B 4OUUB 2V17H 1K9TA 2JJSA 3MV11 2MWCA 1ZWIB 1I1AB 5DK0A 3MACH 3T3ME 3MRKB 5GGQL 3ARED 2A6IB 3NACH 4K8RD 1A6UL 3VXTA 4L5FL 1GGTA 4NQTA 4E41E 1AFVH 5TPWL 3L3JA 2UZXB 5FO7B 1FLRH 3RWCA 1RIVL 4O00A 1OAQH 3QP3A 3L5IA 4XNQB 1GC1C 1J87A 4MNQD 4AYFA 4NKIL 3V6FA 3HZMA 1EPFA 2R56H 5EUOA 4HUUA 1LNUB 4P4KB 1I8KA 2MHAB 1A6VL 3T3PE 2YR3A 1A14L 2E9BA 3GNMH 3MRGA 1H15A 1OP3H 3D87B 1T22B 2GJ6B 3S5LG 4EVNA 1IGTB 4ZFFA 5C8JB 3ZE2F 3KPSB 4JO3H 4G6FD 5CP3H 4KJQD 4M7JH 4X6CE 5DJ2B 3FO1B 5HJ3A 1OM3H 3U4EA 1JTTA 3WFCL 2PW1A 2FNBA 4OGAD 3BGMA 2JCCA 4OTXH 2BNRE 2HFFB 5JW5A 1NGQH 5I8CA 2XQYK 2LAGB 5J4MA 1WC7A 3C60C 1JGDB 1UVQA 1K8IB 5KVGL 4KUZH 4GUPA 3BPNC 4TUKL 4Z7UA 2L0DA 4KPHH 5ICYB 4GKNB 4HGWB 4POUB 5CINL 5CD3B 3L5XL 2D03L 2Q7NA 4LLMA 5IBTH 2A1WH 2AV1A 1Q9KB 1QO3B 4JFYA 3QJFB 1HH9B 1KCRL 1GHFL 4NZUL 4J4PC 2WWKO 2R23A 3GJFB 3N9GL 4MHHG 3D0LA 4XGZB 1GPOL 2A73B 4RFNC 3RY5A 1N6QH 3S4SG 4GSDL 5IW1B 1T0NA 4PRBA 5JDSA 2EDBA 3V6BR 4UOJA 4UOW1 3ROOB 3B9KC 4OZHB 4MNGE 3SDDA 5EG6C 5EZJA 1DBJH 3EDDA 1EEYB 5E7FA 4GRLA 3HZVA 2VAJA 3V0WH 4AEIL 3LV3B 1R3IL 3FQWB 2WWMC 4WI7A 3EIFA 1IM3A 3VA6A 2JJVA 1TNNA 1ZT1B 1BBDL 5A2LH 1ZLWH 3BRFA 3CJJA 4TSCL 2F74A 3KPNA 1NGYA 4H5SA 3ZDXF 5DEGA 3ILQC 4ONHA 1LEKB 4HKXB 4YPGA 4UDTB 5D72L 3QQ9D 4RAUB 3TIEA 1ZVHA 3IFPA 1U8KB 3ROLB 4JFFE 4KKBC 5DMGC 5HSFA 3D9AL 2YN3A 5TH2B 3GIVA 2YD4A 3BP7B 1H3UA 4PJFB 1EAPA 4JHBA 4ZOAA 5ADPH 3D2UB 3IDIA 3AAZA 3RKDC 3U0WH 5GRVK 3UZVB 5K9JH 3PWLB 3NTCH 4R2GB 2YXMA 4XVUD 5A40E 2ATKB 1IGYB 2XTJE 1HHHB 2Z35B 3CFCH 5IF0B 3DXAD 2FJFB 3FOMB 1I8IB 1R3LB 5C7XH 4N5ED 1NAML 3GMPA 5JA8B 1AY1H 3A6BL 4M1GH 4JN2A 3LS5H 4NN6B 4O58H 1OTSD 4HK3N 2GCYA 4XP1L 5IV2A 1CF8H 5DEZA 2R2BA 1G7IB 4JDTL 5I8KL 3HUJA 1EJOL 2APXA 8FABA 1JUFB 1CLZH 3LKSA 3N50A 1KUMA 2X4RA 4PJ8A 3KXFE 1SM3L 1ZLUH 4K3HA 1MVUA 2ZOKB 1CFQB 4ZFGL 1VPOL 5DK2B 1CT8B 1KJ2L 3GMOA 1WBYB 4R26H 5FHAL 1AR1C 3B2UD 4GQ9L 1VACA 5DUBA 4B5EA 1ITBB 4G8GB 3MUGB 4R4NC 3BUTA 3DVGB 3H0TA 3TVMA 3RA7L 5FKAA 4DKDC 1MHHA 4FFWD 2AJSL 1HDMB 4YPJA 3TBTB 4DGIH 4Y7MA 3CFDA 5CMAA 4FXLA 4NZJA 4R4BA 3L5WB 2IGFH 1GGIH 4XCFH 1T04A 3FB7B 4GG8B 2AEQH 4G8EB 2UY7A 3HN3A 1QACA 3MOBH 1HZHH 4MLSA 1U3ZA 3GRWA 4PJ8D 5GZOC 3LVEA 4I77H 2N7BA 4AENB 2O93L 2ZNWA 1QFWH 3P0VL 4YUEH 3LB6D 5DHXB 2G2RA 1UH2A 4E41A 4JVUA 1OAKH 3SDXA 4W4NA 1J0ZA 3VXUD 1CDBA 1QBLL 2VE6A 4I18B 4P57B 1DVFA 1QFWM 5DDHB 1JHKL 3LN5A 1NUNB 12E8L 1FVCB 4GKSB 3U7AA 4MZ3A 1JP5A 2XWBA 3UTSE 1GAFL 1RK1A 3R1GH 3QDMD 3DX9B 3T2QA 2EZ0C 3ARDA 4C4KO 3VMPA 3QPXL 4QRPE 3WFDH 3E3QC 3SKMB 1J8KA 4E9LA 3DV6A 2X9YA 3FQRA 1Y0LB 1RZJC 3JVGC 2NY3B 5F44A 4CUCA 3RZCB 1B0GA 2VDOH 3WIFB 3C8KA 4WNQA 4Y4HC 4Z95L 3GMRB 3H3PL 1I7TA 3BDBA 5E6YA 4FXKB 4ORGB 4L9LA 3UPCA 4PJAE 4M7ZB 1IAOA 2H2SD 3K3QA 4FXGB 4C55A 4BZ2H 1Q9LA 5LBSL 4D0DB 4F7EB 1JJUA 5D7IE 4U1GB 5JORA 4KK9C 3NCJL 1KGCE 5DHYB 1E0OB 3WS3B 4KVNL 1L6XA 4LHUG 3PXJA 2HKHL 1G0DA 2HH0H 3GBLA 1FP5A 4EIZC 5EU7E 1BQLH 3FMGL 2P48B 3QUMA 1CDJA 3GJFK 1A7QH 4PJHA 5K59E 1DSFL 3LAFA 3FQNA 4HPOH 5EN2B 5I16A 3CU1A 1BOYA 2ZSVB 4AIZA 1IM9B 4P49A 5IGXL 4HH9A 2AXFB 1DQJB 5CJQL 4ELMF 1J11A 4C58B 4K8RC 1CCZA 3UO1L 3DLQR 1A9BA 4KMLB 3TN0A 1XGPB 1DQLL 1OGAE 2JB5L 3QUXD 3RGVB 1OAZH 4XNXL 2J8HA 1YY8B 5DJ6B 4ZUSB 4CU8A 4S0SD 2VR4A 4OZIB 3MJ9A 2PTTB 2A77L 2VQ1A 3MV7E 4Y16A 5ACLA 4YXHH 2ZWLT 2FGWH 4QHKI 2EEAA 2QL1A 4N0YH 4O51A 3WJJC 4PGZA 2B4CC 4KJQC 1UXWA 3GMQB 5DJDB 2BRRH 4PJGE 5KANI 4OGAC 5A2FA 5ETUA 4UNTA 3TO4A 5HVHB 4PB0H 3X13A 1U8HB 2BXZA 4WGVB 3EYSL 1RY7B 1X7QB 1EFXD 3BXNA 1FDLL 5ESQB 2NY5C 4HLZG 4D0BB 2DM3A 3MRLB 1GGYA 4JO4L 3VGHA 4U3CA 5DJCA 2EYRB 3ETBF 1RZKH 3X14A 2F53D 3GRWH 3UPRB 4XMLH 2A0LD 5GGSY 4ALAH 5HGAB 5JHDB 2DLGA 5TF1L 3CFIC 2RIKA 2VSCA 3ARBB 3KXFA 1T7XA 2ED8A 5E4EB 1R24B 5E99H 4YR6B 3SY0B 5J13C 3O3AB 1FN4B 4FFZL 1LEIB 2LV4A 4RGNB 2HLFD 1CFSB 1Y18A 5JPNB 1YY9D 4ZDHB 2N7AA 5J1SC 5I1HL 2W38A 1JHLL 1TJGH 2IPTL 1QP1A 5FA4A 3RBSA 4Y4KB 1HINL 1JK8A 4NQXA 2XWJA 1PKQB 1X5LA 4M6NL 2D0GA 4C54A 4X7FC 3C9NB 5ISZA 4K7PL 1OPGL 3KYAA 5F88A 3F12A 4LVEA 2IG2L 1FAIH 3EFFB 3QQ9C 5FDWA 4JG0L 4OCWH 1DL7L 4OCRH 3GBMH 1IAKB 1OP5H 4Q6IC 4DEPC 4DKFL 3D85D 1A7NH 4F7TB 5C86A 4XP5H 1VFOA 4X6DA 1KCUL 1F5WA 3C6SB 3OKYA 1P53A 3UTSA 4D2NA 2HJLA 5AWNH 3OX8B 3VG9B 5GGVY 2SEBB 4JKKA 3I85A 3HI5L 3QUMH 3TV3L 5IMLA 2VZVA 4XCYA 4QKXB 4N0FA 4XMPL 5AYUH 1YYML 2VZ1A 1JNNL 3LD8C 1A2YA 1OTSC 4UUJB 5GSRB 4YGVA 2YOCA 5I2IA 4X7SL 1P1ZB 2J88H 4FQLL 5DRXA 2OSLA 1KV3A 4RGMC 4LCUB 5DLML 1AHWC 4JQIH 3VXRA 2A38A 3EO9L 4PY7B 1FBIH 4JCMA 1R5IA 1A8JH 4JE4B 1RZ8A 5D7IA 3B2UC 4ZAKC 5EIIA 3MJ9H 3OKDB 5KZCD 1RJCA 2AJZB 1TTUA 1FNGB 3V95A 3QT2A 2I60L 3WD5H 4Q0XH 1QKZL 4MSWA 5BO1L 3KPMA 2VXSH 3EO0B 4HHAB 3QFDA 4TYUA 3I6KA 4R96A 2IC2A 4F7PB 1YQVH 3MRPB 5I66B 1NCBL 5F1KC 3X3GL 3GSWA 2VXUH 1ZK9A 1KCLA 3NN8B 4P2RD 1JWUA 3O0RH 5GPRA 4CU7A 1A64A 2WANA 5E9DA 3VMOA 3AS3A 5I74B 4H20H 3TBVA 5BQ7B 1I3GL 1HILB 1T7YA 3QFJE 3BW9B 1S9VB 4EI5A 4X4XA 2CDGB 3O3UN 1MIEH 1Q9OA 4YBQD 4RZCB 1HSAA 1OGAA 4WEUD 1I1YA 4PY8I 1KF9B 1K8DB 4IRJD 3CFJA 3C6LD 4EOWH 4LPCA 1JWMA 3RY6C 1KNOB 5T5FH 1IAIL 1UXSB 2FCBA 2LVCA 4O4YH 1K2DA 5C07E 5GISH 3EKCA 1C8PA 4I0PA 4YO0B 1QSZA 3BH8A 4TN9A 4Y5XA 3VGGA 3U9PH 1I85C 4YE4H 3M17B 1A7PH 3LKQA 4IHOB 3NCMA 4OLYL 2VL5B 4Z7WA 5E9DD 3QEHB 4S2SB 1BQHA 1ES0A 2ENSA 3RWJA 1RUKH 1MI5E 3OBAA 1M6OB 4X9HA 4UILL 5FGBC 2CXKA 2XACC 3QQ3A 1BVLB 4P23A 4NZRL 5SX4H 2H2SC 4GFTB 4ZD3L 3GB7B 4I3SL 1CWVA 1QEWA 3C60B 4RRPA 1Z0MA 2WIIB 3WXWL 5BV7C 5ADOL 4PRHA 5I1GH 3CPLA 2I9LB 4W4OA 4GW5B 1MH5A 4I48B 4QTHA 2RGSA 1G0YR 4OCNC 2DKSA 4MCZB 1KXVC 3EHBD 3HG1A 3GSVA 4AEHL 3RDTA 3BKCH 1TZIA 5DD5H 4XHQA 1PZ5A 1S7VA 4RFNB 4L8CB 3UTTD 4NM8L 2V2XB 3MR9B 4QRRB 2VSDA 4QO1A 2R39A 1A1OB 5TE6L 3RHWK 4MJIB 3UBXA 4JGUA 4F58L 5I1IL 3IFOA 1YN6A 3BP6B 2GUOB 2X7LB 3R4DA 1ZHNB 4W6XB 1JWSA 5A2JH 2VXVL 4N9OB 4CKVX 1J5OL 4NKMA 4ZXBB 4R6UA 2O5YH 4LASH 4Z0XA 2AGJH 2WQRA 2EDOA 3MSPA 3X17A 3O4OC 1HHJA 3MLRL 5E1HB 4F57H 3SDAB 4PRAB 1N0XL 5AD0A 3MLTA 5IB5A 1D3CA 4JO1H 2WBWB 3RDTD 5HGBA 2YBRB 5IEHA 1H3VA 1NMCB 1J1XH 1LK2A 1DLFH 1MIML 3QDJE 1V7NH 4Z5RA 5DMKB 2BNQE 1FORH 2IH3A 1YZZA 3CUPB 3LEYL 5IB4A 3SO3C 4MJ5B 5F9OL 1T3FB 2E9JA 4OCMC 4OLVL 1WIUA 4MD0A 4XC3H 1HHKA 4AL8L 1TETL 2B1HH 5I6XC 1J1PH 2IALA 3O9WB 4TSAL 5HI3C 2Y4SA 4S11A 5IT2L 2R2EB 5DEFA 3RWGA 4NSKB 4BELD 5J3HD 5C08B 3OAYH 4LLWB 4LKCB 4PBXA 1FPTH 5D7KE 5IROA 4J6RH 2HLFC 5EOTB 3LPGA 4X8JA 4BH8A 3HNSL 1INEH 3B2VL 5TE7L 1H0DA 3H9HA 5ID0B 2AABH 3MNVA 4CVXB 1HI6B 1NBZB 3QPQD 4KROC 1FIEA 4NQDB 5CJXC 4UTBL 2PYED 4GXUN 4I1NB 4PLNC 2OR9L 1NH6A 1PFCA 4JFDA 3A67H 1NBVL 2R4SL 4XZUA 3G6AB 2EDYA 1IC7L 3KPSE 2DL2A 2L7UA 1WFOA 5H35B 2GSIA 2J8UF 5CJOH 4LSRH 5DQ9A 2EDDA 4KJWD 2GQHA 1MAMH 2XRAH 5DHVA 5EO0A 3WXVL 4D9QE 1QLEL 3V79C 1DUZB 3ECBA 5C09D 4POZD 2JF1A 5I8OH 2NXZB 5ECJE 1JGEB 2DDQL 4P59L 4QXGL 3QNYA 3OJMB 4JANB 4Z78B 4HUVB 1FYHB 1UZ6E 3CX2A 1E4XH 4TOYH 4DN4L 2IPUG 1U58A 3NCYS 4F37K 1W0VA 4YHNA 4JFDD 4JPWH 1JPST 5HY9B 4WW2F 1U8IB 5CEYB 5C71A 1Z9SA 1FNSL 4U6YB 2QADC 1DQQA 1ZTXL 4XCCH 4B53A 1NCWH 1WTLA 1FLTX 1MI5A 1BAFL 4DUVA 2VUYA 1GIGH 2H9GA 1MREH 1AKJA 3OKNA 5T1LD 2IAMD 3V4PH 4OZHE 5CSGA 4RBPH 4ISVA 4U05A 1O0VA 1X6NA 5IEKB 1OAUL 1EDQA 4MA3A 1G6RL 3EW3B 1T5XA 2A9ML 4OZFG 3DVIA 3MLWH 5FF6A 1QA9B 1I8LA 1MFEH 5FHBL 4M6MH 2WSKA 1G7HA 3QXAB 2F8XC 1HH6B 3W0WB 4Y4FB 2ZKHL 2E7MA 4S1RH 4MX7B 4DW2H 1MCWW 1T0PB 4G9FE 5L6YH 1CL7L 4W81A 3ZT5A 3D18A 5F3BB 1AGFB 3BO8A 1AKJD 4TNWF 3P4LA 3K0WA 4PJFE 3EOTH 5J1AB 2BVPA 2FSEB 4HDIA 5HYSB 2X4TA 4M7LL 5HYFA 5EBMA 4QXWA 2BOBB 4YBQC 1CGXA 4JY5H 3BEWB 1MNUH 2WNGA 3W9EB 4IRJC 1NFIA 4OUOA 2R0WH 4X0KA 1EHNA 4UIMA 3V6OE 2FZ3A 4H8WC 1YMHB 1V3KA 3DRQB 5L2KB 5D6CB 1B4JH 4JZJA 1UCBL 3V5HA 2OXGA 2HA1A 4GBXD 3H9SA 4L3EA 4ZG1A 3BEVA 2P8LB 4NNXB 4K94L 1A47A 4NJ9H 3UDWA 4QCIA 4JGMA 4B41A 3GMNA 5T5NF 3MJ7A 3QDJA 3RUGB 4PRIB 4GAJH 2EIBA 2BNQA 2XKUA 4NZDA 5IESL 1YMMB 5F9JA 3T1FB 3DV4A 1Y6KR 5FOBA 3DTXB 2YPLA 3KPPA 1LP9F 4YLQT 1CK0L 3VW3H 4G8GE 2EDWA 3DGCR 4FP8L 1LO3H 1RHHA 1OTUD 3QQ4A 3LIZH 2A6DA 4PB9L 5CBAB 1INDL 4Y8AA 4PJXA 1NDGA 1IKNA 1Z5LA 5EBLB 4PGEA 4L3ED 1N7ML 4YZFF 2D7MA 3PL6C 4QHUA 4UZGA 1AGCB 2X70A 4YHOL 3PXHA 3RFZC 2A9NH 3WEXA 1TNMA 2VDRH 5DHVH 3PHQA 3QXVA 4X6FB 4MB4A 3EHBC 3H7LA 2C1OB 5A16A 1I1FA 4P2OC 4PTUB 4LQFH 1A3RL 4RISL 4AM0A 4Q9QL 1OVZA 3BQUA 2XA3A 2YUXA 2YPLD 4DFIA 2GT9A 1PQZA 4IRSB 3SGEH 1ADQH 1MPAL 3C5SA 4UOW0 1MFAH 2F5AH 1BD2E 2I9TB 3TT1H 3CCHA 5ACZB 1HOCB 4ESKA 3QYCA 2R1YB 1WEJH 4ONGH 4AG4H 1X5FA 3DECA 3DIFA 4HJJL 3SO5A 1GH7A 4WO4C 1X5JA 2YA0A 1G9ML 5F9AC 4UTAL 4HD9A 2C7UA 4R7DB 1U8MA 2BRQA 2PR4H 1NKRA 4XVTH 2RAMA 3GMLA 3RWHA 2XKNA 2HVJB 3E0GA 1FL3B 2DMCA 5T1KB 3DARA 3EYFB 3IS0X 3PG2A 3LHPL 2V2TB 1W2KT 1F8TL 3AY4C 4JKWA 4N5UA 4YHPB 1UG9A 4N9GB 3DI3B 1PEWA 4BK5A 5AYQA 3I3EA 1DLHA 3VWJB 3MLZL 1FC1A 2Q6WB 4J1UA 2H1PH 2FHCA 5KVFH 3CZFB 5KS9A 3KDMA 5CEZH 4NO0B 4OFDA 3HCVA 4MXVF 5EOCJ 4G3YH 1ZS8B 1CXKA 4WHYG 3G5XB 1KPRB 2I24N 4QXUL 2VAAB 1EGJL 1OGTA 4F33B 5IBUG 1YEGL 4P9MH 3SOBH 3BDYH 5F97E 4XBGA 1H3XA 1NAKL 4LCWD 4P3CL 1D5ZB 4RGMB 5DT1L 1EAJA 2QLVB 4OKDA 4JAMA 4L1DA 2I07B 2XWTB 3R06B 4RCAA 1IC1A 2CR3A 1NAMA 2WWKT 2DQGH 1YPZB 1ZANH 3MV8E 5D5MA 5MERB 2JIXB 1EBAA 4ZAKB 2PCPB 1RZIA 4YIQB 5D1QA 3IDMB 3QPQC 5BJTA 2X44D 5C0CE 4NO3A 3DROA 5GGQH 1KB9J 3GDBA 1I75A 4GAYA 1A6UH 3BGFB 4IM8A 3CVIL 5TDPA 4L5FH 2DQJL 3P4OB 3PHOB 2PNDA 5TPWH 4P2CG 1RZGB 1RIVH 2Z0BA 3QWQB 2IANA 4AIOA 3C5JB 1XH3B 2DI7A 1KJ2A 4HMDA 1G7PB 2VZUA 5TDNA 4G6KL 3DSFL 5KVMC 2EIZA 4QXTB 3LKOA 3ZL4L 4PG2A 3SE3A 1D6VL 4FZ8L 1PAMA 5SX5K 1ZHBA 4LIQE 1WCBA 1A6VH 3WHXA 5A2IH 3GEWB 1W0YT 2FL5A 2VZTA 3MO1A 1A14H 3MJ8A 3FRPA 4KJWC 5F6HI 1XR8A 3IKCB 4LPTA 3V6OA 2C3VA 3MV9E 1JTPA 4PGCA 1H3PH 1RULL 4KH2A 5J1TC 3QWRA 4POZC 5J8OA 5D1QD 3WFCH 1HQ4A 1CDHA 4X80L 5DZOA 4K7FA 2HP4A 4PJ5B 2UYLA 1FYTA 3GJEB 2IAND 5HHNA 4Q58C 2VLKE 3TPUB 3JWDL 3QCUL 3TYGL 5DQDH 5KVGH 4JQXC 3CH1B 4TUKH 3RVXC 4RGNE 4MDJB 5ABDE 1PY9A 3L5XH 3SCMA 2KPNA 4AT6B 5L9DL 2IAMC 5DO2D 3O6KL 4LLUA 1KCRH 5IW3A 4JFEA 2V5SA 4NZUH 3N9GH 3SQOL 5GSVA 3BH9B 4JY4A 1ZVSB 2MPAL 1SEQL 1ZLVH 5GS0L 4XPAL 5DUPL 2P47B 3REVA 1INQB 1EHLH 1BP3B 1PKQE 3LN9A 4L8SA 3CDCA 1FYTD 3NABL 1UM4L 4NM4H 1MAKA 4WJ5B 3WFBL 3F5WA 4QWWD 3VRLF 4QHMB 5INCB 4MA1B 3RPIA 4ODTH 4O2FA 2CKBL 4KWUA 5F1SA 5GRVL 1B4RA 5MENB 3SCMD 4TSCH 3NCCB 3CFBA 4AZ8A 2VLLB 2DLFL 1NKOA 3EYOB 4NT6B 5D72H 2IQAB 2MQ3A 5CHNB 4AY0A 1PGRB 5FGCB 3SDYL 5I18L 3D9AH 1WBZA 2W1NA 5B8CA 1F6FB 4H1LG 3PNWB 5J6GB 4RAVB 2HRPH 2WQ8A 4UQ3A 1TQCC 5L8KB 1NCTA 1UWEL 4MQXD 4ZUTA 3S5LA 2E6PA 1S7QB 4S1QL 5D9SB 3ZT6A 4M8VA 4YC2C 4UDUA 2NW3B 1H8NA 4IOFC 2E6QA 3MRRB 1TVHA 5JLZA 3O4OB 3OKMA 5ICXB 1BLNA 4Z9KB 4LGRB 4HUWB 1EO8H 4HMEA 1NAMH 3A6BH 3PWPE 4C4KT 2ZJSL 3B9EA 2YUVA 3TO2B 5I8KH 4JDTH 2MNUA 5DJ0B 4HIXL 2XXMB 3WL9B 1LO2L 4WHCA 5DI8B 5C9JB 2AK4E 1I4FB 4NQED 3TNMA 4BM7A 1OAYL 1V3JA 4ZFGH 2MJWA 1KJ2H 3RVWC 5EUKB 4PJEA 5FHAH 4QOKB 3I75B 2HRLA 4JPVH 4GQ9H 1CIDA 5I6XB 3S4SA 2G9HB 1IL1A 1K5NA 3KHOA 1CG9A 3P40A 4XPBL 3W39B 2W9EL 4N8CH 1A1MA 3RA7H 4WW2C 1P84J 2AJSH 4E5XB 5ERWB 5T1DL 1KULA 2OI9C 1N6VA 1MAJA 3CXDL 1RFDL 1NGZB 1FZMB 5E2VL 4F15C 3MV8A 1JPFA 5LGJB 5DJYA 3B9AA 3NIFF 5DFVD 3RWDB 1YECL 4MA8L 4U31A 5C0AB 1I3VA 1EVTC 1FRGL 2CMRH 2F54D 4WTXA 4KROB 5IP4A 3MBEA 1FFPA 4MJ6A 1C5CH 4PRNB 1X9QA 3VFRA 3C09B 5KTEL 4MCYA 5HHOB 3D1MC 4WCYL 1QBLH 4KZEH 3O4LB 2WLZA 1JHKH 5JZ7D 1T21A 12E8H 1S8DB 4CVWA 1KTDB 1IILE 2C5DC 5MI0C 3VFGH 3WO4C 1EHXA 4G80A 4I3RH 3IRPX 3QPXH 3I02A 5AZEL 2DM4A 3D48R 3UTQB 4OD2A 5LGHH 3IDGB 3T3MF 1F13A 1SYVA 2A6JA 1KFAH 1U8OA 5BVJA 2ICEB 3BPOC 1J1OL 1JPSH 4CBPA 1LQSR 1YJDL 2NLJB 5HD8D 4K3JL 4Z95H 3H3PH 3EGSA 4OLZH 2VJXA 1YEIL 1OCWL 3T0BA 4QY8A 3LEVL 2VLKA 2V9QA 3UXFA 4HXAL 2E8YA 4R8WH 1CBVH 2E5EA 3D39D 4LMQE 5J12B 2W65A 3QRFM 1IGMH 2X4UB 5CBEA 3ESVF 2QADB 4KVNH 4WY7H 4OQTL 5HYJA 4HS6A 2YA2A 1DP0A 1S7UB 4LHQB 3AS0A 4NQVB 3VFVA 1KTKE 5L2JB 2HKHH 2AAVA 1I8MA 4X7DC 4X6CF 5E6IA 3FMGH 1OTTC 5I19L 4RIRB 1J8HE 5DC4B 3RBGA 3HI6L 4EEEA 5T1MB 3T0XA 3QIWA 2P4AB 4WENB 3JV6B 3VCLA 5C0JA 1Q72H 2ADGA 1ED3A 3PDOB 1QFWI 2DM7A 5H94B 4HUKB 1VEPA 4P2QB 2GW5A 1N5YL 1MCRA 3UO1H 4DVBB 5HHVL 2EC9U 1U8QA 4LLDB 3FCTA 3VA2C 3DURA 4XNXH 3WUWG 5HYJD 1BOGA 3MCKB 3MRFB 4GOSA 1RJZB 5D1XC 3LEXB 2Q86B 1Z2KA 2ZUUA 3RL2A 1LEGA 5GIRB 2OQJB 1HSBB 4XVJH 4NUJA 2E3VA 2BMKB 4AEFA 5F7WC 1NGWA 2EDEA 3F7PC 3ES6A 3VRIA 1XZ0A 2D0HA 4U1NA 5FAAA 4PLJD 5M7QA 4EI6B 2J5LC 4HFWA 2DWEA 2FJHB 3LN4B 4JM2F 3EZ8A 4MQTB 3MROB 1LGVA 5FUZL 1AH1A 4QEGA 4U4BA 1EZVY 1BREA 4POYA 4NNYA 3EYSH 3KPRB 2DQIL 3QNXA 3NFPB 5FECB 4WFHD 2CLVB 4JO4H 2CLZA 4YHIA 4NO2A 3PWPA 1NCCH 5KW9L 3DMMD 3VFOB 1DE4B 4FS0A 5IG7A 3JV0A 4HWNA 3DX6A 3CK0L 5DO2C 3P11H 3OSKA 1S7SB 5I1DB 2DAVA 3RL1A 3LRSA 1X5GA 3PHSA 4XPGL 4LHUA 5E8OB 1TPXB 4FFZH 4PV9B 1JZ8A 4AMKL 4M48H 3QEQA 3BIKA 4ZMAT 5TDOA 5CCKH 1BFOA 1MCKA 4LIQH 4HJ0D 3I9GL 2VN4A 1JHLH 4NJAH 4OJFL 3V9FA 4ODSL 2YN5A 5D7JA 1JYNA 3W5NA 3PL6B 1BECA 2VLJA 3NFNA 4ZPVA 1HINH 3TCXA 5DA0B 1XGRB 2AJYL 2ZOLB 1OWRM 3QNZA 2VLRB 4WUUA 4L8DB 2ZUQC 4M6NH 2H8PB 1D5XB 4HJGB 4YEFA 3U6RB 4P2OB 4K7PH 5D8JL 4OFYD 1OPGH 4O9HH 5IHZB 3HC0B 3PIQA 3T1WA 4RMSA 1RUPL 3RU8L 5BMFH 4JG0H 3O2DL 4XCNB 1T20B 5LCVL 5IFJB 5LXGL 2GJZB 2CO7B 3OGCB 2VH5H 2BNRD 4DKFH 4XNYH 4D8PB 1PYWA 4UU9B 5IHBA 4I4WB 4U1JB 4MVBD 4UV7H 3B43A 3HI5H 3TV3H 4WO4B 5FM5O 2HLAA 4ZSOA 3DUUA 3EO1A 2M8XA 1YYMH 3LQAL 4DVRL 1XCTA 5E24E 1TMCB 2ESVB 3T4YB 5A3IC 4MJ2A 1VGEH 4ZUVA 2V9RA 3UP1A 4HKZB 3HAEG 3BZDA 1KSRA 3FHQA 3OHXA 4FQXC 5C6PB 5JXEC 2YS4A 4M3KB 4PJ9D 4X7SH 4FQLH 4CU6A 1P4LA 4TVPL 1H9VA 2Y5TB 5I1LB 3TZVD 1MWAB 4GXVL 4KTEL 3EO9H 4OD3H 4U6XA 3U46B 5H2BA 3BD4A 3RWEA 1NJ9B 3VFUB 5DJ8B 2BY1A 4CADB 2EC9T 4TSBH 2XKSA 4JM2D 4CAGA 4G8FB 5IMMB 4PPTA 2GAZA 1QKZH 4M8QB 4U1SA 3OMZA 5GHWL 3TNNB 3BUYA 4P5TA 1J8HA 1FG9C 4DKEL 1UKQA 1U3JA 1R0AH 1QR4A 3BZEA 4ZFZA 1AC0A 1QVOA 4WDIB 2XNAA 4PJAF 5L2KE 1NMBH 1I3GH 4PG9A 4PJIF 4DOHB 1P7KA 2PW2A 5D7IF 1ZGLA 4UAOC 2ADIB 2XFXA 1MEXL 3WN5B 4MDIA 3WKNA 1N8ZB 1E4JA 4KKCD 3LPWA 5F3HA 4R0LC 1ZA6A 4XB8A 5EPMB 3B9VA 1LHZA 2NR6C 1C7SA 3QH3B 4HLJA 4DZ8A 3JTSA 3RUGE 4TUJB 2VO5A 2H45A 4FQIL 3CDGA 4K23L 2HT4D 5K59F 1ZSDB 4ZOBA 5LQBL 5IWLA 1Y6MR 2HN7B 1FFOB 2V5RA 4R90L 3WYRA 3B8YA 4XBPA 1HCVA 5TQ2L 1PG7X 4HX1A 5SWQB 3THML 2NMSA 3SDCD 1VKXB 1D9KA 3DX7B 5HD8C 1QSFE 5DVMA 4RNRA 1A7OH 5E8PB 1QYGH 5B39G 4OZ4B 2B5IB 2VDPL 2X41A 1Q0XL 2NPLX 4U1IB 2P8MB 2XN9A 3O8XA 3K46A 3BE1L 3AS2A 1CQYA 4NZRH 4BFBD 3U0TB 4ZD3H 3QHTC 4FQCL 1XGTA 3WXWH 1IEBB 3H7BA 3PWJB 1AD0B 1N5AB 5CJ8A 5CSZA 2ZUWA 1YNLL 2WP3O 4KDVA 4PJGF 5T3XE 4HS3A 2NCMA 2NTFB 3PGCB 1VFBB 4Y19B 1G1YA 1KIRA 1QLRB 1TFHA 4MD5B 1A6WL 4AEHH 2PXYD 2DQDL 4K3EL 2KKQA 3S34H 4NM8H 5IMOB 2XN9D 1CDIA 1DBKH 4HWBL 4LCCC 5KSAD 2BP3A 4JZNB 3F58L 3T2NL 1MJ8H 2VXVH 4I5BA 5DJXA 1J5OH 2R8SL 2UZIL 4ZUUB 1F2XK 2BSRA 4HLZH 2MCPL 3FQTB 3BMWA 2NW2B 3B4NA 4IMKC 3G08A 4H26B 1T5WB 5KN5A 1XMWA 1FFNA 2VDMH 1G6RA 2IMNA 4YXKH 3VFTA 4EUPB 1N0XH 4ZPTB 1F3DJ 1FG2A 1YEEL 4QF1A 3HMXA 1XGQA 3FQUA 2PN5A 3TA3C 4PLJC 4URTB 1QSEA 1XF5B 3I50H 4GRWH 1MIMH 2HMID 6FABL 1HWGB 1LDPH 1JPGB 5SWSD 2CGRL 2CO6B 3LEYH 5D2NE 3OKEA 5F9OH 3RVUC 4XRCB 5SX4I 3BVNB 4HUXA 4OT1H 4DTGH 1KGCD 4AL8H 4PP2A 1TETH 3TYFA 3V8CA 5JMRA 3IU3A 4NGHH 5MEPA 2DTML 4C83A 3TVMC 4F9PA 1X5XA 3NVQA 5IMKA 3W9DB 5IHUL 3VXMB 4RMWA 3KLHD 4EKXA 3HE6A 3IETB 4E0RB 1YPZE 1T4KA 4WV1A 3ME0A 4JFQB 4LLQB 3QAZB 5DUMH 3OR7A 3AROA 4YHML 4IIQB 2V7HA 1G9NH 3IFNL 3I6GB 2W0FB 3E2HC 5F72S 4BSVA 2IF7A 3B2VH 1ZGLM 4PGBA 1S7XB 1BIIA 3NGBC 4HJ0C 4UT9H 1GZPA 1B3JA 5HHMB 1SJHA 2I25N 4PJ7B 4RFEA 5GGRY 4UTBH 1QRNB 1ODAA 2P24B 3NFSL 5HDOA 4JDZA 3I6LD 2OR9H 3DYPA 3EYQD 2IFGA 4G6ML 2Q7YA 2NZ9C 2R4SH 3U2SA 4N8VB 1IC7H 4Z7QE 1CDGA 1GC1L 4JZOB 4F15B 2OP4H 3NCFB 3IJYA 4ELKA 2YD2A 1C12B 1HHIA 2Y5EA 1ACZA 2NY4D 4JQVC 2VB5A 3RX7A 3CFEA 4CW1A 1TVBA 3WXVH 1CXFA 4PJ5E 1S9WB 3DUHA 1VGKA 3GKZA 5EOCH 5SWZB 4XPFH 4CMMA 4O5LH 1MHEA 5C6WH 3RP1A 3T0EE 2XG5A 4A6YB 3C5ZD 4LVHB 1KJMB 4U3HA 3SJVB 3GSRA 2D7OA 3WO4B 3O6FA 4ZO7A 1FNSH 3FT3A 5IBLD 1FNFA 1ZTXH 1KB5B 2J7LA 2WUCL 2BJML 1DDHA 1QSFA 4UBDD 4JM4L 4BSWA 1BAFH 1MCFA 2XIDA 4U33A 5KVDL 4PJ9C 3GSUA 4UMGA 1KELL 3BPOB 5HYQB 3BMVA 3MRIB 2EICA 4LF3A 3TZVC 4HIIA 1MUJA 4XXCA 1OAUH 3F7YB 4Z77B 3QBTB 4JM2C 3ZKMC 1JRHL 4M93B 1G6RH 1SJXA 1JNHB 5MENE 1YEKL 2NNAB 4OKVA 5FHBH 5CGMA 3HMXH 3BD3A 2NY6D 3AMLA 3QXDA 5ITFA 2ZKHH 4FQ1H 1OLZA 1S9KC 4Z76B 1CL7H 4PBWD 2CKNA 3B5HA 3KYMB 5CILL 4NFCA 4KVCL 3P73A 3D69B 4NBYB 1MY5A 2VTFA 5FYKU 3ULVH 4MD4B 1KCKA 3VXNB 3O3EB 4XH2B 3PGDA 2N4IA 3SPVA 1SJEA 1SJVA 5EA0L 2EE6A 1G7QB 1NEZG 3KS0J 2XZAH 3U7YL 1EGJA 5I76A 3VJ6A 3U0PB 1ITCA 2O5ZL 3CC5B 3F8UB 4FQ2L 5F7UA 4KUCF 4RA3A 3GSOB 4R97B 4KKCC 1NLBL 3OB0H 3QXUA 5E2WH 4TTDD 4JB9L 2XTJC 1G0XA 3BI9X 5D1ZA 2PTUA 1UCBH 3T8XB 1E4XI 2WINB 3N1QC 1FL6A 3S98A 1L9MA 1AP2B 5D1XB 1NCDL 2H41A 3WBDA 3KPOB 3PABA 4X7CC 2BCKB 5D93B 5L0QC 3QG6A 3BKYH 3VXSA 4P46A 2YD6A 2H6PB 1CICA 3ARGC 5ILTH 1UJ3C 3SDCC 1JGUL 3OJVC 3UBXI 5DJZB 2C3WA 4DCQB 1AQDB 3LSOA 1I9JL 1UENA 3KWWA 5D2NA 2J5LB 3VFNB 2PO6A 3T08A 4JFXA 2OK0H 1CK0H 1PKOA 4P5MB 3WNKA 3HNVL 3OQ3B 2C9AA 4L3CA 4C56A 3VXQB 1HEZB 4OD1L 5KSBF 2C26A 2EECA 5D1ZD 4GG6E 3BP5B 3OL2A 4F9LC 1INDH 4NN7B 3V6ZB 3EOAA 1F42A 2XTLA 3K1DA 5LAXA 5GGTL 1N7MH 2BNUB 4X5XB 1HXYA 1WT5A 3RTQC 1Z3GH 1A6AA 4OIIL 3VXSD 1WAAE 3T0WA 1TITA 2EEDA 2X9XA 4OZFA 1IKFL 3SBWA 5ID1A 1A9EA 1CICD 4MB5A 3FFCA 4WI5A 3STLA 5J9PB 4H0IA 4FTVD 4Q2ZA 4TUOA 2PXYC 2VABA 3GSNL 1B0RA 5C0AE 4RDQF 2ERJC 1OAXH 4Q9QH 2OTWB 5DTFA 3VMNA 2FIKA 2W60A 3M8OH 3DO3A 2YMXL 2DQHH 3KPQB 3PE9A 1MPAH 4C56D 1LD9B 3DI2B 5KSAC 3O4LE 3ORJA 5I17A 3N1FC 2P5WD 4JRXE 4TQEL 5C07D 1CFTB 2W59A 2BY2A 1F90L 1L0QA 4Y2DA 3HR5A 4XCEB 1XF2A 3VGEA 5C0RH 3QA3A 3MRBA 4PRPB 2P49B 1F4XH 3P9LB 5DC9B 4R4FL 4KI5E 3AGVA 3QIUC 4PR5B 3FO0H 1OB1A 4Z0BH 2GY5A 2DF3A 4F7MB 2OL3B 5CKAA 5ITBL 4R3SB 4M1DL 2HMIC 3RKPA 1QQDA 1BFVL 3WKML 5FB8B 3VH8G 1BZ7A 2CKBA 4N0UA 3AM8C 3TESA 3MZGB 1P5UA 4LLVA 3T0EA 4X7TB 2FR4B 4QT5A 5I15L 3BHBA 4ZS7L 5FIEA 1MCBA 1EH9A 5C0DB 4Y2DD 3U36B 4YHKL 5GS0D 2VDQL 4H25B 5A2KH 5EU7C 5GS2D 1KLFA 3KLHC 4HIJB 1EGJH 1AQKH 1ERNA 4NWUL 1QHPA 1SBBA 2NXYD 1YEGH 4S10A 5IVXA 4KZDH 1G7JB 4FQXB 1V3LA 2D7QA 3Q1SH 3RIFF 3GUTB 1NAKH 4V2BA 1ZLSH 2UVEA 5DT1H 1XAUA 2APBA 1R3KB 2AQ2A 5DK0B 5F6IC 1B6DA 3UYRH 1DEDA 3GI9L 2UV3A 5FK9A 5C6TH 2NX5A 3L3JB 4RMQA 3RWCB 3RQ3A 2OM5A 3EYQC 2ZUTA 1K6QL 1JF1A 2X42A 3S96A 1T89C 2GITA 3HZMB 4OCSH 4OZHF 4L8BA 5EUOB 4G6KH 4HUUB 4CVZA 1I8KB 3ZL4H 1FL5A 1A0QL 4FZ8H 3MXWL 5J6HA 1H15B 1OY3B 3MYJA 2IBBA 3ARSA 4K94C 4ZFFB 1G7LA 3QDGE 5DZNA 4KQ3L 1ND0A 4WI9A 1SEBB 5HBBA 3KPRE 1WZKA 5HJ3B 1XF3A 3U4EB 1RULH 4LSSL 3SKNA 3MXVL 2CDFA 2PW1B 2VL4A 1UYWH 2J4WL 3VI3E 3W2DL 2CUMA 4KK6C 5M95B 3BGMB 4HEME 1QLFB 1BF2A 2DQUL 4R0LB 4OZFH 2NX5D 1KENL 5JW5B 3V7MA 3C5ZC 1NFKA 3JV4A 5I8CB 1WC7B 2R9HD 5J56B 3BN3B 2X1QA 1UVQB 4QYOB 4IOIA 4X9FA 3CMOH 4GUPB 3JWDH 1WFUA 4PJFF 4Z7UB 4PJDE 5GZNC 2YC1A 4UBDC 5ALBL 5HYIA 1I1AD 1RIHL 4LLMB 5D7KD 1AD9A 2AV1B 5FM8A 3MOQA 4PREA 3Q48A 4OM0L 3O6KH 2YD3A 1PBYA 3QHZH 3D0LB 3ZTNL 5HTSA 5JW4Q 3SHSA 1XF1A 1T0NB 4PRBB 1G84A 4V1DE 5JDSB 3SQOH 4KAQL 4X4ME 5EZLB 4PJBA 1JGDA 2MPAH 1OD9A 1QD0A 1SEQH 5GS0H 3T77B 1N4XL 4PJCA 3SDDB 4IS6A 1NCAL 5EZJB 5GS2H 5T3XL 4GRLB 3HZVB 1UM4H 1I7RB 4Q9RH 1Q9KA 1IM3B 2GJ6D 1HIMH 4XAKE 2XT1B 3WFBH 3QJFA 3KPSD 1RQ5A 3GJFA 4JVWA 4K55A 4NRYB 1NGYB 5JNYA 2CKBH 4H5SB 5DEGB 1BZQK 4LPWA 1UZ8B 2ZCKL 3DJ9A 4ONHB 1JYVA 4YPGB 2MFNA 4APQC 3ULUE 1G9MC 3VRJA 5FYKE 4RSVA 4ODWA 2DLFH 3ALPA 4UIKL 1NC4A 3TIEB 3IFPB 5BW7A 2CQVA 1F4AA 3D0VB 1S9YA 1AGEA 1F4HA 4OQTA 1EEYA 3SDYH 3VWKC 4M00A 1MFCL 3GIVB 5I18H 5D7SL 4JRXA 2GFBB 3FKUS 3SGJA 3O3DB 4F3FA 1EAPB 3FQWA 3TH2T 1P69B 2YD7A 1U42A 4OM1H 1UKSA 3IDIB 2DYPA 5JW3H 1UWEH 1ZT1A 4ODUA 5JA9A 3ARYA 2ZUYA 3FONA 3I2CL 4XP9H 3IB4A 1LE5B 3T0AA 4MS8D 2LTQC 3GMPB 5B21A 1U8KA 4JRYB 4JN2B 4MMXC 5E7BA 2EE3A 2GCYB 5IV2B 5CWSA 3ARXA 3TA3B 3HUJB 8FABB 3RVTD 1MCQA 3LKSB 2X4RB 4HIXH 4PJ8B 3VD4A 1LO2H 5DS8A 4HAFA 2HWZL 2LABA 1MVUB 1OARH 3MRNA 3QJHB 3GMOB 1IGYA 5IF0A 1OAYH 1I8IA 5CFHA 3RWIA 5DUBB 3ELAT 3MC0A 4IRZL 3NPSC 3NAAL 5HGHA 1ZGLP 5HXMA 2Y7QA 3H0TB 4NCC1 5D71L 3TVMB 1NSNL 5FKAB 1BX2B 4XPBH 1MHHB 3ZKSD 5EIVA 4OFPA 4MA7L 1A3LL 3MJ6A 5CMAB 3CFDB 3KR3L 2QTEA 4XWGH 5T1DH 4IJ3C 2YSSA 1T04B 4NC1E 3CXDH 1RFDH 3D2UD 4KDTC 5DK2A 1CT8A 5E2VH 4G7YH 1QFHA 2I27N 4NOBA 5DD3L 4JKMA 3V7AE 2G2RB 4E41B 3SDXB 2WM0A 3NGBB 4MA8H 4MMZC 2IBGA 3CH8A 1FRGH 4PYGA 1HDMA 2VE6B 1DVFB 5IM7A 3LN5B 3L5WA 4H1LA 2P42B 3EUUA 3B9DA 2K7PA 4UT6L 2XWBB 1IQWL 3A6CL 3IVKA 5EZOL 4G8EA 5GRZA 3QB7C 3IRZA 3GO1L 4P48A 2F19H 4WHYH 3WIIL 3X11A 3ARDB 4AENA 3QDGA 5E8NA 4YQXL 5K9QI 2VMFA 2UWEE 3DV6B 1FSKB 1B0GB 3C8KB 4G8GD 1MFNA 2FBJL 4U7MA 1L7IL 2E27L 4WNQB 4EXPX 1I7TB 2GTZB 5HGGS 1FVCA 1EXUA 4WWKC 2JJTA 1EERB 1H5BC 1NMAL 1A4KA 4L9LB 4Y1AE 1KCSH 7CGTA 1YEIH 5DMJB 1OCWH 3GJFH 4NYLA 1IAOB 3LEVH 3QHFL 4G9DA 4HXAH 2GIYA 4O02L 2J6EL 2VQUA 4Y19E 4OQTH 3OAZH 2NXYC 5BV7L 3LKPA 2EH8L 4OGXH 1U8LA 1WFNA 3QUMB 4F8TA 2O5XL 1FC2D 4PJHB 5I19H 5C0BA 1U3HA 3FQNB 5DJAA 4AIZB 4MNGB 4FXGA 4D0DA 4LSPH 4F7EA 1MRCL 3K8LA 4NQCE 2ZNXA 3PQYE 4JFPA 4D9LH 1N5YH 3TN0B 4H0HB 5FYLL 3B5GA 2XI9A 2HYMA 4HW6A 4WFFE 4YXLL 3RZCD 2OZ4L 4U0RB 3VI4E 1MRFL 2BVYA 1ETZA 4Y16B 3UDWC 4JCLA 4XI5D 4JFFB 3KLSA 1U3HD 1TENA 1DQJA 2VDLL 1JHTA 5JW4N 4EN3A 5I30L 1IGFL 3FB5A 5ETUB 3TO4B 3X13B 4X6EA 1F97A 2QQLL 4PRDA 3NH7L 3PV7A 1J18A 2LU7A 3IDJA 2XTJB 3BXNB 4OZIA 4KI1A 5BZDA 2R9HC 2Q8AL 4TVPD 3TJHC 4HULB 5IVZA 2EYSA 2DQIH 1RUQL 5DJCB 3X14B 5GRUL 4J3WA 3Q5YA 4M43H 5L0QB 5KW9H 5DJDA 2FDBP 3VFSA 3L3GA 5D7LE 3KXFB 2R2HA 3CK0H 4NQSB 1HQRA 4MAUL 4P99A 2G5RA 3RGVD 4XC1L 3SGKA 3G6DL 5HHME 1MQ8A 1Y18B 1UGNA 4XPGH 5ESQA 5F7EH 4H1LH 4FABH 1P9MA 4ZFOL 1DBBH 3QI9A 4P4KC 3UAJD 1EEZB 4LBEB 1FZOA 2V2WB 1Q0YL 3C2SA 2CJUL 3T4AA 4OJFH 1FE8L 2YRLA 1XIWA 1XR9A 1F3DH 4ODSH 4NQXB 2FHBA 3WNMA 3RTQB 1XGUA 4D94A 5FKPA 3QUZC 4G43A 43C9B 5BXFB 5ISZB 1FN4A 1D5IL 5I1KL 3AS1A 5TGBA 5JO5A 5CZVL 5F88B 4L4TE 2MSPA 3F12B 3NIGE 4N1HB 5D8JH 1CFBA 5FDWB 3WUWA 5F7DA 3CVHA 2VWEE 3HZKA 4MHHI 1CXIA 2FH8A 4Y4KA 4BYHA 4KJPC 2YPVL 1M7DA 4KK5D 1BVZA 3SJVE 5JHDD 2L7JA 3UTSB 1YJDC 1W0WA 1TCRA 2HJLB 3ARBD 3NZ8A 1JE6A 4XP6H 3T04D 3VFWA 4OLXL 2EIDA 5IMLB 1BIHA 4OFKA 5CGYD 4XCYB 1BF8A 4QRPB 4N0FB 3F6IA 2UWEA 4MS8C 1W72L 4RGND 1A2YB 1C7TA 5ALCL 3OF6A 3TM6A 3QIUB 1F11B 4YGVB 7FABH 3VDCA 3E8UL 3MNWA 1BQUA 2AV7A 3RVTC 4Y89A 5DRXB 1UM6L 3C6SA 4KHXL 2E6JA 4F37F 3IXTA 4Y1AA 1S5IH 4Y4KD 3VXRB 4PJAB 1WVZA 4NCDA 2SEBA 4TVPH 1R5IB 4QRUA 1BWMA 4KTEH 1RZ8B 5D7IB 3O2WL 5EIIB 2XZQL 4CMHB 4BZYA 1FNEA 5FYKH 3K2MC 1OP5K 4RX4A 5TFSL 1CI5A 3ZMRA 3TWCH 1UA6H 1X5IA 4MSWB 3QFDB 3I6KB 4R96B 1RMFL 5GHWH 1P4BH 2DQTL 4DKEH 1KN4H 2B2XH 1FZJA 4G5ZL 4BK4A 2OJZH 4JG1L 1O5DT 1DQMH 3BZ4A 4PY7A 3OXSA 5I8EA 1KLUA 4JO2L 4HXBL 3PP3H 1A4JA 4GKZB 3TBVB 3WSQH 3JZ7A 4NQCA 4R2GC 1E4WH 4EI5B 3NA9L 4X4XB 1CLYL 3TJEL 1HSAB 1OGAB 1I1YB 2H2PD 4G42B 5F93C 2P5EE 3CFJB 5DZLA 4ZS6D 1Q38A 2AXHA 1JWMB 1U92A 1MEXH 1EHAA 4J23A 4U1LA 5I66A 2WAHA 3VG0L 2VDNL 4NNPH 3NN8A 3IS1X 1K2DB 4H8WL 3MRHA 4OGYH 4I0PB 5FUOH 3QR2A 2CPCA 3BH8B 4Y5XB 3DSNA 3I3DA 2O61A 4R90H 3LKQB 5C1MB 5TQ2H 3WDJA 4BQCA 4Z7VE 3KJ6L 3R8BB 3THMH 3PWNA 1BQHB 1ES0B 3LDBC 3RWJB 1NFDE 1UXSA 2R4RH 3MLSL 4HBCL 4LRNL 5F96L 3U4AA 2VDPH 4NFBA 3QQ3B 3GM0A 1Q0XH 4P23B 1AR2A 3TT3L 1WFTA 1YDPB 3PWUA 3V8OA 4L8SC 1QEWB 4EDXA 1CZ8L 4LGPB 3M17A 5HPMA 4PRHB 1JZ7A 4LCYA 3CVHH 3CPLB 5D7LA 3E3QE 2NYYD 5CD5D 2GK0A 2DMBA 2AI0L 1MH5B 3KS0H 3SE9H 4QTHB 1YNLH 1CGTA 4G8IB 5IW6A 3HG1B 3GSVB 2KQMA 4I18C 3RDTB 1YEJL 1ZT7A 1PZ5B 1A6WH 3Q6FA 4K3EH 3MZTA 4WFEE 3C60A 3INUL 3UBXB 3HTLX 3R0NA 3IFOB 1YN6B 1KEGL 1RPQA 1K4CA 1JBJA 4NKMB 1M7IA 3T2NH 5TE4L 5AG9A 4PRPE 3ULUL 2R8SH 1U95A 2FO4A 3BFOA 4FG6C 3ARFC 2UZIH 5C70A 2NY3C 5EOQH 3RZCC 4Z0XB 5E5MA 2IFFH 4J4PA 4L4TA 2N56A 4I3GA 4L8CA 5AD0B 4XI5C 1JGLH 3MLTB 3S97C 5IB5B 4ETQB 4MJIA 1CS6A 5HGBB 5DYOA 1AJ7H 3B9KA 5IEHB 4XVSL 3BP6A 3LQAC 1LK2B 3AU1A 4CRPA 4Z5RB 5HDBE 4U1GC 3C60D 5GRJH 3VWKB 5E00A 2IH3B 2QKIA 8CGTA 2Q3ZA 2Y25A 5IB4B 4TRPH 4N0RA 4MD0B 4OZGE 2P8PA 3UX9B 3JWOH 1X3DA 4NN5B 1MWAL 4KMQA 5L8JB 1CTOA 5B39A 4J4PD 4YDIL 2IALB 3WE6A 2DTMH 2LTQB 4QRRD 5DEFB 3RWGB 5DMKA 4DAGL 4MJID 4YDKL 5JW4M 3F62A 4RMUA 3ZO0A 1X4YA 5IQ7L 2KZ1B 4LCIL 3NZHL 5EORH 4MJ5A 3WLBA 3CFKB 4ZXBD 4X8JB 4BH8B 1H0DB 3H9HB 4PY8J 3MNVB 3MRJA 4HIEA 2CXGA 4LARL 1MCHA 3SDAD 3QUYA 4XB7A 3ILQD 2CIKA 3K2UL 5EUOE 1CD9B 2C1PA 3R0MA 2DWDB 4KKBD 43CAA 4PLOB 4XZUB 5KJRH 1EEQA 4G6MH 1RHFA 3EYUH 4HT1L 3DRTA 5EOTA 5HVHC 1UFUA 4HWZA 5ID0A 1GC1H 2GSIB 1ZKAA 5E1AA 5DQ9B 2BFVL 2R0KL 4LMQI 2JCCE 5E08L 2X40A 1BZ9A 3OAYK 5DHVB 5EO0B 5DFWH 4HG4K 3KYKH 5T5NG 3ECBB 4LVNC 2VIRA 1IGIL 1TZGL 3O9WD 4KK5C 2O26U 2ZUXA 2F8VA 3QNYB 3GSNA 1S5HA 3TBYA 4Z7UE 1KN2L 1U58B 5C08D 5CGYC 3GMMB 1W0VB 3LS4L 5DMIL 4RGNC 3UJJL 1VB9A 2Y07H 1NUGA 1EBPA 1MI5B 4JM4H 3OKNB 2RB8A 4FZEL 4HIHB 4NQDD 1KELH 5T3ZH 4ISVB 4R4ND 4DGVL 3OG6B 1JPTH 4C59B 4WWKB 2Y1VA 3GHBL 5IFAH 1H5BB 4J2XA 3RUGF 4MA3B 1QFPA 4DQOL 1T5XB 3GHEL 5FF6B 2W0PA 1G7HB 5D2LA 4D0CB 5GZOD 3JVGA 4XP4H 4Y4HA 1YEDA 3D18B 3FAWA 4YJZL 3BO8B 5EC1A 4HC1A 1B2WL 4KK8C 3WNNA 2BC4B 1MFBL 2NXZD 3ZKQD 4RMVA 3LCYA 4S1SH 5CS7A 2BVPB 4HDIB 3VG9C 2X4TB 5EBMB 3QWOA 5AAMA 3U7YH 1NFIB 2QR0A 2XICA 3KYNA 2DBLL 4FQ2H 2O5ZH 3LOWA 4UIMB 4HF5L 3BKMH 2HG5A 2EZ0D 2OTUA 1MCWM 3FO2A 4JZJB 5SV4A 5FUCE 3V5HB 4JB9H 2D7NA 3ZHLA 2KZWA 1U93B 4KHTL 3H9SB 1RIUL 4CVUA 1GGBL 3OB8A 2ZPKL 4GMTL 4ODVL 3CLFL 4PGDA 3BEVB 1NCDH 5HVFB 2VERN 1F58H 4QCIB 1OSPH 3GMNB 2BOBA 3NCYP 3BEWA 3QDJB 2LU3A 2BNQB 1CU4L 2RR3A 5F9JB 1JFQL 1LO0L 1JZ5A 3DV4B 3T65A 5FOBB 1E27A 3BSZL 4RGOL 3KPPB 4WW1A 4KK9D 2CRZA 4OZGA 3L6FA 4MWFA 1RHHB 3W0WD 4MNQA 3QQ4B 5F1NB 3HNVH 4X5WB 1EUUA 3B3IA 2A6DB 5JR1L 3FN0H 3OPZL 1NDGB 2DLEA 3M1BA 1Z5LB 4PGEB 4PRIA 5EB9A 3PP4L 5FM5M 4QHUB 5I74C 2X70B 2NYYC 4HH8A 3WJJA 5CD5C 4YBHA 4OIIH 1ACYH 3PHQB 1IKFH 3NOIA 1I1FB 5A16B 2FB4L 3RIAK 3CX5K 4AM0B 3SDXE 3BQUB 5L2KD 3GSNH 3GSQB 4CDGC 4LFHD 2GT9B 5CBAA 1WZMA 1PQZB 4DUXA 4Z6AT 3C5SB 1WF5A 1JNJA 4BFIB 5F7MC 4IDJL 2P46B 5EZIH 3IKKA 2FH6A 3ARQA 1U8JA 1MJ7H 2HT3C 3MUJA 3RNKA